Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_chubuense_NBB4
Gene IDProtein IDProtein DetailsSequence
392419086YP_006455691.1 LSU ribosomal protein L34P [Mycobacterium chubuense NBB4]MAKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVSDRRRKGRRSLTA
392419084YP_006455689.1 preprotein translocase subunit YidC [Mycobacterium chubuense NBB4]MFNFFSLDIIYYPVSAIMWLWYKAFAFLLGPSNFFAWALSVMFLVFTLRA
ILYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQKEHGF
NPVLGCLPMLAQIPVFLGLYHVLMSFNRTQTGIGRLGLSVEENRSLGNYV
FSATDVGHFLDANLFGAPLGASMIQHVGLDAFTEFHRPAVIAVGVPLMIV
AGIATHFNSRASVARQSVEAAANPQTAMMNKLALYVFPLGVVVGGPFLPL
AIILYWVSNNIWTYGQQHYVFGKIEKEEEAKKQEALERRASNAPAPGAKP
AARKKKTGSESDVAGTAKGIAEETEGVVEAPGTEGSDGSGSAGSAGSAAG
NGAVSRTPKPGARPKKRKR
392419082YP_006455687.1 16S rRNA m(7)G-527 methyltransferase [Mycobacterium chubuense NBB4]MKRAEVLPAPAAVGAIFGAATDRVQRYAEILAGAGVERGLLGPREVERLW
ERHVLNSAVVAELLEPGERIADIGSGAGLPGIPLALARSDIHVTLVEPLL
RRSDFLRETIAELEIECAVVRGRAEDRVVREQVGEMDAVVSRAVASLDKL
TRWSVPLLRPGGRMLAVKGERAAEEVEEHRQAMAALGMTDVKVATCGGQY
VDPPTTVVVGFLRTPPKQRAPGRRQK
392419080YP_006455685.1 ParB-like partition protein [Mycobacterium chubuense NBB4]MNNPARKRSGLGRGLASLIPTGPAENGEPATTGPRMGAAAADVVLGGPVA
PPTPPAPPEENSVGAVYREIAPAQIDPNPRQPRQVFDEEALAELVHSIRE
FGLMQPIVVRATPGGDGDGDGAPRYQLVMGERRWRAAQEAGVATIPAIVR
ETADDSMLRDALLENIHRVQLNPLEEAAAYQQLLEEFEVTHDELASRIGR
SRPVITNMIRLLRLPIAVQRRVAAGVLSAGHARALLALEGGPEVQEELAA
RIVAEGLSVRATEEAVTLANREGGGTPPAPRRKPIQMPGLQDVAEQLSTA
FDTRVTVSLGKRKGKIVVEFGSVDDLQRIVELMNASTR
392419078YP_006455683.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium chubuense NBB4]MSILRRGDRGGAVTEIRAALSALGMIDDLDEDLTTGKHIAADVFDEHLDH
AVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLNHQFGAPMYGDDV
ATLQARLQDLGFYTGLVDGHFGLQTHNALMSYQREYGLYPDGICGPETLR
SLYFLGARVTGGSPHAIREEELVRSSGPRLSGKRIIIDPGRGGDDHGLIM
NGPAGPISEADILWDLASRLEGRMTAIGMDTFLSRPANGAPSDAERAATA
NTVGADLMISLRCETQSSPSASGVASFHFGNSHGSVSTIGRNLADFIQRE
VVARTGLRDCRVHGRTWDLLRLTRMPTVQVDIGYITNPGDRATLVSAAAR
DSIAEGMLAAVKRLYLLGKNDRPTGTFTFAELLAHELAVEQTRRTS
392419076YP_006455681.1 thioredoxin-disulfide reductase [Mycobacterium chubuense NBB4]MTSSPTVHDLIIIGSGPAGYTAAVYAARAQLQPLVFEGTQFGGALMTTTE
VENYPGFRDGITGPELMDQMREQALRFGADLHMEDVDAVDLAGPIKTVTV
GDETYQSRAVILAMGAAARHLGVPGEDTLLGMGVSTCATCDGFFFRDQDI
AVVGGGDSAMEEATFLTRFARSVTLIHRREEFRASKIMLERAQNNEKITI
RTNTAVTAIEGEPKVTGIRLRDTVTGEESTLAVTGVFVAIGHDPRSELVR
GQVDLDDEGYVQVEGRTSYTSVEGVFAAGDLVDHTYRQAITAAGSGCAAS
IDAERWLADRAEPGERTSTTTDDSDLIGAQQ
392419074YP_006455679.1 RNA polymerase sigma factor- sigma-70 family [Mycobacterium chubuenMGFFGGSREGAGVLRTDAELLVAHVDGDRYAFEELFYRHHRQLYRLALLT
SRDPDDAADALQDALLAAHRTARTFRHDSAVSSWLHRIVVNACVDRLRRN
KFHRCDELDDRRCRVADPTTHVDTSIAVERALLRLPVEQRAAVVAVDMQG
YSVAETARMLGIAEGTVKSRCARARGKLATALTEFAADAAPAD
392419072YP_006455677.1 hypothetical protein Mycch_5314 [Mycobacterium chubuense NBB4]MTRPRARLLAAVVALLLAIAPLAVSGVAGAQPSSLAFLHVQIDSITPNVV
TTTSEPLITVTGTIRNVGDRPVRDVVVRLERAAAVASSSTLRTDLAGNVD
QYQPVADFITIAPDMNRGQEVPFRLVYPLRSADHPSLNIDTPGVYPLMVN
VNGTPDYGAPARLDDSRLLLPVLGVPPPAEADANTEPLNSAVPPDTTRPV
ALTMFWPLADRPRLAAGVPGGTTPVRLVDDDLATSLAAGGRLDTLLSAID
FATSPQVDPGGEVTRAMCLAVDPDLLITINAMTAGYVVNDASDAGLRTTP
THPGTGQQAAIDWLNRLKGLAKRMCVAPTTFAQADLDALRRVADPGLSTI
ATRGAGDIVDQILGVTTTRGATLVGDGPLTADAVELLSGQGPTVAIGAAN
LRDPSGGVGETPSTAPVRFTPNVVAAPFDPTVGAALAGAGNSPGTPSYLN
PAFDIPVKHDSAVARRQDALGSLLWRSLDPQTSPRAEILMPPLMWNLAPD
DASAILGAVATTIRSGLAAPRPLRALIDEAGAVHGSAPMPQGSLGNPRGR
IDDGVVSGITATTSRLRGLNAALTTDERTGLTGTQYTAPLREDLLRALSL
SVPPDARNGLAQQRLTTVGATVEDLFHAVTIVKPSGSYTLATERSPLPLA
LRNDLPVPIRVRLFIDAPPGMTVTDMGEMVLPPGFLPLKVPIEVHFTQRV
AVDVALRTADGVPLGEPVRLSVHSNAYGKVLFFITLSGGVILALLVGRRL
WHRFRGQPDRADLDRPDPIEVALAYRDDDTDGPAPQRAPSTTGGTGE
392419070YP_006455675.1 tRNA adenylyltransferase [Mycobacterium chubuense NBB4]MPEASRDRIDSASDAELLAAAQVSLNQHGEVLRGLGRMFADSGHELYLVG
GSVRDALLGRLGSDLDFTTDARPEQMQEFLRGWADAVWDTGIAFGTLGVA
KGQDRLELTTFRADTYDQVSRHPEVRFGDNLADDLVRRDFTVNAMAVRIT
PEGPAEFLDPLGGLAALRAGALDTPAEPEVSFGDDPLRMLRAARFVSQLG
FTVAPRVRRALEEMAPQLGRISVERVAAELDKLLLGTDPVAGVDLMVASG
LGDVVLPEVGAMRMAIDEHHQHKDVYQHSLTVLRQAIDLEDGEPDLVLRW
AALLHDIGKPATRKHEPDGGVSFHHHEVVGAKMTRKRLRALKYSKQMVDD
VSQLVYLHLRFHGYGDGRWTDSAVRRYVTDAGPLLNRLHKLVRADCTTRN
KRRAARLQANYDDLEHRIAELAAKEDLARVRPDLDGNEIMRILGIPAGPQ
VGQAWNHLKELRLDRGPLEHDEAVEELVKWWNEKGEPRV
392419068YP_006455673.1 TIGR03084 family protein [Mycobacterium chubuense NBB4]MAGAAPIVADLRAESDELDALVADLPPETWATPTPAEGWTIAHQIAHLLW
TDRVALISVTDEAGFADVLARAARNPTGFVDAGAEELAADPPERLLADWR
TTRRALHDALLTVADGRKLPWFGPPMSAASMATARLMETWAHGLDVADAL
GAVRQPTARLRSIAHIGVRTRDFAYTVHGLNPPAEPFHVKLSAPQGSSEP
EWVWGPEDAAQQVTGSAEDFCMLVTQRRPRAELDVVAVGPDAEQWLTIAQ
AFAGPPGPGRG
392419066YP_006455671.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAQPDDPEDFRDAPVAPRVRSGTLLLANTDLLEPTFRRSVIYVVEHNDGG
TLGVVLNRPSETAVYNVLPQWAKLATKPKTMFIGGPVKRDAALCLGTLRV
GADARGVAGLRHVQGRMVMVDLDADPDSVAPVVEGVRIFAGYSGWTIGQL
EGEIERDDWIVLSALPSDVLVEPRVDLWARVLRRQPMPLSLLATHPIDVS
RN
392419064YP_006455669.1 putative lipoprotein LpqN [Mycobacterium chubuense NBB4]MSENARRWRVLAGGIGACAAGVAGVLGLAGTTASAQPMLPPPPAPAPATV
TQTVTVTPNAAPAPAVGQPPVTGATGGAAAVPAGVSAPVVTPPALPTIVP
ASSGTLTDYFAGKGVTLQPQSSRDFRALNIVLPMPRGWEHIPDPNVPDAF
AVIADRVGGNGLYSSNAQIVVYKLVGQFDPKEAISHGLIDAQQLPAWRST
DASLADFGGMPSSLIEGTYRENNMTLNTSRRHVIATVGPDHYLVSLAVTT
SIDQVVAAADATDAIVKGFKVSVPSAVPAAPPPPVPGVPPVPPAPGAPAP
PAPGVPAAAPPPQLLGLQG
392419062YP_006455667.1 cytochrome c oxidase- subunit I [Mycobacterium chubuense NBB4]MAVEAPHLLTLEPRRPFPARLGPRGNLIYKLVTTTDHKLIGIMYCVTCFA
FFFIGGLMALLMRTELASPGLQFLSNEQYNQLFTMHGTIMLLLYATPIVF
GFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGGLIAMAGFITPGGAADFG
WTAYAPLSDAVHSPGAGGDLWIMGLIVAGLGTILGAVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILILMAFPILTAALFALAADRHLGAHVFDAANG
GAILWQHLFWFFGHPEVYIVALPFFGIVTEIFPVFSRKPIFGYTTLIYAT
LAIGALSVVVWAHHMFATGAVLLPFFSFTTYLIAVPTGIKFFNWIGTMWK
GQITLETPMLFSIGFLATFLLGGLTGVMLASPPLDFHVTDSYFVVAHFHY
VLFGTIVFATYGGIYFWFPKMTGRLLDEKLGKLHFWLTFIGFHTTFLVQH
WLGNMGMPRRYADYLPSDGFQPLNVVSTIGAFILALSMLPFVWNVFKSWR
YGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
IRRMREEAHVGRHAEVGETTEGFGPRVAPDR
392419060YP_006455665.1 hypothetical protein Mycch_5302 [Mycobacterium chubuense NBB4]MPHDTSFAPTQLAARAAYLLRGNDLGVMTTAAPLLYPHMWSWDAAFVAIG
LAPLSVERAVVELDTLLSAQWRNGMIPHIVFANGVDGYFPGPARWACSAL
AADAPRNRHTSGITQPPVHAIAVQRILDHARRRGRSTRAVADSFLDRRWP
DLVRWHRWLAECRDQNQRGRVTLYHGWESGMDNSPRWDSAYANVIPGDVP
EYQREDNKINTDASQRPTDVEYDRYLWLVEEMKVNRYDDQLLPKAMSFAV
EDVFVSAILSVACQVLAEIGEDHKRPHADVKDLYAWSERFRAGVIATTDQ
RSGAARDYDVRAERWIATETVAQFAPLLCGGLPHDRERALLRLLEGPRFC
GHPDLAYALIPSTSPVSRDFRSREYWRGPVWPVMTWLFSWCFARRGWAER
SSTLRREGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
392419058YP_006455663.1 amino acid ABC transporter ATP-binding protein- PAAT family [MycobaMADHRLAAVSLAARDLHLSFGPNAVLRGVDLDVAAGTSTAVIGPSGSGKS
TLLRTLNRLYEPDRGDILLDGRSVLADDPDRLRQRIGMVFQQFQLFPHRS
VLDNVTLAPRKLKRLSADEARELGLAQLDRVGLRHKAEVRPATLSGGQQQ
RVAIARALAMSPEVMFFDEATSALDPELVKGVLALIADLAADGMTMIVVT
HEMGFARSTADTVVFMDHGQVVETGAPEQLFEGAETDRLRRFLSQVL
392419056YP_006455661.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPKKYGVKEKDLVVSHVVDMVLTGKLRSGDRLDRNEIAHALGLSRVPVQE
AVVQLEHDGILSTRYHRGAYVERFDEATVREHHELYGLLSGIASGRAAAA
ADPTIIAALDEQIGLLRRGTDARQFDTGARRFRAVINDAYAGPRLQAAIC
SSQTLIPLSFWQTYAQHQNELLPSYEAELAAIRAGDADAARTACATRADT
MARILLTELIRRGVLCAVHSD
392419054YP_006455659.1 putative phosphatase [Mycobacterium chubuense NBB4]MALVPLNLLMSHDGKSRRAHVTCVYKCGDACSKPVPNRSDNEYFRDVAAA
VSRRSILQAGGVAVLAVGAGSALAACSSNSQPDPTAASSAAPAAPPPGMN
FASVAPNREDAVVVADGYRQAVVISWGDPILPGAPAFDVAGQTGAAQRGQ
FGFNNDFAGLLPIPGRPNRFLLVTNFEYVTPQFMFPGYQADAPTREQFEV
EIAAVGMGVVEVERTADGLKPVMGAYNRRITADTPFTLTGPAAGSDFVKT
PADPTGRTVAGTFANCSGGVTPWGTVLSGEENFHEYFGAAAGSPKPGPVD
ADRLDRYGVAPEPTALKWETFDPRFDLTETPNEANRFGYVVELNPWDPAS
TPVKHTALGRLKHEAATIYVTGDGTVVAYTGDDQRFDYMYKFVSSKKIQT
GASAMAHNLTILDEGTLYVAKLSSDIPAGQIDGSGAVPAKGSFSGTGTWI
PLLRSGPGGAAESLVPGVTAQEAAVFTRMAADKAGATKMDRPEDFEANPK
TGKVYVALTNNDKRGAPGEAAPDAANPRNDNKSGQVLEITDNHAGTDFVW
ELLLVCGDPKAADTYYGGFDKDGVSPISCPDNLAFDDHGNLWISTDGNAL
DSNDGLFAVALDGPNRGEVKQFLTVPVGAETCGPVVTDDLVTVCVQHPGE
NDDNSIDNPQSRWPEGGNGTARPSVVAVWRDGGRIGV
392419052YP_006455657.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MTRPADPVRWPDGTRAAAAFTFDVDAESAALGVSHHHADRMSVMSHQAYG
PLVGVPRILEILRRNDIRSTFFVPGYTAHRYPDVVRSIADAGHEIAHHGY
LHEAMTGKSESEEAAILDRAGDVLERVTGRRPIGYRAPMWELNWHSPKLL
ADRGFLYDSSLMDADHPYELAVDGGRSIVEIPVQWALDDWEQYCYIPDFS
GSGLIESPLKAAELWRLEFEGLQSAGGCFVLTNHPFLSGRPSRAAVLEEL
IGYVASRPDVWVAPLGEIAAHTRSLELTPRCIARPDPDDF
392419050YP_006455655.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMAGHQQGRVALVTGATQGIGRAIAERLAADGARVGVNGRAETDAMREVVS
ATGGFAAPADMSDPAAITDAVARIEAAEGPVDVLVCNAAYMSMAALTEHP
EDDWWRVVDTNLSGTFRTIQAVLPGMRRNGGGNIVVITSEWGVTGWPRAT
AYAASKAGLIALTKSLGRELAAENITVNAVAPGVIDTPQLEVDAADAGVP
LPEMHARYAAGIPAGRIGRPDEIAAAVALLARTDVGAFVGQTIQINGGST
RCRV
392419048YP_006455653.1 amino acid transporter [Mycobacterium chubuense NBB4]MDVHPAPSSATDGAALDQLNRGFSFRSALSLAFADVSPIVALYTIFTLGL
FAAGPRFFWAFPIVLVGQLAVAAVFGELSSRWPYAGSVYQWARHVRSTTW
GWTAAWAYMWGLTIALSTLAYAAAGFLIEVFGVENPGRWTTAALALVIIG
VGTATNMIGRRFLKIMIVASITCEIIGSVGLGIVLLAFYRENPFSTLFHG
LPDVSAWTAGPMLLAIAYTGWAFVGFESAGSIAEEVDDPERNVPKAIILG
LLSVGLIVMFSSAALILAIPNLDRVLTEQADDPVAGTLLAHFGAGIAKPL
LIMFVIGFISSFLAVQAAVSRCIWGAARDRGLPGAALLGKLAGPERMPIN
AIGLTAVVAGALVLLAGSSLFNILVNFTVIGFYIAFGIPVLGAAIARLTG
KWTPGRFSLGRWGAPITYFATVWIIAQTVNVAWPRTQPGQPWYINWSMVI
TTAALGVIGVLLYLRQRNNITEPVGQRLSATAPKDAG
392419046YP_006455651.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMDDTDDELASLSEFIFLKENARQAGVPDELPSAARIDAGPISALKYGDES
PRVVFLHGGGQNAHTWDTVILGLGVPALAVDLPGHGRSAWRDDGDYGPKT
SAAAVEAAIRDHAPDAELVVGMSLGGLTAVRIAVTAPELVPKLVLVDVTP
SAPERHTEMTDAQKGTVALVQGERTFPSFDAMLEVTVAAAPHRDRESLRR
GVFHNAKRLDDGTWTWRYDSIRTADGFEGLWDDVPRLTTPTTLIRGANSF
FVNDDDAAEFARTAPGFQQVHIVEDSGHSVQSDQPRALVELLRGVLAG
392419044YP_006455649.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MLELAILGLLLESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADG
LIVEDAAPEGTVKVRRARRVYQLTDAGKQRFTELVADTGPQNFSDDGFGV
HLAFFNRTPAEARVRILEGRRRQVEERREGLREAIARASSSFDRYTRQLH
QLGLESSEREVTWLNELIAAEKSAQGRAEQT
392419042YP_006455647.1 hypothetical protein Mycch_5284 [Mycobacterium chubuense NBB4]MRLQRQVVDYALRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSS
VMCPICRKEQLTLVSWVFGDHLGAVSGSARTAEELVLLATRYDEFSVHVV
EVCRTCSWNHLVKSYVLGAVPPPKGSGRTRRTQTARSNARTASE
392419040YP_006455645.1 putative integral membrane protein [Mycobacterium chubuense NBB4]MTAGAEETSPVPPAGVRSPAPPAEDLRSFDDRDFPSRTDTLGAALSETIG
GPVGRHALIGRTRFLTPLRVMLIIALVFLALGYSTKAACLQTSGTGTADQ
RVGNWSHNRAYYELCYSDTVPLYTAELLNLGKFPYKSSWVETDETGKPRV
QYDGTPAVRYMEYPVLTGVYQYLSMALAKTYTALTKLISMPIIAEVVMFF
NIAAFGLALAWLTTVWAAAMLAGPRRIWDAALVAGSPILIFQVFTNFDAL
AVAFATGAMLAWARRRPVLAGVLIGLGVAAKLYPLLLLIPLALLAVRTGR
LRGVGQAAVAAVVAWLVVNLPIMLLFPRGWSEFFRLNTRRGDDMDSLYNV
VKSFTGWQGFDPNPGFWEPPTVLNTVSAALFAACLIAIGYVVLTADRRPR
VAQVAFLVVAAFLLTNKVWSPQFSLWLIPLAVLALPHRRILLAWMTLDML
VWVPRMLYLFGEQNKGLPEQWFTTAVLLRDIAVITLCALVIRQIYRPRED
LVRGGGVDDPAGGVFDGAPDAPPRWLPDWLRPRVEAPHILANRASAKL
392419038YP_006455643.1 SSU ribosomal protein S6P [Mycobacterium chubuense NBB4]MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVDKVDIWGRRRLAY
EIAKHAEGIYAVVDVKAEPATVTELDRQLNLNESVLRTKVMRTDKH
392419036YP_006455641.1 SSU ribosomal protein S18P [Mycobacterium chubuense NBB4]MAKSSTKRRPAPEKPVKTRKCVFCSKKGQDIDYKDTALLRTYISERGKIR
ARRVTGNCVQHQRDIAIAVKNAREVALLPFTSSTR
392419034YP_006455639.1 replicative DNA helicase [Mycobacterium chubuense NBB4]MAVVDDLSRSGDPSNLEPPPNEDFGRQPPQDPAAEQAVLGGMLLSKDAIA
DVLEKLRPGDFYKPANQIVYDAILDLYGRGEPADAVTVAAELDRRGLLRR
VGGAPYLHTLISTVPTAANAGFYAEIVAEKALLRRLVEAGTRVVQYGYAG
ADGADVSDIVDRAQAEIYDVTERRAAEDFVILEEILQPTMDEIDAIASEG
GISKGVPTGFVELDEVTNGLHAGQMIIVAARPGVGKALALDTPLPTPTGW
TTMGEVAVGDELLDADGTPTRVVAATHILLGRPCYEIGFSDGTTIIADEM
HQWPTSHGIRTTAALRAVADTVTAAKMTDATSGNSAVLAPGRIAIGVTSI
RRVPTVPVRCVQVDNPEHLYLAGRGMVPTHNSTLALDFMRSCSIKNQLPS
VIFSLEMSKTEIVMRLLSAEAKIKLADMRSGRMSDDDWTRLARRMSEISE
APLYIDDSPNLTMMEIRAKARRLSQKAGLRLIVIDYMQLMSSGKKYESRQ
QEVSDFSRSIKLMAKELNVPVVAISQLNRGPEQRTDKRPQVSDLRESGCL
TASTRILRADSGAEVTFGELMRTGERPLVWSLDERNRMVARPMTNVFYSG
HKEVFKVRLASGRQVEATANHPFLTMDGWNALGELAVGARVAVPRRVPEP
VQTQRMHDSEVVMLAHMIGDGSCVKRQPIRYASIDEQNLAAVTSAAEHFG
VTAVRDEYAAARVTTLRLPAPYRLTHGKRNPIAQWLDKLGLFGKRSYEKF
VPAEVFALPNDQVALFLRHLWATDGSILWNAKQGLGNVYYATTSRQLADD
VVQLLLRLGIQSQIYVARKTSYRDCWHVRIFGVENQRKFIRQVDVHGAKY
FSAREVLNNLRQVKATANSDTVPSSVWMEIRDALADRGMSHRAFAKAMGT
QFCGSTMWKRPVGRKRLHRAAAVLNDKELHGLATNDVFWDRIVEVTSIGE
QDVYDATVEGTHNFTANCIVLHNSLEQDADMVILLHRPDAFERDDPRGGE
ADLILGKHRNGPTKTITVAHQLHLSRFANMAKQ
392419032YP_006455637.1 amino acid ABC transporter substrate-binding protein- PAAT family [MRTIATVLVVVSTLVASCATVQPLTDVPASLTTRPMPSGAEVAPSVSGAA
VESCDATASLRPSSEPGPTVDAIRRRGRVVVGIDQNNNPLSFRDPVTGEL
EGFLVDLSREVVRDLVGDPDKADFRLVSEPDRIPAVRDKTVDILTKATTI
TCPRAEQIAFSTVYFEGSQRLLVPRGSLVRGPADLAGRRVCSGLASTSIA
TVARVAPAATILGVPNMDDCLVALQQGQADAASTDDVLLAGMVAQDPNLE
IVGPPLEAEPYGIGINKSQDDLVRAVNASLDRIRRDGTWVALYRRWLTVL
GPPPRPPEPKYRD
392419030YP_006455635.1 hypothetical protein Mycch_5271 [Mycobacterium chubuense NBB4]MRRSRSCARSGAGSGRLRSRSVADRRLCFCLAVRRSRLRLPMSGSVARGS
DIDGRRVPPGCARGTPGCEATASIPVGVIIPPQIDMSQNRGVSMSYRRFN
ATMPCPRGLAYATVATVAGVVVGEMAAVLIFAGSIDRRLDEQARATGALV
VARCEFNATPQYPQTHITGVPGTGPEQRTADAFLADAQQRLDTVESERND
SAETELDSAAWRSLRRPPSGYPRYRWSQGCGIAGVAGGELHQPAAQSLRG
GDVRGNRRTGHAGWIPGRDIAIDARRGHPSVAVEAPKRMWRNVTRGDRRG
RERPSPDWTPSSGTHSQTRPCCCADGCDRRLMP
392419028YP_006455633.1 hypothetical protein Mycch_5269 [Mycobacterium chubuense NBB4]MTIPSTRLRYSLGRIVCGLATAALLLALPLGDVKADPADDALARLNKLSQ
QALQSREAVTAAQRDEDAKAAERAAADDRHRADLSALDLANSQLQPYQAA
VNRLAAMSYMSGGDSQAAAVLTATSPQHLIDRLAVQRVVDATTAEQMKAY
RATRERAASAAQASEKSAADARTAAERAAPVRADLQAKWKELLRQIAAAE
AQYAALTPQQQAVIDAAVPPPPPAPQDPAIVAMPGLPPGDLAPPPVAAVP
EIPDALPVGVANEAGLQPNTVLVARAVSARFPQIATIDGVRPDSKPWHPR
GLAIDIMIPNPGSPEGIALGDQIRAFAMANAGRFGLQDVIWRGTYSTPDG
PQATGYGHYDHVHITTTPRG
392419026YP_006455631.1 transcriptional regulator [Mycobacterium chubuense NBB4]MHTRERILRAAAEMIAEDATTTLSVRAVAVRAGVSTGSLRFHFPTQRALQ
DEVLTRIYRHFIPDEPIHDSSRPARERLVDCLRQVLAAAGVGDEARKAWG
AAYEHFIAPEPSEKVRKAYLAQERVSAGRVEYWLGVLADEGALPRDDFPR
KVRFLLTVLNGLSIQRALPSGESVLQAETETLYLAVDAVLGTGTS
392419024YP_006455629.1 dihydrofolate reductase [Mycobacterium chubuense NBB4]MAQLLRVQNFNVSSDGIGAGEDQSVDRPFGHVHPEQLFAWAGATASWPMR
TDPGGSRGLDDYFTRDYPRNIGAEIMGRNKFGPQRGPWQDHEWCGWWGDE
PPFRTPVFVMTHHKRPSFTLSDTTFHFVEGDPATVLEQAREAAQGKDVRL
GGGVSTIRQFLDAGLVDTMHVAVSPVELGSGLRLWESPDELLDRFHLDVV
PSPSGVTHHLFWRK
392419022YP_006455627.1 ribosome-associated heat shock protein implicated in recycling of 5MMVVMESTRVDRWLWAVRLTKTRPDAAEACRGGHVRVNDRSAKPSTVVCP
GDEVRALVGGRTRIVEVVRVIQKRVGAADAVTCYLDRTPPPPPAAPPPLA
VRDRGAGRPTKRDRRLLDKWRARQG
392419020YP_006455625.1 lactoylglutathione lyase family protein [Mycobacterium chubuense NBMPVRTSAPLGAPIWIDLATSDLEQAQRFYGTVFGWTFESAGAEYGGYVTA
FLDGRHVAGLMVNDPQWGAPDGWTTYLHTADISDTVAKATAAGATSCVAP
MEVKDKGWMGMLSDPTGAFFGLWQPTGHRGFDVVDEHGAPAYHQLTTRDY
RAALDFYREAFGWQTATVSDSDDFRYSTASFDGHDLVGVMDGAGILGEGV
PSDWCFFLGADDVDKTVQVILDNGGSVVRAAEDTPYGRLAAVADPTGAGF
NLSSIGA
392419018YP_006455623.1 putative Fe-S protein [Mycobacterium chubuense NBB4]MTTIAEATGRVAALRRYPVKSMLGEQRAALELSPLGVAGDRRYAFIDDET
GRVATAKNPRLWRRLLQCSATTGPDGVVIALPDGRAVPVGAADAPVSNLV
GRSVHVADERAAGAVVERSDPVDVLAHGVDADIEAALLEIAQGTPGGGFV
DHSPVHLITTATLDAVGLDRAEAVRYRPNIVIETPAGCPPFVENDWVGAT
IRLGEAELRGTLPTPRCSVPTLEHGSMPRSPQAVRYGLEHNRVEAGEFGV
LPCAGLYAEVVAGGTVREGDAVHLSAGA
392419016YP_006455621.1 beta-glucanase/beta-glucan synthetase [Mycobacterium chubuense NBB4MMLSGFGALAAMIPLPEAGALPSPAPAAPPAPSAATPNYLFQDEFDGPAG
SAPDPAKWRVVPARESIKNPVFWDRPENMGQYRDDREHVFLDGNSNLVIR
ATRNPDGKYASGKVTGTFWGGINTTWEARIKFDCLTLGCWPAWWLSNDHP
VVGGEIDLIEWYGNADWPSGTTVHARSDGTSFATQHHPVDSNWHLWRVTW
NDSGMYFWQDYVEGAEPYFTVPAHSLEGWPFNLPDYRVFPVLNLAVAGSG
GGDPKGGTYPADMLVDWVRVWSG
392419014YP_006455619.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMAFTRKRAQHTMGFDDYEQLTLSRRDNGVLLITIDRPEKYNAADEGMHSE
LARIWVDVAADPQTRVAVITGAGKAFSAGGDLAMVERMAGDYERVSHMLD
EMSALVYNIINCDKPIVSAINGVAVGAGTVAALLADVAIAAEDARIGDGH
VKLGVAAGDHAAIIWPLLIGMAKARYYLLTGEMVTGAEAERIGLVAKAVA
REDVLDEALRVADALATGSQQAIRLTKRTLNNWLRTAGPTFDQSAAYEML
TFLGPDVVEGYTAIREKRPPRFPSALNRD
392419012YP_006455617.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium chubuense NBB4]MSEQLHDFFGEVFQRYFRPAIDAEPRLHSGPVQRMFTLTDAVQDPLEQSR
RGALAWGHTEVGDARFAAELFVITQCGLMYAAELSNERRALYYLATPPTL
FDPLVDQVETAELDEDAVVIVDNAFGHDLASARPMDAALRRIVDEHWALR
VNLAEPVMR
392419010YP_006455615.1 hypothetical protein Mycch_5251 [Mycobacterium chubuense NBB4]MSGRFRYRRVYDDASSADEARVLVDRVWPRGVRKEELDLTEWLREVAPST
ELRQWYSHQPEKFAEFRRRYRAQLRAPDRRRAVEHLDELARRGDVVLLTA
TRDADHSQAAVLAEWLNERQP
392419008YP_006455613.1 glutamate synthase family protein [Mycobacterium chubuense NBB4]MKKRTLAVLGPAAALAGIAVQDLLQKEHALRHNFPVIARARYLLESVGPE
LRQYIITSNDAERPFSRDQRRWVYTSAKKENNYFAFGTDNDTENASYPII
KQATFSDVVPASPIHGRDVEVPGAKVLGGPRGRRHAFRPSSVVNVSAMSF
GSLSPQAIQAINKGAEIAGFWHNTGEGGLSDHHRQGGDLVFQIGTGYFGC
RDEHGNFDLDQLVDVVGSGPVRAIEIKLSQGAKPGLGGHLPGAKVNAEIA
RIRGVEQGKDVASPSRHTAFRNIDEMLDVVERIADATGLPVGIKSAVGEM
TFWQELADRMADGQRGVDFITIDGGEGGTGAAPLVFADHVSFPFRVGFAQ
VYGVFAEKGLSDQVTWIGSGKLGLPANAIVAFALGADLVNVAREAMLAIG
CIQAQKCHTDRCPTGVATQNPWLARGLDPEQKSHRLANYVLTLRRDLLKV
SEAAGVRHPAMLDPNTVEILDGDRGHRTLAQVYDYRRGWGVPGPDIVREI
DAYMARYDDRPGTDEVVEHEPLKVATDPNQATE
392419006YP_006455611.1 hypothetical protein Mycch_5247 [Mycobacterium chubuense NBB4]MIDHRKYRGFEILRGSWGAVLLIAPDRVLRATRSGPIDTKSRTVTRILGA
RHLTQAALSGLRPSPEVLAMGVWVDAVHALTACALALSDRRRARAGYTDA
AVASVWAAAGYRDLRHGRATPRAHQQVRDQLADLVLDHVPGGPPLHDRAR
EVRAPLQTQIR
392419004YP_006455609.1 choline dehydrogenase-like flavoprotein [Mycobacterium chubuense NBMGDGREVRSRNESAWLVPNDGVRTNHRLRADMRRYESDDEVDVVIVGAGA
GGATLGQRLARAGWSVVLLDAGPFWDPDLDWVSDERGSHGLYWTDARQIG
GSDPVPLGSNNSGRGVGGSMVHYAGYTPRFHPSDFHTRSGDGVGADWPIE
YTDLRPYYEQIEAELPVAGQDWPWGDPHSYPHSPHPVSGNGLTALRGADA
LGVDMRVGPVAIPNGRFGNRPHCIYRGFCIQGCKVNAKASPLITHIPDAL
AHGAEVRADCHVSRILVDDETGSATGVVYLHDGVLHRQRAHAVVVAGYSI
ETPRLLLLSSSARYPEGLGNDHDHVGRHLMVQGAPQVAGRFSDEIRMYKA
PPPEVSSEQFYETDPTKPYRRGFSIQTVSPLPITWAEHVAAQGHWGQTLR
EYMRDYVHWATLGALCELLPLPDNRVTLAGETDRHGLPVAHFAYSQCDND
RQLIDAAGSVMSDLLRAAGAEEVITINRYAHLVGGARMATRPQDGVIDAE
