Database of HIV inhibiting peptides
| HIPid | HIP953 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFRS |
| Length | 48 |
| Nomenclature | C46 |
| Source | gp41 |
| Cell line | PM-1 |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Virus entry |
| Assay | Fusion kinetics |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of human immunodeficiency virus type 1 entry in cells expressing gp41-derived peptides. |
| Authors | Egelhofer M, Brandenburg G, Martinius H, Schult-Dietrich P, Melikyan G, Kunert R, Baum C, Choi I, Alexandrov A, von Laer D. |
| Reference | J Virol. 2004 Jan;78(2):568-75. |
| Pubmed ID | 14694088 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India