HIPid | HIP879 |
Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
Length | 36 |
Nomenclature | ENF (T-20) |
Source | Synthetic |
Cell line | CEM4 |
Inhibition/IC50 | 0.05 |
Unit | μg/ml |
Target | Fusion inhibitor |
Assay | MAGI/cMAGI infectivity assay |
Properties | View |
Structure | Jmol |
Paper | Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus. |
Authors | Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK. |
Reference | Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. Epub 2007 Jul 19. |
Pubmed ID | 17640899 |