Database of HIV inhibiting peptides
| HIPid | HIP961 |
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
| Length | 37 |
| Nomenclature | Cecropin |
| Source | Cecropin |
| Cell line | Hut-78 |
| Inhibition/IC50 | 2 to 3 |
| Unit | μM |
| Target | Gene expression |
| Assay | RT-PCR |
| Properties | View |
| Structure | Jmol |
| Paper | Antimicrobial peptides melittin and cecropin inhibit replication of human immunodeficiency virus 1 by suppressing viral gene expression. |
| Authors | Wachinger M, Kleinschmidt A, Winder D, von Pechmann N, Ludvigsen A, Neumann M, Holle R, Salmons B, Erfle V, Brack-Werner R. |
| Reference | J Gen Virol. 1998 Apr;79 ( Pt 4):731-40. |
| Pubmed ID | 9568968 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India