ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
1535 | RLSGMNEVLSFRWL | SG3 | 14 | L | Linear | Synthetic | Unknown | Conjugation with EGFP | Free | NA | Protein (GFP) | 21291271 |
1536 | GPFHFYQFLFPPV | 435B peptide | 13 | L | Linear | Synthetic | Unknown | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 17268054 |
1537 | GSPWGLQHHPPRT | 439A peptide | 13 | L | Linear | Synthetic | Unknown | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 17268054 |
1538 | AAVALLPAVLLALLAP | MTS | 16 | L | Linear | Protein derived | Hydrophobic | NA | NA | NA | NA | 7782278 |
1539 | AAVALLPAVLLALLAPEILLPNNYNAYESYKYPGMFIALSK | SKP | 41 | L | Linear | Chimeric | Unknown | Tyrosine radiolabeling with Iodine 125 | Free | NA | NA | 7782278 |
1540 | AAVALLPAVLLALLAPVQRKRQKLMP | SN50 | 26 | L | Linear | Chimeric | Unknown | NA | NA | NA | NA | 7782278 |
1541 | WEAKLAKALAKALAKHLAKALAKALKACEA | KALA | 30 | L | Linear | Synthetic | Cationic amphipathic | NA | NA | NA | Nucleic acid | 9062132 |
1542 | MGLGLHLLVLAAALQGAWSQPKKKRKV | Peptide 1 | 27 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 9287160 |
1543 | MGLGLHLLVLAAALQGAKKKRKV | Peptide 2 | 23 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 9287160 |
1544 | WEAALAEALAEALAEHLAEALAEALEALAA | GALA | 30 | L | Linear | Synthetic | Amphipathic | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 19388672 |
1545 | GLFEALLELLESLWELLLEA | JST-1 | 20 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid | 9156807 |
1546 | GLFKALLKLLKSLWKLLLKA | ppTG1 | 20 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid | 11829517 |
1547 | GLFRALLRLLRSLWRLLLRA | ppTG20 | 20 | L | Linear | Synthetic | Unknown | NA | NA | NA | Nucleic acid | 11829517 |
1548 | CGAYDLRRRERQSRLRRRERQSR | DPV15b | 23 | L | Linear | Protein derived | Unknown | NA | NA | NA | Nucleic acid (siRNA) | 0 |
1549 | RKKRRRESRKKRRRESC | DPV3 | 17 | L | Linear | Protein derived | Unknown | NA | NA | NA | Nucleic acid (siRNA) | 0 |
1550 | CVKRGLKLRHVRPRVTRDV | DPV1048 | 19 | L | Linear | Protein derived | Unknown | NA | NA | NA | Nucleic acid (siRNA) | 0 |
1551 | CRQIKIWFQNRRMKWKK | P16 | 17 | L | Linear | Protein derived | Unknown | NA | NA | NA | Nucleic acid (siRNA) | 0 |
1552 | YARAAARQARA | YARA | 11 | L | Linear | Synthetic | Unknown | FITC linked to a beta-Alanine residue | NA | NA | Fluorophore (iodine) | 15906170 |
1553 | PPKKSAQCLRYKKPE | Secretory leukoprotease inhibitor derived PTD | 15 | L | Linear | Protein derived | Unknown | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 0 |
1554 | DPVDTPNPTRRKPGK | Secretory leukoprotease inhibitor derived PTD | 15 | L | Linear | Protein derived | Unknown | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 0 |
1555 | KRVSRNKSEKKRR | hClock-(35-47) | 13 | L | Linear | Protein derived | Cationic | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 15346201 |
1556 | GRRHHCRSKAKRSRHH | hPER1- PTD (830-846) NLS | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1557 | SARHHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1558 | SRAHHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1559 | SRRAHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1560 | SRRHACRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1561 | SRRHHARSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1562 | SRRHHCRAKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1563 | SRRHHCRSAAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1564 | SRRHHCRSKAARSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1565 | SRRHHCRSKAKASRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1566 | SRRHHCRSKAKRARHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1567 | SRRHHCRSKAKRSAHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1568 | RRHHCRSKAKRSR | hPER1-PTD | 13 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1569 | GRKGKHKRKKLP | hPER3 NLS | 12 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
1570 | GKKKKKKKKK | Lys9 | 10 | L | Linear | Synthetic | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1571 | GKRVAKRKLIEQNRERRR | Thyroid A-1 | 18 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1572 | GRKLKKKKNEKEDKRPRT | HME-1 | 18 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1573 | GKKTNLFSALIKKKKTA | ABL-1 | 17 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1574 | GRRERNKMAAAKCRNRRR | Nucleoplasmin X | 18 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1575 | GKRARNTEAARRSRARKL | GCN-4 | 18 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1576 | GRRRRATAKYRTAH | HEN1/NSLC1 | 14 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1577 | GKRRRRATAKYRSAH | HEN2/NSLC2 | 15 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1578 | GRRRRKRLSHRT | HNF3 | 12 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1579 | GRRRRRERNK | cAMP dependent TF | 10 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1580 | GKHRHERGHHRDRRER | Cyclin L ania-6a | 16 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1581 | GKKKRKLSNRESAKRSR | beta Zip TF | 17 | L | Linear | Protein derived | Cationic | Biotinylation | Free | NA | Biotin | 0 |
1582 | MIIYRDLISH | TCTP (1-10) deletion mutant | 10 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Amidation | NA | Fluorophore (Rhodamine) | 21440624 |
1583 | MIIYRDLIS | TCTP (1-9) deletion mutant | 9 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Amidation | NA | Fluorophore (Rhodamine) | 21440624 |
1584 | MIIYRDLI | TCTP (1-8) deletion mutant | 8 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Amidation | NA | Fluorophore (Rhodamine) | 21440624 |