| |
| HIPid | HIP970 |
| Sequence | SQGVVESMNKELPKIIGQVRDQAEHLKTAY |
| Length | 30 |
| Nomenclature | P159 |
| Source | Integrase |
| Cell line | NA |
| Inhibition/IC50 | Low |
| Unit |
NA |
| Target | Integrase |
| Assay | Integrase assay |
| Properties | View |
| Structure | Jmol |
| Paper | Helical and coiled-coil-forming properties of peptides derived from and inhibiting human immunodeficiency virus type 1 integrase assessed by 1H-NMR--use of NH temperature coefficients to probe coiled-coil structures. |
| Authors | Krebs D, Maroun RG, Sourgen F, Troalen F, Davoust D, Fermandjian S. |
| Reference | Eur J Biochem. 1998 Apr 1;253(1):236-44. |
| Pubmed ID | 9578482 |