| HIPid | HIP965 |
| Sequence | EINCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNIS |
| Length | 41 |
| Nomenclature | V3-ADA |
| Source | gp120 |
| Cell line | JY |
| Inhibition/IC50 | Low |
| Unit | NA |
| Target | Virus entry |
| Assay | MTT assay |
| Properties | View |
| Structure | Jmol |
| Paper | T-tropic human immunodeficiency virus type 1 (HIV-1)-derived V3 loop peptides directly bind to CXCR-4 and inhibit T-tropic HIV-1 infection. |
| Authors | Sakaida H, Hori T, Yonezawa A, Sato A, Isaka Y, Yoshie O, Hattori T, Uchiyama T. |
| Reference | J Virol. 1998 Dec;72(12):9763-70. |
| Pubmed ID | 9811711 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India