HRVFGVDRLYVVDGSVMPTQGAANPALTIMALAARAADLMKRHAAQS
392419002YP_006455607.1 hypothetical protein Mycch_5243 [Mycobacterium chubuense NBB4]MKPVRAAVHAIRTGRFERTLAALTAAGAAVTTAEIYLSHDGASFGNRMMY
WPVVIVPTAVPAGLAGFFSRRAAHTVLPAASALIVANGVQGTYLHWRGIR
QRPGGLTRYNMESGPPAFAPLLASLVGGMGLLAALLRREDLTGNGRR
392419000YP_006455605.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMTTSSPRTVVVTGASAGIGRAAAQAFGRRGDRVALLARGHAGLRGAADDV
EAAGGRALCVPTDVADFDQVDAAATTVENTFGPIDVWVNVAFTSVFAPFT
EIAPNEFRRVTEVSYLGFVYGTMAALARMKPRDAGTVVQVGSALGARAIP
LQSAYCGAKHAINGFTESVRTELLHDRSKVRITVVQMPALNTPQFDWVLS
RLPRHPQPVPPIYQPEVAARAVVRAADHPRRKQYWVGASTAGTVLGQRLM
PAVLDRYLARTGYSSQQTGQPVDPDRPNNLWQPVDDEPGSDHGAHGSFDD
QSISRSRQVWLSRHARSLSIAAAGAALTAGGAALTYHRH
392418998YP_006455603.1 hypothetical protein Mycch_5239 [Mycobacterium chubuense NBB4]MARDTRGPMPPETSDLRRVSLNPPHWRQARRLLAVEAVVTGVIGVVGLIG
VAVAPHNDGWRVLGVPLTPALSAVLIGIGVAAALAMTHRRAAKVFTLAMS
AATVALMIICSVAAVHHDPGPLGFTAPAILLWTILFCWSIASAMWVFPDQ
IQGPDWVPRRRPRRPADTAASARRAKS
392418996YP_006455601.1 cellobiohydrolase A (1-4-beta-cellobiosidase A) [Mycobacterium chubMSSAAGAVARWIAPVLTLAAIAAVGLAAHSAPAGPSPAVRLVDEVNPLAG
APFYVNPASAAMRAAQSADPPSPQLAAVANTPQAYWLVPGSSAATVASYT
AAAQAAGAIPILTIYGIPHRDCGSFAAGGMASGADYRSWIDGIAADLGAS
RAAVVVEPDALAMADCLSADQRQERFDLIRYAVDALTRDPAAAVYIDAGH
LRWHSPEDMAGRLNQAGIEHARGFSLNTANFFTTEDEIGYGEAISGLTNG
KHYVVDTSRNGAGPAPDSALNWCNPGGRALGTPPTAATAGPHADAYLWIK
RPGESDGTCDKGDPPAGTFVNQYAIELARNAGQ
392418994YP_006455599.1 TIGR03086 family protein [Mycobacterium chubuense NBB4]MHTIEHTTAVAASVALVDTVATADLGRPTPCAGWDLLDLLSHMTVQHRGF
AAAARGRGADPDVWRVESVVEAVRKDPARAYSGAATDALEAFAADGIGEA
SFALPEFGDGAVFPGTIALGFHFVDYVVHGWDVAASLGVTYELPGSVLAA
ALPLVLAVPDGEVRQLDTVPFDAAIRPVDGAGELDRILRHLGRRPEWTAP
MLSDS
392418992YP_006455597.1 Transport protein [Mycobacterium chubuense NBB4]MSRGLSWRSVPDLIRRFSVLIALFWLATAVLTNVFVPQLETVAESHNVSL
SPKDSPSLQASKRIGKDFGEYDSDSSAMIVLEGDQPLGADAHRFYDGLIQ
KLQADTKHVEHIQNFWGDPLTAAGSQSSDGKAALVQVFLAGNQGESLANE
SVDSVRDIVDNTPAPPGVKAYVTGPAPLITDQFEVGRHGTLKTTLITIGV
IALMLLVLYRRLTTVFFVIFTVMIELTASRGVVAVLANAGIIELSTYSTN
LLTLLVIAAGTDYAIFLLGRFHEARYAGQDRVAAYNTMYHGTAHIILGSG
LTIAGAVLCLSFTRLPYFQSLGVPAGIGVLVAVIAALTLAPALLVIGRHF
GLFEPARPLSTRGWRRIGTAVVRWPGPILVATVAIALIGLLALPNYKTNY
DNRTYMPADAPANVGYAAAERHFSQARLEPEILMVEADHDLRNPTDMILL
ERVAKAVFHTDGIAQVQSITRPLGTPLDHTSIPFQLSASSAAQINTLPFQ
KARTADLLKQVGVINDSINTLRKQEALQQQSASITDEQAKAFQNTVATAQ
DLRDKIANFDDFFRPIRNYFYWEPHCYDIPICWALRSLFDALDGINDLTD
QLADVAGSIAKLDALQPKLLALIPPQIADQQTNRDLTMTNYATQSGLNDQ
NSRALENSTALGQAYDASKTDDSFYLPPEAFTNPEFIRGEKLFMSPDGKS
ARMIITHEGDPATPEGISHIDPIRHAAQEAVKGTPLAGSKIYIAGTAATY
KDIKDGAKYDLMIAGIAALCLILLVMVFITRSLVAAFVIVGTVALSLGAS
FGLSVLIWQDLLGIELYWIVLALAIILLLAVGSDYNLLLISRFKEEIGAG
LNTGIIRAMAGSGAVVTAAGLVFAATMASFVFADLRILGQIGTTIALGLL
FDTLIVRSFMTPAIAALLGRWFWWPLKVRPRPASQMLQPYGSRASVRQLL
LWEDGDPAVTPQHRRE
392418990YP_006455595.1 acyl dehydratase [Mycobacterium chubuense NBB4]MTAPAETSPLEARVGHYYQMDGTYLVGREKVREYARAVQDYHPAHWDVAA
AGELGYSDVVAPLTFTSAPGMQCNRRMFEEVVVGYDTYMQTEEVFEQHRP
IVAGDELHIDVELTSVRRIAGRDLITVTNTFTDTAGERVHTLHTTVVGVT
ADDIGADVKTAVQNAMMHDMNILDIGGSDADYRKTVRPDGELRVSDGGTT
RVPGTASFDDVTVGDELPVHHTRLSRGDLVNYAGVAGDANPIHWDEDIAK
LAGLPDVIAHGMLTMGLGAGFASSWSGDPGAVTRYAVRLSAPAIVPAKEG
ADIEFSGRVKSLDPQTRSGVVLVAAKSDGKKIFGLATMHVRFR
392418988YP_006455593.1 nitroreductase family protein [Mycobacterium chubuense NBB4]MPNAFPDAATLRTVLDLASWAPSAQNAQPWHWLVDSDGLHLDADWDRRLG
DTPADRSDVLLSCGAVLHHCAVALAAAGWHPRIRRFPDGGAGRLASFELI
ESSPVAASVELASAIPRRRSDRREYGESALAPATLELLLIRAARLGVQMS
VVPKDRWVRLGEGRIELSYGPVGDDQPPPSGPGDGVLLVLATEADDDRSR
LRAGEATSDLLLSATALDLASCPLTEPLRDARARLALACDVFDGEAHPQV
LVRVGPAIVGAPELPPGPRRPVAATTTWT
392418986YP_006455591.1 hypothetical protein Mycch_5227 [Mycobacterium chubuense NBB4]MADIIDLIYADHDWLRRQFFRLDDAQSAEDLAAIWDALGTRLDAHADAEE
TVFYPALLKHGGREDPGNPEGDPEDETEDAITDHNAIRDAVRESRRHQPG
SEKWFEAVNKARSENGSHLDEEEREAMPDFIKSASLELRHELGMKWLRFY
AEHDTSRGIDTADKDSDEYIDKHS
392418984YP_006455589.1 putative membrane protein [Mycobacterium chubuense NBB4]MVALPVDPRYRDAVPSSYHAAEPHTGSVSSKLNWLRAGVLGANDGIVSTA
GIVVGVAAATAERAPILTAGVAGLAAGAVSMALGEYVSVSTQRDTEKALL
TKERRELRDDPAAELDELTALYEAKGLSVATARTVAEELTEHDAFAAHAE
VELGITPGELTNPWHAALSSALAFTVGALLPIVAILAPPADWRVPVTVVA
VLAALVLTGAVSAALGGAPKHRAVIRNVVGGGLALAITYAIGHLVGAAIT
392418982YP_006455587.1 Zn-dependent protease with chaperone function [Mycobacterium chubueMLVLALVFGWCLAAALTLSLGRMHMWFTPGWQLRALSVGSLGLAVATLSS
TAALLCALAAQWRVPAVLSWAMVGVVGAVAASRAVLHLRRVHALSEAVEV
FRRTRTAADGVLVVEDPAPEAFAVPGRGAVVVVTTGLREALSSDEFEAVL
RHERAHLRFRHHLYIQLTELAACVNPLLRRWCATVRFTAERHADEYAAQA
DRSGTARALTKVALLTSHGYRSPSVQLRISEHAAAVVARVQALQNPRPRR
QRLLPAFAAAVLLALVGADVAATADWVQDHLLPETGEAAAVIVG
392418980YP_006455585.1 hypothetical protein Mycch_5221 [Mycobacterium chubuense NBB4]MSQPAERVVLVSGAARGVGAAVAHRLADLDSHVVVNHRDHPGGTVEATVD
SIATRFGRLDALVLDASGGLPFGTDAGQAMRVSRDEHRTLASLAMPLMSP
GARIVFVTSHQAHFFPHKAVPKGYTAVAAGMRAGETALYAMRSQLGRHGI
HLSVVSGDMIGVGHPSDELADAVVNAVTTPHPPGVVFLGGAEYLMTA
392418978YP_006455583.1 Mn-containing catalase [Mycobacterium chubuense NBB4]MFIHNKDLQFEVRVNEPDPRFATLLQEQFGGANGELKAAMQYFTQAFVLR
QKNPKMYDLFMDIATEEFSHLEMVGSLITMLLDGLNDDLKQANQRCDWMP
LVSTRDGREQAIHAVAVNPLALIQSAGGPTVGDAAGNFWTGAFVTANGEP
TVDLRSNIAAESRAKIVYEYLKQFTDDPGVQDTLTFLMTREITHYQQFTA
ALNDLPVNFPPGHLAGDDRFQNVAFNMSDGAESVRGPWNEGQGPWPEGIS
WDYVEKPTEQWLQGSTRQNKGNEKNPDGQPSVSSEKPFTHEQRVPTK
392418976YP_006455581.1 methyltransferase family protein [Mycobacterium chubuense NBB4]MTDAMNAEFDTVAEWTAEAARELGPDYYVPAGCRGSGSPAALDWLIDELE
LTAGESLLDSGGGVGGPAAYAAQAVGVTPVLVEPEAGACRAARRLFDFPV
VRALGSALPIADAAVDAAWSLGVLCTTPDQLGLLTELRRTVRAPGRIALL
VFAAREPVPADEQPEGNNFPTIGGLEALVQDAGLRVRAWRSTADLPAIPD
EWTRRIDAVTDAMEQRHGSSQTWRLAQHQSEQIGDLLAAGKVTGEMLILA
HA
392418974YP_006455579.1 phenolic acid decarboxylase [Mycobacterium chubuense NBB4]MTSVTSPVPDQDLSGIAGHRFIYTYANGWQYEMYVKNDTTIDYRIHSGHV
GGRWVKDQTVDLVQLDDDVFKVSWTEPTGTSVSVNVLPGKRRLHGTIFFP
EWVRTHGERTVCFQNDHLDEMRAYRDEGPTYPIYVVPEFAYITLFEHVGV
DDDTVIDRAPQDLPEGWADRTG
392418972YP_006455577.1 sugar phosphate permease [Mycobacterium chubuense NBB4]MDSGESRPATADKEPPPGVIKKAITASAIGNATEWFDYGIYAYGVTYISA
AIFPGDAASATLLALMTFAVSFLVRPLGGFVWGPLGDRLGRKRVLAITIV
LMAGATFCAGLVPTYATIGMWAPFLLVLLRMIQGFSTGGEYGGAATFMAE
YAPSRRRGMLGSFLEFGTLSGFSLGALLMLGCSLVLGDDQMHAWGWRLPF
LVAAPLGLVGVYLRSRLEDTPVFRELERKGRTEEETATQFRELIARYWRP
ILQLGGMVVALNVVNYTLLTYMPTYLETQIGLSADQSLVVPIIGMLSMMV
FVPFAGLLSDRVGRKPLWWFSLIGLFVAGIPMFLLMGTNLAGALIGFAVL
GLLYVPQLATISATFPAMFPTHVRYAGFAIAYNVSTSLFGGTAPAVNDWL
TTSTGDVLFPAYYMMGACVIGAIALWKVPETARCPIDGTVTPGTDAAPDP
VPFEKNPA
392418970YP_006455575.1 putative permease [Mycobacterium chubuense NBB4]MSLHTLAARARLSPGTAAGLLLCAAVFVVGLSWAKWMHYSSKAVDLGQTH
RWPGSDILATGGVTAGDPPSWHAAATFFHAYVASIWPALVVALLLSAAVQ
AFLPPSWPARLLNRRSTLSSALAGGAAGMPSMMCTCCAAPVAATLRRNGV
TPPAAVAYWLGNPLLNPAVLVFLLMVAPWQWSVTRLVIGLVTVIGAAAAV
GLATRDPLAATPAPRPELVDRPGPGRFRPSPGRFAAALAKLALTLLPEYA
ILVLVIGAYRGRLLTITEPSHRGLLIVVVVSLVGVLVVLPTAGEIPILLS
LAVLGASPGVLGALLITLPAVSLPGAAMVARSFGPKATAITAGVVVAAGL
LSAAALSSLSSL
392418968YP_006455573.1 putative nucleoside-diphosphate sugar epimerase [Mycobacterium chubMTMNITVFGATGQVGAQVVALLTAAGQDVTAASRGSGVDAVSGAGVDGAL
ANAEVVVDVLNSPTMADDAALAFFTATAANLTAAAKRAGVGHYVLLSIVG
VDQLEGGGYVRGKVVQENAVAASGVPYTIVRATQFHELTEVITGSLVVGD
EARVPDALIQPIASADVAAVLARTATERPANGVMDLAGPEPMSFADMAAL
VLAAQGKNLRVVVDPAATYFGTPVHTASLVPRGDAERAPHRLSDWLGAR
392418966YP_006455571.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMSLVTYEVNDHIATITLNRPEARNAINGAMRRDLNAAWDRFRDDEDAWVA
ILTAHGEVFCAGGDLKDGEGSVGTFGGTFWEKPTINSFESGMELFKPTIA
AVHGPCIGYGLTGILFCDFVIASTSASFSFPEVRLGLPTIVGAIRLPERL
RWADAMELLLTGKPVSAHRAKEIGLVWRLVEPDELQEQALAWARTLTEAA
PLAQRATKEVAWRTATMGWIESVRFGETMRKVAAVTEDVAEGLRAWREKR
APTWRGR
392418964YP_006455569.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMPSPTPVIAALALTIASLVAVPTASAEPVPVADTTAVEPGVVRIDTDLPV
QGAVGSGTGVVLRPDGIALTNNHVIRGAADITATDVGTGRSYPVDVVGYD
RKNDVAVLRLRGASNLPVAPTADSSTVRIGDPVTGVGFPGGGPLTRSPGT
VRALGQNVTADDDFTGSSEQLDGLIGFDADTLPGDSGGPLVDSTGRVVGI
VTVGSQTYRMTNAGGFAIPINQALATAEAIQAGNASGSVHVGPTGILGIG
INDDRDPAGVVVQGVLRGSPADLAGLAGGDVITGIDAVPTPDGTVLTDVL
DRHHPGDPVTVDYLDRARTAHSIPVRLAAGPPN
392418962YP_006455567.1 hypothetical protein Mycch_5203 [Mycobacterium chubuense NBB4]MPVPDTPRPGQESVWDYPRPPRVEEFRGSIVVELGGRKIAETDRAWRVLE
TSHPPTYYLPRESFVDGCLRDAPGSSWCEWKGQASYFDLVTPAKTAPKAA
WTYRNPTSGFGAIGNAIAVMPASVDRCLVNGEVVQPQPGGFYGGWITSWI
AGPFKGVPGSMGW
392418960YP_006455565.1 putative membrane protein [Mycobacterium chubuense NBB4]MNLHHVLGSVERLRILDSPAATASGVARRLIGSGRLAQALRGSWLGHPVH
PLLITVPIGSWIASAVFDVVFTDVAAARRLVAVGLVATPPTVLAGWADFP
LLNRRQQRVGLVHAVSNFVGVVMFTLSYRAYRRERNEAARRYTMLGLAAI
SVGGALGGHLSYAQGAGMFRWQPVRAVTHRSPIEHQRAA
392418958YP_006455563.1 hypothetical protein Mycch_5199 [Mycobacterium chubuense NBB4]MAKYLLLKHYRGAPTPADFVPMDRWSPDEVRAHVQYMHDFAAKLEETGEF
VDAQGLAPEGAWVRHDGQGRPPVTDGPFAETKDLIAGWMIIDVESYERAV
ELAGELSAAPGAGGTPICEWLEVRPFMAAPPTVTE
392418956YP_006455561.1 putative copper export protein [Mycobacterium chubuense NBB4]MAAEVVHFLSLSVPAAIGLTIAFLAIPEARGGVVSQNVRRLALPTALAVA
VWAAAQFVLSAAVSDLVVALLLAAGLVVLRTRASRPVAAAVTATAVVGAV
IPLLPATVGSLDSLARSVLTVVHVVAATLWVGGLVVLGAAGMLGRRARGE
EAAAGRDWAQVWERFSVVALYAVGGLIISGMWLAWTHVGTPAQLLTTAYG
RYLAVKLVLVVALLGAGAYNMRVLMPRIRLARRDGDTRSVVRLTVEHFPV
VVVAEAVVGVAILAVVPFLRGSARAEAGWPGAGPFDATVFASGAALVALV
ALALWAGTRQARFAPRGRGQYHSHGRVR
392418954YP_006455559.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMRLQRSVIANVDRHIVWKHVSDPECYPTFMPHLERWETVTEGPVGIGSRY
TVHWKVGSVPIGGVIELTEFDDARDLAWIGITGVTLRGRFRLRDCGEGKT
KVTFRLSYEAPGSGILALIADRVAARQVGRIMDETVRRLKVLVEG
392418952YP_006455557.1 arabinose efflux permease family protein [Mycobacterium chubuense NMSCPLPSVGAMSLDTSAAAAREQVWTGHAKGSAAYGRLIAALFFAGVATF
AQLYSPQAVLPLISADLGVGAAAAALTISASTVGLAIGVIPWSTVADRIG
RVRAISWSVTTATVIGMLVPFAPTYEMLLAGRFLEGVLVGGVPAIAVAYL
TEEIDRGHAARAAGTFVAGTTVGGLLGRLVSSPVAEATTWRVGVFAVAAM
CGLAALCFVRLAPEPRGFVPANRRGANPEGGLVHRLVANLRSGRQLVLYA
QAFLLMGGFVALYNFLGFRLARPPFGLAPSLVSLVFLAYLAGTWSSSRAG
AEAVRFGRKRVLLASIAVMAIGVAITLSDNIIAVLVGLVVATAGFFGAHS
IAAGWTGQLASVGKAQASSLYNLSYYTGSSVIGWLGGVAFDARGWIGVAG
TIIALTALAAGLAAFALPAQPRRA
392418950YP_006455555.1 selenophosphate synthase [Mycobacterium chubuense NBB4]MTAKRLTGYAHGGGCACKIPPGELEDAVRGLTGQAGDHVLVGLDDGDDAA
AVLVGDVAILSTADFFTPVVDDAFDWGRIAAANALSDVYAMGGRPVVAIN
LVGWPRDVLPMEMMTEVLRGGLAVASEAGCPVIGGHSIDDPEPKYGMAVT
GVADPARLLRNDAAEAGLPLTLTKPLGTGLLNNRHKQTGEVFGEAIEVMT
RLNRAASEHALAAGLRAATDVTGFGLLGHLHKMCRASGVGAVIDSTAVPV
LDAARDALRDGFVSGGTRRNLDWVRPHLRADGVAEDDLLLLADAQTSGGL
LVVGELPGHPVIGHTVEEIGLHIR
392418948YP_006455553.1 selenocysteine-specific elongation factor SelB [Mycobacterium chubuMYVVATAGHVDHGKSTLIRALTGMEPDRWDEERRRGLTIDLGFAWTTTSS
GDPVAFVDVPGHQRFLPNTLAGLGAAPVICFVVAADEGWSAQSSDHRDAI
AALGIRHGLIVVTKADRAPERTGEVAAQARQELAGTGLADAPAVAVSAAT
GSGLAELRRTLDRVLDAVPAPAVSARLRLWIDRSFSITGAGTVVTGTLTA
GTLSVDDKLQLLGTDRDRTVTVRGLQSRGESRSALAPVTRAAVNLRGVAH
NDIHRGDVLVTLGAWLTTRVLDVRRATGAALTDAPGHLVVHVGTAAVRAR
LRPLDDDHARLTLDRRLPLVFGDRILLRDPGGRHVLAGARVVDADPPALR
RRGDGARRAATLSAMGPDRDLGAEIARRGAVLREHLLQLGLLDAAAAPPA
DVVVHGRWWVHGPTYHAWTDRLRTAAGALHTRDPLAAGLSRRAVRDLLAL
PDEALVDPIARAAGLEQTGGHLRMPHTADDLGPAEAGIAELESRLGCAPF
RAPEADDLAALKLGTRELAAAERAGRVLRLRDGIVLLPTAPALAMRALAG
LEQPFTTSRARQALDTTRRVVIPLLEHLDGRGWTRRVDAGHRAVVR
392418946YP_006455551.1 putative thioesterase [Mycobacterium chubuense NBB4]MAEHHARDYRYFLPITTRWMDNDVYGHVNNVTYYSYFDTVANHFLISEGG
LDIHTSPVIALVVESTCSYRAPIAYPDTVRAALRVDRLSQRSVTYGVAIF
ADTGGDTADVAVAHGQFVHVFVDRDRRSAVAIPDRIRDALATLVLDRGES
P
392418944YP_006455549.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGLLNDKTALVTGGTSGIGLATAQRLAAEGAHVFVTGRNQSTLDAAVAAI
GDGATGVRGDVSQPADLDAVVDAIRAYGHGLDVVFANAGGGEFAALADIT
PEHLEKTFATNVFGTVYTVQKTLPVLNDKAAVILAGSIAAHNGTPAFSVY
AASKAAIRSFSRTWAAELAERGIRVNTVSPGSVVTPGLKELAPAGQEQAL
LDQLEADVPLGRLAEPDEIAKAVVFLASDLSSYVNGTELFVDGGAQQV
392418942YP_006455547.1 Phospholipase/Carboxylesterase [Mycobacterium chubuense NBB4]MNTVQYSPDRHADLFGEPTDPSVLLWHGAQSDARASVRTLAELLATRGIG
VVAPDWDSHAPDRGASDLLASAAFAREWSAGPLVVVGWSMGGAAAAGLTL
RASRHGVAVAHTVCLAGAFMVPDPISGADLTAMVSDERPGTPFTLLHGSA
DDVVPPEAGRRFAAALDDAGWPVQALELPADHGSIAGARYDAATDSYAAA
TDPHTLEVAGRVAGHIADAVGATHRR
392418940YP_006455545.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium chubuenseMPEGDTVYALARRLDTVLRGRALARGELRVPAHATADLAGLVVLGHDTHG
KHLLTRLSDGLTLHTHLRMSGSWTISAAGRWLPRAVMPDVRVVLRTDGPA
AYGVRLPVVELLRTRDESQAVGHLGPDPLRADWDLAEAARRVREQQDRPL
AAALLDQRCVAGFGNLWANELCFLRGHSPWTPVADVDVTALLELGARALR
HSATVPGAMQVTTGVRRKGEQHWVAGRAGRPCLRCGTTIRVVAEVPNDPE
RGAPGGVRSANPAPLRRDTVCMRTVADTGFLMTSVVIVGSGFTGFECARR
LARLMRRKDAAVDITIISPVDYMLYTPLLPDVAGGVVDGRFVTIPLANAL
RGVQHVRGRVESVDFDGHTLCYTDPEDRSRRLTWDRLVLTPGSVTRLFDI
PGLATYARGLKSPAEALYLRDHVLEQFELAAIDDDRQRIAARRTVVIVGA
SYSGTELAAQLRALADAAADQMGFDAGAVRFLLLDMADQVMPEVGEKLGS
AAMQVLRERGIDVRLGTTLKEVHADHVILSDDSRVDTHTVAWVTGVTGAP
LIEGLGLATEKGRVKVDADLHVPGHPDVFAAGDAAAVPDLTKPGKITPPT
AQHATRQGKVLAHNVAASLGFGTKKRYKHKDMGLVVDLGPRYAVANPLNV
HLSGLPAKFVTRAYHLYAIPRFVNRWAVSLAYLTDAFFARSVVSMGLSTQ
EDAQFSTSEGIPMPKAN
392418938YP_006455543.1 putative cobalamin binding protein [Mycobacterium chubuense NBB4]MTDVRERLWDALIDGDEYAAATTVFGALDDGMTPEDVLLDVIARVQHKVG
TEWAANRITVAQEHAATAINDRVIAALAHHPASRRTPSAGRVTVACVDGE
WHALPARLLGEVLRLRGWHVDFLGAQVPTPHLIAHVHQHGPDAVALSCMI
PTRLPTAHAAITACQAAGVPVLAGGAAFGRDGRFAHRLGADAWAPDARAA
AQRLEEGFRPIHVAPTHLPIDDLPHLIDQEYTMVSGTTAQLVKTTVADLE
ERFPAMRSYSELQRQHTTEDIAHIVEFLAAGLYTDDDDLFTDFITWTAEI
LAARGVPATSLHPALESLAAQLQDFPRAQRLLLAARTALSRLTPQSAPA
392418936YP_006455541.1 putative nucleoside-diphosphate sugar epimerase [Mycobacterium chubMRIVVIGGTGRVGSKVVDQLTAHGHEAVAAAPSTGVNTVTGEGLDDALAG
AAVVVDVTNSPSFEDAASAEFFDRSTTNLLAAEARAGVGHHVALSVVGTE
RLAQESGYFRAKLAQERLISEGPVPHTIVRATQFFEFLQTIADSATVEGT
VRLPGALIQPMVSSDVAEGVAIAAVNPPVLGIAEIGGPVAYRLPDLIRTA
LTARGDTREVISDPGALYWGVAIEERTLVPGEGATLFDTRFEDWLLESAA
MG
392418934YP_006455539.1 transcriptional regulator- luxR family [Mycobacterium chubuense NBBMSGRGHGQSLRGRDGECAELREFVAAVRAGDARALVLRGEAGVGKTALLD
FAAQLATGMRCIQLAGVESDMELAYAGLQQLCAPLLSGLDDLPQPQRDAL
SVAFGRAEGPAPDRFLVGLAVLSLLAAASGDQPLLCVVDDAQWLDQVSVQ
TLGFVARRLVAEPVGMLFAVRDTGVEVLPGVAERTVGPLSDNDARALFES
VMLGGVDPQVRDRVVAETRGNPLALLDVPRNFTATELAGGFWNVGAQTVP
ARIEESYARRIASLPEPTRRLLLLAAAEPLGDSALFLRGAARMGIAVGAL
APAEAAGVVEFGPRMRFHHPLMRSAAYRAAEPADRRAVHGVLAEVTDRTV
DPDRAAWHAASAAAGPDDDVAAELEASAARAQSKGGLAAAAAFLERAALL
TADPVVRGARALAAAQAKRDAAATDAAYELLTVAEVAPASELHHARVARL
RAQMAFVRSRAGELGAPAVGDVTADLLAAARRLEGHDDFASREAYLEAIA
ATIYAGRLGAPDALARAAEAARSALERTPELPRAVDLLLKGVVDRITGGP
GAGRESLRAALSAMCALARSDERQVMRWFVPAFPILQESTAHELWDETIT
QELSAAVVREARRTGALAGLPRALVYRAGFHVLCGEFGTATTLLHEAAAI
TAATGHERPVRYHSVVLAAWLGDAADTRARIEAARADGTARGEGRLLGLT
AYATAVLSNGTGRYEQAFAAAGEGCEFEDFGFYSWCLHEYAEAAAHLGDQ
DAVTWAVGRLEERAGASDTDWGLGALASARAFLSGEPDAEARFTEAIERL
GRTRAVVHLARTHLSYGEWLRRANRRVDARRHLGTAHDMFTQMGAQAFAE
RARRELVAAGNKVSKQPTGAGSALTAQEAQIASLAAEGLTNQEIGAQLFI
SAHTVEWHLRKVFTKLAITSRRQLRTATWVS
392418932YP_006455537.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTMELRGQTALVTGGTAGIGLACARLLAENGADVVITGRNTARGTAAAAS
IDRGVRFVPADLASLDSVDDLVRRTGAVDIVVNNAARFPAARTVEQQPDS
FEKTFDTNVRGAYFLVAGLIEGMLQRRRGCIVNVTTMVTSKGVPGAGVYS
ASKAALESLTRTWAAEFGPHGIRVNSVAPGPTRTAGVEAEWGETNEALGR
SLPLGRTATPDEIAYAVAFLASPRASFITGSVLHADGGGSAV
392418930YP_006455535.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMAETLTSQTPYDGVTVLRLNRPERLNAINETMLGELRDACAGLRADPSVR
AVVLTGAGRGFCSGIDMRDFGPGMLAADDPAIDRLRFQEAMAALPLAIEN
LPQPVIAAVNGPCVGGGLALCLAADIRIASSAATFGNAAILLGLSGAEMG
MSYHLPRIVGTSVAADWMLTGRTVDAQEADRRGLVSRLVAPEQLLDTAIE
TARAIAQLAPLGVQMTKRALQTNTDAASLPAAMELENRNQVLTHATDEAA
GRRRNWEG
392418928YP_006455533.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTEQARPVRTRRGRPTQAESAALRHQVREAAVATFLEKGYDATTMEAIAE
AAGITKRTLYARYPDKRSVFLDAIPWAFTRAVENDTIPEIDGGDLRSALM
AIGRGALRRALDPDMVRLHRIARGEAHRFPEFASSAQSFEWASRQRQVMD
LLARHVDAGTAVVDDVELVAEHFLAMVEGFPARLADFGIYRSRKDERRHL
TYAVDLFLRGVLPR
392418926YP_006455531.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMTTSCEGKVALVTGTSRGLGKAIAQRLAASGATVALTARTAEPDPRYTGS
LHETLAEITGQGGSAVAVAADLSRPDERERMFAEVVEQVGAPDILVNNAA
VTFLRPLDTFPDKRVRLMFEMHLMAPLHLAQLAVPAMRERGRGWILNVTS
VAADLPDGPPFSDFDTSAGFGIYGAAKAALNRLTKSLAAELFADGIAVNA
AAPSRPVATPGAGTLDLAKTDTEDIELITHTAFTLCTGDPTTMTGRIAHT
QPFLREIGWPS
392418924YP_006455529.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MTQTTRPGHWVEPDSGIGLGLEDIGPGTYNMNIATDRYTSRDYAARERER
IWMRAWQIAGRVDELPKVGDWKQYKILDQSFVIVRGKDEKLRGFVNACRH
RGNILCNARTGNAKRGFLCQYHLWSYNLEGTLRGVLREELAGQVDKTQNS
LLEVSVDTFGGFIFLNPDPDAQPLSEYLGPEVVDLLAPYQLDRMVTVMDV
REAVDCNWKVVMDAFEEGYHINGIHPQLLTVLAIDPATSRYQFFDRHSVA
VAPFEVKGASTEKQIEGILNLPDTFPSTVAVIPRFQELVAQYHREDGSVE
FPDGITARKLLQHATRDTLTGMGLDVSGLTDDQMSDNQGWVLFPNYFMTV
RAGECHVIMAVPHPDGDPNRCIWHVSSYMYLPAEHADAFRVGLTEVDEPG
SYKYFEALQQDYEQMPRQQLGLRNNRLDHMSLVREEVVIAHYHSVVDRYL
AGEL
392418922YP_006455527.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPERWTRQRRLEHTRNLLLDAAEETFARKGLTGAALEDIADAAGYTRGAI
YSHFGAKEELFLAVIDRQRQRFLEIFSEVIQSLRRITDLDVDELARRWRD
AGSDPLRAALNYELTLYLLRNPQARERLAAQRLETVASLGEFIGKEVARL
GAVLTMPAESLARVILAVNDGVTLASHLDGVDLYRPYLQLVVSSIVPAD
392418920YP_006455525.1 phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthasMSGGDRPLLTPGHTCWRVEEAARFAYIVDAADYFAHVKAAMLRAQRRIIL
IGWDFDTRMTFERGGKKLAGPNQFGAFLRWLVRRRERLEICVLKANLGLV
PGLQTLWRGVIPVALVNRLSSERLEFAVDGAHPTGAVHHQKIVVVDDGVA
FCGGIDLTVDRWDTSEHPDDGRLRRTAGRTYGPRHEVATAVDGAAARALA
ELARNRWRTATGQFLAPVEPGPNLWPGSLTPALRDVAVGIARTQPALPPG
SEAREVEALNLAAIAAARQTIYLENQYLASRPIAEALAARLQEPDGPEIV
VILPRSSESPLERTSMDTARHALLGLLWAADEYDRLGVFWPVTDEGTPIY
VHSKVMVIDDRLLRIGSSNLNNRSMGFDSECDVAIEAVGDARGAADVRAT
IICLRNALVAEHLGVSASDLDEALSRCGSVLGAVRALHRDGRTLRLFTRE
TIAGEAGPLAENILMDPDRVPRSLASGVQRFLAGFRTNRPPSGYGPVMTA
NDSGPQQDSSGTGEQQPEVPPANPAYSTPPPEGLPDADDE
392418918YP_006455523.1 hypothetical protein Mycch_5158 [Mycobacterium chubuense NBB4]MKPRRVLLLANACAAVAGLVVFAPPPSASADVCGSVGGRFVSVSGCGNVA
DAIAPWVPPPAAYAPLPEDYAAPPPPPPPPPNISVCGSVGRRVTVSGCV
392418916YP_006455521.1 hypothetical protein Mycch_5156 [Mycobacterium chubuense NBB4]MTSTTRFLLAVLAAPAVALGVAATAAAEPPPPPPPNCTAADLAGVMTGVT
AATSAYLFTHPEVNDFFTGLKGKSRDEMRTAVEDYIGAHPDVGDALRSIR
QPSVDFRNRCG
392418914YP_006455519.1 hypothetical protein Mycch_5154 [Mycobacterium chubuense NBB4]MMERGSSKHGPREDEALKDQLRGTLQGNRSSRAEEWRDPEPPADDDPDVP
TAGPTNR
