HIPid | HIP857 |
Sequence | YTSLIHSLIEEGQNQQEKNEQELLELDKWASLWNWF |
Length | 36 |
Nomenclature | T-20S138G |
Source | Enfuvirtide |
Cell line | HeLa |
Inhibition/IC50 | 1.3±0.5(0.5) |
Unit | nM(fold) |
Target | Fusion inhibitor |
Assay | MAGI assay |
Properties | View |
Structure | Jmol |
Paper | Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20. |
Authors | Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M. |
Reference | J Biol Chem. 2009 Feb 20;284(8):4914-20. Epub 2008 Dec 10. |
Pubmed ID | 19073606 |