HIPid | HIP932 |
Sequence | GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC |
Length | 46 |
Nomenclature | Esculentin-1ARb |
Source | Rana areolata |
Cell line | T cells |
Inhibition/IC50 | 35 |
Unit | % |
Target | Fusion inhibitor |
Assay | GFP expression |
Properties | View |
Structure | Jmol |
Paper | Antimicrobial peptides from amphibian skin potently inhibit human immunodeficiency virus infection and transfer of virus from dendritic cells to T cells. |
Authors | VanCompernolle SE, Taylor RJ, Oswald-Richter K, Jiang J, Youree BE, Bowie JH, Tyler MJ, Conlon JM, Wade D, Aiken C, Dermody TS, KewalRamani VN, Rollins-Smith LA, Unutmaz D. |
Reference | J Virol. 2005 Sep;79(18):11598-606. |
Pubmed ID | 16140737 |