392418912YP_006455517.1 metal-dependent hydrolase- beta-lactamase superfamily III [MycobactMRMKDVAAGRVQPVASGSAGLHRRGCQAYNSAVARPVLLDAPVIRTVRVG
ACGAMFRRYPPRSRSNNRNVGEVSVRELVVLGTASQVPTRRRNHNGYLLR
WDAEGLLFDPGEGTQRQLLLAGVPASAVTRLCLTHFHGDHCLGVPGILQR
LSLDGVRRPVEAYYPASGAEFFARLRHASVFHDVTDVRENPVAGDGCVAS
GVFGELQARRLDHPVEAFGYRLAEPDGRQFVRERLDHFGVHGPAVGELQR
TGSVGVGDRTVRVDDVTRPRRGQRFAFIMDTRLCDAVYALADGADLAVIE
ATFLDEDRALARDYGHLTAGQAARVAQECGVRRLVLTHFSQRYPDGSRHR
DEAAAAFAGDLVVAEDLQRVRVPRRC
392418910YP_006455515.1 hypothetical protein Mycch_5150 [Mycobacterium chubuense NBB4]MAESSRRTTQRDAVRRVREAHAFAVDLPVIGRVPLPRPEQLAFYGALGVL
AAVEIIEWPVALVLATGHLLVQDEHNRVVEEIGEALSEA
392418908YP_006455513.1 hypothetical protein Mycch_5148 [Mycobacterium chubuense NBB4]MNPMKSAFRGVARVADATAAAAGAVGGAAINGVVGGLQGAANGARSGLTS
GSHSSAAAALTLGVIGAAGLVEWPVLVTVGGTVLVLHQLSQRSGHDDHAV
VVSSNGSGAAPRKSAPRPRATARKPAKTARKSAAPRRTTSQ
392418906YP_006455511.1 hypothetical protein Mycch_5146 [Mycobacterium chubuense NBB4]MSNVSPNDPVSDIAPGDIVVIDRGAGDRPYKVVHKEPSDAGFLITFSEDD
TETFQLDLPADKRVARSLESKWESEQSPTPHTEAGPHDS
392418904YP_006455509.1 Cutinase [Mycobacterium chubuense NBB4]MRIRRTVRAGAAAVAVSAAVGGMAVAGALGAPPRASAQPCPDVEVVFARG
TSEPPGVGATGQAFVDAVRAQAAPRSVGVYAVNYPASNDFGGGAAFARTV
VDGIRDEANHVEAMAANCPDTKLVLGGYSQGAAVSGFVTSGSVPNGYAAL
DVPPPLPAQATDHVAAVVLFGTPSGPLLSKYGAPAITIGPRFADKTLQLC
VPGDGVCSGGADGGPNLAHALYAVDGLTNQGAAYAVGRL
392418902YP_006455507.1 HemK-related putative methylase [Mycobacterium chubuense NBB4]MTTAYTDFGAPVRPVDVYPPQEDSHLLISAMTEAGLVPGARVADLCTGSG
VVAVAAAAAGAAEVTAFDICPKAVNHARESALAAGVEVSVHRGSWARAIE
FAPFDLVVANPPYVPQAPVDDTGSIPIGAGPAQAWNAGADGRLVLDPLCA
AAPLLLDEGGTMLVVHSECSDVKRTLSALRANGMRAEVIAQQLIPFGPVM
SARARWLMQAGLLAPGSRVERLIVVRADAP
392418900YP_006455505.1 hypothetical protein Mycch_5140 [Mycobacterium chubuense NBB4]MPTLVQPALPEPRGPISLSVVELLAERAQLRYVTRVETSLGDADPAGLDL
QLALYLCYELHYRGFADVDAGWEWNPGLLYLRGRLEDLFLQDVRREVGEI
EPDASALDELDKLCIEPVDGAGPSYFLRDEGTWEQMREYFAHRSLYHLKE
GDPHAWAIPRLTGQAKASFVAVEFDEFGGGKGARLHQQLFADLMAAAGLD
TTYLGYLADATAESLAVVNLMSMFGLHRRLRGSAVGHFAATEVTSPPGSR
RMVQALERLGAPEECCAFYREHIVADAVHEQVVRTDVVGDLVAREPDLDR
DVVFGIRAFDAVENRLADHLMACWRAGVPSLRRALN
392418898YP_006455503.1 3-oxoacyl-(acyl-carrier-protein) synthase [Mycobacterium chubuense MATSGAVQRPAVVVTAVASTTALATDAEGTWSALRAGESGIESLGDYLGD
RFDLPAHIGGRVKEDFDAQLSRVEIRRLSYMQKMALVLSRRLWDAAGAPE
VDTRRLLVSVSHAFGSTLDLWTGYEEFKARGLRAISPLAVQMHMPNAPAA
AVGLERKAKAGVIAPTTADASGASAIAEAWRLIALGEADVAICGGVESRI
EPLPIVAFNNMGLLSTNDADPEGACRPFDRDRDGMVFGEGGALLLVESEE
HATARGATILARLMGVATNADAHDLIEPDPSGEMAASAITRALDLAGLTP
PDVDHINAHAAGTIIGDAAEACAIRKAFGTHQPAVTAPKAALGHTMGASG
AVEAVVTVQTVRDGVVPPTLNLRHLDPEIDLDVVTGEARRGDYRYAVSNT
MGFGGHNVALVIGKY
392418896YP_006455501.1 hypothetical protein Mycch_5136 [Mycobacterium chubuense NBB4]MTTTHAGRHRLPGRVAPTGRGLVTVSMFAAAAAAGWALAVSGGAPHTASV
QPHSAAASAPAPAVQQIQRQGQVVAVSRDSLTTASADGQVMTFRITSDTT
QITGPGTVATPYAATSFAPRQNVVVVGVVRDGTPVATAIADQHVTAGRGA
PMDYGLPT
392418894YP_006455499.1 pentulose/hexulose kinase [Mycobacterium chubuense NBB4]MTSPLVIAVDCSTTAAKAIVVDADGKVVGTGTRALETRSPAPHWFEQDGS
QWWTATDTAIRNALNEIPDPRAVAAVCVTHQRESFVCLDEGGTPIRPAIL
WMDGRAASEVRTYGTERVELLSGKPADITPGLYKLLWLRDREPDTMARCR
RIADVHSYLVHAMTGRWISSTASVDPLALIDQTTGDYSDELLELAGLQRR
QLPDLVPSGASLGPLRPEIADDWRVSRDVVVIAGTGDGQAAGIGLNVTDP
GAAYLVLGTAVVIGSETLSYVPARAYRSMISAMPGQSTVETFSSSGTYLS
TWFRQEFGDPELAGAPDPRLEREAAALPAGAEKLITLPYWNAAQTPHWDG
QASGVTLGWQGCHTRAHFYRSLLEGIALELRLQLDGLEGARGGRVEVIRA
MGGGARSPLWTQILADVFDRPLEVCASGEVSALGAAAIALTAIGAHDTLP
AAASAVNRTDTVVTPHPDAAATYRQMRSVYERVYAQTRDLLHTLHDLPLN
DEKRGER
392418892YP_006455497.1 ribulose-5-phosphate 4-epimerase-like epimerase or aldolase [MycobaMRLHTERQQVVDACRFLSRSGLVVGTAGNVSIRVDDVVVISPSGVDYEAM
SAADVGIHDLDGNVVDAALAPSSELALHLAVYRSSEHSAVVHTHAPASTA
LSTVVDEVPASHYYTALFGGGIRVAPYATFGTQQLADNVTAALRDRSAAL
MGNHGAVLAGTALPKVLNLVPYLEYVCDVQLRAMASGAPVRVLDDEEIAA
VGRLLAGYGQQATGGR
392418890YP_006455495.1 monosaccharide ABC transporter substrate-binding protein- CUT2 famiMRLMTKIAAMASVGVVGVALTACGAGDTSANKDTKRIGVSVYDMSSFITA
GKEGMEAYAKDNNIELVWNSANLDVSTQANQVDSMVNQGVDAIIVVPIQA
DSLGPQVATAKSKGIPLVAVNAALNNPDVAASVQPDDVAAGEQEMQMMAD
RLGGKGNIVILQGPLGQSGELDRTKGINNVLAKYPDIKVLAKDTANWKRD
EAVNKMKNWISGFGPQINAVVSENDDMGLGALQALKESGRNDVPIVGIDG
IEDGLNAVKSGEFIGTSLQNGTVELSAGLAVANALAKKEQVNTKPVYVMP
AITKDNVDVAIQHVVTERKKFLDGLSQLTAQNLKTGDIAYEGIPGQKQP
392418888YP_006455493.1 monosaccharide ABC transporter ATP-binding protein- CUT2 family [MyMTAPKEKLLRCSDIHKSFGGVPVLEGISLELEPGTVTALAGENGAGKSTL
MKIISGQYSADRGTVAVGGTALTHGSTRDAVRHGVAIVPQELASIEDMTV
YENLFVGRELTFGPFLNRRAMIDEARDALAVFGVDINPSAKMSSLPVGLR
QIVEIVKAARTGARVVMLDEPTSAISEREVEGLYKVVRQLREHGVAMVYT
THKMAEIRAIADRVVVLRDGGLILDKPIADVSDDDIVTAMIGRELDALFP
DRPTPGTEPVLTVRNLQVEGASGPVSFTVNAGEIVGLAGLVGAGRTELLE
AIFGARTTTSGDVTVRGKVVKRNNPAAAISAGMAMVPEDRKLSGVVLSMS
VLDNGSLPRLSSFSIAGWLRGKARNKAVSDVMSSVRLKTRGLSQEVGTLS
GGNQQKVVLARWLTGDVNVLLLDEPTRGVDVGARSEIYRIVTEFAAGGMA
VLMASSDMPEIVGLSHRAFVMRGGTFVGELDRDALDHPEVQESVFRLATA
LDEKPTTKQQEAS
392418886YP_006455491.1 hypothetical protein Mycch_5126 [Mycobacterium chubuense NBB4]MRIEDVAPLLITAGAESMVVGRALLTPEQARPLERSAL
392418884YP_006455489.1 putative sugar phosphate isomerase involved in capsule formation [MMQRQDVELATLAGSVLSRESAAVAALAGTAEAGIVEVAHRVLAIPGKVVT
TGSGTSGIMAERLAHLLSVCGTPAVYLPAMDALHGAMGAITASDLVIAIS
KTGRSSEMTDLVHRLVARGVDVVAVTECPGSPFAAAATTVTALPATAREA
DPGDMIALASTLAVGAWGDALAVVAMALRGHTLHDVVDSHPAGGVGHRGH
RPGDESAPVVRV
392418882YP_006455487.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTEPTVDLDFPLNGKTAMVTGGGSGIGAAIVSAFAVKGARVAVVDLNGDA
ATGTAAAVGNDSRGFACDVADPASVTATVDDVLAAFGGIDILVNSAGIVM
LAPAEDLSLEAWDKTVDVNLKGTFLVCQVVGRHMLAAGHGAIVNMASQAA
TVALDQHVAYCASKFGVVGVSKVLAAEWGGRGVRVNTISPTVVLTELGHK
AWDGPRGEALKQLIPVGRFAYPNEIAAAAVFLASDAAAMITGADLLIDGG
YTIK
392418880YP_006455485.1 small-conductance mechanosensitive channel [Mycobacterium chubuenseMDHAIEISYATQVATTAAWVAGTVTAAYAVGWAASWSLQRLGRRSGLLHD
IAHLTRMPLRATLVVIAATAAVQHTTDTRSGWRGWVDHALVIALIGTFTW
LVASLVFVAERQAITRFAGGDTGLTDADRHRRKIRTQVTTLRRIVVAIVV
VLGAAAALMTFPAFSDIGKTLFASAGVLTVVAGLAAQTSLGAAFAGIQIA
FSDAIRVGDIVVLEEEWGRIEEITLTYVVVHLWDERRLVLPCTYFTTTPF
QNWTRNATELLGTVELDVDFTVPFDAMRAELDRLLRTNEKWDARVGVLQV
TDAVEGLVRVRMLVSASNAGQLFDLRCDVREGMVAWLQRTNPGALPRRRI
EHQTEGERELESAIAYIGRPQADSGLFSGSADAERRSRTFDSADA
392418878YP_006455483.1 hypothetical protein Mycch_5118 [Mycobacterium chubuense NBB4]MADRNVLGGPLDPCGTEPLTGFYRDGCCSTGPQDLGRHTICGVVTAEFLA
HQRSIGNDLSTPMPAYRFPGLVPGDRWCVTALNWLRAHEDGHACPVVLAS
THEATLESVPLEVLRQYAVDVPDDLTDL
392418876YP_006455481.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTLLDGRAVIVTGAARGVGKGIASALTERGASVLLVDRDEALLTETADAL
RAAGRTAVPLPADLRDEDAAGRIVGAAIDAFGSLHGLVNNAIATNEPKRF
CEITREDYDLVFDVGPRATFELMQAVYPVFCDNGGGSIVNLGSGSGTLGK
AKFGAYAGAKEAIRGISKVAALEWGRHNIRVNVVCPFAESDGIRLWREMA
PEAYERAARAVPLGRLGDVATDIGPVVAFLLSDDAAFVTAQTIMVDGGTA
GFR
392418874YP_006455479.1 hypothetical protein Mycch_5114 [Mycobacterium chubuense NBB4]MFFAGAAATAIATAPLTLAQPAPPPCFNADGTPCATAGTAGPGGAAGAIP
GGPAGTAGPGGASGSTNPGGVSGAAGPGGATGAIPGGPAGTAGPGGASGS
TNPGGVGGSAGPGGVSGCIPNVGCASIPVP
392418872YP_006455477.1 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [MycobacMTLTDDTATLPNGLTVDAARAEAARAYELDRTHVFHSWSAQAEISPMTIT
ASEGCYIWDGDGNRLLDFSSMLVNTNIGHQHPKVVAAIADQAAKLCTVAP
QHANAARSEAARLIAERTPGQLNKIFFTNGGADAVEHAVRMARLHTGRYK
VLSRYRSYHGGTETAINLTGDPRRWPNDHGNAGIVHFFGPFLYRSQFHAT
TEAEETERALAHLHDLIRMEGPSTIAAIILESIPGTAGIMVPPPGYLAGV
RALCDEYGIVYIADEVMAGFGRSGKWFAIDHFGVTPDLLTFAKGVNSGYV
PLGGVAISPQIYETFAHRAYPGGLTYSGHPLATAAAVATITAMAQEGIVE
NAARIGSEVLGPALQELASRHRCVGEVRGTGVFWAVELVADQATREPLAP
YGSSSAAMNSVIADCKKAGMLPFANYNRIHMVPPCIVTEEQVREGVAILD
KALEAADAALA
392418870YP_006455475.1 hypothetical protein Mycch_5110 [Mycobacterium chubuense NBB4]MNIALESRFAAELPELAVRWKAEDAPDPRLLVLNEPLARDLGLDPSWLSS
PEGLALLVGTAVPADATPVAQGYAGHQFGNLVPRLGDGRALLLGELLDVS
GGVRDLHLKGSGRTPFARGGDGLAAVGPMLREYVISEAMHALHIPTTRAL
AVVSTGRPVRRETVLPGAVLARVAASHVRVGSFQYAAMIAQAPGGDPDLL
RRLADHAIARHHPAAAEADHRYLALFNAVIAAQADLVARWMLVGFIHGVM
NTDNMTISGETIDYGPCAFMEAFDPATVYSSIDSWGRYAYGNQPAIALWN
LARFAEALLPLFDEDTEKAVALAEASLGAFQGRYESAWSQGMRAKLGVPD
APAEVVDPLVGELLEQMKQSRVDHTSFYRRLGQAARGDAGPVRGEFVDLA
AFDAWAGRWRALRPRADVMERVNPVYIPRNHLVEEALTAATDGDLGPVER
LLEAVRSPFTERPGFERYAEPGAQEFAASFRTFCGT
392418868YP_006455473.1 hypothetical protein Mycch_5108 [Mycobacterium chubuense NBB4]MAGECRVDQQVSIGRRELVPTMWSNVVSLNTIALELVPPNAERGREQALE
DAEKVLRCSAEAGVAGRVRHVMIPGMIEEDSDRPIEMKPKLDVLDFWTII
KPELPGIKGLCTQVTAFTDEAALRARLTRLRDSGFEGIAFVGVPRTLSDG
EGSGVAPTDALSLFDDVVENRGVILIPTREGEHGRFNFKCDRGATYGMTQ
LLYSDAIVGFLTDFAATTEHRPEILLSFGFVPKVENRVRLINWLIQDPGN
EAVAAEQEFVRKLSDTEPAGRRALMVDLYKRVVDGVGSLGFPMSVHFEAA
YGINTAAFETFAEMLEYWAPDKP
392418866YP_006455471.1 ATP-dependent helicase HrpA [Mycobacterium chubuense NBB4]MSESGADVRALRARLDGLTIRDAARLGRRLRQLRSPSPGQLEKLAQQFAA
AEALVAARAAAVPAISYPDLPVSERRDDLAAAIAANQVVIVAGETGSGKT
TQLPKICLELGRGIRGTIGHTQPRRLAARTVAQRIADELNTPLGEAVGYT
VRFTDQASDRTLVKLMTDGILLAEIQRDRRLLRYDTLIIDEAHERSLNID
FLLGYLRELLPRRRDLKVIVTSATIEPERFAAHFGGAEHGWSGGAEHGWS
GGAEHGWSGGAEHGPAPIVEVSGRTYPVEIRYRPLEVVVPATDSDDPDDP
DHEVVRTEIRDPTDAIIDAVRELEAEPPGDVLVFLSGEREIRDTAEALRG
VVDTRTEVLPLYARLPTAEQQKVFSPHQGRRIVLSTNVAETSLTVPGIRY
VVDPGTARISRYSRRTKVQRLPIEPISQASAAQRAGRSGRTAPGVCIRLY
SEEDFAARPRYTDPEILRTNLAAVILQMAALGFGDIDNFGFLDPPDARSI
RDGIALLQELGAFDGEAALTDLGRRLARIPVDPRLGRMILQADTEGCVRE
VLVLAAALSIPDPRERPTDREEAARGKHARFADEHSDFTSFLNLWRYLGE
QRKERSGNSFRRMCREEFLHYLRIREWQDLVGQLRGICRELGVTEQDAPA
DAARVHAALTAGLLSHVGMRETDGRTYLGARNAKFVLAPGSVLSKRPPRW
VVVADLVETSRLYGRIAARIDPEGLERVAGHLVQRTYSEPHWDAERGAVM
AYERVTLYGLPLVARRRVGYAQVDPAVARELFIRHALVDGEWNPRHHFFR
DNARLREELTELEDRARRRDLLVGDDEIFAFYDARIPADVVSGRHFDGWW
RKQRHKTPDLLTLRREDLLRSEAGEEQPDAWRAGDLSLPLSYRYEPGAAD
DGVTVHVPVDVLARLGGDEFAWQVPALREELLTALIKSLPKDLRRNFVPA
PDTARALLATIDPGSGPLLDAVQRELRRRTGILVPIDAFDLAKVPAHLRV
TFAVEAADGAVVSRGKDLGELQNRLAAPARQAVADTVAGDLERSGLRDWP
GDLDEIPRVVERTAASGHAVRGYPALVDNRKAVDLRVFATTAERDAAMPA
GSRRLVRLAGPATTKAVERALDLRTRLVLGTNPDGSLAALLDDCADAAVQ
TLVPSPVWTRAEFAAARDRLSAGLAEATLGVVRRVEGVLAALHEVELALP
DAPAPGQAEAVADIRAQLARLLPSGFVAATGAAHLGDLTRYLRAIVRRLE
RLPQAPGADRERMARVASVQRAYDDLRAALSPARAAAPDVADIARMIEEL
RVSLWAQQLGTPRPVSEQRIHRALDKIHG
392418864YP_006455469.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMKAVSCAHGVLEVVDLPDPRPAEGQLVLEVLRCGICGSDLHAKDHADELT
EVMAEGGYSDFMRSDTPVVMGHEFCGVVAERGRKTGQELKEGTTVVSFPL
LRAAGGVHLTGLSPLAPGAYAERVLAEASMTFAVPNGLDPATASLTEPMA
VAYHAVQRSEIAAKDVAIVLGCGPVGLAVICHLKARGVRTIVASDFSPGR
RALATRCGADVVVDPAVESPYEAVPRKQAGLTELPKLYELGVGSMEKLRK
LPGWSHVYRLADRLGGTAPKRPVIFECVGVPGMIDGVIGAAPLASRIIVV
GVCMGDDKIRPAMAIGKEVDIRFVFGYTPLEFRDTLHMLADGKLDASALV
TGTVGLDGVAAAFGALGDPETHAKILIDPASAAVAP
392418862YP_006455467.1 putative membrane protein [Mycobacterium chubuense NBB4]MTAVGKARSLTVVAGAYVVAIGVAWAWLVWGPATGRLWLDTLVADILATL
VVFAFSRAFGNSSFYDAYWSVIPPLLLFYWWFDSGVTTLSTWLLAGLVTT
WAVRLTGNWVYAFPGLHHEDWRYPMFRDRAGRWEFAADLVAIHLIPTLQV
FLAMVPAYVAVTTTSTATWLTLVAFAVGMAAVALEFAADLQMHRFVKTKR
PGEVMDRGLWSWSRHPNYFGEFGFWFAVALFGLAAAPTWWWWLFLGAAAM
LAMFLGASIPMMETRSLERRPGYQAVIDRVSRFVPVRPKPQAEART
392418860YP_006455465.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium cMSVAASDRDGRIAVPDDLDAIASTGAEDHSGIDSAAVDRIWVAAQHWYAA
GMHPAIQVCLRRDGRVILDRAIGHAWGNGPSDPSDAEKVPVRTDTPFCVY
STAKAITTTVAHMLVERGHFSLDDRVCEYLPSYTSHGKDRTTIRHVMTHS
AGIPFATGPRPDLKRMDDSEYAREMLGRMKPVYPPGMLHMYHGVTWGPLM
REIISAATGRNIRDILNDEILAPLNFRWTNYGVAPQDVPLVAPSHVTGKP
LPAPIAKAFKTAVGGTPQQIIPFSNTPQFLTSVIPSSSTVSNANELSRFA
EILCRGGELDGVRVMSAETLRAATTQCRRLRPDIATGLMPMRWGTGYMLG
SKHFGPFGRDAAGAFGHTGLTDIAMWADPDRALSVAVVSSGKPGGHREAK
RYPQLLDRINAEIPRI
392418858YP_006455463.1 hypothetical protein Mycch_5098 [Mycobacterium chubuense NBB4]MNLSGNSMRRKLAGVGAACLFGGLAAATVAAPAAIAAPADQCSASAVAGT
VGSVTTAARQYLDTHPGANQAVTAAMSQPRPAAEANLRGYFTANPSEYYD
LRGILTPIGDTQRACNVSVLPGDLQSAYDTFMAG
392418856YP_006455461.1 putative membrane protein [Mycobacterium chubuense NBB4]MPGSPAQVPTCYRHPDRPTYVRCTRCNRFICPECMHDAAVGHQCADCIGA
AARTVPPARTALGGQRRRSAAPVVTYALIGLNVLMFVLQSLSPDVERALV
LWPPAVAGGDLYRLLTAAFLHYGFTHILFNMWALYVVGAPLEAALGRLRY
GALYLLSALGGSVLAYLLSPLNSATAGASGAVFGLFGALFVVGRKLNMDV
RGVVVIIVLNLAFTFIIPLVSSQNISWQGHIGGLVTGAVVAAAYAYAPRA
QRLLVQAGASAAVLVLFAVLIWWRTAELRSMFGLS
392418854YP_006455459.1 haloacid dehalogenase superfamily protein- subfamily IA- variant 3 MWVLGLPDRIRACLFDLDGVLTDTAGVHRRAWKKMFDEFLAGRDAGGFVP
FDAGADYEEYVDGKPRDDGIRSFLASRHIDADDDAVRDLGSRKNELFLQT
LHADGVTVFEGSRRYLKAAAEAGLRRAVVSSSANTREVLEITGLDTYIEA
RVDGVTLRDEQLRGKPAPDTFLRAAQMLDVPPSAAAVFEDALAGVAAGRA
GEFGLVVGVDRVGQAEALRDHGADVVVTDLGELLTP
392418852YP_006455457.1 K+ transporter [Mycobacterium chubuense NBB4]MTTIANDTSVQNHPLRPAIVVGALGVVFGDIGTSPIYTLATVFNPRDPHP
VPVAPQNVYGVVSLIFWSVMTIVTLTYVSLVMRADNHGEGGIMALITLVR
KWAAPKTRRTALALAALGVFGAALFFGDSMITPAISVLSAVEGLEVVDPG
FARFVVPVTAVIILALFAVQRRGTAAVGRFFGPVMIVWFAAIGACGIAGI
AHNPDILWALSPTHALSFIAGHFPIAFFALAAVVLAVTGAEALYADMGHF
GRKAITVGWLGLVLPALTLNYFGQGALVLRDESTVHAPFFLLTPEWARVP
MVLLATAATVIASQAVITGAFSVASQAAQLGYLPRLRIQHTSAATMGQIY
VPWINGMLMVAVLILVFAFRSSAALGYAYGMAVTGTITITTLLFLYLART
RAGAPLWLVLGGGGALLAVDLMFFAANLTKLVHGAWLPLLIAITAFTVMT
TWQRGREIVTAQRGQAEGPMLEFIDGLRTKEPPLVRLPGTAVFLNRGSET
APLSMRANVEHNHVLAEHVVILSLTTEPVPRIADSERVTVDDLGATDDGI
IHVVARYGYMERADVPNALRLLTPEQTEGRLDVDGATYFLSKLELCQGDA
PTMAPWRKRLFIATSYVAADAAAYFGLPLDRTVIIGSRLEV
392418850YP_006455455.1 sugar phosphate permease [Mycobacterium chubuense NBB4]MRSDLRAVVTGASIGNAVEWFDFAIYGFLATFIAAHFFPQGDETAALLNT
FAIFAAAFFMRPLGGFVFGPLGDRIGRQKVLAIVILLMSAATLGIGVLPT
YGTIGVAAPVLLLLLRCLQGFSAGGEYGGGAVYLAEFADDARRGLTVTFM
AWSGVLGFLIGSVTVTLLQALLPAAAMESFGWRIPFLIAGPLGLVGLYIR
LRLGDTPQFAELSDADQTAESPLREAVTTAWRQILSVVGLFIVFNIGYYV
VFTFLPTYFIKTLKFGKSEAFLSITLACLVALVLILPLAALSDRIGRRPL
LVGGAAAFAVLGYPLFLLLGSGSLPAAILAHCLLAAIESVYVSAAVTAGV
ELFATRLRFSGFSVGYNVCVALFGGTTPYVVTWLTATTGNAVAPAWYLVA
AAVVSLLTVLAMRETAGRSLALVP
392418848YP_006455453.1 hypothetical protein Mycch_5088 [Mycobacterium chubuense NBB4]MNLRRLLMIVGAVALLVGVIALLVPVSVSGPDGDIGCGNGIVSDLSQARD
ADSRNLANLPVINQIVPHRDFTAECQSALSSRRSWSIPVAVIGLVVLAGS
FFVGGRAGRASP
392418846YP_006455451.1 PPOX class probable F420-dependent enzyme- Rv0121 family [MycobacteMPHFETDAAVAAFRQAPVAMLATVRPDGSPHVVPVVFAVHESRVDVVYTA
VDAKPKSTQRLARLVNIEANPAVSLLCDHYDDDWTQLWWVRADGVAAVHY
SGLEMATGYTLLRRKYRQYERVALDGPVVTVAVNRWASWSGG
392418844YP_006455449.1 ABC-type uncharacterized transport system- permease component [MycoMRGARSRVSAALPLLPFLTVVAIFLIVPTVTVVVGSVYVDGVFSLDRIAA
LFTGTALSALRNSVLLSAATALLGAVFGAVLAWLIVSSPPASMVRRAVLS
LCSVLAQFGGVALAFAFLATVGLNGVLTLWVQQVTGWNLAGSGWLYGLAG
LTLVYTYFQIPLMVIVFVPALEGLRDQWREAAVSLGASTWGYWREVALPL
LTPAFLGSALLLFANAFAAYATAAALVSQGSPILPLLIRASLVSEVVLGQ
AGFAYALALEMIVVVAVVMVAYNLLVRRSSRWLS
392418842YP_006455447.1 ABC-type spermidine/putrescine transport system- ATPase component [MSAAGVAVELDDLTRVYGTTRALDGLTLHIQPGEMVALLGPSGCGKTTAL
RILAGLDEATSGTVKVGGVDVGGVPANKRDMGMVFQAYSLFPHLTVLDNV
AFGLKMRGKAKRERISRAAEMLELVGLGALGNRYAKELSGGQQQRVALAR
ALAIRPRVLLLDEPLSALDAKVRTQLREEIRRVQLDVGTTTLFVTHDQEE
ALAVADRVGVMSQGRLEQLATPADLYANPATPFVADFVGLNSKVPAEVAG
GRASLLGTSVAALPGSIDSGAGLAMVRPESVTVAADPSGSATVTSVSFLG
AISRVNVTLGDGSAVSAQMGSAAARAFAPGERVSVAIEPGGVLVVPG
392418840YP_006455445.1 putative heme iron utilization protein [Mycobacterium chubuense NBBMTTGGPPRDHGDPGDAPTVPPPLTEPVNTARPSAAEEARTIAASTNTGTL
ASLTADGDPWASFVTYGLLDGAPVLCVSNLAEHGRNLAGDPRASIAIVAP
ATESDPLANARVTLAGYVERPEGDEHAAARDAHLSAVAAARYYIDYSDFS
LWVLRVQRVRWVGGYGRMDSTSGAAYSDAEPDPVAPHAARAVAHLNADHA
ESLAAMARALGGYPDTTAATCTGADRYGLDLRLTTERGLAYTRIGYPTPI
NVIDELRSAAVELTRRARMR
392418838YP_006455443.1 uncharacterized protein- probably involved in trehalose biosynthesiMRLPFGEWIVHKRWYAGRTRELASAEPSAITPLTDDLDHVLLDVGYTDGT
SERYQVLIRWAGGRADEYGEGAAIGVEHGPDGDRTAYDALYDPEAARHLL
TLIDSSATVGGLRFGKEPGVTLPLDAAPRVSGAEQSNTSVIFGTDAVFKV
FRRITPGINPDIELNRVLARAGNAHVARLLGSYESAGDGPDSQPCALGMV
TAFAADSVEGWDMATASTRDLSPEGGADFAGESRRLGEAVASVHATLAET
LGTSDVPFPVDVLLERLHSAVQAAPQLTSHAPLIEERYRKLAEETITVQR
VHGDLHLGQVLRTPQGWLLIDFEGEPGQPLDERRAPDSPLRDVAGVLRSF
EYAAYQRLMGADQGHEHDRQLAARAREWVDRNCAAFCDGYASVAGVDPRD
SGNVLAAYELDKAVYEAAYEARFRPSWLPIPMMSVHRILG
392418836YP_006455441.1 ABC-type multidrug transport system- ATPase component [MycobacteriuMSPDIPPAIDCRRLTHRYGAVIAVDDLSLQVRAGETLGLLGPNGAGKTTV
VRVLTTLTPVQQGEVFLFGLDSRRHTMDIRHNIGYVPQQLSIEAALTGRQ
NVELFARLYDVPRAQRGRRVDEALSAMRLLDVAGTAAGTYSGGMVRRLEL
AQALVNRPSLLILDEPTVGLDPIARESVWTQVRRMQDEFGMTVLLTTHYM
EEADALCDRVALMHRGRLQAVGTPAELKRAITGAGDHQATLEDVFRHYAG
SELADAGGDLRATRASRRTARRVG
392418834YP_006455439.1 nicotinamidase-like amidase [Mycobacterium chubuense NBB4]MTDPSEMSGKALVIVDVQNDFCEGGSLAVTGGAAVARRINDWLSRTRYDH
VVATKDFHIDPGGHFSDHPDFVDSWPPHCVVGSPGAEFHPDLDTGPIEAV
FTKGRYTAAYSGFEGATDDGTPLADWLRAHGVDSVDVVGIATDYCVKATA
ADAAAAGLTTRVLLDLTAGVSPATTAQAVESLRAAGVRCD
392418832YP_006455437.1 hypothetical protein Mycch_5071 [Mycobacterium chubuense NBB4]MNATQRILALSVAATSAAFLLAGCGGSKNDDASPSGPAAGTPSALPDNQA
PPRQLVVNVAIKGGSVTPTNEQLEASVNEPIVLRVDSDTADQLHVHSTPE
HEFPVAAARGQSFQFTIDTPGRVDVELHNLNKTVATIQVQ
392418830YP_006455435.1 hypothetical protein Mycch_5069 [Mycobacterium chubuense NBB4]MTSSQDASVLAQGSEGGGAALSQVIGLSAVALVVMLVVLWIGYMHRERKI
TWLNSIAEWTGRRFTRPPWVALPITIFISAICCALFGFIWDVSLHIGKGR
DPGPLANPAHYFIVIGLFFVFVAGCTAIVLPYDKPGPAAVRITDNWYAPV
GGIVMAGCGLYALTGFPLDDVWHRIFGQDVTLWGPTHLMMIGGAGFSTLS
ALFLEHEGRKADHGGLEEGAAPQDGIGLKFVQYLGLAGVLVGLSVYQIEF
DFGVPQFRQVFQPMLIAAAASLALVAARMFMGRGAALIAAVIAIGLRGIV
AFLVAPVLDAPVNWFALYLGPAVIVELLALTPLFTRPVVFGLVSGLGIGT
VGLWLESLWVNAVYPYPWPASIWPEALAMAVPVAVFAGGCGAMVGMVLTG
QRLPRRAISVGLVVLTVLAIGGATANGLRYSVPASETATFALTEAAGPGP
GRFVTADVRFNPPTVISEDPNWVSVLAWQGGLTNERGQFVDHLRKVGPGH
YRSTKPMPVSGNWKTLMRVHDGTTMTAVPIYLAADPGIGVKEVPADAQFT
RPFVSEITILQRERSPDIPASLWLIGCIVVLVCTLAMIAGISWGAGRINN
HEPSGSETELQPSGQS
392418828YP_006455433.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTFNITPTAAQHDLARRAHEFAEDVVRPVAADYDQRQEFPWPVLEEAATR
GFYSPLFYRDLIGDPTGLSLPMFMEELFWGCAGIGLSVVMPALALSAIGQ
AASPEQMLQWAPECFGTPGDIKLAALAISEPEGGSDVRNLRTTARRDGDD
WIIDGHKMWIGNGGIANVHVVNAVVDQELGHKGQALFIVPGGTPGLDMVR
KLDKLGCRASHTAELKFTNVRVPGDHLLGGQEKLEHKLARAREAVAGAKN
SGSATLGTFEQTRPMVAAQALGIARAALEYVTEYANRRVAFGAPIIDNQG
IAFPLADLATGLDAARLLTWRASWMAATGVPFERGEGSMSKLAASELAVR
TTERAIQTMGGWGYIKDHPVEKWYRDAKLYTIFEGTSEIQRIVISNALGA
ADGKPPLHVDLEPTGGPFNRMFGRGTPLRTQVANSALEMKDRVPSPVMNM
AMKVLRPPKK
392418826YP_006455431.1 hypothetical protein Mycch_5065 [Mycobacterium chubuense NBB4]MSSKNDVMSALDTVDAALRAVSGLPFHGLSPADQRALLVRLDDLTKEVAA
