HIPid | HIP896 |
Sequence | YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV |
Length | 36 |
Nomenclature | Peptide 4 |
Source | vif |
Cell line | Hut-78 |
Inhibition/IC50 | 75 |
Unit | % |
Target | Protease inhibition |
Assay | PR binding assay |
Properties | View |
Structure | Jmol |
Paper | Human immunodeficiency virus type 1 Vif-derived peptides inhibit the viral protease and arrest virus production. |
Authors | Baraz L, Friedler A, Blumenzweig I, Nussinuv O, Chen N, Steinitz M, Gilon C, Kotler M. |
Reference | FEBS Lett. 1998 Dec 28;441(3):419-26. |
Pubmed ID | 9891983 |