HIPid | HIP829 |
Sequence | NMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQEL |
Length | 36 |
Nomenclature | T652 |
Source | gp41 |
Cell line | CEM |
Inhibition/IC50 | 4 |
Unit | ng/ml |
Target | Fusion inhibitor |
Assay | RT production |
Properties | View |
Structure | Jmol |
Paper | Methods and compositions for treatment of HIV-1 infection using antiviral compounds in simultaneous or sequential combinations |
Authors | M. Ross Johnson, Dennis Michael Lambert |
Reference | Trimeris, Inc. |
Pubmed ID | US6861059 |