LQRRLLARMVGGPAPREFAGAPWAEVLARRLRISVGEAQRRIADAQQEAP
MPKTA
392418824YP_006455429.1 glycosyltransferase [Mycobacterium chubuense NBB4]MRIALLSYRSKTHCGGQGVYVRHLSRGLVELGHDVELFSGQPYPEGLDPR
VRLTKVPSLDLYREPDPFRVPRPSEIKTSIDLEELLTTWTAGFPEPKTFS
MRVARLLAARRDDFDVVHDNQCLGTGLLTIAKSGMPVVATVHHPITRDRV
LDVAAAKWWRKPLVRRWYAFAEMQKTVARQIPELLTVSSTSAADIAEDFA
VDPDQLHVVPLGVDTQLFQPARQRVRNRIIAIASADVPLKGVSHLLHAVA
RLRVERDLELQLVAKLEPNGPTEKLIAELGISDIVHSSSGLSDSELADLL
ASAEVACIPSLYEGFSLPAVEAMASGTPIVASRAGALPEVVGEDGGCARL
VTPADVDELTAVLGELLDSPRELRRLGDNGRRRALEVFSWESVAAQTVAV
YERACERVAAC
392418822YP_006455427.1 hypothetical protein Mycch_5061 [Mycobacterium chubuense NBB4]MSDLPCVPGVFTAEDCRQTAESIAATQESTGAIPWSVGGHTDPWDHIENA
MALTAAGLLEPARAAFEWSRVTQRPDGTWPIQLRDGVVEDANSDTNFCAY
IATGVWHHVLVTGDRDFAVAMWPVVAKAIDFVLDLQSGTGEIAWARGPAG
DADEALLTGCSSIHHSLRCALALADYVGDAQPEWELAVGRLGHAIAHHPE
AFVLKDRWSMEWYYPVLGGALRGGRAQARIDERWDDFVVPGLGIRCVDDR
PWVTGAETCELVMALDAIGEQDRAHEQFAAMHHLREEDGSYWTGLVYADG
KRWPVERTTWTGAAVILAADALSVTTTGSGIFRGSDLPRGLEGEYDCECA
TSER
392418820YP_006455425.1 transcriptional regulator [Mycobacterium chubuense NBB4]MDRLGRAAVELLAREGFAGLTVRRVAARAGVGAATAYTYFSSKEHLVAEV
FWRRLASSPHTAHGSDDPPARVIEVMGHIWTLVADEPEFAGAVTTALLGK
DPDVEVLRQRIGRDIRERLSAALGPDTDPEVIDALEMLYSGALVRAGMGY
ASYEEITGKLERSARLILG
392418818YP_006455423.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTVVHGSTKRLDRLPPSPRVPRVLQGIGFSFSRKWTVDQVTRRCGNVFTL
TLPVFGRSVIVADPALAKQVFMANTDDVGNIQPNLSRVLGPGSVFALDGT
QHRLRRKLLTPPFHGKSIKNYERIFEEETLREAATWPEGQPLQTLEPMMR
ITLNVILRAVFGADGAHLDELRRIIPPWVTLGSRLAVLPMPSRTMGRFSP
WGRLAAYRRRYDDLVDRLIDAVRADPDFNSRDDVLALLLRSTYEDGSAMS
RQDIGDELLTLLGAGHETTAATLSWAFERISRHPEVLAELEAEALTDTNE
YRQAAILEVQRVRTIIDFAGRHVYAPSFELGDWVVPQGYSILVAIAQVHR
RSEEFPDPDRFDPQRFVGQRPTTFAHIPFGGGTRRCVGAAFANVEMDVVL
RTVLRHFVIEPTDAPGEKTHFRGVAHTPRDGGKVVLRRR
392418816YP_006455421.1 methionine-R-sulfoxide reductase [Mycobacterium chubuense NBB4]MTQQYNRNPAAVGALSPEQYHVTQENGTERPFTGEYWDSHEPGIYVDVVS
GEPLFASVDKFESGSGWPSFTKPLDPANVRKKRDFSHLMIRTEVRSAHGD
SHLGHVFTDGPRAEGGLRYCINSAALRFIHLDDLEAQGYGQYRGLFTKPR
EEHV
392418814YP_006455419.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMTALVIGANGYLGSHVTRQLVADGQDVRVMVREGANTIGIDDLAVTRFTG
DVFADEVLREAMTGCDVVYYCVVDARGWLRDPTPLFRTNVEGTRHVCDVA
VEPGIAGTLKKFVYTSSYVTVGRRRGRVATESDIIDDRGVTPYVRSRVQA
ENLVMDYVRARALPAVAMCVSTTYGAGDWGRTPHGAIIAGAAFGKLPFVM
SGIELEAVGIDDAARALLLAAENGRVGERYLISEKMISNADVVRIAAEAA
GVAPPGRTLPLAASYAMAALGSVKGRLTGTDERLSLGSLRLMRAEAPVNC
AKARSELGWRPRPVEQSIREAAEFWVGLRSAKRAGR
392418812YP_006455417.1 hypothetical protein Mycch_5051 [Mycobacterium chubuense NBB4]MCWLCDHPGATRQDFLAVLREKARTNGWAVQYVETTMPFAYTVGLSDWNL
PELLMTSVSPARAARVLGTLARAAMGGAALVPGEQMKVPGGPLAEFVEVD
HPDVHCGWAVTHADGPVRVLQAVWADGRGRWPWSAQFCDGRRRQPVLGVR
ARAA
392418810YP_006455415.1 hypothetical protein Mycch_5049 [Mycobacterium chubuense NBB4]MDMTDRPVLEPSATHPITVEPTGRHVTVRMGGDVIAETDAALTLREAGYP
AVQYIPLTDVAQDRLACSDTTTYCPFKGDASYYHVVTGGGATVEDAVWSY
EQPHRAVAAIAGHVAFYPDKAEVRVDD
392418808YP_006455413.1 DNA-binding ferritin-like protein (oxidative damage protectant) [MyMTAFTIPGLSDKQGAEVAELLQKALSRYNDLHLTLKHVHWNVVGPNFIGV
HEMIDPQVELVRGYADEVAERIAALGASPKGTPGAILNDRTWDDYSVGRD
TVQAHLAALDLVYTGVIEDTRKSIGRLEELDLVSQDMLIGHAGELEKFQW
FVRAHLENSGGQLANDGEDTEKGAAGKAKGGS
392418806YP_006455411.1 hypothetical protein Mycch_5045 [Mycobacterium chubuense NBB4]MLHPLNTPLGRFGIDTSEDGAQRCTASIPVHGLANPLTGLPSVAPLAMLV
DHLGGLVNHNRRGPGEWTVSSELSLELTPGAAAVIAASPDAPIVGQSRPL
GSKDRGALAWCELRANDVVIATATVRSFYISVPADLASWPDQSTGSLPGT
TLAALMAVEVGETGGAATVLMQTADPVLNNSVGMVHGGVSSMGLELVGSA
ALNAGAPDTPLKTASLRVNFVRPFHGGADAHYLAKPVHAGRSSGVAEARA
VGHDGRVALLARLTAYR
392418804YP_006455409.1 NADH/NADPH-dependent glutamate synthase small subunit [MycobacteriuMADPRGFLKYTHRETPQRRPVDLRLRDWKEVYEEFPHDHLQVQASRCMDC
GIPFCHNGCPLGNLIPEWNDLVRTGRWRDAIERLHATNNFPEFTGRLCPA
PCEGSCVLGINQDPVTIKQVEVEIIDNAFDEGWVVPLPPDRLTGKKVAVV
GSGPAGLAAAQQLTRAGHAVTVFERDDRIGGLLRYGIPEFKMEKRHIDRR
LEQMRAEGTEFRTGVNVGVDITAAQLRSEFDAVVLAGGATARRDLPIPGR
ELDGIHQAMEYLPWANRVQLGDPVVDADGQPPITAKGKKVIIIGGGDTGA
DCLGTAHRQGAAHVHQFEIMPRPPETRADSTPWPTYPLMYRVTSAHEEGG
DRVYSVNTEEFLGENGRVTHLRGYEVEMRAGKFEKIDGTDFEMDADLVLL
AMGFTGPEREGLLTDLGVEVNERGNVSRDSAFATSVPGVFVAGDMGRGQS
LIVWAIAEGRAAASAVDRHLMGSSALPAPIKPTAVPQR
392418802YP_006455407.1 putative F420-dependent oxidoreductase- Rv1855c family [MycobacteriMRFAFKTSPQNTTWSDMLAIWKAADDIDVFESGWTFDHFYPIFSDSTGPC
LEGWTTLTALAQATTRLRVGVLVTGIHYRHPAVLANMASALDVVSGGRLE
LGIGAGWNEEESGAYGIELGSIKERFDRFEEACQILRSLLSQETTTFDGK
FYQLKDARNEPKGPQQPHPPICIGGSGEKRTLRITAQYADHWNFVGGPPE
EFARKRDVLARHCADVGRDPKDIMLSAHVRLNPERDYDAVIEEASALGAE
GLDLAIIYLPPPYDPAVLEPLADTIRASGLLASKAR
392418800YP_006455405.1 sulfate permease-like transporter- MFS superfamily [Mycobacterium cMIARLLPSRRDYSALPRSWRRDILAGVTVGVVALPLALAFGVSSGVGAAA
GLVTAVVAGLVAAVFGGSSVQVSGPTGAMAVVLAPIVAAHGLGSIALVTV
LAGVIVLLAGVTGLGRAVTFIPWPVIEGFTLGIAAIIFLQQVPAAFSTTS
PPGDRTLPATWHVILHADWGAATKTLGVVAFVAAVMLLLPRIHRAIPESL
AAVVGATIAVMVLGIPVATIGALPSHLPAPVLPQADAGSLRDLLGAAVAI
AALAAIESLLSARVAATMAASGPYDPDRELVGQGLASVASGVFGGMPATG
AIARTAVNVRSGARTRLSAIVHSLVLLGVVYLATGPVSAIPLAALAGVLM
VTSFRMISRSTIRKILRSTRSDALTFVLTAAVTVCFDLIEAVQIGILVAA
FFALRSVASRSSVVREQLPGPRRPGDDEIALLRLDGAMFFGVAERISNAI
TDADHPRTSVVIIRMSQLGMLDATGANTLAQICTELESRGITVIIKGVRA
EHAALLANVGVFESLRHERHLMDSLEDAIEHARSHVTPTPTTPGSAR
392418798YP_006455403.1 PHP family phosphohydrolase- histidinol phosphatase [Mycobacterium MDPVTALRQIAYYKDRAREDPRRVMAYRNAADVVEALTDAQRDKHGAANS
WQSLPKVGPKTAKVIAQAWAGQEPDVLVELRESVQDLGGGDLRAALRGDL
HVHSNWSDGSAPIEEMMMAARDLGHEYCALTDHSPRLRVANGLSPDRLRR
QLDVIDELREKVAPLRILTGIEVDILEDGSLDQEPDLLERLDVVVASVHS
KLAMDAPAMTRRMLKAVANPHTDVLGHCTGRLVTGGRGMRPESKFDAEKV
FTACRDAGTAVEINSRPERRDPPTRLLNLAMEIGCVFSIDTDSHAPGQLD
FLGYGAQRALDAGLAAERIVNTWDADTLLAWTTS
392418796YP_006455401.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTTSHARPARARRAVRPSGDDRELAILTTLETLLEGRALADISVDDLAKG
AGISRPTFYFYFPSKDAVLLALVERVINEADHNADEAMGGMDTSVDPAGV
WKAINALFETFGTHRAVTLAGAAARPLNAEVRALWSRFMQKWIDHTTASI
ETERARGAAPTTIPAADLAASLNLMNERTMLAAFAGEQPAVTAGKLVDTL
AHIWVTSIYGTAP
392418794YP_006455399.1 RraA family protein [Mycobacterium chubuense NBB4]MTVTPRPTADLVDEIGPDVRSCDLQMRQYGGRAEFAGPITTVRCFEDNAL
LKSVLSEPGDGGVLVIDGDGSVHTALVGDLIAELGRSNGWSGLIVNGAVR
DSATLRTLDIGIKALGTNPRKSTKTGDGVRDAAVEFGGVVFVPGEIAYSD
DDGIVVVKPDQPDAG
392418792YP_006455397.1 putative copper export protein [Mycobacterium chubuense NBB4]MGGPAQVVTTRRAVAGALLVTAAACLAAWALAYPVGALSAALVRAVADGA
AVVTLGLVIVPALDGSRYRAELRRRATVPAVAASAVWVVSELVRVVFGTA
EAAGVGAGRVAVRTVWEFVVYTAPGRAGLITVAAAAGVCAVVSLAPRSDS
AGVAAAGLAGIGIVSHPLTGHLSDSGVGGIAIAVHMLAAALWCGVLAALV
LTVDHRGQWARVLPRFSALSLLCVAALLAGGVVAGLVIMDSPAQLYSNGW
GRVLSAKIALTVALTVLAWRNRTLWLPAAQGHRATAEVSRSRAYTELALM
ATALALAASLAVTS
392418790YP_006455395.1 hypothetical protein Mycch_5029 [Mycobacterium chubuense NBB4]MSANSARHAARWRGAAAGLLTGTLTLAAHGAGGGPLPAGPATAQLLLVAA
AVGALAARLPRTGRFGPILALLTAGQLIGHGLLSALGHAHATPSAGPAWL
MLSSHLAAVGTGALLIVVGDRLCRTLSRALHRTTRPDAPAVPAPRATPGR
TADQPLRSALLVASSMSHRGPPVSAAR
392418788YP_006455393.1 hypothetical protein Mycch_5027 [Mycobacterium chubuense NBB4]MPGTVKGGDDVGSRARIAAAACVMASGLLAGGAGTATAFADSGVTAGRGH
SGHGVSGRHGDRSADREGPRRGRVTEAERGEKGGERAHRPPRQQPRERAG
TPRARDDDIPGARLGNRRAEEVDGEGGKQPSPPCCEKGADGCGAPGPGPG
SGPSPVPGGPGIPEAPGAPGAPGIPETPGIPETPGAPGAPGIPESPGIPQ
APGAPGVPEAPPGLGGGAGGPPHAVPGGGGGVHLPVMTWPHRQAPAWVPP
VREPRGPDVLDTVPGVGPSTGAPVRVPIVVAVPPALGPGPGSAGAGVAGA
GGGVARMPAAPRPASAEPPPVREAPPASSTGNFAAPASPYRAGYREYLRS
AGTPQIAALALPGIAGMLILTGAGGYLGYRQARAGRAVRTPGVVRFMN
392418786YP_006455391.1 hypothetical protein Mycch_5025 [Mycobacterium chubuense NBB4]MIIWVIAGLLGLATGLRIGWALVNKQSLVSTAMILALGSLGVVAALNWQP
LTLLIDTLLHWPNVSMGLSQVALIACAAGSCVMITTVSSIRSPATAKRIA
IAQYGVAAAIAAASLVVFFAAGQQPEMAPEEYLRRNLGSQGVSLPWLLPL
LYVLLALSLVVWAGLRHSNRTRRGRALFVFTVGIVLILLALAFFLLRAVG
TSGLVGVGAAATLLGCAMLVVAAGSLLPSLEDWFGARGELRTIQPLLDEL
GRRHPDVGIGVRPRGPLVFRVAERMSLISDALFLEATAAAGVLHPVDPSG
AAAGSGELDDHDDAALTAEDDQAAPDVSPVEQAHAIARWIHADEDFPGLS
WLRQPTSYSDREWILEIARQYRRLTREAGADRRHAA
392418784YP_006455389.1 hypothetical protein Mycch_5023 [Mycobacterium chubuense NBB4]MNFGSGRAIEIAPFHSRGSLKGFVVSGRWPDSTKEWAQLLMVAVRVASLP
GLLSTTTIFGAREELPDEPEPGTVGLVLAEGTVVGESAVPPGHFAERQPP
ALLMLHPPSETTPTLPECSGAASGCVLLPGLPHLGLEHRAAWVEAESDGT
VTSMVSRVGVDPISHPDTAILAMLLAA
392418782YP_006455387.1 Peptidase S24-like protein [Mycobacterium chubuense NBB4]MVVEDSMRPALCPGDGLLAVRAGRPRTGQLRVFPDPTLPSRFLVKRVGAV
RSSAEGVVFEAVSDNAGAPGVVDSRRFGWVPAAESYRVVFRVRTVRSVRT
VRRR
392418780YP_006455385.1 Rhodanese-related sulfurtransferase [Mycobacterium chubuense NBB4]MNDTDVPQAAIADVPSTFGEAVVLLDVREDDEWQRGHAPGARHIPMGEVP
ARMAEIDPGAQLFVMCHAGGRSQRVAQYLVRNGFAPINVSGGMLAWAGAG
RPVVTDGGNPGTV
392418778YP_006455383.1 glycerophosphoryl diester phosphodiesterase [Mycobacterium chubuensMSSGEVSAGHPFVVAHRGASADRPEHTRAAYERALEEGADAVECDVRLTR
DGHLVCVHDRKLDRTSTGTGLVSEMTLDQLRAFDYGSWHPSWRPDGSHGD
TGLLTLDDLVAMVLDWHRPVKMFIETKHPVRYGALVENKVLALLHRYGVA
SPASADLSRAVVMSFSAAAVWRIRRAAPLLPTVLLGETSRYLGGGAATTV
GATAVGPSIATLREHPELVDRAAAQGRALYCWTVDHYEDVQYCRDLGVAW
IATNHPGRTKAWLQDGLTGADRD
392418776YP_006455381.1 hypothetical protein Mycch_5015 [Mycobacterium chubuense NBB4]MLPAVVPATDAAAEGAAATPEAASAAEAAAGEELGTGTGVAASAGSGASA
SGAAGSWGRAG
392418774YP_006455379.1 hypothetical protein Mycch_5013 [Mycobacterium chubuense NBB4]MTSPPPTAAPTTAERIRSACVRAGGAMIAAEGLEPTPTPVHHLLGDGSFA
ITVPADGAVASAVLSAGAAGVQAVLEMTDYAPLPLREPVRSLVWIQGRLR
GIPLCEVAALLDLIASSEPNPALLQVISNPRQPVDEGRQLLMCLEIESVV
VADATGAESVPLGALLDADPDPFCAMESCWLQHLESAHREVVERLAARLP
APLRRGRVRPLGLDRYGVCLRVEGDDGDHDVRLPFARPVSDVAGLSQAIR
VLMGCPFLNGMRARRA
392418772YP_006455377.1 fructose-2-6-bisphosphatase [Mycobacterium chubuense NBB4]MSGRLVLVRHGQSRGNVDRRLDTRPPGAELTELGREQARQFARALPLPPA
MVAHSIATRAVQTAQEIGAQVSLTTRVFEGLHEVQVGSLENRSDEAAHDE
FNATYRRWHSGELDVALPGGETGHQVLDRYVPVLDGLRRRYLDDEAWNGD
IVVVSHGAAIRLVSALLAGVDSAFAIDHHLANTESVVLTPVTEGRWSCVQ
WGALTPPFGPEPSVTTIPDARGADRSADPMG
392418770YP_006455375.1 hypothetical protein Mycch_5009 [Mycobacterium chubuense NBB4]MAVRMSPHRFEELVGDALDLLPPELASAIDNVVILVADRNADEPDLLGLY
EGIALTERDSWYAGSLPDTITIYREALLDVCGSEQEVVDEVAITVIHEVA
HHFGIDDDRLHELGWA
392418768YP_006455373.1 seryl-tRNA synthetase [Mycobacterium chubuense NBB4]MIDLKVLRENPDAVRASQQARGEDPGLVDALAQADAARRAAISNADNLRA
EQKAASKRVGKASPDERPALLASAKELAERVKAAEAAQDEAEKAYTTAHM
AISNVIIDGVPAGGEDDFVVLDTVGEPPAIDDPKDHLELGESLGLIDMAR
GAKVSGSRFYFLTGYGALLQLGLFQLAVRTATENGFTLMVPPVLVRPEIM
AGTGFLGAHADEVYRVEADDLYLVGTSEVPLAGFHADEIVDLSAGPLRYA
GWSSCFRREAGSYGKDTRGIIRVHQFDKVEGFVYCRPEEAEAEHERLLGW
QRQMLAHIEVPYRVIDIAAGDLGSSAARKFDCEAWVPTQNTYRELTSTSN
CTTFQARRLAVRYRDENGKPQTAATLNGTLATTRWLVAILENHQQPDGSV
RIPEALVPYVGAEVLTPKG
392418766YP_006455371.1 putative Zn-dependent hydrolase of beta-lactamase fold protein [MycMQVTSIGHAGFRIDTKAGAILCDPWVNPAYFASWFPFPDNSALDWTALGD
VDYLYVSHLHKDHFDPVNLREHVNKDAVVLLPDFPVPDLRRELEKLGFHR
FFETTDSVKHRVSGPKGDLDVMIIALRAPADGPIGDSGLVVDDGETVAFN
MNDARPVDLDVLHTDFGQIDVHMLQYSGAIWYPMVYDMPARAKEAFGTQK
RQRQMDRCRQYIAQVGATWVIPSAGPPCFLDAELRHLNDDHGDPANIFPD
QVVFLDQMKAHDHHGGLLMIPGSTADFAGSQLNSLNHPIPDEDVHAIFTT
GKADYIAAYAERMAPVLAAEKAAWAPAAGEPLLEPLRELFEPIMLASDQI
CDGIGYPVELRLRSGDHNETVVLDFPKRTVREPISEEKFRYGFAIAPELV
RTVLRDREPDWVNTIFLSTRFRAWRVGGYNEYLYTFFKCLTDERIAYADG
WFAEAHDDTASIELGGWEIQRRCPHLKADLSKFGVVEGTTLTCNLHGWQW
NLTNGRCLTTRGHELRSAKL
392418764YP_006455369.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium chubuMEPVYGTVIQLARLIWRIQGLTFTVTGVENLPRTGGAVIAINHTSYFDFT
FAGLPAYRQHLGRKVRFMAKKEVFDHKITGPIMRSLRHIEVDRDSGAASF
DQAVRKLEEGEFVGVYPEATISRSFEIKDFKSGAARMAIAAGVPIVPHIV
WGAQRIWTKGHPKKMWRPKVPIHIAVGTPIEPTLPAAELTALLHSRMQHL
LEHVQDAYGPYPPGEFWVPHRLGGGAPTLGEANRMDAEEAAAKAARRAAP
PDVDPGSLEAPG
392418762YP_006455367.1 HAD-superfamily hydrolase- subfamily IIB [Mycobacterium chubuense NMTPELIATDVDGTLLDDDEDVSPRTRAAIRAAVDAGTQFVLATGRPPRWI
TPVVEQLGFAPMAVCANGAVIYDPAADRIVSARTLSSDVLGELAEIAARV
IPGAGLAVERVGRSAHDAATPQFVSSPGYEHAWLNPDNTEVSVEDLLGAP
AVKLLIRKAGARSADMAAALARHIGIEGDITYSTNNGLIEIVPLGISKAT
GIEELARPLDIDAANIVTFGDMPNDVPMLDWAGLGVAMGNAHPDALAAAD
EVTATNAEDGVARVLERWWRD
392418760YP_006455365.1 GLTT repeat protein [Mycobacterium chubuense NBB4]MPNRRRRRLSTALSTVAALAVASPVAVLAVSELSGPAPQGPQHREFKQAA
TITDLPGELMSALSQGLSQFGINLPPLPTGLLGGTGATSPATVTPGLGTG
LGSGLGTGLGAPTLTDPGLANPALTNPGLTSPTGAAPSAAPGLTTPALTD
PALASPGLTTPGLSTPSLTTPGLTTPAANSTLTAPGLSTPPALTDPALGA
ASILPAGLGAGEVPISAPVGGDPALGVGYPILGDPSLAATQPVAAAPSGG
LLGDLSSAANQLGAGEAIDLLKGVLMPAIMSAVKPPVVPPPAAAAAPALG
AAEAAAPAAQAAVGAAEAGA
392418758YP_006455363.1 putative glycosyltransferase [Mycobacterium chubuense NBB4]MSDIPSGALDAGQSRAVSPLARVILPRPGEPLDVRKLYIEESETNARRAH
APTRTTLEIGAESEVSFATYFNAFPASYWRRWSILESVVLRVELSGSARV
DVYRSKATGARITVGGSGVTSTDAEPGVVEFEIDLSPFEDGGWIWFDITT
DAKSTLHHAGWYAPVEAPGRANVAVGIPTFNRPSDCVNALAALTSDPSVD
EVISAVIVSDQGTSKAKDHPGFAAAAAALGNRLSVHNQPNLGGSGGYSRV
MYEALKNTDCEQILFMDDDIRIEPDSILRALALNRFAKVPTLVGGQMLNL
QEPSHLHVMGEMVDSENFMWTGAVNTEYDHNFAKYPLNDEEEYRSRLLHR
RIDVDYNGWWMCMIPRQVAEELGQPLPLFIKWDDADYGLRAGEHGYPTVT
LPGAAIWHMAWSDKDDAIDWQAYFHLRNRLVVAALHWDGNVRGLLASHLK
ATLKHLLCLEYSTVAIQNKAMDDFLAGPEHIFSILESALPDVRKMRQEYP
DAVVLPSATALPPPSDKRWRRKVEIPTNPLSISMRLSRGVVHQLKPHDPR
HHERPQVNVATQDARWFSLCRVDGVTVTTADGRGVVYRQRDREKMFELLR
ESLKRQARLARKFNRMRRVYRNTLPTLTSTQKWESVLLDAGAGSGHG
392418756YP_006455361.1 4-hydroxybenzoate polyprenyltransferase-like prenyltransferase [MycMSTSQVGQQTGSPAAGPPGNLVAGIVKAMRPRQWVKNVLVFAAPVAALGD
ERYVYDYRQVLVKVAIAFVAFCLAASAVYLVNDARDVEADRAHPTKRFRP
IAAGVVPEWLAYVLAVVLGVASLAISMLATPNLAVVMAIYIGIQLAYCFG
LKHQPVIDICIVSSGFLIRAIAGGVAADVPLSQWFLLMMAFGSLFMAAGK
RYAELQLAERTGAKIRKSLESYTSSYLRFVWTLSATALVLCYGLWAFERD
NIAAVARAANQAIDAARTHASWYAVTIVPFVVAILRYAVDVDGGLAGEPE
EIALKDRVLQLLAVAWIGTVGAAVFLS
392418754YP_006455359.1 putative esterase [Mycobacterium chubuense NBB4]MLLSDRWDNTISMKLVGRLRASARRLTVAALAAAVLPAVIGVVGGSATAG
AFSRPGLPVEYLMVPSAGMGRDIKVQFQSGGPNAPGVYLLDGLRAQDDFN
GWDINTQAFEWYLDSGLATIMPVGGQSSFYSDWYKPACGKAGCTTYKWET
FLTQELPAYLAANKGVNPNRNAVVGLSMAGSAALTMAIYHPNQFQYAGSL
SGFLNLSEGWWPMLVNISMGDAGGYKADDMWGKTEDPNSAWKRNDPMVNI
SKLVANNTRIWVYCGNGKPAELDAGMTSGNLFNAKFLEGFTMRTNRTFQE
KYIAAGGTNGVFNFPSNGTHQWAYWGSQLQQMKPDIQRVLGAQPQPSAPA
APEAAPAPAPAG
392418752YP_006455357.1 hypothetical protein Mycch_4991 [Mycobacterium chubuense NBB4]MAGITVVLASSAAWLTGCAFSDDMMASMGSQMETTPAHGQSEAHQPGPPH
AGPQSNALVVTPRQRSYLDALRAAGLHPSSDLNALSIGSYVCQARAAKQP
DQAVWDFVAPLVRNDLHDPDAHLATADYIRIATDRLC
392418750YP_006455355.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMAFHNPFIKDGLIKFPDSGSLVRHVERWARVRGDKLAYRFLDFSTERDGV
ARDLHWADFGARNRAVGARLQQVTAPGDRVAILCPQNLDYLVAFFGTLYS
GRIAVPLFDPNEPGHVGRLHAVLDDCHPSAILTTTDAAEGVRKFFRSRPA
NQRPRVIAVDAVPNEVGATWEPVDVQHDTIAYLQYTSGSTRIPTGVQITH
LNLATNVVQVIEALDGQEGDRGVSWLPFFHDMGLITVLLSPMLGHYITFM
TPAAFVRRPGRWIREMARKEGDTGGTISVAPNFAFDHAAARGVPKDDPND
QAEPLDMSNIKCILNGSEPISAATVNRFNEAFSPFGFKPQAIKPSYGLAE
ATLFVSTTPMNAEPRIIHVDREELNNHRFVEVPADSPKAVAQAGAGKIGV
AEWAVIVDADSATELPDGQIGEVWISGQNMGTGYWGKPEETVATFHNILK
SRSEPSHAAGAADDATWVRTGDLGAYHDGELFITGRTKDLVIIDGRNHYP
QDLEYSAQEATKALRTGFVAAFSVPANQLPDEVFADTHSGLKRDPADTSE
QLVIVGERAPGAHKLDMGPIADDIRAAIAVRHGVTVRDVLLTPAGAIPRT
SSGKIGRRACRSAYLDGSLRSGKVANAFPDESD
392418748YP_006455353.1 acetyl-CoA carboxylase- carboxyltransferase component (subunits alpMTTEVPTAHPTKTTAELLAELRDKLEIAKEPGGEKAVAKREKKGIPSARA
RIHSLLDPGSFLEIGALAKTPGDPGALYGDGVVTGHGTINGRPVGVFSHD
QTVFQGSVGEMFGRKVARLMEWVAMVGCPIIGINDSAGARIQDTATSLAW
YAELGRRHELLRGLVPEISLIFGKCAGGAVYSPIQTDLVVAVRDQGYMFV
TGPDVIKDVTGEEVTLDELGGADAQARYGNIHQVVESEAAAFQYVRDYLS
FLPANTFDDPPCVNPGLEPEITPHDLELDAIVPDSDNQAYDMMEILLRIF
DDGDVFPVGEQSGPAIITAFARVDGRPVGVIANQPMYMSGAIDNEASDKA
ARFVRFCDSFNTPLIFVVDTPGFMPGVEQEKGGIIKRGGRFLNAVVEADV
PKVTITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGAEGAAQLLVK
RFPDPTAPEVQKIRADFIEGYNTNLAVPWIAAERGFIDGVIEPHQTRLLL
RKSLHLLRDKQISRVQRKHGLTPI
392418746YP_006455351.1 serine/threonine protein kinase [Mycobacterium chubuense NBB4]MPLNEGDVIAGYTITRLLGSGGMGEVYLARHPRLPRQDALKVLSASVSTD
SEYRERFNREADIAAGLWHPHIVEVYDRGEFEDRLWISMAHVEGTDAAQL
LAERYPNGMPPALVVRIVTAVAEALDYAHQRGLLHRDVKPANILIADPET
DNERILLADFGIARRLGEASALTATNMTVGTVAYCAPEQLTADEAIDGRA
DQYALAASAFQLLTGAPPFQHSNPAIVISQHLTAQPPSIAEQRPELSGLG
GALEKALAKSPRDRFERCIDFARALANRTGFPVPAGAGDPEATMPAVAAA
GPRHSKTPRSRGRMLVLLALVLSLSAVAALLYLLLYDGPARSPDKVAVPV
VVVGADCATLGAAGVTEQGKSAYCAQLAGSGQQMLWSLYSGDIPHPTGTG
AVPVQVCVSQTNRSADDCGQDIRRENADPAANDNNAVPSAAP
392418744YP_006455349.1 cell wall arabinan synthesis protein [Mycobacterium chubuense NBB4]MPAPTARLIAIIAGLAGIVLCGLAPLLPVTQTTAAIQWPQSANADGFVSD
ITAPLVSGAPKSLDVTIPCRAVASMPRAGGVVFSTIPAGGIDAGRNGLFV
RANADVVYVAFRDTVAAVAPRPAVDSGACSALHVFANVDAVGADFVGIPG
AAGNLPVDKRPQVAGAFTDLRVPPATGAGAGLAANIVIDTRFITTPTALK
LAVMVLGVLCVIASIVGLALLDRVSGRRPPRTRRRAGWATWLTDAGVIGG
LLIWHVVGALSSDDGYNLTIARVSGEAGYTANYFRFFGATEAPFDWYQSV
LAHLAAVSTASVWMRVPATAAAIATWLIVSRCMLPRLGRRVAANRVAVFT
AGAVFLAAWLPFNNGLRPEPLIAFATVAVWMLVERTLGTRRLAPTALAIV
VAMFSVTLAPQGLIALAPLLVGARAIARIVAARRPVDGLVASLAPLAASV
ALVFVIVFRDQTLATVAESVRIKYRVGPTIPWYQEFLRYYFLTVEDSVDG
SLTRRFSVLVLLLCVFGLIMVLLRRGRVPGAVSGPVWRLAGTTGIGLLLL
TLTPTKWAVQFGAFAGLAGALGGVTAFAFARVGLHSRRNLALYVTALLFI
LAWATSGINGWFYVGNYGVPWFDKQPVIVHFPVTTIFLVLAIAGGLLAGW
LHFRMDYAGHTQVADTGRNRALASTPLLIVATIMVILELGSMVKATAGRY
PVYTTGAANISALRSGLSDTSCAMADDVLVEADTNAGMLTPVPGQRFGKY
GPLGGEDPVGFTPNGVSDTLEPAEPVAANPGTVNSDGPIDKPNIGVGYAA
GTGGGYGPEGVNGSKVFLPFGLDPKRTPVMGSYGENTVAAKATSAWYQLP
PRTPERPLVSLAAAGAIWYYNEDGSFNYGQSLKLQWGVHRPDGSYQALGE
VQPIDIFQQKAWRNLRFPLSTAPPEANVARVVADDPNLSEDQWFAFTPPR
VPVLQTASQFLGTQTPVLMDIATAANFPCQRPFSEHLGVAELPEYRIIPN
FKQMVASSNQWQSARAGGPFLFIQALLRTATIPTYLRNDWYRDWGSIERY
IRVVPGDQAPNAVIQEGSTRVFGWSRGGPIRALP
392418742YP_006455347.1 Arabinofuranosyltransferase A C terminal/ArabinofuranosyltransferasMRGALAAPVRVAGQMVVAAAVASVVAVVSLAAIARVEWPAYNSSNQLHAL
TTVGQVGCLVGLLASGWLWRRGRRVLARLGAVLFLAAFSVVTLGMPLGAT
KLYLFGISVDQQFRTEYLTRLTDSPHLHDMTYIGLPPFYPPGWFWLGGRL
AALTGTPAWEMFKPWSIASITIAIVLAFVLWANLIRFEQALVVSAATAAT
ALAHSPAEPYAAIITVLLPPVFVLAWSGLGARAHPAEPDDRHPGEPGNRH
PGEPGNRHPGEPGNRPSGGWAAVVAVGIFLGVAALFYTLLLGYAAFTLTV
MAVVLAVARRKIGPLLRLLTIAVIAGLIALIGWAPYLIAAAHGTPADKGT
AQHYLPIDGAQLSFPMLKFTLLGALCMLGTLWLVVRARNSTRTAPALAVA
VLTVYAWSLLSMLTTLVGTTLLSFRLQPTLTVLLAAAGALGFIDATCALA
RRVQPANARRVVAAGTVIGALGAVTFSQDIPDVLRSDIVVAYTDTDGSGQ
RADRRPPGAEQYYRDVDAKIQQVTGRPRNETVVMTADYSFLSYYPYYGFQ
GLTSHYANPLAQFKERAGAIEGWRMLTDADQFIAALDALPWPPPTVFLMR
RGANDTYTLRLAEDVYPNQPNVRRYHVALDKALFDDPRFDVSTIGPFVLA
