Database of HIV inhibiting peptides
| HIPid | HIP958 |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Length | 36 |
| Nomenclature | T20 |
| Source | gp41 |
| Cell line | PM-1 |
| Inhibition/IC50 | 95 |
| Unit | % |
| Target | Virus entry |
| Assay | Flow cytometry |
| Properties | View |
| Structure | Jmol |
| Paper | Membrane-anchored peptide inhibits human immunodeficiency virus entry. |
| Authors | Hildinger M, Dittmar MT, Schult-Dietrich P, Fehse B, Schnierle BS, Thaler S, Stiegler G, Welker R, von Laer D. |
| Reference | J Virol. 2001 Mar;75(6):3038-42. |
| Pubmed ID | 11222732 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India