Database of HIV inhibiting peptides
| HIPid | HIP930 |
| Sequence | GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC |
| Length | 45 |
| Nomenclature | Palustrin-3AR |
| Source | Rana areolata |
| Cell line | T cells |
| Inhibition/IC50 | 30 |
| Unit | % |
| Target | Fusion inhibitor |
| Assay | GFP expression |
| Properties | View |
| Structure | Jmol |
| Paper | Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells. |
| Authors | VanCompernolle SE, Taylor RJ, Oswald-Richter K, Jiang J, Youree BE, Bowie JH, Tyler MJ, Conlon JM, Wade D, Aiken C, Dermody TS, KewalRamani VN, Rollins-Smith LA, Unutmaz D. |
| Reference | J Virol. 2005 Sep;79(18):11598-606. |
| Pubmed ID | 16140737 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India