IRKPTSI
392418740YP_006455345.1 FAD/FMN-dependent dehydrogenase [Mycobacterium chubuense NBB4]MTMSSTEFPTTATRLTGWGRTAPSVAAVLSTPDPEVIVTAVTRAAEGGGR
GVLARGMGRSYGDNAQNGGGLVIDMNALNRIHSIDTDDALVDVDAGVNLD
QLMRAALPLGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRSM
DLLTANGEVRTLTPAGADSELFWATVGGNGLTGIILRATIAMTPTETAYF
IADGDVTRTLDETIAFHSDGTEDNYTYSSAWFDAISAPPKLGRAAISRGS
LATVDQLPEKLQKDPLKFDAPQLLTFPDVFPNGLANKYTFGPIGELWYRK
SGTYRGKVQNLTQFYHPLDMFGEWNRAYGSSGFAQYQFVVPTSAVDEFKA
IIADIQRSGHYSFLNVFKLFGAGNQAPLSFPIPGWNVCVDFPIKAGLNEF
LNGLDKRVLEFGGRLYTAKDSRTTAETFHAMYPRIDEWIAVRRKVDPDGV
FASDMARRLELL
392418738YP_006455343.1 hypothetical protein Mycch_4977 [Mycobacterium chubuense NBB4]MKRCIVVAAAALLTAAGLLTSAPPASAGCLYGGAFISKCDDPVQPDGTWQ
RCVGVARWVPSGFSTHLVPEKHCGPMGPGQPPGDPAFTDPPTHID
392418736YP_006455341.1 alkylhydroperoxidase AhpD family core domain protein [MycobacteriumMTQTLTTAPRLRIYKSSPELYDAMMALSTASSKDVDAELAELIKIRASQI
NRCAFCLDMHTRDARKHGVTEQKLDTLAAWAEAGDIFDERERAALALTEA
ITLLGHDGVPDDVYERAAAAFTDRELGQVIAMAVTINAWNRINAAVRTAP
PRR
392418734YP_006455339.1 ABC-type polysaccharide/polyol phosphate export systems- permease cMTFMDAAAQSRTLSRAWGDLVDGFGKRELWLHLGWQDIKQRYRRSVLGPF
WITIATGTTAVAMGALYSKLFKLELSEHLPYVTLGLIIWNLINASILEGA
EVFIANEGLIKQLPTPLSVHVYRLVWRQMILFAHNIIIFVIIAIIYPKPW
TWTDLAVIPALALIALNCVWVSLCFGILATRYRDISPLLNSLVQLLFFMT
PIIWNENTLRSQGAGQWAKIVELNPLLHYLDIVRAPLLGADQQLRHWVVV
LVLTVVGWVFAALAMRQYRARVPYWV
392418732YP_006455337.1 ABC-type polysaccharide/polyol phosphate transport system- ATPase cMVSPAEPYIETRNAWVEFPIFDAKTRSLKKAFLGKAGGAIGRNESNVVVI
EALRDITLSLKMGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGVATVHGRV
APVFDLGVGMDPEISGFENIIIRGLFLGQTRKQMLAKVDEIAEFTELGDY
LSMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDADFLKKAQTRL
AALVERSGILVFASHSNEFLARLCNTAMWIDHGTVKMSGGIEEVVRAYEG
EDAARHVREVLEETAHTHER
392418730YP_006455335.1 hypothetical protein Mycch_4968 [Mycobacterium chubuense NBB4]MSFGYGVLVALALLVAPGAIIARCGGLRWAAAVATGPALTYGAVAMAIVP
FGALGVPWNAGTALGALLVLGALATSLRILTRRRTAPAAAAPATPPGPGF
LAAAGVLVGAVLIFVAAVRGIPHWQSIPSTWDAVWHANTIRFILDTGQAS
PTHMGELRNIETHEALYYPSTFHALGAVLSQLSGAAPATAYTVSSVAAAS
WLFPAGAAILAWLLLIGRTGVWPTAGAAATAGALSASFTAVPYVEFDTAS
MPNMAAYGLAIPTFALARSALHHRDRIPLAVLAVVGVFSVHITGGVVTVV
IIAAWWLLEALWRPVRGRLADFGTLLLIGVPSAALLLPQFLGVLQQAEII
EGHSFVTHQGKKRALIDALVQHTRHLNDFPIQWGLIVLCAVGAVILVVRR
IWWPLAVWLLLMAAIIHSSAPFGGVLGAVIGKFSDLFYSDPRRLSAVVTM
LLSAVAGIAAYTIVSWVVSALRRRVGGGSPRLWYGATAGVLTAVSIASAV
HYLPRHQFLLGDKYDSVIIDDRDLQAFAYLAGLPGAHDTLIANANTDGTA
WMYAVADLHPLWTHYDYPVQQGPGYHRFIIWAYADDADTDPRVAEAVAAL
NIRYVLVSTPVVRGFVMPDGLASLDKSHSWEKIYDNGEARIYRWRGARRH
392418728YP_006455333.1 putative NAD(P)H quinone oxidoreductase- PIG3 family [MycobacteriumMLAIVAESDGLRWQSVPDVSPAPHEVLIRVAAAGVNRADLLQAAGNYPPP
PGASDIIGLEVSGTIESIGADVENWSPGQRACALLAGGGYAEFVAVPAGQ
VLPAPEGIPLPHSAGLPEVACTVWSNLVMTAGLRPSQLLLVHGGASGIGT
HAIQVARALGCRVAVTAGSRNKLDLCAELGAEITIDYQSEDFVKVVREAG
GADVILDIMGAAYLDRNIDALAADGRLVIIGMQGGVKAELNIGKLLAKRA
GVIATALRSRPVTGPAGKTEIVAQVLEHVWPMVADGQVRPVIGAEFPIAH
AQAAHELLESGDVSGKVLLRVDI
392418726YP_006455331.1 sugar phosphate permease [Mycobacterium chubuense NBB4]MATCDTVDTDTRQLRRISLASYVGSAIEFYDFFIYGTAAALVFPQVFFPE
LGHVMATTASLGAFASAFLARPVGAAVFGHFGDRIGRKHVLVITLMLMGI
ATVGVGLIPSTASIGIAAPLLLIGLRLVQGFAVGGEWAGAALMSTEHAPE
GRRGFFSMFTQLGLGTALVLSNFVFLVVHAAFGGSGSAFYQWGWRIPFLF
SAVLIGTALYIRLKVKESPEFTDQEPVPHEGTPFAELIRAQGRQVLLAGG
AAICAPMLVFQAGTFFTHFAAEHMGYSMNLVLLVSMIGGVFATVFAAVTA
ILSDTYGRRRVALCSFALAAPWSLLVFPLVESRDHVVFAAAIMVTYALIG
ACIGPMAAFLPEIFAARYRYTGAALSHTMGAIVGGALPPVLSPMLIVDYG
GWAVAAMMGGLGVISLVCVVALPETAGRSLTARATRRGSSVTASRTSR
392418724YP_006455329.1 hypothetical protein Mycch_4961 [Mycobacterium chubuense NBB4]MRTHRRAATAAVVGLGITLSLITACQRTTEGMVAQTTEPGPPLTSEPTTS
GRSPGIPGLPGIPGITIPNLPLPTRGTNVPEVPAPPNATTMSCEEYNKLD
EATRVAVVRAILAQQNNPLGPNGESIGQILADAACQFLPSAKVSEVLMGS
392418722YP_006455327.1 histidinol-phosphate aminotransferase [Mycobacterium chubuense NBB4MSARLRPELADLPAYAPGRTVPGAIKIASNETVHGPLPSVRAAIEKAVDG
INRYPDNGYVELKERLAKHVNFAPENISVGAGSVSLCQQLIQITSTVGDE
VLFGWRSFEIYPLQVRTAGATPVQVPLTDHTFDLDAMLAAITERTRLIFV
CNPNNPTSTVVEPGALARFVEAVPPHILVVLDEAYIEYIRDEWVPDSFGL
VRSHSNVVVLRTFSKAYGLAGLRIGYAVADPDIITALSKVYVPFTATSVS
QAAAIASLDAADELLARTDGVVAERVRVSAELRDAGYDLPPSQANFVWLP
LAGRAQQFAADAANSRVIVRPYGDDGVRVTVAAPHENDAFLEFARSWKGR
P
392418720YP_006455325.1 DNA-binding protein with HTH domain [Mycobacterium chubuense NBB4]MTALDEFTDIVSGIYAGVMTPERWDECMAAVGRAFGAHTAALVVSDRAAR
VMKHAQMPTAAAQSYQAHYARLDHVLSAVESGPLRAVRTGAELMWPYQRR
EFQAEWARPNGLEDGLFVRLTGGSSVTTLAIATVKRSERFDNSERIALIN
RLVPHFQQALRMRAHLDELEIRSADCLEASEWVRHGIVITAPDRRVVSCN
SAAERILSSTDGLRIRNGRIEADLPHVDTQLQRSLQEALTLNGSDTWGGS
FPCARPSGRRPYVIHVAPIDQTTFASPRSGRASIVIVDPEHQPEPPAGLL
QRLYGLTKTEARIALLVARGQGLKPLADELSVSITTVRTHLQHIFDKTGT
SRQAELVRLVLTVDPR
392418718YP_006455323.1 putative membrane protein [Mycobacterium chubuense NBB4]MIRRTRKPSDREDRLVSASKWELLTCARRGHITYAPDDEALAGRLSGTTG
VGEVWRCLRCGSFVVGAPHGHGPADHAPLVLRGRALRQAIIVRVLAVERW
FRAVLIGLAAWAVWKFRGAQGSIQATVDHDLPLLRASGIKVDQMTAVHEL
EKALAARPSTLTLIFFLLAAYALLEFVEGLGLWLLARWGEYFAVVATSVF
LPWEIYDLAVKGVTFTRLGALVINVAAVAYLLISKRLFGLRGGRKAYDEE
RRGEQLLDVERAAMSA
392418716YP_006455321.1 hypothetical protein Mycch_4950 [Mycobacterium chubuense NBB4]MRIEVDPEALIAAGRHTGSLGSQLGRLSGALGGALSSGIASGMDPAGLDF
GLEYGHRASEFAAAVADAANAFTAVGQLLEATGYNYRNADAASTIGGPGP
VGGPTGESRTALPAHVPPGPAGATVPPPAKWYLVQPLLEVLPGLGLIAGA
AMTWPSGSSALMGVTAIQWRNFATGFALIEPSLADVKAVVAAQSIPEGAT
ITSALDSLGTAISSLADVCSAVAQSVSEFAQTVRQTQDAIRRLLDRLSVG
GLWDTLTGFLTGEGDDILREVARDVRTVLGNFQQQVKGIVGLLDELATVI
GDAAAAFQKWIRPVLVEQFGDGVGNALADTVTMYNDFQVGAVTGLIGTVS
GDVAMADPDTWKGMAETALSVAEDPSTLPGVLATMGGEFLALDKWSGDHP
GRAAGEAAFNIGSLFVPGGALSKTGGVAKGLNLGRRTLEERRLPQPREVR
SWMRGQPNTAERHDVTELRPVRPVSPGAIPPVRSDGVPPVRQQGPAGARP
VRAGEPTAAGAASPRAPVEQPGRTPADPPESPDSPVSSARSPHRGG
392418714YP_006455319.1 WXG100 family type VII secretion target [Mycobacterium chubuense NBMGRSVDVVVSELHTAAARLRDAGQRLQDGLTGVDLETRELLGSGWKGDAA
SAYGPAWDQWHTGAGQVIRGVQIMSDLLTIAGKEYAKTDRQAGEVLDATM
QGTGTASGLAQQMDLGSASRVGPTAAPAPGGADGSDEPPARRR
392418712YP_006455317.1 hypothetical protein Mycch_4946 [Mycobacterium chubuense NBB4]MPHVTRIEGPKAGNPIYQVGGKSFVFFRTPRPDAFDPDTGERYADVIVIW
VESEEDKLALTQDPDSPFFTTPHFDGHPSVLVRESRLDEVGVDELRELIQ
DAWLSRASKRRAQQWLSQAE
392418710YP_006455315.1 alkyl sulfatase-like hydrolase [Mycobacterium chubuense NBB4]MEHKPPTATIESAHRAHLGELPFDDTRDFTNADRGFIAALQPCVITAADG
RVVWDNDVYSFLSGDAPASVHPSLWRQSTLAAKQGLYEVVEGIYQVRGFD
LSNITFVEGDTGVIVIDPLVSTEVAAAALALYREHRGNRTVNAVIYTHSH
VDHFGGVLGVTTQADVDAGRVAVLAPEGFTQHAVQENVYAGTAMARRAGY
MYGAVLERGPQGQVGCGLGQTPSTGEVAIIVPTVDIRRTGETHTIDGVEI
EFQMAPGTEAPAEMHFYFPRYRALCMAENATHNLHNLLTLRGALVRDPHG
WAGYLTEAIDTFADRADVVFASHHWPTWGADEIVEFLSLQRDLYAYLHDQ
TLRQLNQGFTGIEIAETFAMPPALERAWHARGYYGSVSHNVKAIYQRYMG
WFDGNPARLWPHPPEAIGPRYVAAMGGIDRVIELAQQAFGDGDFRWAATL
LDHAVFTDENHGPARQLYADTLEQLAYGSETATWRNFFLAGATELRDGNF
GTPTTTSTTMAAQLSPEQMFDVLAISVNGPRAWDLDLALDVTFGDIATNY
RLTLRNGVLVYRKVAADEGSAQATIRLTTKARLLGLAAGDNTSPGVEISG
DPAVLTSLVSVLDRPDPGFDIVTP
392418708YP_006455313.1 fructose-2-6-bisphosphatase [Mycobacterium chubuense NBB4]MQLLLVRHALPLRSEPGEGSDPSLSPEGVEQAARLPAALARFPITRLVSS
PQVRAIETGQPVADARGLPIEIDERFAEYDRDLAHYIPIEHIAEENPQEL
QRLIDGHLPSGVDEDEFLGRVSAGVDDLVATTGHDETVAVFSHGGVINAL
LHKALGTDRLLSCHVDYASVTRVLKSRTGRLAVASVNGTEHVWDLLPRNS
RW
392418706YP_006455311.1 transglutaminase-like enzyme- predicted cysteine protease [MycobactMKRDVGAELEVEITAATTLEFQIAVAPQPGAEVTESLSFTLNGREIPLTE
ITEIVGEHGSRIHTLEAPQGNLKVSYSASVVGEARPAPVRDLDLSTYLRP
SRYAEADKFFGFAATEFGEYADTATLLEKVSSWVGARLSYVPGSSDPIDG
AADTLLAGQGVCRDYAHLVIALLRALDVPARLVSVYAPGCRPMDFHAVAE
AFVGDQWRVVDATCLAPRQSMVRIATGRDAADTAWLDNHKGAITVNTMTV
TATVDGDLPKDSIDQLVSIR
392418704YP_006455309.1 periplasmic glycine betaine/choline-binding (lipo)protein of an ABCMISYRKPRRYPLRIAIALLLALMVSACGSSNPLGGGEVSGDLKSIKVGSA
DFTESKILAEIYAQALEANGFTVSRQFGIGSRETYIPAVRDHSIDLIPEY
TGNLLQYFDEKSPATTPDAVLLALLKALPGDLSILYPSPAEDKDTLAVSQ
ATAQRWNLKTIADLAAHSAEVKVGAPSEFQSRQTGLVGLKEKYGLDIAPA
NFIAISDGGGPATVQALTGGTVTAANIFSTSPAIEQSKLVVLEDPKNAFL
AANVVPLVSSQKMSDELKTVLDAVSAKLTTQGLIELNTSVEGNRGVDPDE
AARKWIADNGFDKPVQK
392418702YP_006455307.1 ABC-type proline/glycine betaine transport system- permease componeMRYLFTHLDDLWTLTLIHLRLSLIPIVLGLVIAVPLGALVQRTTALRRLT
TVTASIIFTIPSLALFVVLPLIIPTRILDEANVIVALTLYTVALLVRAVP
EALDAVSPAVLDAATAVGYKPLTRMVKVELPLALPVLIASLRVVAVTNIS
MVAVGSVIGIGGLGTWFTEGYQANKSDQIIAGIVAIFVLAIVIDTLIMFA
GKALTPWTRAPRSRGAATAGASA
392418700YP_006455305.1 hypothetical protein Mycch_4934 [Mycobacterium chubuense NBB4]MSEADRSDATTWPAILTWRAHDEPRMESARVQLSGNRIKAYGRVVAAATP
AHPAFSASYDLLTDELGATKRLTLTVTLAERERQLSIARDEENMWLVQEH
SGQTSRSTFDGALDVDVIFSPFFNTLPIRRTGIYTSDSESVTLPVVYVRV
PDLSVDVETVSYAAGADGISLKSPVAETTITVDSEGFILDYPGLAERI
392418698YP_006455303.1 putative tRNA adenosine deaminase-associated protein [MycobacteriumMGAQRAQAQERAVDVPDGFAVAVVREDGKWRCTAMRPATLTSLTAAETEL
RELRSAGAVFGLLDIDDEFFVIVRPAPSGTRLLLSDATAALDYDIAAEVL
EKLDADIDEEELERCDPFEEGDLGVLSDVGLPEAVLGVILDESDDLYADE
QVGRIAREMGFADELSAVLDRLGR
392418696YP_006455301.1 hypothetical protein Mycch_4929 [Mycobacterium chubuense NBB4]MKLRSLLPTHRTPDSRILATTLIPILAAGTCLPSAHAEPGQADLAKPFSE
AGGPFVGQWRAHRESLTINADGSAVETTDAGTVNFRLTFVQGPPSQPDTT
AEGNLPDGGYAAATLVDGGRGLTLSIANGDNGFAFCKIVNGGYANSDDCG
A
392418694YP_006455299.1 CsbD-like protein [Mycobacterium chubuense NBB4]MGADDKASNKIDDLGGKAKEGLGKLTGDESKENEGKVDQAKSSLKDAGEK
VKDAFKK
392418692YP_006455297.1 mannitol-1-phosphate/altronate dehydrogenase [Mycobacterium chubuenMKVNQSTLAQLPVSVPTYDRNEIGIGIVHFGVGGFHRAHQAMYVDKLLEN
GLAREWGICGVGVMPADRRMKAALDAQDGLYTLILRNPDGSRDVRVIGSI
LNYLYAPDDPEAVIELLAAPTTRIVSMTITEGGYQIENAGDVSVFGLVTE
ALSRRRARGIASPTIVSCDNIEGNGDIARRAFSGYADRSHPGLSEWMAEH
TTFPNSMVDRITPVTTPDVISGLADELGVEDEWPVVAEPFTAWVLEDDFV
SGRPPFEQVGVLMVDDVTPYELMKLRLLNASHQGLCYFAYLAGYRLVHEA
AADPLFADFLMDYMDSEGTPTLKPVPGIDLADYKRTLIERFANPGVRDTV
ARLCADSSDRIPKWLLPVIRANLGADRPVRLSAAIVASWARYAEAVDEQG
EPIEVVDQLADSLIPIARSQREHPLAFIENEALFGDLAQQPRFVDAYRWA
LESLHRDGARATLEALRRDHG
392418690YP_006455295.1 carbohydrate ABC transporter substrate-binding protein- CUT1 familyMKKLRRAVRRLTVCAAVSGVVLTAGCAGAGSLGASENEVTIALVSNSQMT
DAQKLSSDFEQKNPGTKLKFISLSENQARAKITMSTAMGGSEFDVVMISN
FETPQWAKDGWLRNLSDYAKNTPGYDENDFIPSLRDSLSYQGHMYSVPFY
GESSFLMYRKDLFEQAGIQVDQSPGYQPTWQEVAQWADKLKSDERAGICL
RGKPGWGEVLAPLDTVINTFGGRWFDEKWNAQLDSPEVKKAVNFYVDTIK
KSGELGAASTGFQECANLFGQGQTAMWYDATSAVSVLEDPKTYPDLVGKI
GYLPAPIVEKPNSGWLYTWSLGIPKGAKNPDGAWKFISWMTSKDYIRLVG
EKLGWARVPPGSRISTYKDLPEYEAISKSYGPLTLQSIENATPNKPTVQP
VPYTGIQFVGIPEFQDLGTRVSQQISAAIAGQKSVDDALAQAQEYAAVVG
KTYQEK
392418688YP_006455293.1 carbohydrate ABC transporter membrane protein 2- CUT1 family [MycobMTTPRVVDSTEKATATTDAASPSKKKSRKFSPWGVVAWLVGLGFFFPVFW
MVLTAFKKESDAATSPPKLFFTPTLDQFKAVFDQAIGPAMLNSLFATGLS
TLIVLLLGTPAAFALSLRPVRKTQDALFFFMSTKMLPVVAVILPLYVIVS
NIGLLDNIWALVVLYSAMNLPIAVWMMRSFFLEVPGELLEAASLDGASLW
RSVREVILPLVSPGIAATALICVIFAWNEFFFAVNLTAVNAQTMPVYLVG
FIAGEGQYWAVLSAAATMAALPVILCGWFAQNKLVRGLSFGAIK
392418686YP_006455291.1 putative membrane protein [Mycobacterium chubuense NBB4]MRGLRRLLERAVARVTASDPSHQRLRMAARGTLAVACSVGTIALLSQLFD
KPVLPAAPGLIVAMIGTMAVNDDSLRGRMVTLALGVLTALAGVAAGSLLF
GSSFASHVVFVVAAGAATYAQRYAPRGTALGMLGFMSYFMAIFLRVPFSS
LAWTAVAIGCGAVIAGVVKEVLVPDRPVGDLRRTIDAFTTRLAQVCRAAA
VIARDGDDGIDGRRRARLRRRVLALRETELAIDSQLGGSQADASVQIHDL
VLHATLAAEALGEQSVHGADSAALAEQRTELAGIVAELTRAGRQARPDEG
VPESADDDTPDADGEDDDGPRMWPSPDSRKALQAIVATGLAVPLGLLVST
QRWYWAAIGAFVVFTRPATAEESVVRGFERLLGTTVGAAAGIALGTAVSG
HATAQLTLLAVGVFVSLYLFGVSYAFAMAGITAILAIIYDLMGQFSDRVL
ELRVVETAIGVALGGLAAIVVFPMSSRRKIREAEDDLLAALQDFLDALAA
PEKPRAAYAVRDDARNVEQKAHDLRLAAEPLTEPFPGLGSGRRRQRVIML
TVLGRSARQLAREVTADPAVIDSREVQEDIAALSRRLQAARSSDDGAARS
AVRTPRSEGPIGRELQRIARVLDSLDDASVEDVSPGERHSRTTTGPRAS
392418684YP_006455289.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMTDEAARAVAAAAAVGLAVADGEVAGLVVQSATGVIEAATPEAEEILGLS
LGQMLGRASADPRWAAVGVDGVALRPQDHPAIRALMTGRPVYGTELGVHR
PGRDRAGEHVWLRVDSVPFNFVDGAPTNVVVRFSVLSGQRATELRLAESE
RLYRFLIDNAPDIVAWQLPDTTFLWVSPASETLLGYAPEEMVGRTAYEFM
HPYDRATSQATAWMAGRSPSPESIVVRMRHRGGHHIWMEVAGQVLRDADG
NPAQLRTSWRDVTARVEAERGRDAALQLVQSVVANAPIGIAVCTEDGLMQ
QVNAALCTMLGRDSAQLLGRRVDEFLHPEAECSDRFSALLSGELPVDESE
CRYVRPDGTPMWGHRTAVVLRDGDGRGDPRLLLHLQDVTERRTAHDALTH
AATHDALTGLANRVAFTEHLAAMRRRLGPDDCSGLLFIDLDDFKAVNDTY
GHEIGDELLTVVGARLRESIRPQDFAARLGGDEFVVHCRYLTDHQGAVDI
AKRIVDKLSEPYRLGARTISISASIGVTTTTRDGHDRLMTSADRAMYRSK
KAGRGLITDAADDPAPSGRADSVSMSDTDGDYDDAGPDNTLSPSESLDSD
EVRNDDGDVVVDPPDEWIDAEEDETLDERLAAEVPDVLPRGDAEQATPDR
RTYGQIDGTPEDGTSFYTVLDDDE
392418682YP_006455287.1 hypothetical protein Mycch_4915 [Mycobacterium chubuense NBB4]MKSMAAVVLAGGLLAAPLLTVGMGTASATPGTCDGAGCVPYVAHGAQVGG
SCTQNTRYNFGMDAAGNTLACSSRSQWVSSPSLVGVRTLREPCGESAGVA
QTPDGVPLKCEAGAWTADYWVMFYG
392418680YP_006455285.1 conserved lipoprotein/antigen [Mycobacterium chubuense NBB4]MKREILVAVGGAAILIAGLSGCSKGEDKSSTSGETSSVASAAGKSTVTID
GKDQQVQGSVVCSDMGGNTNIAIGDATTGIGAVVSTGDDPKVVSVGLGNV
NGVTLGYQSGAGQGDAKAEKDGKTYKISGTATGVDMANPMQPVNKKFEIQ
VSCP
392418678YP_006455283.1 conserved lipoprotein/antigen [Mycobacterium chubuense NBB4]MTTRWAVTAAAAALMLAGCSKQPPEYTPPPGQLYPGTAQVTVNGQDLGKS
TSVKCSSAGPLTMISAGTDTSGMSAMIDKGDELVVRAVGIRDLAGFTGSY
NDGLGGNATVKMADRTYEISGTAEGFETAKPSFRASGTFAIKVSC
392418676YP_006455281.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTSAAEPQSLLLQMLDPAHRADPYPLYSRIREQGPVQQPGSNLTVFSSYA
DCDEVLRHPHASSDRLKSTVAQRMIADGAPPRPFGPPGFLFLDPPDHTRL
RRLVSKAFVPKVVKALEPEIAALVEGLLDDADGSFDAISGLAYPLPVAVI
CRLLGVPLEDEPQFSSASALLAQSLDPFVNLTGAVGAGSEERMAAAVWLR
GYLRELIAQRRRDPGEDLMSALIHVVGAPPACGGESGDQLTEDEIVATCN
LLLVAGHETTVNLIANAILALLRDPAQWAALRAEPARVSGVVEETLRYDP
PVQLVGRIAAEDMTIGTVTVPKGDSTLLLLAAAHRDPDVFDRPDDFDPGR
PGIRHLGFGKGPHFCIGAPLARLEAAVALTALTSRFPNATLAGEPSYKQN
VTLRGMSELPIAL
392418674YP_006455279.1 cytochrome P450 [Mycobacterium chubuense NBB4]MPSELRTVPKTRLSYRERIAALQEIHTGCEIFRDADGPVTEVGIAPRWML
PPFVVVTSPRGARDVLTATFPTVDRDFPFMTEQQELNGGSLLNFAHADWV
GRRRMLQPVFTRQQITRLTATMFSIASECVRGWGSDGGIDLDRDSRRITM
RVLGQSIMAFEPDQDTDALVEPMRRISAYIAARGRAPVKLPRWVPTPERR
HAVAFNKVAHDLAADILSACRRDSEREAPLVRAMLEAVDPDTGQPLSDMD
ICHELVIFLASGLETTATTLAYALWALGRHPEMQEKAAAEVAAADVAALV
SDPRGCLPYTMCVLQEALRLGGPTPAIMRVARTDMDVDGHRVESGSQLVV
GVYALHRDPRLWDDPLRFDPDRFGPTDVRTRDRWQFLPFGGGPRSCIGEH
FALTAAALELAAVLRRVEIVSTTTTFPITAPLTIVPDGPIPAQIRQRA
392418672YP_006455277.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MSDSPRNAMPDAVVVAYARTPFTRSLVGGLAKASEFELASAVIRGVIDRS
GLDPALIDTIVLGEVLQGGGCIARYSALDLGLPLDIPAYDVGGWCTSGMV
AMHQAVAGIRAGMARCVVAGGLNTPSQSPLAGPHFATTGITDTPIAPMHP
GIGEMPALDLALMLGEGTATQFGLTRAEVDDWAARAHALACEAHEGGVLD
AEKVAVDVGGAAVFDDELPSRDLTLEALASMNSFVGEDCTVTVGNQTGLT
DGAAAVLICEREFALAHGMTPLARITGWSVVGSTPEGATEATITATRRAL
DVAGVDVGAVDLFDVHDSYASIGVAYERSLGVGRDRLNVHGGGLALGHPY
GASGTRVASTLINELQRRGGGVGAGAIVSAGGLGAAIVLDVMPPVQ
392418670YP_006455275.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSTRSLLLTGATSGLGLGVARRVVGRPGWQSVLLVRNAQRGAVLRELLGD
RFTEGFDQIVNCEQSSLDSVRGAAAHVGELIDEGRVAPLSTIVLNAAVLR
NDATELSVDGIELTVATNLFGPHTLLARLSPRLAADARILIVGSPTIRQT
WFQRAAGVKAASWKPLREQCAPSQDGVAAYARTKLGLFYLSCAAARLAPA
EMGAAYFDPGVMPGTNILRERHRASQIYWLKVLPYIAWTFGGVTVGRGSR
VMAPYVLHEKPMGDRAFLSVKRGKRPPPVEVARVREYFTGANEICCVEPG
DAAPWWHRPEALCG
392418668YP_006455273.1 monoamine oxidase [Mycobacterium chubuense NBB4]MAHPPAVAADVIVVGAGISGLIAARTVLAAGLTPVILEADSRVGGRILTE
EAAPGLPVELGAQWIGDTHHRMFALAEELGVQTYPQFDEGETSYELAGSG
VLRENEFRARFAGELGELEKVLRLLDELAAEVPPEAPWRAPRAADWDAIT
AGAWYDGQALSPVARTLLEICTVGILAVPTVEVSFLHLLFTIQTCGVTSE
LFAESEGGAQTTRFVGGTGEIPKRLAALVTDHLVLDAPVQLIEHSDDSVT
VHCRGGRTARGRRVIVAISPALAGRIMYDPPLPGKRDQLTQRMPNASAMK
AFFVYDEPFWRAAGLNGQLISDVGPARMSNDTCLPGDDHGVILCFLEGEQ
ARTYGRMPTEERRAALTAELVRHYGDKAARPAAYLDGEWADRQWTRGCYN
ANLGPLVWTNFGDALAEPIGTIHWASTDTAVRWSAYMEGAVEAGERAAQE
VIDALTG
392418666YP_006455271.1 amino acid ABC transporter substrate-binding protein- PAAT family- MGYPRRRRAGLVTILLLAAALLSACGPSADRSENPIKSAGVLRVGTEGVY
SPFSYHDAATGRLVGYDVEVARAVADKIGVNVEFVETPWDAMFAALEANR
FDVVANEVTINPQRRAKYDLSEPYSVGEGVIVTRAADNSITSLADLKGKV
AAENATSNWSDVARKAGARVETVEGFTQAITLLNQGRVDVVVNDSIAVYA
YLAETKDTSVKIAGSVGEKSEQGFAARKNSGLLPELNKALDELRADGTLA
RISQKYLNANASGAPEAAGAPPVRSAWQLILDNLWPLAKAALTMTIPLTI
VSFVIGLAIALVVALARLSANVVVANVARFYISVIRGTPLLVQLFIVFFA
LPEFGVKIDPFPAAVIAFSLNVGGYAAEIIRSAIQSIPKGQWEAASTIGL
NYVGTLRRIILPQAARVAVPPLSNTLISLVKDTSLASTILVTELLRQAQI
IAAPTFEFFALYGTAAVYYWVICLVLSFGQARVERRLERYVAK
392418664YP_006455269.1 transcriptional regulator [Mycobacterium chubuense NBB4]MATQTEELRRLIVADINAGEPGTKLGSERELAERYRTSRSSLRQVLAALE
ESGLVDRVIGRSGGIFISHGQVQRSLSDVVGVPAFLASQGYVAGTRVLST
KIAAPDATTQQALGIAAEDFVIEIQRVRLADGSPISLELARFPAETFPGL
LEQQLGGSLYEILESHYGLVTSRADERIEAVNATPEEATLLGIKPGSALL
LITRITYDQNGTPCEYSRDLFRGDRTRLAVTARGRGVGAQPSVGDASVAL
QSQQRRVG
392418662YP_006455267.1 putative homoserine kinase type II (protein kinase fold) [MycobacteMGDDRAVAEQALEAFDLPQGSALRLLNLSENATYAVEEPGTGHRSILRVH
RKDYHRRDQIESELHWLDALRRDSDLTVPTVIPARDGGRVVTVTHDGTER
HVVHFEMVPGAEPDENSLTTTDFHTLGCITAALHDHARSWRRPAEFSRFA
WDWEHSLGDSPRWGRWRDAVGVGPAEEEVLTRAQELLQQRLSEYGSGPDT
FGLVHADLRLANLLVDGDTITVIDFDDCGFGWYFYDFGTAVSFFEDHPSV
PEWQEAWVSGYRTRRELTPADEDMLASFVLLRRLLLLAWMGTHSHSRESQ
AISITYAAGSCELAERYLSSDGHRLT
392418660YP_006455265.1 carbon dioxide concentrating mechanism/carboxysome shell protein [MMASNAIGMIETKGFVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGE
VGAVKAATEAGAESASQVGELVSVHVIPRPHSELGAHFAVNGQ
392418658YP_006455263.1 hypothetical protein Mycch_4891 [Mycobacterium chubuense NBB4]MSIDREELRRLVRDVIRETVGDLKAAPAPAPAPPKASPPAPARAPEGPVA
TGPLAADERSRTDTVRIANDRDLDVFVRNLLRLFENPKTRADLRHGRLTF
RLAGAERGGSGSSRRVERGAVTERQIADIAEAGSSLILGPRAVLTPLARE
RARALGVTIHKERT
392418656YP_006455261.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MTGENLVPHAGQLLERAHFAAAAFSDYDQASVARIVEAVAEAGHRNAERF
AAAAVAETQMGVVDHKIVKNRACSRGIVDFYRDQDYVSPRIDSARKIVEI
PRPAGVVLALTPTTNPVSTVYFKVILAMMTRNAVVVAPHPRAKQCSADAA
RVLAEAAATAGAPDGIIQVIDEPSIPLVEALMADERTDVIVATGGTGVVR
AAYSSGNPALGVGPGNVPVLVDATADVEAAARRIVDSKAFDNSVLCTNES
VLIVEEAVAARLRSALTRHGAHILDEDAALRLREFMFPGGALNTEVVGRD
ASWIAERIGLRVTPKTRVLIAPFTDVIGEEVLTHEKLSPVLGMTTVADAR
RGIRAARAVVRIAGAGHSAAIHSEDPATITDFAAQVPVLRVAVNVGNSTG
SSGLDTNLAPSMTIGTGFVGRSSIGENLQPDNLINWTRIAYNSDAGVPMA
NFAGLSPWRSPAGPVPAYPRASNDTAAAPAPAVRTVSRAPARRNGDPGIE
ALRAELRALVAEELAQLIKR
