| HIPid | HIP896 |
| Sequence | YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV |
| Length | 36 |
| Nomenclature | Peptide 4 |
| Source | vif |
| Cell line | Hut-78 |
| Inhibition/IC50 | 75 |
| Unit | % |
| Target | Protease inhibition |
| Assay | PR binding assay |
| Properties | View |
| Structure | Jmol |
| Paper | Human immunodeficiency virus type 1 Vif-derived peptides inhibit the viral protease and arrest virus production. |
| Authors | Baraz L, Friedler A, Blumenzweig I, Nussinuv O, Chen N, Steinitz M, Gilon C, Kotler M. |
| Reference | FEBS Lett. 1998 Dec 28;441(3):419-26. |
| Pubmed ID | 9891983 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India