| HIPid | HIP899 |
| Sequence | LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Length | 37 |
| Nomenclature | LL-37 |
| Source | Cathelicidin |
| Cell line | CEM-SS |
| Inhibition/IC50 | 1.6 |
| Unit | μM |
| Target | Multifunction |
| Assay | Cytopathic effect |
| Properties | View |
| Structure | Jmol |
| Paper | Anti-human immunodeficiency virus type 1 activities of antimicrobial peptides derived from human and bovine cathelicidins. |
| Authors | Wang G, Watson KM, Buckheit RW Jr. |
| Reference | Antimicrob Agents Chemother. 2008 Sep;52(9):3438-40. Epub 2008 Jun 30. |
| Pubmed ID | 18591279 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India