392418654YP_006455259.1 amino acid transporter [Mycobacterium chubuense NBB4]MTDDPTTLAPGQQKSTDSVQRLKRNAVGTFGVIFMAVATAAPITAMVGNV
PIAVGFGNGAHAPAGYLVATIVLGLFAIGYATMAKHITSTGAFYGYISHG
LGRVIGMASGLIITMAYVVFEGSLIGIFAFFFQNLFDSQLGIHVHWLIPA
LLMLTLNCILTYFDVNLTAKVLGVFLITEIVMLSLGAIAVAVKGGGPDGF
AVGQILNPVGAFQPAAIAGASAGLGLFFAFWSWVGFESTAMYGEESKDPK
KIIPRATMIAVLGVGIFYVLVSWMAIAGTGPKQAVDLAQSADTSSEIFFG
PVRSTYGEWAITLFNILLVTGSFACGMAFHNCASRYLYAMGREGLHAGLQ
KTLGATHKHHGSPHIASFVQTGITLVLILAFFFAGMDPYIHMYTLLAILG
TMAILIVQSLCAFSVVAYFHFHKNHPSSAHWFKTFLAPLLGGIGMLYVVY
LLWEHKDAAAGAASGTLLFKLTPWIVVGVFAFGALLALYFKFRDKDRYEL
IGRIVYEDNEIRD
392418652YP_006455257.1 propanediol dehydratase- small subunit [Mycobacterium chubuense NBBMSDRDVTIGNAVDGKLGLADLRMDPAALAHQAVVAEEGGNPQLAENFLRA
AELATIDDEDVMALYEALRPYRSTAAELEELRASLVARGASRCAALVEQA
AAAYTRRGLLR
392418650YP_006455255.1 protein of unknown function DUF222 [Mycobacterium chubuense NBB4]MGSFVTGAAARERFSTLLDQVDAAYAEMTDLPCDTVGSRFRMEMAERLET
QERRNRALMYRTFGQIADPPDEAAMAPMVKPRLAARLRIPVREVTRRFKT
AAKVCARRQLSGPALPPLLPVVADALAAGTLGEDHLRAITTTMDKLPSAT
SAVDREDVEATLVRESAKQDADFVKEVGKRLDEVFNPDGHYDEADRARRR
GLHLGAQGPDGMSKLWGWVDPENRAYIEACSAAVRPGRHLPDGSIENTPD
DRTPSQRCHDGVKLGLKTALSSGQMGSHRGHPVTVIARTTLAELNQAAHA
ATNPDVSMPAPARTGGNTALPMRDLIRMATDAIHYLAVFDDHSDRPLYLG
RQTRIATTDQRIICYSRDGGCTRPGCLEPGYHSEVHHSTDWARGGRTDAD
VLYFACGPDHKLLTDGHWTAAVTERGRLAWTDGTSSPGVNRAHQPDELLR
GDPDG
392418648YP_006455253.1 ATP-dependent DNA ligase [Mycobacterium chubuense NBB4]MAAMKLPVMPPVSPMLAKPVAEMPPDASYEPKWDGFRSILFRDGDDVELG
SRNERPMTRYFPELVDAARTELPPRCVIDGEIVIATPEGLDFEALQLRLH
PAASRVRLLAGQTPASFIAFDLLALDDCDYTSRPFGERRAALVETLAGSG
PTIHVTPATTDIRIARRWFSEFEGAGLDGIIAKPLNLTYQPDKRVMFKVK
HQRTADCVVAGYRLHKSGDDAIGSLLLGLYTDGGALASVGVIGAFPMATR
RALFTELQPLVTTFDDHPWNWAAQAAADPALARRYGVGSRWNAGKDLSFV
PLRPERVVEVRYDHMEGKRFRHTAQFNRWRPDRDPRSCTYAQLEQPLTFR
LDDIVPGLGRP
392418646YP_006455251.1 Transport protein [Mycobacterium chubuense NBB4]MSEQLSPRRPVFVRLIRVLSIPIILFWLAVAVVTAMATPALDAVADQHAV
SLAPHNSPAYESMLNIGAKFGEFNSDSTAMVVIEGQDKLGDSAHDYYNRI
VAKLKADREHVQFIQDFWGDPLTAAGVQSPDGKAAYVQVFLVGAQGTTPS
HESVAAVRDLVASVPAPPGVQAHVAGNTVLNADTSVAGHKSMATMALVSI
GVIVVMLLIVYRSIVTTIIALVIVLVELFATQGIVATAGNLDIIGLTPYA
VSMVTMLGIAAGTDYVIFLFGRYQEARANGEDREQAFYTAYHGVSHVILG
SGLTIAGACLCLTMTTLPYFSTMGLPCAIALLVIVAAALTLAPAILTVVS
RFGLLDAKRELSTRGWRKVGTAVVRWPMPIVAMTSLIAVIGFVSLLTYIP
QYNDQKYTPSNMPANVAMTAAERHFSQARMNPELLMLEADHDLRNPADML
IIDRVAKAVFHLRGIERVQTITRPLGAPIEHSSIPFQIAMQNAATLQTAK
YNNDNTAQMLEQADELSKTIANMQRMYEITKQIVATTHDMTGRTHDMVDT
TNDLRDSIANFDDQFRPIRNYFYWEPHCYDIPMCWALRSIFDSLDGIDTL
ADKLEGLSGDIDQLDALMPQMLQTLPPTIESMKTMRDFMLSTHSTMAGIQ
KQMQESAQGSTMMGNYFDQAKNDDSFYLPPEVFQNPDFKRGLKMFVSPDG
TAVRMIITHQGDPASVEGIKHVAGIRDVVADAVKGTPLENAKVSLAGTGS
LYADMQNGVKTDLLIACIASMILIFAIMLLITRSVVAALVIVGTVAASLG
TACGLSVLLWQDVLGLGVQWIVIPLSVVILLAVGSDYNLLVVSRLKEEIH
AGLNTGIIRGMGATGRVVTAAGLVFAFTMMSMIVSDLRVVGQLGMTIGIG
LMVDTLIVRSFMTPSIAAALGRWFWWPLNTFQILDRYRRGSGKLVAEEPS
AEYGAHASRV
392418644YP_006455249.1 hypothetical protein Mycch_4877 [Mycobacterium chubuense NBB4]MGPRGVAAWLLAVAATVALSPPCIAEPAPPAGSAASVIDELKSQGYDVQI
NWVSGVSNRPLEECRVLAVHNPDLNGPPPETFTTVYVDVSCPNRDDDSFS
FGGGIGLGF
392418642YP_006455247.1 DNA polymerase LigD- polymerase domain protein [Mycobacterium chubuMASAATELDVDGVKVRLTNPDKPYFPKLGKDGTKGKLVEYYLSVAEPMVS
LLRDRPVHLQRFPDGIEGEEIYQKRLPQKRPDYLQACTVTFPSGRTADTL
KVTHPSAIAWAAQMGSVTLHPWQVRCPDTEHPDELRIDFDPQPGTDFSDA
RVIAVDVLKPLLDELGLVGYPKTSGGRGVHVFLRIAADWDFIAVRRAGIA
LAREIERRAPDAVTTEWWKENRGARVFIDYNQNARDRTFASAYSARKTPI
ATVSTPLTWDELRDAEPDDYTIVTVPDFVAGRPDPWAAIETAAQSIEPLL
QMVAADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEDGNRV
392418640YP_006455245.1 hypothetical protein Mycch_4873 [Mycobacterium chubuense NBB4]MSAPRTQVNGYGRYVGRVGALAAALGIGVMVATSPAIASADSSTSSASSK
DASTTTSGGSAASQTGTDSGTQKATSSPSTNSTTAGGSAGSVATADSTDS
AGADAASDSSDAGTDATAADDGTDSSTTGTGTDTTGTDTTETDATETDAT
DTEPTDTDTTGALTEPSQSPDTGGTTATVPESSNRPPASVTETRSTSSHP
TATTETTTVPAQRAASSAPLAAAAPTDPNVTGTVTESPLAGTSSGVAATA
ETSSAATESTALVVPAVAAAAASTGTAGPVIGVIGFLNSVVTNLLNPFLA
PAPSTPGPVTPIVWAVLGFVRRNLFNEGPTITYDPTKTSQTGQTVTGDIG
AVDPEGDTVTYTVTKGPQHGTVTIDQATGHFTYTPDGIDYAGAQTDSFTV
SVTDGKKNLLSFFRQPHGDQTTIDLGVRPPTAERVIVPLPPGFTNAQIPR
FAADGTSLLFSATPPDAAAGARREIYQVNVDGTGLTCVTCGVVDPTPLRA
GTTAPRILSKPVPFEDGSGRILMQSVDPATGAYTHVIYESDADGTRLVRV
LTPAGKPGVIATDPQREMRISPDGTHVLFSQIQLVPNPSDPPGFITAVPI
VGALTPGLDANGNKVYTITDARVVYPVGEGKQWTHDGKGVIILGGLYESG
NVDDIVVDIATGEVTRLTGNLDYDEDADLSPNGQWLTIDSMRGLDALTPV
TRIVRPAFLPLLIQGSVYTAYAGNSDAVNVSNQPWLVAVGDDLHRGDGIP
LFVSDDPNTPQDEGDGWTARSMPSWNADGTEVAFWEADTTDPTGQRSRLV
VAKLQYTTSVGTAADKTTPTVSSAFPTLASNTPTQVSLPPTGTYTGAGGG
TAVVTETTDATTGHIVRTVLYTDYVDDEGMILNGVESTDQSAAQNTIHYI
ADITVTGTHTGSLTGDATINKLTRTITPTTAGSQITSTLDGDTLVLLDPA
RVAAAKAST
392418638YP_006455243.1 putative thioesterase involved in non-ribosomal peptide biosynthesiMTTPSDRSRWIRNFNPSPDAAVRLVCFPHAGGSASYFFPLSRALAPEFDI
YAVQYPGRQDRYSEPFVDSIDGLADEIAAALDPLTDAPVAFFGHSMGAVL
AFEVARRVEARDGRRPVTVFASGSRAPSRYGDEREHKGDYDLVQVMRDLG
GTDPRVLNNPEMLDTFLPAFRNDYRALQAYHRGTDVGISAPIVVMTATDD
PKTSEADARAWHEHTTGGGDVHTFTGGHFYLEKHPERVIEVIAQTLRAR
392418636YP_006455241.1 hypothetical protein Mycch_4869 [Mycobacterium chubuense NBB4]MPNNASYRVVQWTTGNVGKSSVAAIAANPTLELVGCYAWSDDKAGRDVGE
LAGIEPLGVTASNDIDELLALKPDAVVYNPMWIDVDELVRILESGVNVVA
SASFITGRNLGEGRARLAEACQRGGSTLFGSGVSPGFAELLAIVAGTACD
RIDKITIAESADTTLYDSPDTERPVGFGAAIDDPDLQPMAAAGTAVFAEA
VQLVADALGIELDDITCVAEYAQTTEDLPMASWTIPAGHVAGVFASWRGI
AAGRTVIDINVRWKKGQTLEPDWKLDGDGWKITIDGRPTVNMTVGFLPPP
DMIENAKTLEDFFVLGHIMTALPPIHAIPAVVAAAPGIATYNDLPLPQPR
GVVSTG
392418634YP_006455239.1 hypothetical protein Mycch_4867 [Mycobacterium chubuense NBB4]MGRTVAVMWHASFSVAAGVLYFFFVLPRTYELLGDTSHTLGTALRIVTGA
LIGLAALPVVFTLLRTRRPEFGTPKLALNLRTASIVLHVLAGLLIVGTAI
SEIWLSLDAAGQWLFGIYGAAAAIALLGVLSFYLAFAAELPPPPPKPVKV
KQRKSRRRRKGGDTTHDQSEEAADEGSEGDTDQVDGVPDTTDDTAAAAET
ENAGTETQADRADEETADETVPTAESEPAAETEDSDAGTDEASDGKLRNQ
RPTGKRTVLGRRKKNRGGVAVED
392418632YP_006455237.1 DNA polymerase III- subunit gamma/tau [Mycobacterium chubuense NBB4MALYRKYRPATFAEVVGQEHVTEPLSTALNSGRINHAYLFSGPRGCGKTS
SARILARSLNCEQGPTATPCGVCDSCVALAPNGPGNVDVVELDAASHGGV
DDTRELRDRAFYAPAQSRYRIFIVDEAHMVTTAGFNALLKIVEEPPDHLI
FVFATTEPEKVLPTIRSRTHHYPFRLLAPRTMRTLIEKIVASESVEVDDA
VYPLVIRAGGGSPRDTLSVLDQLLAGAEGNKVAYQRALSLLGATDVALID
DAIDALAAGDAAALFGAVEGVIDAGHDPRRFATDLLERFRDLIVLQAVPD
AVARGVVDGPEDVLERMREQASRLGTATLTRYAEVVHAGLGEMRGATAPR
LLLEVVCARLLLPSASDTEAALLQRVERIETRLDMSIPAGENGGAAGAVA
DAAPPKQYVRKTQAPAEPAPEPPRPPAPAPAPKKFDRQPDSPPPMPPPAA
PAVEAPAATPAAAVATGEPNAAAVRSMWTTVREKVRERSRTTEVMLAGAI
VRAVDGDTLVLSHESAPLARRLTEQRNSDVIREALKDALGVNWKIRCETG
TAPASQPAAPEQRRAAAEPPPPPPEEDEESMLAEAGNSDPAAPRRDPEEA
ALELLQSELGARRIDG
392418630YP_006455235.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MTMFKEHAVNSGSDGKLSLAEILEIFAAGRMPLKFTAYDGSSAGPDDAEL
GLDLRTPRGTTYLATAPGDLGLARAYISGDLAMHGVHPGDPYALLSALTE
KLDFKRPPARVLAHIVRSIGIEHLKPIAPPPQEALPRWRRIAEGLRHSKT
RDADAIHHHYDVSNTFYEWVLGPSMTYTCACYPRPDATLEEAQDNKYRLV
FDKLRLSPGDRLLDVGCGWGGMVRYAARHGVKAIGVTLSKEQAAWGRQAI
AEEGLGELAEIRHSDYRDVREGGFDAVSSIGLTEHIGVANYPAYFRFLKS
KLRTGGLLLNHCITRHDNRHGASAGGFIDRYVFPDGELTGSGRIITEIQD
VGLEVLHEENLRHHYAMTLRDWCRNLVEHWDEAVAEVGLATAKVWGLYMA
GSRVGFEQNAIQLHQVLACKLDERGGDGGLPLRPWWTA
392418628YP_006455233.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMAQVSASSTVLINAEPATVLAAVADYEAMRPKILSEHYSGYRVLEGGQGA
GTVAQWKLQATKSRSRDVKAAVDVAGRTVIEKDQNSSMVTNWTVAPAGPG
SSVTMKTSWQGAGGVGGFFEKTFAPIGLRKIQAEVLGNLKREVEGTQAVE
GT
392418626YP_006455231.1 DNA-binding protein- YbaB/EbfC family [Mycobacterium chubuense NBB4MQPGGQPDMSALLAQAQQVQQQLMEAQEALANSEVHGQAGGGLVQVTMRG
SGEVVGISIDPKVVDPSDVETLQDLVVGAIADAAKQVTIMAHDRLGPLAG
GLGDQGFPGLPGM
392418624YP_006455229.1 hypothetical protein Mycch_4855 [Mycobacterium chubuense NBB4]MPGMNRVVLGGEAVRAGVATRHELARDYTRLYRGVFVRKGIEVTLRDRAI
GAWLATGRKGVIGGVAAAALHGAPWIDPDIRIEVVGVTCRPRDGLVVRRD
LLTGDQITYRSGLPVTTRIRTAFDLGRHLERAEALARLDALMWNQRFDIG
DVLDIADRLPRLRGIAQLRELLPLVDGGAASPRESAIRLRLHDKGFPRPE
TQIPVLQGSRAIAFLDMGWQEYGVAVEYDGDHHRKNREQYVKDIGRLRTL
EALDWIVIRVIAEDRPEEWLARVEGALHRRGCPLALRDRPTLAA
392418622YP_006455227.1 UDP-N-acetylmuramyl tripeptide synthase [Mycobacterium chubuense NBMVTARGRFALTAGAGARWASRVTGRGAGAMIGGLVAMTLDRSILAQLGQG
RRSVVITGTNGKSTTTRMTAAALATLGPVATNAEGANMDAGLVAALAAAP
EAPLAALEVDEMHVPHVSDAVNPSVIVLLNLSRDQLDRVGEINHIERTLR
AGLARHPAAVIVANCDDVLMTSAAYDNPNVVWVAAGGGWASDSVSCPRSG
EVIVREQQHWYSTGSDFKRPDPDWWFDDTHIHGPGGLSLPMALTLPGTVN
RGNATQAVAAAVALGADPAAAVAAVSAVDEVAGRYRTLQVGAHTVRMLLA
KNPAGWQEALSMVDRDAAGVVIAVNGQVPDGEDLSWLWDVGFEHFESVPV
VAAGERGTDLAVRLGYAGVAHTLVHETRAAIASCPPGHVEVLANYTAFLQ
LNRVLSRA
392418620YP_006455225.1 hypothetical protein Mycch_4851 [Mycobacterium chubuense NBB4]MWNSFWSFLWSTVVIFAFIAYLMILFNILVDLFWRDHKTSGWIKAVWVIF
LVVLPYVTALVYLIARGKGMAERAREQALQAKRETDDYIRQAAGRSPAQE
IADAKALLDAGTITHSEFDGLKAKALGQQLAMDRMVR
392418618YP_006455223.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MPSPDDHPLRTESDSLLRNTSGTARDRDPAEPVEELEIEAAIGRNVRLLR
LQQGLTVAETAARVGISKAMMSKIENAQTSCSLSTLALLAKGLDVPVSSL
FRGADVERPAAFVKSGTGARIVREGTREGHEYQLLGSLRGEHKRLECLLV
TLSEKSRTYPLFQHPGTEFIYMLEGVMDYSHSRSVYRLHPGDSLQIDGEG
AHGPVDLVEVPIRFLSVIAFPDSQV
392418616YP_006455221.1 glutamate synthase family protein [Mycobacterium chubuense NBB4]MTYTSDDRARLGLRESATFDRATIAAIQRAADTGIYDIRGWGAKRALPHF
DDLLFLGASMSRYPLEGYRERCATDIVLGDRFAKHPLHLDIPVTIAGMSF
GALSGPAKEALGRGASEVGTSTTTGDGGMTPEERGQSKYLVYQYLPSRYG
MNPDDLRKADAIEVVLGQGAKPGGGGMLLGQKISERVAAMRTLPEGIDQR
SACRHPDWTGPDDLTIKINELREITDWEKPIYVKVGATRTYYDVKLAVHA
GADVVVVDGMQGGTAATQEVFIEHVGIPTLAAIPQAVQALQELGVHRRGV
QLIVSGGIRNGADVAKALALGADAVAIGTAALIALGDNHPRYAAEYEKLG
SAAGFYDDYQDGRDPAGISTQDPDLAARFDPVAGGHRLANYLRVLTMEAQ
TIARACGKSHVCHLEPDDLVAVSIEAAAMAKVPLAGTSWIPGR
392418614YP_006455219.1 glutamate synthase family protein [Mycobacterium chubuense NBB4]MCGIVGLHLRTPELYPRLGELLTGMLCEMGDRGSDSAGVAVYGDPAWSPP
GAGCVSVAELAAGDRRCVADVTSAVAAALGDDVDGIAVDGSYLLSAGRRS
EELLVAVRSAFPHAIIAGFGSDVAVLKGVGYPRALTGGWGLATARGWQGV
GHTRMATESAVTPAGCHPYAVGPGQCMVHNGSFANHATIRRELRSAGVEF
DSENDTEVGARFIAALLADGRDVEGALKELCATFDGFYTLLVSDRDSFAV
VRDAIACKPAVVAETDEWVAMGSEYRALAGLPGVEKARIWEPEPEVVYAW
QR
392418612YP_006455217.1 ammonium transporter [Mycobacterium chubuense NBB4]MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAIV
GVLWVLFGFSMTFGTSYGGFVGSFTEFAGMKNLMEPMTTIKGLPISLFSL
FQALFAAITVALISGAVADRMKFGAWMGFATLWAVLVYFPVAHWVFAFDG
VVTENSTGGWIANKLKAIDFAGGTAVHINAGAAALAVAIVLGKSASWGQL
RKPHNVPLTLLGAGLLWAGWYAFNGGSALAAGNSAAIVMVTTFVATCAAT
LAWIAIEKIKDGHVTGVGAASGAITGLVAITPACGAVTPVGAIILGAIAG
AVCVYAVGLKERFGYDDSLDVVGVHLVGGVIGTLLIGFLASDTMPNATNG
LFYGGGFDQLWRQAVAAGAVMAFSFVVAFIIAFALKKTVGIRISPDDEEK
GIDAAFHREASYELLPA
392418610YP_006455215.1 hypothetical protein Mycch_4841 [Mycobacterium chubuense NBB4]MIEPIRRQIVVNAPVERAFTVFTAQFGDFKPREHNLLPVPIAETVFEPRV
GGRIYDVGADGSRCEWARVLHFEPPSRVVFSWDIGPTWQVEADVAKTSEV
EVRFIAEAPDRTRVELEHRHLDRHGEGWRSVADGVGGDAGWPLYLARYAE
LVGHR
392418608YP_006455213.1 nitroreductase [Mycobacterium chubuense NBB4]MPSPLDSAPTDRLADTSVPIHPLLAARWSPRAFDPTAELAHEDLTALLEA
ARWAPTWGRRQPVRFVVGVRGDATFATLADLLRRGNGYAKAASALILLCA
DQGDDDKTALYSGVDAGAALANLSVEAVARGLIVHPMAGFYPERAVEELA
LPEGLRPLMVIAVGRLGDYAEVPPEIAERDRLPRERLPLSEIVLNRG
392418606YP_006455211.1 aspartate-semialdehyde dehydrogenase [Mycobacterium chubuense NBB4]MVNIGVVGATGQVGQVMRTLLAERDFPADEVRFFASARSAGKKLEFRGQE
IEVEDSETADPSGLDIALFSAGATMSRVQAPRFAAAGAVVIDNSSAWRKD
PDVPLVVSEVNFARDAGVRPKGIIANPNCTTMAAMPVLKPLHDEAGLVRM
IASTYQAVSGSGLAGVEELFGQASAVVENSRDLVHDGRAVDFPAPNKYVA
PIAFNVVPLAGSLVDDGSGETDEDQKLRNESRKILGIPDLAVSGTCVRVP
VYTGHSLSLNVEFSEPLSAARATEVLSEAPGVTLVDVPTPLAAAGVDESL
VGRIRQDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLAAQL
392418604YP_006455209.1 hypothetical protein Mycch_4835 [Mycobacterium chubuense NBB4]MAPQTVYMAQPPSRLNKVAAWVGIAAGSVFVVAVLFGAGFFVGKQVGHDS
RDDRGREMMMRPGTVMLPMPPRGEFERGPGFAGPFGPGGPMIQIPRPPQS
PGAPDTTAPSRP
392418602YP_006455207.1 peroxiredoxin- Ohr subfamily [Mycobacterium chubuense NBB4]MIGPMSIEVVYTAESTATGGGRDGHVKSTDGKLDLDTRPPKEMGGSGEGV
NPELLFSAGYSACFLGALRLVAKDEEIGLDDASGITARVGIGESGKAVGD
GESSEADGGLGLTVELIGYLPGLEQAVADDLMQKAHGVCPYSKATRGNID
VKLAAKV
392418600YP_006455205.1 glutamate--cysteine ligase family protein [Mycobacterium chubuense MAGAMASQCAVDCADNALTSAEAAASHIVDGCLTDGPVGRVGLEIEAHCF
DLTDASRRPGWDELTAVIAGLPPLPGGSVVTVEPGGAVELSGPPMADPVS
AITAMAADRSVLRASFADAGLGLVLLGADPLRVAQRVNPGGRYEAMEEFF
RTSGTQEAGAAMMTSTSSVQVNIEAGPRAGWADRVRLAHALGPVMIAIAA
NSPVLGGQFTGWVSSRQRVWSRLDAARCGPILGESGADPASDWARYALRA
PVMLVHNPDPIPVVEWVPFADWADGLVPLGRRRPTVADLEYHLTTLFPPV
RPRGFLEVRYLDSVPDSVWPAVVFTLTTLLDDPGAADIAAEATEPVAAEW
DRAARLGLADRHLWQAAQRCVQTAAERAPVDVAESMEVLARSVERGRCPA
DDFADRAVTRGIAAAVTELAQGEL
392418598YP_006455203.1 TIGR03442 family protein [Mycobacterium chubuense NBB4]MCRHLGWLGEPVSVASLMLDPPSGLLVQSYAPRRQKHGLMNADGWGVGFF
TDDTTVPRRWRSAAPLWGDASFASVAPALSSRCVVAAVRSATVGMPIESS
ASAPFTDGTWLLSHNGVVDRAVLPAARDAESTNDSALLAALIFGRGMDAL
GDTIAGVGADDPGARLNIVAADGSRLLATTWGDTLSVLRRDDGVVLASEP
YDDDPAWQEIPDRHLVEVTGARVESTPLTALKGS
392418596YP_006455201.1 selenocysteine lyase [Mycobacterium chubuense NBB4]MTLAERWRAARPPAAGVHVDSAACSRQSFASIDAATQHARHEAEVGGYVA
AEAAAPALDAGRAAIRALTGMEDAEVLFTTGSSHALDVLLSSWSGERTAA
CLPGEYGPNLMALAHHGFDVRELPVDGFGRLDLDALGTVLATDPPALVHF
TVLGSHSGIVQPAHDIASACRAHGIPLIVDAAQGFAHLDCSAIGADAVYS
SSRKWTAGPRGVGMLATRSDLVSDVARLRLTHGETNVGLHLGLSVALGEH
LAAGPDAVQARLREVGAATRTALADVAGWRVWEPVEEPSAITTLHPPDGV
DPMSVRARLIAEHSIVTTYLATERAPKEMTRPALRISPHVDVTDTDLETL
ADALTAVTR
392418594YP_006455199.1 hypothetical protein Mycch_4825 [Mycobacterium chubuense NBB4]MTVVGEELKQTEFSRAHRREYRRKVQLCLDVFETMLAQSSFDFEKPLTGM
EIECNLVDADYQPAMNNSEVLAAIADPAYQTELGAYNIEFNVPPRRLPGR
AALELEDEVRASLNAAEAKASTDGAHIVMIGILPTLMPEHLSGAWMSEST
RYQALNDSIFTARGEDIMIDIAGPERLSLQAASIAPESACTSMQLHLQVS
PADFASNWNAAQVIAGPQLALGANSPYFFGHHLWAETRIELFTQATDTRP
DELKTQGVRPRVWFGERWITSIFDLFEENVRYFPSLLPELSDEDPVAELA
AGRTPRLSELRLHNGTIYRWNRPVYDIVEQDGVGRPHLRVENRVLPAGPT
VIDMMANSAFYYGMLRTLSEEDRPLWTKMSFAAAHHNFVQAAQHGMDATM
YWPGLGEVTPDELVLRRLLPMADEGLRRWEVAAAVRDRYLGVIEGRAKTG
RNGAAWQASAVEALQDRGMSRPEALAEMLRLYCERMHTNDPVHTWDVPD
392418592YP_006455197.1 adenylate/guanylate cyclase family protein-protein kinase family prMEGTPFGRYRLIDLLGRGGMGEVWRAHDTVTDRVVAVKLLPAQWAQDEVY
LQRFRREAHAAAQLNEPHVVPIHNYGEIDGRLYVDMRLIDGCDLQTLLDE
GPLIPARAVTIIEQVAMALDAAHQAGLVHRDVKPSNILVARYDFAYLIDF
GVARASHDTGLTNSAHLVGTLPYMAPERFRSGASDVRSDVYSLTCVLAQC
LTATTPFAGPSVEEQMMGHLTAPPPLPSLINPYIPSEFDGVIAKGMAKNP
DERYQTVLELAEAAGAALGGAAATPPRGRLPSTLPNGVGHGELAETLLRE
GVPAERGSETSAAPDGIDLSRTGDSIDELLDRAVAAINRGDRAVASALAD
QVLAVDHRNAEAEDLLRAPTDSGEIRRLTLVSADLVDPTDLALRVEPETH
RLLIGRFRALVRQTADRYEGHVASTKADGLLVVFGYPSAHEDDVYRAVQA
GLDIVRNVERLSDQAHRRFGATVEVRIGVHRGPVYLDDNQDDVYGLAVTL
AEQVSALAPKGGVAVSHSVEPLIRNAFDLESLPAAAMPGTDEVINPFHVL
GERAYAAKAPMGPLVGRDRELARLHKSWQRAQAGTLTIPAVVFRGEAGIG
KSRLAAAAAELVPREGGTVLELVGSPVHADVGLYPARQLLERRSGITRLT
EPAKRLQLLAAEVTNLGLDPDTEIPLLAPILGLDASLGYEPPQAEGRKLQ
ELIASALKNYLLTAFGEAPGLLLAEDAHWFDQSTLSLLGSLLTATHGRLL
AVITGRDGNWLSDQWPAKVFDLSPLTDEQTDQLVLALDPRVAPEQCAAVR
QRCGGVPFYIEQVVNGMGSPSDTSEPTVPDSLYEPLFARLLAVPDVVPVV
EAAAVIGRHVERGLLVAVSSLSADKVDDVIDELEDAKVFEPHGPDAWKFR
HELLREVAAELAPPSVRRTLHGKTADVLVQGAAGEPDWRLVAAHYEQAER
YADAAGAYRQASADARRRGALEEARTYLTRSLTQLELCPPGRDRDRLEIE
PRLERGFLTSTAEGYQSPSVAGDLERCLQIVGSDLHDDQVFGTLLAVSSY
YINKSDVRRAKQLAEAMQAKPDEQRRSWSPAIACVLGMATFLRGQFDTAR
DFFEEASAGFDDEGQNSMQELWFIPWDVVALAHEHLSIYHILHGDQAAAD
AAMARAINRGDELAFPWGPYNQAYASHIEIWMRREAGQLDSARRTVTEMV
ERAERYGIDFWQALGSTLGQHTVEADILLRAPDTAPDALTAQIEQLTAAT
DLWRALGLFAYQTQYDCVIGQLLIATGRLDEARQRIDTALQIADDTEMHF
FDAELLRARAQTYADPDIRAADLAAARGLARRQGAPLFELRAALDDFELR
GAAARPALADALTRLPDDCVLPDAVRARALLAG
392418590YP_006455195.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMDHMAGRTVDVDRLSHMPRGGPDASCLDRLLQTNRQEYLDRDSDAPADVA
RKRSVIRALDWTGQVFGNHEKFAKIALDEVADVADPRILELGAGHGGLSR
KLLEWHPTARLTITDVEPASVAAIAASELGSHPRATVREMDATAMDAADG
EFDLAVFALSFHHLPPPAAARVFAEGTRVATKLLIIDLPRPPAPLHLLRL
AAMLPWAPVVPFVHDGVISSLRCYSASALRALAAHADPSIDVELRGGLFG
PQVVVAGRHR
392418588YP_006455193.1 bacterial peptide chain release factor 3 (bRF-3) [Mycobacterium chuMTISTAAPRTDRVSAEARRRRTFAVISHPDAGKSTLTEALVLHAKAITEA
GAIHGKAGRRSTVSDWMEMEKARGISITSTALQFPYTTQTGNSCVINLLD
TPGHADFSEDTYRVLTAVDCAVMLIDAAKGLEPQTLKLFQVCRHRSIPII
TVINKWDRPGRHALELMDEIHDRIQLQTTPLTWPVGIAGDFKGVLDRRSG
TFIRFTRTAGGATAAPEEHIDASRAHDAAGADWDNAIEESELLSADGADF
DRDSFLRCTSTPVLFTSAALNFGVNQLLEVLAELAPSPSGQLDVDGNLRE
ATAPFSAFVFKVQAGMDSAHRDRIAYARVCSGTFERGDVLTHAATGKPFV
TKYAQSVFGQQRSTLDTAWPGDVIGLANAAALRPGDTLYSEVAVQFPPIP
SFSPEHFSVARNTDPSKHKQFRKGIEQLDQEGVVQVLRSDRRGDQAPVLA
AVGPMQFEVAAHRMATEFGAPISLESLPYTVARICDAADAPTLQKLASVE
VFTRTDGVMLAVFSTKWRLENVARENPTVTLRSLVAAGD
392418586YP_006455191.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MNTPFTPPPGPFGGHPGPGFGFGFSPQDRRALHERRRQARRDFREHVREH
RGDAGFGPGFGPGFGPGFGFGFGPGGRGRRGGPRGAARGKRGDVRAAILT
LLTERPMHGYEMIQEIDERSQQLWKPSPGSVYPTLQLLVDEGLLVGTETE
GSKKLFELTEEGRAAAEKIETAPWDEITEGADPGAMGLRSAVGQLMGAVA
QSAHAATAEQQQRIVEIVNNARREIYHVLGED
392418584YP_006455189.1 Kef-type K+ transport system- membrane component [Mycobacterium chuMAVSGFGFATLALIVVIGMAGPLIASVGRFGIPAVIGELAAGIAFGSSGL
RIVDHTDPVFTLLADIGFALVMFVAGTHVPVRDASLRTALPAAAVRAVLA
GLGAAVLAVVLAQVFGTGHALLYAVLMASSSAALALPVIDSLGLTGPPVL
SVTAQIAIADTAAIVLLPLAIAPSQAGRASLGVLAVFGCAAVVYGLLRVA
DRRGWRRRAHRFTERYRVALELRVSLMLLFALCALAVTTRISIMLAGFAL
GLVVAAVGQPRRLARQLFGVTEGFFGPLFFVWLGASLNIGALGTNPKLIA
LGVALGLGAVLAHTAGRMLGQPVPLAVLSAAQLGVPVAAATLGSDRKILT
AGEPAALILGALVTVVAAAVAAAVLRRRQQAAPT
392418582YP_006455187.1 putative integral membrane protein [Mycobacterium chubuense NBB4]MTDHSLTVLSTVAALASAVAGGMMFVFSTFVMRGLDRVGPLDAISAMRGI
NAEAESNALFLIVYFGAAVLAVAVGVLAGLRWHTPGSAWLLAGAVCGVVG
AIVTVAFNVPLNDRLDAGPVSAPAWNSYLDAWTRWNHVRTVSSLAAAALL
TVGAVQRADVAHRVTMAA
392418580YP_006455185.1 uncharacterized membrane protein [Mycobacterium chubuense NBB4]MDVDAFVQANRPAWDRLDRLVKKRRHLSGAEVDELVDLYQRVSTHLSMVR
SASTDAVLVGKLSSLVARARSVVTGAHAPLWREFTRFWTVSFPVVAYRSW
RWWLATAVAFFAVTGVIALWISGNPDVQAAVGSPAEIDQLVNNEFADYYR
EHPAGSFALSVWTNNAWVAAQCIGSSILLGLPVPYVLFQNAANLGVIAGL
MFESGRGDVFLGLITPHGLIELSAVFLAGAMGMRLGWSVISPGDRPRAQV
LAEQGRAVVSVAVGLVAVLLVAGLIEAFVTPSPLPTPLRVAIGVAALLGF
LGYVVHFGRRAVRLGETGDIEDAPDYVPTG
392418578YP_006455183.1 hypothetical protein Mycch_4809 [Mycobacterium chubuense NBB4]MVITGRAGLIALLCVLPIALSPYPAATFAVLLTAVAVAVAVDAALAGSPR
ALRMTRGGETSARLGQPVGALLTVDNGGGTRFRGVVRDAWAPSANAAPRM
HDVNLAAGQKVTLSTRLAPSRRGDQVSALVTARSVGPLGLAGRQGSHRVP
