| HIPid | HIP880 |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASPWNWF |
| Length | 36 |
| Nomenclature | T705 |
| Source | gp41 |
| Cell line | CEM |
| Inhibition/IC50 | 14 |
| Unit | ng/ml |
| Target | Fusion inhibitor |
| Assay | RT production |
| Properties | View |
| Structure | Jmol |
| Paper | Methods and compositions for treatment of HIV-1 infection using antiviral compounds in simultaneous or sequential combinations |
| Authors | M. Ross Johnson, Dennis Michael Lambert |
| Reference | Trimeris, Inc. |
| Pubmed ID | US6861059 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India