HIPid | HIP961 |
Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
Length | 37 |
Nomenclature | Cecropin |
Source | Cecropin |
Cell line | Hut-78 |
Inhibition/IC50 | 2 to 3 |
Unit | μM |
Target | Gene expression |
Assay | RT-PCR |
Properties | View |
Structure | Jmol |
Paper | Antimicrobial peptides melittin and cecropin inhibit replication of human immunodeficiency virus 1 by suppressing viral gene expression. |
Authors | Wachinger M, Kleinschmidt A, Winder D, von Pechmann N, Ludvigsen A, Neumann M, Holle R, Salmons B, Erfle V, Brack-Werner R. |
Reference | J Gen Virol. 1998 Apr;79 ( Pt 4):731-40. |
Pubmed ID | 9568968 |