WQVRILPPFLSRKHLPSRLARLRELEGMTPALIRGQGTEFDSLREYVVGD
DIRSIDWRATARRADVVVRTWRPERDRRVVIVLDTGRTSAGRVGVDPTSA
DPGGWPRLDWSMDAALLLAALAARAGDHVDLLAHDRVTRAGVFNASRTDV
LVRLVDAMAPLEPALVESDARAMVAAVQRRVRRRALVVLLTDLNASAIDE
GLLTVLPQLSAKHQVLVAAVSDPRVDRLATGRTDAVAVYDAAAAERARID
RRTVAALLRSHGVDVVDAPPEELAPALADHYLAMKAAGRL
392418576YP_006455181.1 hypothetical protein Mycch_4807 [Mycobacterium chubuense NBB4]MTVTGPSSAVGATLRQRWRGAKWVLAALVVIVAVAVLSTWLTAARPGGRL
DPESTSAQGARALVTLLREHGVDVVAATSLADVERQARPGTLLVIAQTFH
LTGDSATLRRLADLPGDRLLVEPASRTREALAPALRRSDSTAFGGLAPNC
DLREADRAGTVAFGAADAYEAAGSIPVTRCYDGVLARYSDGGRTITAVGS
AEFMVNSGLLDEGNAALAMNLAGAAPRVIWYAPQHSEGGETAGASTLSDL
IPTQVRWMVLQLMVVVALLALWKGRRVGPLVAEQLPVVVRASETAEGRGR
LYRSRRARDRAADALRTAALQRMLPRLGLGPTAPPPTVVAAVAARSGRDA
QVLARTLYGQPPAGDAELVDLARELDDIERQVAQS
392418574YP_006455179.1 hypothetical protein Mycch_4805 [Mycobacterium chubuense NBB4]MAAPKPAAGGVTLSITGAIDKMGTMTYDAGGYGPAGSPPPGAPPTGYPPP
GPPGFPPPGYGPPPYGAYGPPPGYAGPGYGSAGYFAPPPVIRPGVVPLRP
LTLSDMFNGAIAYMRVNPKATLGLTTIVVVAAQLFGLALSLWPLAFAGQL
AGSLEGDANNGASLVLQNGSGLASLASSFAATVATTLSTILLSGLLTVVV
GRAVFGAGIGIGEAWRRLKPRLWALIGFTLAEGIGALVLIAIPVVIIAVV
AVAANGWAAFFFAIPLVLALIAALAYLGTMLAFAPAIIVLERGRIGYAVR
RSFSLIKGDFWRVFGIRVLAVVVAQIVAAAVAIPFSFGGQFLLTAAASTG
TAMIAMVLIAVGGAIGQIITGPFSAGVVVLQYTDRRIRAEAFDLVLQTGA
TTGWAAPPNSTDDLWLTGQR
392418572YP_006455177.1 hypothetical protein Mycch_4803 [Mycobacterium chubuense NBB4]MTRGKGIYDDEKTSTASEETDTEKDADAETPDVDKDTGEPTA
392418570YP_006455175.1 cysteine synthase [Mycobacterium chubuense NBB4]MTPTGTSDCCRQSRSWVDNAVRLIETDARRSADTHLLRYPLPASWSTDCD
LALYLKDETTHITGSLKHRLARSLFLYALCNGWIGEGTTVIEASSGSTAV
SEAYFAAMLGLPFIAVMPASTSTTKIKLIESQGGRCHFVTEAAQVYAEAQ
RLAEETGGHYLDQFTNAERATDWRGNNNIAESIFDQMAMETHPIPTWIVV
GAGTGGTSATIGRYIRYRRHATRLCVVDPENSAFYPSYVNGDPDVVTGLS
SRIEGIGRPRVEPSFLPGVVDRMVTVPDAASIAAAHHVSRVIGRRVGPST
GTNIWGAFGLLAEMAAQGRSGSVVTLLADGGDRYAETYFCEEWLTSHGLD
PSEPAEVLAGFERSARWP
392418568YP_006455173.1 membrane carboxypeptidase (penicillin-binding protein) [MycobacteriMPEHPPTSPTEPPPRSVTVIKLAWCVLLASVVAAGLMFPVVGGIGLMSNR
ASDVVANGSAQLVEGEVPQVSTMVDAKGNVIAWLYSQRRFEVPSDQIANT
MKLAIVSIEDKRFAEHNGVDWQGTLTGLSGYLSGNLDTRGGSTIEQQYVK
NYQLLVLAQTDAEKRAAIETTPARKLREIRMALTLDKTFTKSEILTRYLN
LVSFGNGAFGVQDAAQTYFGINASELNWQQAALLAGMVQSTSTLNPYTNP
DGALARRNLVLDTMIENLPEHADELRAARQQPLGVLPQPKELPRGCIAAG
DRAFFCDYALDYLARAGISKDQVAKGGYLIKTTLDPDVQNTVKSAITSFA
SPDLPGVASVMNVIRPGKDSHPVLAMASNRTYGLNLDAGETMQPQPFSLV
GDGAGSIFKIFTTAAALDMGMGINATLPVPGRFEAKGLGSGGAKGCPPAT
WCVQNAGSYKGSMDVTEALATSPNTAFAKLISQIGVPRTVDMAIKLGLRS
YALPGTARDYDPNSNESLADFIKRQNIGSFTLGPVEVNDLELSNVAATLA
SGGTWCPPNPIDKVVDRHGEEVSVTTETCEQVVPEGLANTLANALSHDDQ
GNGTAAGAAGSVGWNLPLSSKTGTTETHRSSGFLGFTNHFAAANYIFDDS
NSPGELCSFPLRQCGDGNLFGGNEPARTWFAAMKPLTAPFTDVTLPPTDP
RYVDGAPGSRVPSVSGMDQDTARKRLREAGFQVADQATPVNSSSDYGTVV
GTTPSGATVPGSIITIQISNGIAPAPPPPPPSAAIPGGPPPQVGSTVIQI
PGLPPITVPVLGPPPPAPPPPP
392418566YP_006455171.1 oxyanion-translocating ATPase [Mycobacterium chubuense NBB4]MSTTPRALDMASILRDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRCV
VVLTIDPAKRLAQALGIRDLGNSPQRVPLAPEVTGELHAMMLDMRRTFDE
MVVQYSGSERADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLAEDKWDL
VVVDTPPSRNALDFLDAPKRLGSFMDSRLWRLLLAPGRGIGRLVTGAVGL
AMKGMSTILGSQMLSDAAAFVQSLDATFGGFREKADRTYELLKRRGTQFV
VVSAAEPDALREATFFVDRLSTEHMPLAGLILNRTHPMLCGLHGDKAAEA
ADELATSDPDSVAVAALRIHADRASTAKREVRLLSRFTGANPTVPIVGVP
SLPFDVSDLDALRAIADQITGEAA
392418564YP_006455169.1 hypothetical protein Mycch_4794 [Mycobacterium chubuense NBB4]MSEPTRWEYATVPLLTHATKQILDQWGEDGWELVSVLPGPTGEQHVAYLK
RPK
392418562YP_006455167.1 Zn-dependent hydrolase- glyoxylase [Mycobacterium chubuense NBB4]MDHPAYGVLRPVTETASVLLCENPGLMTLDGTNTWVLRGPGSDEMVVIDP
GPDDKDEHIERLAELGPIPLVLISHRHGDHTGGIDRMVDLTGAVVRSVGS
GFQRGLGGPLADGEVIDAAGLRITVMATPGHTADSVCFLLDDAVLTADTV
LGRGTTVIDKEDGDLGDYLESLRRLHGLGHRMVLPGHGPDLQDSAAVTET
YLAHREERLDQVRAAVRELGEDATTRQVVEHVYTDVDEKLWDVAEWSVQA
QLNYLRR
392418560YP_006455165.1 hypothetical protein Mycch_4790 [Mycobacterium chubuense NBB4]MSWLLVALIPGLLMVATFGLERVEAGLRRESISAADVADFLDQAEASDVT
TLARDGMDTALHGLQQRRSERDYPEAKLSHPVPAPSLPTHAYFAQRANTE
FQQTRSVNPV
392418558YP_006455163.1 thiol-disulfide isomerase-like thioredoxin [Mycobacterium chubuenseMSASARWSIAALVVLVVLAMGLWSQLGSGDGPTSTPESVSARDRRDADTA
QALAAPRARADLAPCPSAGPGAGPEALRGIVLECAGDGADVDVAAALAGR
VTVLNLWAYWCAPCAAELPAMAEYQRRVGSRVTVLTVHQDENETAALTRL
AELGVHLPTLQDGRRRIAAALKVPNVMPATVILRADGSVAEILPRSFASA
DEISAAVDPKIGDA
392418556YP_006455161.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMTASQWLDIAVLAVALIAAVSGWRSGAPGSLLALVGVALGAVAGVLLAPH
VVDHISGPRTKLFVTLFLILGLVVIGEIAGVVLGRAVRGAIRSPGLRIVD
SVVGVALQLVLVLTAAWLLGTALVSSPQPNLAAAVQGSKVIAEVDSVAPN
WLRTVPGRLSGLWDTSGLHEVLKDFGPTPVAAVEAPDASLATSAVVGATK
SSVVKVRGVATSCQKVLEGSGFVVAPNRVMSNAHVVAGAETVTVEVDGQT
YDASVVSYDPNADISILDVPNLPSAPLQFADGQAPSGTDGIVMGYPGGGD
FTATPARIREVIELNGPDIYRSTTVTREVYTIRGTVKQGNSGGPMINRSG
KVLGVVFGAAVDDVDTGFVLTADQVSQQMAKVGNVARVTTGTCVNG
392418554YP_006455159.1 Protein of unknown function (DUF1469) [Mycobacterium chubuense NBB4MSDRRNGVPTTVTSIPLVDPHAPKPDPSIGDLVKDATAQVSTLVRAEVEL
AKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFLAELLDSWLWRWAA
FLIVFGIMVVVTVVLALFGYLKVRRIRGPQKTIETVKEIPDALTPGPDKR
AIATTDGKQAPTADPSGW
392418552YP_006455157.1 acetyl-coenzyme A synthetase [Mycobacterium chubuense NBB4]MQPWVTTLTTMTETHVDVQASYPPAPEFTANANASEALYEEAEADRLAFW
ATQADRLAWDTPYTEVLDWSDAPFAKWFVGGKLNVAYNCVDRHVEAGNGD
RVAIHWEGEPVGDARDITYAELKDEVSRAANLLTELGLRSGDRVAIYMPM
IPEAIVAMLACARLGAMHSVVFAGFSASALKARIDDARAKLVITSDGQYR
RGKAAPLKAGVDEAIDGLGEDSPVEHVLVVRRTGIDVPWTEGRDLWWDET
VPNASPEHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQASYTHH
HVFDVKPESDVYWCTADIGWVTGHTYIVYGPLSNGVTQVVYEGTPASPDE
HRHFQVIEKYGVTIYYTAPTVVRTFMKWGRELAFEHDLSSLRLLGSVGEP
INPEAWRWYRLVFGGDRTPVVDTWWQTETGGIMISPLPGVTSCKPGSAMH
ALPGISAKIVDDDGNELAPGTDHGEQASGYLVLDQPWPAMLRGIWGDPER
FKETYWSRFAEQGWYFAGDGARYGKDGEIWVLGRIDDVMNVSGHRISTAE
VESALVGHSGVAEAAVVGATDEHTGQGICAFVILKSHAKEMSRDQMIDEL
RAEVSREISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTST
LVDPSVFEAIRASK
392418550YP_006455155.1 HAD-superfamily subfamily IB hydrolase- TIGR01490 [Mycobacterium chMTSPEPATGAFEPAERASQDRPIRTAAFFDLDKTVIAKSSTLAFSKPFFS
QGLINRRAVLKSAYAQFLFLMSGADHDQIDRMRSYLTNMCAGWDVEQVKG
IVGETLHDIVDPLVFAEAAELIADHKLCGRDVVVVSASGEEIVAPIARAL
GATHAMATRMVVEDGKYTGEIAFYCYGDGKVEAIRALAAREGYTLEHCYA
YSDSITDIPMLETVGHPTVVNPDRSLRKEAASRGWPVRTFSRPVSLRDRI
SAPSGAAVATTAAVGVSALAAGALTYSLLRRFAL
392418548YP_006455153.1 Flp pilus assembly protein- ATPase CpaF [Mycobacterium chubuense NBMSAPLIDRVRERLAAERAALRPSIVAAAIRAESGGVLGDTEVLSSLRELQ
TELVGAGILEPLLCAPGTTDVLVTAPDAVFVDDGRGLRQTSVRFADEAAV
RRLAQRLALRAGRRLDEAQPWVDGHLSSVGGGHPDGPLTVRVHAVLPPIA
AAGTCLSLRVLRPATQDLDALVASGAIDAEADALLREIIASRLAFVVSGG
TGAGNTTTHL
392418546YP_006455151.1 type I restriction-modification system methyltransferase subunit [MMVRLLSKDPKRTEADVQSDIKALLLQPNFGLEDQQVPKLEVQTEDGTRRR
IDILTGATVVEVKKDLTAAVRKEAEPQLSGYIDNRIELTGGRYNGILTDG
RSWVLYEVDPATNQLAVRSELAINAVGDTDRLVAWLSAVLATDHGLTPTP
RTIEERLGVESPAYAQDHAYLASLYDALHDDPTVSLKRALWARLLRSALG
VGFDAKEGRLFIDHTMLVIEATVIAHALMGFTEEELMADPAAMLAGERFT
EHDIHNAVEAGFFDWLLEHSDGQKFIRQLIRRVAVFDWDKAQHDVLKHLY
ESVVNAATRKTLGEYYTPDWLAEAVIDHTMGDDVLDKRVLDAACGSGTFV
FHAVRRYLAAADAAGHDPSNAIDGAQSHVFGLDIHPVSVALARTTYLMAL
GSRLTGPRGTITVPIFLGDAVQWASDASVAADTIKIPVDAHDLANSAAEP
TLIDIEQTLVFPLSSIDDPGTFDRLTTALTDLAQTVTGKSKRPSAASILS
SFSISPSSDDGKILTETFKLLCDLHAEGRDHIWSFFVRNQVRPLWFSLPG
RKVDVLIGNPPWVSYRHMTEAMQSKFQSFCTQRNLWHGKSLATHQDLVAL
FAVRACELYLKDGGTFGLVTPLAVLDRQQYEGFRAGNWGTYVRGQITEWW
DLEKVRPQPFPVPAGVAFGVHHAYDGVGIGSAAEPPHGSPSTKEAFAGRS
AATWEATEPQLTCTTEPNVGRSVDDTAASPYAAVTRQGANLVPRYLFLVE
RVAGGGKLGHAAGKQPIVSRRSTQEKAPWKDRPDVHGSVEKQFIHTALLG
ESIAPFRLLDPFETVVPVDNGSLLKQSDIDKNPGLAQWWNAVNAEWDEHK
TGQNRAKAVSLTQQADHMGKLTRQLGGAKHRVLYSKSGNTLAAVRTDNPD
HIVDHSLYVVPARNEPEAVYLTAVLNAPAVTAAVAQYQSKGLFGTRHFDK
YVWLLPIPQYNGSDALHEQIVELGRHAEEVAAAVDIPAGTGFQAARKLIR
QALIADGVSGALDTAVGPWLPTPAEIDATAAAVTPLGDEDSTGVDAASEV
LLDGS
392418544YP_006455149.1 hypothetical protein Mycch_4772 [Mycobacterium chubuense NBB4]MTTRTRTLSTAHEEHEAFALLDDAIAALSAIAYGNDTDQNTVPVDAVLIV
RVQRDDDDGDRTGHVAVYPRVGAQPASTRALIEKAGKLLDQATADGDAGD
DQPRPAGPGGWTPTPTPAAPPMA
392418542YP_006455147.1 hypothetical protein Mycch_4770 [Mycobacterium chubuense NBB4]MSDTDSDADRRFAHNLFSGTDDDQAPAGKQKQRDRADDGQRDGDDDAEGR
RFAADLFAPDDPEANVLAGLTHGKTVGRWQHPEREPEDRGPWFDRRPPTD
DFFRI
392418540YP_006455145.1 hypothetical protein Mycch_4768 [Mycobacterium chubuense NBB4]MPDWDTMRALLAGIPVLPGAPCKGRSDLFERTIGEHRAAGRLTTTEIDTA
RHEALRLCHDRCPALDACRAYLQALPIAHRPRGVVAGLVITSNGVPMKTG
GVIAGQVVKRP
392418538YP_006455143.1 hypothetical protein Mycch_4766 [Mycobacterium chubuense NBB4]MIRPIPAAYAGAIDVPCPTCSAEPGAFCLVEDGRRGPRRRRVPCVRRCPP
GPPDVEHQAPAYPTRSFSEPIHPHETQE
392418536YP_006455141.1 hypothetical protein Mycch_4764 [Mycobacterium chubuense NBB4]MDARQFDGFALVDWARSACLCDVGAPGHSLAVAVTDDGRDVLWLIDDAEL
HAEHPRHGDSRQPHEQVGPLPERWRERVAWSAAFRCGRPTKSGRPCKLPV
DQAGGSCSFHRAANPDAERQAAS
392418534YP_006455139.1 hypothetical protein Mycch_4762 [Mycobacterium chubuense NBB4]MPVDIYCDGRRAAGQDAKHDPWLVARWVRIDGEWARTGRVADAGAQPRFL
KGQLAQLIQDGSPIESVDDWRPDARARYPMKCPRCRFDVVVTKSPKFVEF
LDAHEPEGTPSPLLSEMVASLR
392418532YP_006455137.1 Flp pilus assembly protein TadB [Mycobacterium chubuense NBB4]MIGAALALAFAVLVSPDTARARVTVLMPALGKRRAVPGTWCAVVVWAALA
LVVPVTGVLAAGVLGATVLSRRRLRRRASVRVAEAAALQGALDLLVAELR
VGAHPVGAIEVAAAEADGQVAESLNAVAARALLGADVAAGLRAEAQRSTS
PGHWNRLAECWELAQRHGLAIATLLQAAQRDIAERERFRGRVEAGMAGAR
ATAAILAGLPALGVLLGHAIGAEPVRFLLSDGAGGGFLVVGTVLICCGLL
WSDRITSRVLA
392418530YP_006455135.1 hypothetical protein Mycch_4757 [Mycobacterium chubuense NBB4]MLRERCRDLRDRVIVLAVADDGMSTVEYAIGTIAAAAFGAILYSVVTGDS
IVSALTNIISRALNTNV
392418528YP_006455133.1 serine/threonine protein kinase [Mycobacterium chubuense NBB4]MSGREVLVGRYELRGVLGHGGMAEVRDGWDTRLCRPVAVKLVHPTLVSQP
DIRRRFADEARSAAVLEHPNIVAVHDFGDHDGTPFIVMERLPGHTLGDVM
AQGPMAPQQVRAMLDDVLSALAVAHGAGVLHRDIKPGNILVSASGDRLKV
GDFGIAKTGGAAATATGQIIGTMCYMSPERVAGAPASVADDLYAVGVIGY
EAVTGRRAFPQDNPLAVARAIMDDPPPPLAVCCPGLDPALAAVIDRAMAR
DPAQRFGSADQMRAALAGGAAPRPATRVLTQAPVPLTGYPVAPVRRPRRP
NTARGYLAAAAIVAAFLVSILTVAVIGRSSPPTPEPISTSTSVPAPPPTT
TPSPPVPAASSTVEQPAPQPAPPKKRPGNGHGRGHGD
392418526YP_006455131.1 helicase/secretion neighborhood putative DEAH-box helicase [MycobacMRDAASDFGRELLGCAVDGVAAGEEPLRHVADLPPRRAKTQPWPHWTAPD
VVRAFHDRGVEAPWSHQLVAADLAHNGRHVVVSTGTASGKSLAYQLPILT
ALTNNPRARALYLSPTKALGHDQLRAAAALTSSIPGLMDVAPTAYDGDSP
AEVRRLARERSRWIFSNPDMIHLSLLRNHARWAVFLRHLRYVVVDECHYY
RGIFGSNVAMVLRRLLRLCARYSPAGAESAAGPTVIFASATTSEPAITAS
ELIGQSVVEVTEDGSPQGARTVALWEPALIDDLVGENGAPVRRSAGSEAA
RVMADLVAEGARTLTFVRSRRGAELAALSARARLADTAPALAEQVASYRA
GYLAEERRALERALAEGELRGMATTNALELGVDIAGLDAVVLAGFPGTVA
SFWQQAGRAGRRGQGALVVLIARDDPLDTYLVHHPAALLDKPIERVVIDP
ANPYVLGPQLLCAATELPLTDAEVRMWDAEAVADALVDDGLLRRRPSGYF
PTPGVDPHPAVDIRGSTGGQIAILEAGTGRMLGSSGSGQAPAQVHPGAVY
LHQGESYVVDSLDFEDGIAFVHAEDPGYTTFAREVTDITVTGPGRRHDHG
PVTVGLVPVSVSNTVIGYLRRRLDGEIIDFVELEMPTRTLETMAVKCTIT
PEALLRNGIDPLRIPGSLHAAEHAAIGLLPLIASCDRGDIGGVSTAVGPV
DGLPTIFVYDGYPGGAGFAARGFGTMADWWEATASAIEACECPTGCPSCV
QSPKCGNGNDPLDKDGAVKVLRLVLDALGAPERLRRAQ
392418524YP_006455129.1 hypothetical protein Mycch_4750 [Mycobacterium chubuense NBB4]MHCRPRQARRPGNTSVRAGCLTVFRVSQLSFFSAESVPPAIADLTGILAA
HGQAVLVGAGQEQAARLSVVVDRMWRAEGLAEMIAEAGLQPEIARTDERT
PLVRTGVDARLVGIAADWTRGAVKTVPPQWLPGPRELRAWTLAAGAPEAD
RYLLGLDPHAPDTHSALASAMMRVGIAPTLIGTRGSHPALRISGRRRLSR
LVENVGEPPEDAEALSQWPRI
392418522YP_006455127.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MAAEAIETGRISAFVRWVARTPWPVFTLGMLQADVIGALLVLGFLRFGLP
PEDRIQLQDLPAYNLAIFLGYLFVSFTVASYLTLRMLIPVMRWQRRDMLL
GDRDPADTEVARMRALKMPFYRSVISATNWLLGSVVFIIASWPVASKSAP
VVAVATGLGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVILRQ
VLTWVLSTGVPVLAIVLALVASKFQVLTAPADRVITTILLLAIVALVIGL
SSTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLAERQRLRDLFGRYVGEDVARRALERGTELGGQEREVAVLFVDLVG
STHLAATIPAAEVVSLLNDFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDASGAALAASRELHDELIEVLGETDFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEKGHVLASAVAVSDALDAEALCWDVGETV
ELRGRTAPTQLARPLNLMTPASADREVTSDASK
392418520YP_006455125.1 protein of unknown function DUF222 [Mycobacterium chubuense NBB4]MYVRVMVLGDLQGAVTALLGAFDEVADCEVDLATSTELVGVLDELETLWC
RLPAVRHRLLARLQTETTPQQLGAKSWKDALAIRWRISTSEAHRRLTDTA
LLAPRQAVTGPSLPPVLPATAAAQAHGLINGEHVEVIRKAVHRLPGFVDT
ATREQFEVDLVRLAVGVGPKELHDTAERTLFLLDQDGPEPDDTERARTRA
VVKHKQRRDAMTDLTATLNPQAWAVWEAIFAKYAAPGMCNPDDPHPCTTG
TPTQAQIDNDHRSLAQRQHDALLAAGRIALMSGQLGRLNGLPVSVIIRTT
LKDLESRAGIGVTGGGSVIPIADVIRMAGHANHYLAVFDHATGSALNLFR
AKRIATPAQRIMLIARDGGCTKPCCTVGAYGSQVHHVTTDWAAGGNTNLD
DLGLACPPDNRSVTPDGWTTHMNNHCEVEWTPPPHLDTGQTRLNYHHRPE
KLLRPPDQAESPPHNSTAEAASGEPTPDGPHRDDAFDPRPTDNTDHPGGP
APPDDQAA
392418518YP_006455123.1 uncharacterized protein- gamma-carboxymuconolactone decarboxylase sMTDVREEGYRVFREMLPDALPEGGLPRGGFGDELLEIGIDNVFGRLWARE
GLSRRDRSLVTMGILIALGAHDEFGYHVQIARTNGLTDDEIAEVIYHSSG
YAGFPAANTACRIARQVLEG
392418516YP_006455121.1 hypothetical protein Mycch_4741 [Mycobacterium chubuense NBB4]MRADERLREEQVMNERLRKEQSNWVARAAVALIALQLIIRAVLAFGGYFY
WDDLILVGRAGTQGLLSPGYLFDDHDGHVMPGAFLVAGAITRLSPLNWVG
PAISLVVLALLASLALLRALHVILGWRPVLLVPLTFALFTPLAVPGFAWW
SAALNSLPMLTAMAWVCADAILLVRTGRQRYAVTGTLAYLCGLLFFEKTA
IVPFVAFTVAALYGHVTSSASVREIWRRGMRLWVVSLALTAGWIGVYLLV
VDQQRWSFDLPMTWDLLSRSFTHGIVPGLVGGPWDWQRWAPASPWATPPV
AVMVLGWVALGCVVAVTLVRKQRIGPVWGAALAYAVACQVPIYLMRSSRF
TALELAQTLRYLPDLVVVLALLAAVGLCAPNRPRRGWLDAARRRTVVTVC
LAVVFVASCLYSTATFLTSWRDNPAQPYLQNARAGLAAAHAASDAPMLDQ
EVDPLVLQRVAWPENLASHMFALLPDRPEFTSATSLLRMLDPAGNLVDAK
VTWVRSIRPGPAPQCGYLVQPDFPVRMPLDGPLLPADWTAEINYLANSDG
SMMLSLSEGPEVKVPVRPGLNRVYVRLPGAGDAITVRANTAALSVCVAAG
PVGFVAPR
392418514YP_006455119.1 hypothetical protein Mycch_4739 [Mycobacterium chubuense NBB4]MNWIQVLLIASVLALLVYLLRSRSNARSKAWVKVGYVLFVIAGIYAIVRP
DDTTVIANWVGVARGTDLMEYVLIVAFAFTTLSTYMRFKDIELKYARLAR
AVALQNAQAPEQG
392418512YP_006455117.1 hypothetical protein Mycch_4737 [Mycobacterium chubuense NBB4]MTDATAGPSGAVTRGSVVRVGAATGVSALCGYAVLYLAARDLAPAGFSVF
GVFWGAFGLASGAAFGLLQETTREVRNRRTAPHGGEQTRPMRVAAGVGLA
AAVLIAVSAPLWSAHVFAADGLLSVALLSLGLAGFCLHTTLLGLLAGLDR
WSGYGALMVTDALARVAVAAVTFAVGWGLGGYLWATVAGSVGWLLMILVS
PATRAVARLSTPGGTGAFLRGTGHSIAAAGASAVLVMGFPVLLKATSGDL
GAAGGVVILAVTLTRAPLLVPLTAMQGNLIAHFVDQRAHRLRALVTPAVL
VGVLGAVGVTLAATFGPWLLREAFGAQYQAAGALLGWLTAAAVAIALLTL
TGAATVAAALHRAYATGWVSATVASALLLLLPVELEVRTVVALLCGPLIG
IAVHLAALAQVHAV
392418510YP_006455115.1 amino acid adenylation enzyme/thioester reductase family protein [MMTAADPTPQIPDQYVLSSSAPQARTLIDILYETARRHPDAPALDDGTVQL
TYAELIADVEDSVAWLAARGIGRGDRIGIRMPSGSYALYVAILATLATGA
AYVPVDADDPPERAELVFHEAGVVAIITERGLVRGPGSSRGWRATAPLSR
DDAWIIFTSGSTGTPKGVAVTHRSAAAFVDAEAQIFVRDAPLGPGDRVLA
GLSVAFDASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDITVVS
TVPTLASLWPAEALEAVRLLIFGGEACPPELAGRLAVDGREVWNTYGPTE
ATVVACAARLTGSGPVSIGLPLPGWDLAVVDGQGEPVGMGEVGELVIGGV
GLARYLDQDKDAEKYAAMPSLAWSRAYRSGDLVRLEFDGLYFVGRADDQV
KVGGRRIELGEVDTALVHLPNVTGGAAAVRRTPSGTPLLVGYVVVAPGAA
FDVADARARLSATLPAALVPRLVVVDELPTRTSGKVDRDALPWPVRGSGA
DEGHGTELGGTLGWLAGLWQEVLAAPVDGPEADFFALGGGSLSAAQLVAA
LRKRYPQVTVAELYDHPRLGSLAGYLDELAPPPEVQTRDVTPVPRLTQAV
QVALTVPLAVLTGIQWIVWLAVANNLAAQMHLVPWARPVSWWWILAGFLV
FVSPPGRMAIAAFGARVLLGNLAPGTYRRGGSVHLRVWLAERLAAASGAE
NMAGAPWLVYYARALGNSVGSGVDLHSAPPVTGMLTLGHRCSIEPEVDLS
GHWIDGDSFHVGPITVGNDATVGARTTLLPGAVVGKNADVAPGSGVVGKV
KNGQYWKGSPAVKSGKAKHPWPDHRPPRAPLWVAVFGITSLLLGALPVTA
LAAGLAVIGWGVRGTASLSAAIVPALVWLVPATAAAVAVYAVLTVLGVRL
LSIGLDEGYHPVRSRPGWQLWATERLMDAARNYLFPVYAGLLTPWWLRLL
GAKVGRGTEISTALMIPKFTVVEDSAFLADDTMVASYELGGGWIHVARAT
VGKRAFLGNSGITQPGRRVPDDGLVAVLSATPHKAKAGSSWLGSPPVRLR
RQPTAADALRTFHPSSRLKALRATVETFRFVPVVVTFALGVAVFFGVQAV
AVSVGWAWTIPAAGLILLAAGAVAGGVAVGAKWLVVGRITAIEHPLWSAF
VWRNEVSDTFVETVAAPWFARAATGTPVMNLWLRGLGAKIGRGVWCETYW
LPEADLVTLGDGATVNRGCVVQTHLFHDRIMRMDTVVLESGATLGPHCVA
LPAARLGAGATVGPASLVMRGDEVPPSTRWQGNPIAPWYPPRKKRDASPE
PKRKKPAAA
392418508YP_006455113.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium cMSVNDVVHGHCDARFERLADALAEELAAGEELGASIAVDIGGELVADIWG
GSADRAKTRPWQRDTIVNVWSCTKTLTAMAALILVDRGALDPFAPVADYW
PEFAANGKRHIEVRHLLSHTSGVSGWQTPFPVERIYDWAAATAHLARQQP
WWEPGTASGYHAMNYGHLVGEVVRRITGKSLKEVVREEISEPLGADVQIG
ARTEDFGRIAELVAPPARDLHLDRLPPDHPAVLTFAAFPPGAYGVAVAET
PQWRQADIGGANGHGNARGLVRALTPISLGGSAFGVDLLSPETVELIFTE
QSNGVDQVLFEPLRFGIGFGLPTPRSVPAVPDGRVCWWGGWGGSLVVMDL
DRRATFAYVMNKMGPGTTGNARTNRYARLVNAALEDARA
392418506YP_006455111.1 inorganic pyrophosphatase [Mycobacterium chubuense NBB4]MQFDVLIEIPKGSRNKYEVDHETGRVKLDRYLFTAFGYPADYGYIEDTLG
EDGDPLDALVLLPEPVFPGCIVEARPVGMFQMTDEQGGDDKVLCVLADDP
RWEHVRDLSDISDFELDGIRHFFVHYKDLEPGKFVKAADWVGREAAEAEV
KRSIERFKSAGH
392418504YP_006455109.1 putative hydrolase/uncharacterized protein- coenzyme F420 biosyntheMSPAAKSSFSVGRAVDWNLAATVGGKLARPEPPATDYTRNQAIDQLTEAA
RAAEIPVREVTGLSEGGEIPEARILNRPDWIRAAAQSMRAMTGGDGEGRP
GVISGRIAGAQTGAVLAFVSSGILGQYDPFAVGGGELLLVYPNVIAVERQ
LHVAPADFRMWVCLHEVTHRVQFRANPWLAGHMSGALAVLTEDVADDVTH
VAGRLAEYVRDRRKHADDEASEPNSTGVLGLLRAVQSEPQREALDRLLVL
GTLLEGHADHVMDAVGPAVVPSVATIRHRFDQRRQRKQPPLQRLLRALLG
IDAKMAQYTRGKAFVDDVVTKVGMARFNAIWTSPETLPLPHEIDEPQRWI
DRVL
392418502YP_006455107.1 hypoxanthine phosphoribosyltransferase [Mycobacterium chubuense NBBMTYAVGVPAHTAELYPGDIKSVLLSEEQIRSKTTELATQIADDYRDAVTG
TGEQDLLLITVLKGAVMFVTDLARAIPLPTQLEFMAVSSYGSSTSSSGVV
RILKDLDRDINDRDVLIVEDIVDSGLTLSWLLRNLATRRPRSLRVCTLLR
KPDAVRADVDISYVGFDIPNEFVVGYGLDYAERYRDLPFIGTLEPKVYET
F
392418500YP_006455105.1 hypothetical protein Mycch_4725 [Mycobacterium chubuense NBB4]MPIPARAKTSGLKLAAAAAVGGTAMMLAGCDSQSGPTLQPSADTRQVTVV
GAGQVQGTPDTLTVNASMEFIAPDATTAMNQTNERQQAVIDGLAAMGIDR
KDIATTRADLQPQYGSDNTSIAAYRATNSINVKIRDLNKASNAIGLVVGT
GGNATRINSISYSIEDDSQLVKDARARAFEDARDRASQYAQLSGLNLGKV
ISISESGGETPPVPMPAAGPRAMEAAVPLQPGQQTVSFSVTVIWQLD
392418498YP_006455103.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMVVLCHGFPQLAYSWRHQIEGLAEAGYHVLAPDQRGYGGSDKPADVDAYT
VVELSADVVGLLDDVSAQQAALVGHDFGAVVAWTAPLLHPARFSAVVGLS
VPPVPRPRIPTTQAFRRVFADRFFYILYFQQQGPADAELNRDPAKALRHL
FADPPTGDPEAASRMADPGPEGLLGRLGEPGGPPDWLSQADFDVYVKEFT
RGGFTGPLNWYRCFDRNWELTAHPTARTIGVPAMFVGGSADPSLIHTPRD
RVREVVTGNYREVMIEGAGHWLTEERPHSVTRLLRDFLEV
392418496YP_006455101.1 GTP cyclohydrolase I [Mycobacterium chubuense NBB4]MTRSHNHSATITTPEFDQARAEAAVRELLIAVGEDPDRHGLVDTPARVAR
