| |
HIPid | HIP970 |
Sequence | SQGVVESMNKELPKIIGQVRDQAEHLKTAY |
Length | 30 |
Nomenclature | P159 |
Source | Integrase |
Cell line | NA |
Inhibition/IC50 | Low |
Unit |
NA |
Target | Integrase |
Assay | Integrase assay |
Properties | View |
Structure | Jmol |
Paper | Helical and coiled-coil-forming properties of peptides derived from and inhibiting human immunodeficiency virus type 1 integrase assessed by 1H-NMR--use of NH temperature coefficients to probe coiled-coil structures. |
Authors | Krebs D, Maroun RG, Sourgen F, Troalen F, Davoust D, Fermandjian S. |
Reference | Eur J Biochem. 1998 Apr 1;253(1):236-44. |
Pubmed ID | 9578482 |