| HIPid | HIP906 |
| Sequence | MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL |
| Length | 38 |
| Nomenclature | 2410 |
| Source | Synthetic |
| Cell line | CEM4 |
| Inhibition/IC50 | 0.032 |
| Unit | μg/ml |
| Target | Fusion inhibitor |
| Assay | MAGI/cMAGI infectivity assay |
| Properties | View |
| Structure | Jmol |
| Paper | Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus. |
| Authors | Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK. |
| Reference | Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. Epub 2007 Jul 19. |
| Pubmed ID | 17640899 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India