HIPid | HIP824 |
Sequence | LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |
Length | 36 |
Nomenclature | Apelin-36 |
Source | Apelin |
Cell line | NP-2/CD4 |
Inhibition/IC50 | 0.3 |
Unit | μg/ml |
Target | Virus entry |
Assay | Immunofluorescence |
Properties | View |
Structure | Jmol |
Paper | Apelin peptides block the entry of human immunodeficiency virus (HIV). |
Authors | Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. |
Reference | FEBS Lett. 2000 May 4;473(1):15-8. |
Pubmed ID | 10802050 |