| HIPid | HIP897 |
| Sequence | YVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLV |
| Length | 36 |
| Nomenclature | vif 30-65 |
| Source | vif |
| Cell line | NA |
| Inhibition/IC50 | 75.1 |
| Unit | % |
| Target | Protease inhibition |
| Assay | HPLC |
| Properties | View |
| Structure | Jmol |
| Paper | Peptides derived from HIV-1 Vif: a non-substrate based novel type of HIV-1 protease inhibitors. |
| Authors | Friedler A, Blumenzweig I, Baraz L, Steinitz M, Kotler M, Gilon C. |
| Reference | J Mol Biol. 1999 Mar 19;287(1):93-101. |
| Pubmed ID | 10074409 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India