HIPid | HIP899 |
Sequence | LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Length | 37 |
Nomenclature | LL-37 |
Source | Cathelicidin |
Cell line | CEM-SS |
Inhibition/IC50 | 1.6 |
Unit | μM |
Target | Multifunction |
Assay | Cytopathic effect |
Properties | View |
Structure | Jmol |
Paper | Anti-human immunodeficiency virus type 1 activities of antimicrobial peptides derived from human and bovine cathelicidins. |
Authors | Wang G, Watson KM, Buckheit RW Jr. |
Reference | Antimicrob Agents Chemother. 2008 Sep;52(9):3438-40. Epub 2008 Jun 30. |
Pubmed ID | 18591279 |