| HIPid | HIP851 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL |
| Length | 36 |
| Nomenclature | C36 |
| Source | Synthetic |
| Cell line | NA |
| Inhibition/IC50 | Medium |
| Unit | NA |
| Target | Fusion inhibitor |
| Assay | CD spectra |
| Properties | View |
| Structure | Jmol |
| Paper | Highly potent synergistic combinations of human immunodeficiency virus (HIV) fusion inhibitors |
| Authors | Shibo Jiang, Chungen Pan |
| Reference | New York Blood Center |
| Pubmed ID | US7919101 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India