HIPid | HIP962 |
Sequence | EINCTRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAHCNIS |
Length | 42 |
Nomenclature | V3-BH10 |
Source | gp120 |
Cell line | JY |
Inhibition/IC50 | High |
Unit | NA |
Target | Virus entry |
Assay | MTT assay |
Properties | View |
Structure | Jmol |
Paper | T-tropic human immunodeficiency virus type 1 (HIV-1)-derived V3 loop peptides directly bind to CXCR-4 and inhibit T-tropic HIV-1 infection. |
Authors | Sakaida H, Hori T, Yonezawa A, Sato A, Isaka Y, Yoshie O, Hattori T, Uchiyama T. |
Reference | J Virol. 1998 Dec;72(12):9763-70. |
Pubmed ID | 9811711 |