Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID1474 | EGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERL | Complement C3 | Serum | 5005.43501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3821 | GNDGATGAAGPPGPTGpAGPPGFPGAVGAKGEAGpQGpRGSEGpQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3824 | AGNDGTpGRDGAVGERGDRGDpGPAGLPGSqGAPGTPGPVGApGDA | Collagen alpha-2(V) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3827 | GApGQpGMAGVDGpPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGp | Collagen alpha-1(XI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID7973 | VPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGP | Elastin isoform c precursor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8521 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTKRG | Fibrinogen alpha | Serum | 4996.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8522 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 5333.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID11030 | ARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQG | Collagen alpha-1(I) chain | Urine | 4253.0061 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11031 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4306.9377 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11032 | LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 4323.0038 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |