Database of HIV inhibiting peptides
| HIPid | HIP983 |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Length | 36 |
| Nomenclature | T-20 |
| Source | gp41 |
| Cell line | Lymphocytes |
| Inhibition/IC50 | 7.57 |
| Unit | μM |
| Target | Fusion inhibitor |
| Assay | RT-PCR |
| Properties | View |
| Structure | Jmol |
| Paper | Ex vivo comparison of microbicide efficacies for preventing HIV-1 genomic integration in intraepithelial vaginal cells. |
| Authors | McElrath MJ, Ballweber L, Terker A, Kreger A, Sakchalathorn P, Robinson B, Fialkow M, Lentz G, Hladik F. |
| Reference | Antimicrob Agents Chemother. 2010 Feb;54(2):763-72 |
| Pubmed ID | 19949052 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India