| HIPid | HIP824 |
| Sequence | LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Length | 36 |
| Nomenclature | Apelin-36 |
| Source | Apelin |
| Cell line | NP-2/CD4 |
| Inhibition/IC50 | 0.3 |
| Unit | μg/ml |
| Target | Virus entry |
| Assay | Immunofluorescence |
| Properties | View |
| Structure | Jmol |
| Paper | Apelin peptides block the entry of human immunodeficiency virus (HIV). |
| Authors | Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. |
| Reference | FEBS Lett. 2000 May 4;473(1):15-8. |
| Pubmed ID | 10802050 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India