AYREIFAGLYTDPDDVLNTTFDEQHDELVLVKDIPMYSTCEHHLVSFHGV
AHVGYIPGHDGRVTGLSKLARVVDLYAKRPQVQERLTGQIADALMRKLDP
RGAIVVIEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKASRAEALDLIL
RK
392418494YP_006455099.1 dihydroneopterin aldolase [Mycobacterium chubuense NBB4]MSDRIELRGLRVRGNHGVYDHERRDGQEFVVDITVWVDLHAAAASDDLTD
TLDYGALAQRAADVVGGPPRNLIETVAGEIAEDVMRDERVHAVEVVVHKP
SAPIPLDFADVAVVARRSRRGGRGAAP
392418492YP_006455097.1 Protein of unknown function (DUF3180) [Mycobacterium chubuense NBB4MGPTRKRDLLAAVVVTAVAGYLLVRMVYRWFPPITMWTGISLLGVAVAVA
GWGFFVRARIRDGEIGVGRGRLHPLAVARSVLIAKASAWMGSVVLGWWLA
VVAYLLPRRSVLRVAAADTPGAVVAALCAFALVVAALWLQHCCKSPEDQP
PNADAAPG
392418490YP_006455095.1 hypothetical protein Mycch_4715 [Mycobacterium chubuense NBB4]MVQPPAGENVPHDGLRPARLTIGVISAGRVGAALGAALERADHVVAGCSA
VSRASRQRAQRWLPDTPVLPVDEVAGRAELLLLAVPDAELSALVAGLAAT
GAVRPDTIVVHTSGANGIGVLAPLAAQGCITLAIHPAMTFAGTDEDLDRL
RGTCFGITAADEIGYAIAQSLVLEVGGEPFRVREDARTLYHAALAHSSNH
VVTVLLDAVESLRAALWGQELLGQETVGDTPGGIAERIIAPLARASLENA
LQRGQGALTGPVARGDAAAVAGHLHALAEVNPGLAEAYRTNSLRTAQRAH
APQEVFDVLAEAGQS
392418488YP_006455093.1 L-aspartate 1-decarboxylase [Mycobacterium chubuense NBB4]MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDID
NGARLVTYAIAGKRGSGVIGINGAAAHLIHPGDLVILIAYATLTDAEIRN
HRPRVVFVDAANRPVDLGADPAHVPLDAAELLSPR
392418486YP_006455091.1 putative amino acid aldolase or racemase [Mycobacterium chubuense NMDTPAHPPVDLAALRALSEQPLDWSARAIPPQWWGRTPAQVVAEAPRLFE
AGVWGPVCVLRADALAHNLATMARWCREHRVELAPHGKTHMSPQLAARQL
EAGASAITVANVAQAAVYRAFGVHDLVLANELVDPAGLRWVAAELERDAA
LNFVCWVDSVRGVELMTSALADARRRVPVCVEVGVPGGRTGCRSREDVDD
VARAAAESPRLRLVGVAGYEAARGQDVTADSLAIVTGHVAALRAAVLRLA
PLIENDDVIVSAGGSTYFDAVADGLTGWAAGVAVRTILRSGCYLTHDHGL
YARTSPLTRDGGDGLHPALELHAQVISRPEPGLAIVAMGRRDVSFDQGLP
VPLDLPGATVTALNDQHAYLRLGGDPVEVGAWLRFGISHPCTVFDKWRVI
PVLDAGDRVVDLVRTYF
392418484YP_006455089.1 Lsr2 [Mycobacterium chubuense NBB4]MAKKVTVTLVDDFDGEGAADETVEFGLDGVSYEIDLSAKNATKLRNDLKQ
WVEAGRRVGGRRRGRAVATGRGRAAIDREQSAAIREWARRNGHNVSTRGR
IPADVIDAFHAAT
392418482YP_006455087.1 hypothetical protein Mycch_4707 [Mycobacterium chubuense NBB4]MILDVIDGHRNLVELQNGRATEKVRPDVRRTADWDAKSRKGSTVTSSTSP
QQGRARARAIDFSATKAALWLSLTAFLALVVLYFVGMDQGATSVFGNNTY
VHEFFHDARHLLGFPCH
392418480YP_006455085.1 fructose-2-6-bisphosphatase [Mycobacterium chubuense NBB4]MSEVVRLTFVSHAMTDAVAAGRFPTDEGVNATGRAQLGGLDLGSAQRALC
GPEARTRQTAELLGLHAATEPRLADLDFGRWRGEVLGRVLPAELAVWLTD
PTQAPHGGETVVDLIDRVRGWMESLTSERTRVVAVTHPAVIRAAIVAVLD
APPKSFWRIDVAPASRTVMHFRGHAWTLRSNR
392418478YP_006455083.1 putative enzyme involved in biosynthesis of extracellular polysacchMPSQTPVVKINAIEVPPDAGPELEKRFAHRAHAVDSQPGFLGFQLLRPVK
GEDRYFVVTQWESEEAFQAWATGPAIEAHAGERANPVAKGASLLEFEVVL
DVAGTDTKA
392418476YP_006455081.1 hypothetical protein Mycch_4701 [Mycobacterium chubuense NBB4]MTIALTFLILVSPFALAALLSWTASRSGSLRLHLDQFRLAAPMGGRLSED
RDALRVEHDVDAIRTRFEQQPSWPSSGARGERR
392418474YP_006455079.1 A/G-specific DNA glycosylase [Mycobacterium chubuense NBB4]MIDAGDLIGWYARAQRDLPWRRPGVSPWQILVSEFMLQQTPVARVEPIWL
DWIARWPTPSATAAAGAADVLRAWGKLGYPRRAKRLHECATVIANDHDDL
VPDDVETLLSLPGIGTYTARAVACFAFRQRVPVVDTNVRRVVARAVHGLP
DAGSPSARDLADVAALLPDDETAPQFSVALMELGATVCTARSPRCGVCPL
RQCAWRAKGFPAGAGPVRRTQRYAGTDRQVRGRLLDVLRGSTSPVTRAEL
DLAWTTDTAQRDRCLDSLLVDGLAEQTADGRFVLFGGAGEAGGADAQAVT
AHSDSSAAEANRRR
392418472YP_006455077.1 hypothetical protein Mycch_4697 [Mycobacterium chubuense NBB4]MTWPYRDDVLDLEPHGPLPQQIYWRRRALALGVTVVVIGIIAAVVAVVVM
NSTSSEQPTANESSAPSGQAAPPPLPGENPGVKTPIQPPAQQAPPPTATP
TAAVVPPPILKEGDDCPDSTLAVKGITNQPQYVVGDQPKFTMVVTNIGLV
ACKRDVGAAVLAAYVYSLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEV
TWTGMSSAPNCPLPRQPIGAGTYNLVVQLGNLRSATVPFVLAQPAPPPAN
VPPQAPAPAPAPAPAG
392418470YP_006455075.1 DNA repair protein RadA [Mycobacterium chubuense NBB4]MARSSSKTRSQYRCSECHHVTPKWVGRCPDCGTWGTVDEVALTAVGGSAT
RRAVAPASPAVPISSIDPGHTRHFGTGVSELDRVLGGGLVPGSVTLLAGD
PGVGKSTLLLEVAHRWAMTGRRALYLSGEESAGQIRLRAERTGCTHDEVY
LAAESDLQTALGHIDAVQPSLVVVDSVQTMSTTEADGVTGGVTQVRAVTT
ALTMTAKTSGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALR
MVRGVKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKAVSGTAVTV
TLDGKRPMIGEVQALIGSPATGTPRRAVSGIDSSRAAMITAVLEKRAKLP
VGANDIYLSTVGGMRLTDSSSDLAVALSIASAFTDLALPTTAVAIGEVGL
AGDLRKVTGMDRRLAEAARLGFSRAVVPSGVTSVPPGLQLLPADDITSAL
QVLRRISHNDAN
392418468YP_006455073.1 CarD-like transcriptional regulator [Mycobacterium chubuense NBB4]MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDDKA
STILDEVLAAAS
392418466YP_006455071.1 cysteinyl-tRNA synthetase [Mycobacterium chubuense NBB4]MTERPAAVMRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRS
GVAFDVLRRWLTAKGFDVAFIRNVTDIDDKILTKAADAGRPWWEWAATYE
RAFSAAYDALGVLPPSAEPRATGHITQMVELIDRLIERGHAYTGGGDVYF
DVATLLDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEPSWPT
PWGRGRPGWHTECVAMAHEYLGAEFDIHAGGMDLVFPHHENEIAQAEAAG
DGFARFWLHNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYLGSAH
YRSMLEFSETALQDAAKAYAGIEDFLHRVRTRVGAVVPGEWTPRFAAALD
DDLSVPIALAEVHAARAEGNRALDAGDHDGALTQAMSIRAMMGILGADPL
DERWESRDETSAALAAVDVLVHAEVRRREDARARRDWAEADAIRDRLKEA
GIEVTDTADGPQWSLLDGSDK
392418464YP_006455069.1 Na+/H+ antiporter NhaD-like permease [Mycobacterium chubuense NBB4]MELTLAVIALVAVLGVALLRPRFQAVIAVPAAAVVILAGAISWQDAVAEI
ARLAPVVGFLAAVLVLARLCDDEGLFHAAGVVMARATTGGQNRLLVSVFA
ISAGVTAILSLDATVVLLTPVVLATARTLAVPARPHAYATAHLANSASLL
LPVSNLTNLLAFSAAGLTFLHFASLMALPWLAAIAVEFVLLRWLFAKDLA
VEPRRDAGTEPIELPLFALVVVGLTLVGFAVTSLLGLSPAWAALAGAVVL
GVRALATHRTTLVRIGIAAEVPFLAFVLCLGVVVAAVMRNGLESSMHHVI
PDGHGLVALLGVAAVAAVLSNVVNNLPAVLVMLPLVTPTGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSVVGREVKAGFREFSRVGFCTTPLTLVAAVL
ALWAGLRLIGA
392418462YP_006455067.1 arabinose efflux permease family protein [Mycobacterium chubuense NMVALDRPIGETQRWAYPLLLVLSGVALGVSGLPAPLYGIYESSWHLSPLA
TTIVFAVYAIAALAAVLVSGRISDVVGRKPVLLAALAALLVGLGVFLVAD
NMALLLLARTIHGAAVGSIVVAGAAALLDLRPDHGVRSGQLSGVSFNIGM
TVAIIGSALLAQYAPHPLRTPYAVVAVICLVVGAGVIALHEPHTARSRGP
IRIARPAVPPEIRADFWFSALGAMASWSVLGVLLSLYPSLAAQQTHIDNL
VFGGAVVGTTAFSAALAQLAATRLPARYSAIIGDVGMSVSLLLTIPVLLT
HEWQLVFVAAALLGTTFGLGFGGSLRHLADVVPVGRRGETMSAFYLAAYT
AMAVPTLVAGWAATQWDLAEVFPWFAGTVATACLGAAVAGLRSTRRMRTA
392418460YP_006455065.1 putative lactam utilization protein B-like protein [Mycobacterium cMPTVTVDLNADLGESFGVWQLGDDDAMLDIITSANVACGFHAGDAATLAR
TCRAAAARGVRIGAQVSYRDLAGFGRRFIDVPPDELIADVIYQIGALQAL
AKASGAAVSYVKPHGALYNAIVTNQAQAGAVAAAVHTVDPNLPVLGLAGS
AFFVEAERVGLRTVPEAFADRSYRPDGRLVSRRERNAVLSDVDEISDRVA
SMVQRGRVAAVDGSTIPITVASVCVHGDSPGAVRIASAVRDRLTSDGVAL
APFS
392418458YP_006455063.1 ATPase component of Mn/Zn ABC-type transporter [Mycobacterium chubuMSAQPREVFSFTHACLAFGDRVLWDDLDLSVRAGEFVAVLGPNGTGKTSL
LKVLLGQVELSAGTATVGGEPVRAGSRSIGYVPQHRSIDRGVSLRGCDLV
GLGYDGHRWGVAGWQRETRNAKRDAVHRALAAVNGTHLSGVSVGVMSGGE
LQRVRIAQALATDPALLLCDEPLLNLDPANARLVCALIDQRRREAGTAVL
FVTHEVDPVLPYVDRVIYLVDGRFRIGTVEEVMTSQTLSELYRADIEVIK
VGGRYIVVGEHSQYQHNHAGHPGHVHE
392418456YP_006455061.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSRSPTPRRRATLASLAAELKVSRTTVSNAYNRPDQLSAELRERVLSTAK
RLGYPGPDPVARSLRTRRAGAVGLMITEPLNYSFSDPAALDFVAGLAESC
EAVGQGLLLVAVGPNRSVTDGSAAVLAAGVDGFVVYSASDDDPYLPVVLQ
RHLPVVVVDQPKNIAGTSCVGIDDRAAMRGLAEYVLELGHREIGLLTMRL
GRELPHGGPRPALADPERVATPHFHVQSERIRGVYDAMTAAGLDPESLTI
VESYEHLPTSGGAGADVALEANPRITALMCTADVLALSAMDRLRARGIYV
PGQMTVTGFDGVPEARQRGLTTVVQPSVEKGRRAGELLHNPPRSGLPVTE
VLDTAVVRGRTSGPPA
392418454YP_006455059.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSGTSESPVGTPARAAGAGAESRPRQVMNVAVLAESELGSEAQRERRKRI
LDATLAIASKGGYEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALGRE
FERIDAKTDRAVLAAGATPYQRLNIMVGKLNRAMQRNPLLTEAMTRAFVF
ADASAAGEVDHVGKLMDSMFARAMSDGEPTEDQYHIARVISDVWLSNLLA
WLTRRASATDVSKRLDLAVRLLIGDGDQPKI
392418452YP_006455057.1 hypothetical protein Mycch_4677 [Mycobacterium chubuense NBB4]MNRFAATSAAALLAVVLTHPASAQAASNTGTTSIAVDPATQIQMQVTANC
DAAQTRCFFNTTANLMTPGGPTGFPGDTWARQTITIRSSDRDVWQQAWYS
APSGNPRELKGANHENVLSKMYKSLDDVEISITYFGGGPIERFKADGDSV
PTEWRTGLPATKADFIACSQIQVVYGGVNLTTPTACAQTTFA
392418450YP_006455055.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTSIEQRDVQSVLAGIDDLLPRIAKRAASAEELRRLPDDTVNELDEVGFF
KLLQPEQWGGLQCDPTVFYEAVRRIASACGSTGWVASIIGVHNWHLALFD
QQAQDEVWGSDPTVRVSSSYAPMGAGTVVDGGYLVSGAWQWSSGCDHATW
AFLGGPVIKDGRPVDFGSFLIPRSEYRIDDVWNVVGLKATGSNTVVVKDV
FVPRHRFLSYRAMNDGSAGGYENNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYDAHVEHQGKRVRAAFAGEKSKEDPFAKIRIAEAASDIDAGWRQLIGN
VHDEYQLLQAGQEIPFSLRARARRDQVRATARAIASIDLLFEASGATALN
LDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
392418448YP_006455053.1 lactoylglutathione lyase-like lyase [Mycobacterium chubuense NBB4]MTIRSLGYLRIESTDVAAWREYGLKVLGMVEGSGSTEGALYLRMDEFPAR
LVIVPGEHDRLLVSGWETANAAALQEIRSRLDAHGTPYKEAAAAELAERR
VDEMIIFDDPSGNTLEVFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAETLRFYRDVLGFSLRDSMKLPPQLVGRPADGAPAWLRFLGVNPRHH
SLAFMPGETPSGIVHLMVEVENADDVGLCLDRALRRKVKMSATLGRHVND
KMLSFYMKTPGGFDIEFGCEGLEVDDHSWVARESTAVSLWGHDFSVGFK
392418446YP_006455051.1 Protein of unknown function (DUF2867) [Mycobacterium chubuense NBB4MTIESDTLLACCTLARVDHVDTHVLPTARPTSRSPEMWMREILENTSAAM
RARLTAGWAMLGLKLHRGDTILGWPISHNDAEYVRLHRHSPVGLTGQLVT
RASGDGVQFATFVQLSNPAARALWRRVLPTHLEIVRSLLREAGERAH
392418444YP_006455049.1 lysophospholipase [Mycobacterium chubuense NBB4]MPFLEHDRGRAYYRHWAAAHPRAAIIFLHGFGEHTGLYHRYGFALNAAGI
DLWAVDQFGHGLSPGDRGDFGTIEDSSALAESLTALAQEEHEIPLLAQGH
SFGSVVTLFRLLENPQRYRAAIVSGAPLVPVPELLDSDTSMNLDPAWLSS
DPFYVDSLLNDPLAFVDADGAALARELDRAWDRFGSELPSLAVPTLAVHG
TNDPIAPIGAVRAYAEQIEALQLAEFPGARHDVLNDAEHREVATAIVDFV
DRVLD
392418442YP_006455047.1 arabinose efflux permease family protein [Mycobacterium chubuense NMSAQQSSQPASITTGLKRVVVASMAGTVVEWYEFFLYATAATLVFNKVFF
SEGTSDSKAIIAALLTYAVGFVARPLGGVVFGHFGDKFGRKKLLQFAILL
VGVVTFLMGCLPTYAQIGVWAPILLVVLRFLQGFAVGGEWGGAVLLVAEH
SPNDSRGFWASWPQAAVPVGNMLATVVLLVLTGTLSDAAFLSWGWRVAFW
LSAVVVLIGYYIRTKVTDAPIFVEAQQEVERVKSVSYGVVEVLKRYPRGV
FTAMGLRFAENIMYYLVVTFSIVYLKTHVGADTSDILWWLLAAHAVHFLV
IPQVGRLSDRFGRRPVYIAGALLAGTWGFFAFPMMNSGDYLLIMGAIILG
LMIHALMYSPQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSVAPAIATWL
LDAFGSAVPIALYLAGAAVITLVAAWLTRETNGLDLKKLDEADREELAKA
GVL
392418440YP_006455045.1 acetoacetyl-CoA synthase [Mycobacterium chubuense NBB4]MTPQWVPTEADVDGARVTDFARFAEQRTGSAFPDYRSLWQWSVDDVEGFW
AALWDYFELGERSEEVLQHPEMPGAQWFPGTTVNYVDQVVRNARTDRPAI
VSVGEGRPDREVSWQELLERTAAFAEKLRAGGVGRGDRVVGYLPNIPEAV
IAFLATASIGAVWSACGQDYSAKAALDRLGQLEPTALVAADGYQFAGKYR
DKRDDVAALRKGLPTVRATFTMDDLAARSANPLDTVAVEFGHPLWILFSS
GTTGLPKGIMHGHGGVIVEHLKAVALQSDIGRDDTFFWYTSPSWMMWNFQ
VAGLLVGATIVCYDGSPNAPQPDALWDITARIGATVLGTSPGYVLGCIKA
DAHPSKTHDLSALRTVGITGSSLPPSSSLWLRDRVGEHVQVASISGGTDV
VSAFIGGVRTVPVWPGELSAPYLGVALDAWDEAGNPVRGEVGELVITKPL
PSMPVAFWNDPDGSRYHDAYFDVYPGVWRHGDWITLTDHGSVIVHGRSDS
TLNRHGIRMGSADIYQAVEGLPEVVEALVIGAEQPDGGYWMPLFVVLADG
VDLTDDVRGRINDVIRTEVSPRHVPDEIIVAPGIPHTRTGKKLEVPVKKL
FQGRDAAKVVERSAVDDPALLDWYVTQRRT
392418438YP_006455043.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MDLKIGELARLTGTSAPTIRYYEDIGLLPPPHRAGGQRRYRDDDVRRLTF
VRRCRDFGFPIEAVRTLASLSADRDHSCIEARDIARTHLAAVHRRMVELR
ALEHSIAELVDAADGACSGGPGAECAVLRELARPAR
392418436YP_006455041.1 Protein of unknown function (DUF3478) [Mycobacterium chubuense NBB4MIDFLDRSTGDVLGVRASGKLTAADYHHVLAPRIDSLVEQFATLKVLFLM
DRAFEGWTLRAAWANTVFDLAHRRHFDQIAMVGAPAWEEWCIKVPAAVLM
RGELRTFRREQLGEAWDWLLAA
392418434YP_006455039.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MNFEIDEQQRDFAASIDAALGAADLPAAVRAWADGDTAPGRKVWAQLTDL
GVTALMVPERFDGIEAHPVDLVVALERLGRWNVPGPVTESIAVAPILLGD
DERSGALASGELIATVAAPPLVPRAVDADTAGLVLLAEDGQISEAAAGAE
HESVDPSRKLFDVSASGEARPSDVSRAVEFGALATAAQLIGAAQAMLDAA
VEYAKQRSQFGTVIGTYQAIKHKLADVLIAVELARPLVYGAALSLADQSA
DTARDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHNPSLLLLRVQALR
PAWGDPTWHRRRVLEALNQ
392418432YP_006455037.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMTAAARTTPAVLDRIAHELPDHDAVVTAAKTLTFAQLRAEVRQAAAAMIE
LGIAPGDRVAIWSPNTWHWVVACLAIHHAGGVLVPLNTRYTASEAVDILA
RTAAPLLFTSGEFLGADKAASIDGDMLPALRHIVRIPIDKADGTWDEFVA
RGADLAAVDARAAAVSPEDVSDILFTSGTTGRSKGVRCAHRQSLDASAAW
AACGQVTSDDRYLCINPFFHNFGYKAGILACLQTGATLYPELTFDPEKTM
RAVQEQGITVLPGPPTIYQTLLDHPRRAEFDLSSLRFAVTGAATIPVVLI
ERMQSELDIDIVLTAYGLTEASGFGTMCRAEDDAVTVATTSGRPIADFEL
RIGEQGEVLLRGPNVMLGYLDDAEATAAAIDAEGWLHTGDVGEVDEAGNL
KITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAAVIGVHDERLGEVGK
AFVVTLPGAELDEDAVIAYTREHLANFKTPRSVEFLDALPRNPGGKVVKP
QLRERI
392418430YP_006455035.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTDLSLAPKEIEGHGLLTGKVVLVTAAAGTGIGSTTARRALAEGADVVVS
DYHERRLGETRAELAALGLGKVDAVVCDVTSTEAVDALIASTVEKAGRLD
VLVNNAGLGGQTPVVDMTDDEWDRVLNVTLTSVMRATRAALRYFRDTGHG
GGIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEYGVRVNAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVAATIAFLASDYSSY
LTGEVISVSSQHP
392418428YP_006455033.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MPASQAYVIDAVRTAIGKRNGSLAGVHPVDLGAAGWRGLLGRVDVDPGAV
DDVIAGCVDAIGPQAGNIGRLSWLAAGYPEEVPGVTVDRQCGSSQQAISF
GAQAIMSGTADLIVAGGMQNMSQIPISSAMTVAEQFGFTSPTNESKSWLH
RYGDQEISQFRGAELIAEKWDISREDMEQYALTSHQRAQAAIRAGHFENE
IIEVDGFRIDEGPRDTSLEKMAGLKTLVEGGRLTAAMASQISDGASAVLL
ASEQAVKDHGLTPRARIHHISARGADPVFMLTGPIPATRYALDKTGLSID
DIDTIEINEAFAPVVQAWLKETKADPDKVNPSGGAIALGHPLGATGAKLF
ATMLNTLERTGGRYGLQTMCEGGGTANVTIIERL
392418426YP_006455031.1 hypothetical protein Mycch_4650 [Mycobacterium chubuense NBB4]MGALAVFLIAVGVADICRKLSAHRRLPLAAGPLTVVACAALAGLWHRGDV
VLLIVAAAVSVAWVALGSAAEHTGSRQGRALAVFGAGILLMVAFGGWSSE
VAGPVGRWLPWVGLEQVEPSRALMIVGVVLLQLVTANQLVRLILGAVGAV
RPAGVPQPSDRLKGGRLLGPMERLLIVGLALGGQFGAASAVIAAKGIIRF
PELNAARKESAEPGGSGIDEVTEYFLVGSFASWLIALAGLALTAA
392418424YP_006455029.1 hypothetical protein Mycch_4648 [Mycobacterium chubuense NBB4]MALEKHVGRVGALAVALGIGSAVAVMPGVAWAEPNNSGSAAASQNSGDSA
RGHGPLRHERARPAASTESAGSSESSEESSEATDRSAAKRRSHGSRRAPA
AGTHAAQAEADGRTTSQAKEDTDDTTSSKSARPRKAALGLDEPARTPVSV
PESRAHRISIKDVDPSPAGTGTDAVGVVSAAPEVPRTVKALFAPRATSHR
PDAPEPPGASPLLWTMLAAARRQLGELRDAAAFTRIAATGCEVAPDASST
STPGLATQPVVIGADGTIYQVTVEANATTGRLTGGTRVSIVGPDGRVLKT
RTLFGAPTEASNAVARDDGSLLVTTYSPLLNRTFVSEIGPSGLVRPAGSA
SGNVLAPVSLAADGTAYVETRINPSFDLGHKLIRISPNNTTRVYSAFISP
SPPVVAPDGSAYLLTQNLFSQATVLMAIGPDGTVRRTAPRSDVQVVGQPV
IGTDGRGYWAVTYDNADGARVTDVYTFTGNSSTIRHIDGDVSTYRLVPAG
DGVYVPVVNNAVGTTSIARIGATAIEISQPGIGYLIDPIDVTPDGTVYAS
VYDYVTKTYSVAVYRPDGSVTQTEIAGDIVQSGYPRPPTEGFPTPNPDNT
GYVAYTSGGHSYLAVLSADGTITGTVALPDGTEVTRPVSFDADGRAYQVV
ETPGSADHAVSVVSASTGAVTATLPGYLVTGHDSLEFGPDGTGYLITVEG
YATTLNPTYHIVSFDNTGTVVASLDVTGFLNRNPVDYRSQGYFNEPLTFG
PDGTAYASFGVFSSDQDGGVYALTPAGATRILAINDPKTSLMPVIVDSAG
TPYVTVTREDGDSYVTTVVPLTA
392418422YP_006455027.1 acyl CoA:acetate/3-ketoacid CoA transferase- beta subunit [MycobactMISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDILL
TDGEARLIADTPAIGAAAAIEGWMPFGRVFETLAWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHATSYWVGNHSKRVFGDSVD
VVSGIGWDKVDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRAVSLHPGV
EPGQVAENTAFEVHGLDEAATTRLPSGDEQKLLREVIDPKSLRDKEVRM
392418420YP_006455025.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMTISTKTVEPGIASVTVDYPPVNAIPSRGWFELADAITAAGRDMGTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCFEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRLFFTAATVGAETLHQFGSVHEVVPRPELDEAALRVARDIAAKDTRV
IRAAKEALNFIDVQKVNSSYRMEQGFTFELNLAGVSDEHRDAFAGTGKGS
TK
392418418YP_006455023.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQGVVDEIVASGGEAVTSGANVADWAQAEGLIQTAVDSFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRAKSKAGDTVE
ARIINTSSGAGLQGSVGQANYSAAKAGIAALTLVGAAEMGRYGVTVNAIA
PSARTRMTETVFAEMMSTQDQDFDAMAPENISPLVVWLGSVESRDVTGKV
FEVEGGKIRLAEGWAHGPEIDRGARWDPAELGPVVGDLVGKARTPVPVYG
A
392418416YP_006455021.1 hypothetical protein Mycch_4640 [Mycobacterium chubuense NBB4]MISDADRIAAAQAYISALASHDADTVPFAPGCTRVEVGIKTGFSGNHLRR
SLNGGLQYRVISSVGTPEFTVDGNTVRARFDLSTKPTLAGRRVGAHVDET
FLIPADDPSGRAQIHHINASIRPFLTR
392418414YP_006455019.1 cytochrome P450 [Mycobacterium chubuense NBB4]MPGPNSCPISPDFDFLDASLNLERLPVEELAELRKSEPIHWVDVPGGTGG
FGDKGYWLVTKHADVKEVSKRNDIFGSSPDGAIPTWPQDMTRDAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAIGRLEDELRARAQKIAETAKAEGSG
DFVEQVSCELPLQAIAELLGVPQDDRDKIFRWSNEMTAGEDPEYAEVDPA
MSSFELIQYAMKMAEERAKNPTEDIVTKLIEADIEGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSQNPEQWELFKKDRPETAADEIVRWATPVS
AFQRTALEDTELGGVKIKKGERVVMSYRSANFDEEVFDDPHSFNILRSPN
PHVGFGGTGAHYCIGANLAKMTINLIFNAVADHMPDLKPVGEPERLKSGW
LNGIKHWQVDYTGQCPVSH
392418412YP_006455017.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MYIELTPGQRQLQAELRQYFSTLITPEEAAAMESNRHNEAYRAVIKRMGS
DGKLGVGWPKEYGGLGFGPIEQQIFVNEANRADVPLPLVTLQTVGPTLQV
YGTEEQKKKFLPGILSGDIHFAIGYSEPDAGTDLASLRTTAVRHGDEFIV
NGQKMWTTGAHDADYIWLACRTDPDAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVRVPADMLVGEENGGWKLITTQLNHERVGLGPAGR
VAGIYDQVHAWASKPGSDGVTPIDQADVKRLLGQIKAIWRVNELLNWQVA
ASGETIAVADAAATKVFSTERIQEVGRLAEEIVGRYGNPADPETGELLDW
LDKMTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
392418410YP_006455015.1 MaoC-like protein [Mycobacterium chubuense NBB4]MSTESVAVGTKLPELALYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRFITDWAGPTAVIKSISLRLGVPWYAYDTVTFKGEV
TDIVDDVITLKIVGSNSLGDHVIATATLVFGGAA
392418408YP_006455013.1 hypothetical protein Mycch_4632 [Mycobacterium chubuense NBB4]MSSREPEPNDEDTGPLHVNSARASAADAEDRRYDAPLSVNPRPVHRNRRP
VLLLAAAIAAVIALGVLAWLFWPSGGGSGSSAKNPGPTTETESRQAAEGH
LMGMLPRGYAPDACEVVVPAKGALAQVSCTNNTDPGGPLTATYTLAKDSD
SLKDLFDDVVSTSSVVDCPGNIQSPGPWRRNATPQQSAGTLVCGFQQSKP
TVAWSTDANLMLSEVQSGPQGPNMVQLYTWWASHS
392418406YP_006455011.1 hypothetical protein Mycch_4630 [Mycobacterium chubuense NBB4]MRGDSCLITTIRGFYFVGRHSKNVARSATIRAYLTAGVTAGVTGAAMAGV
GALTLIDDHAPAPVRYEVQLASTGQDCGPGTGLSCDGNGDAQKIAAVDAP
AVAVRPMIGPGGWLYGDGADAADDCTGSACNGGNAGLLGGNGGDGANGGS
GGRAGLYFGNGGDGGDGVDAVYENGKLVSAATRGGNGGAAGLFGNGGNGG
NGGSNANTLDVPNNPDTPTDESTANNAVGAAGGTGGAGGRISGNGGAGGN
GGDASSAHGSSRGGSGGAGGDALNRGGTAGSGGNGGNAEADATGKSATGG
SGGAGGDGSRGTGGDGGDGGSADGGAGASATGGSGGSGGDIGHSGQAGNG
GDGGDADAIGGDATGGNGGSGGSSVVGTSPGLSGSGGDGGDGGDGTTSPT
KTGTGGSGGAGGNGGLFGRDGDDGADGTGSGTPPASASSTSASDSASD
392418404YP_006455009.1 hypothetical protein Mycch_4628 [Mycobacterium chubuense NBB4]MIGRSDFARSSQPAIDGWRRSLPAETKYTRALGAAVVAGGLVFSASLYPL
PDGPSLFGALRPAEHGLLSRLPSLVESAGANHKIDFTAVALPELAHLVEV
MTQTFHAVPVETLLTMVEKFGLSNVVTSFEVLASSAAAAHDNSVSFAGGG
GGGGGGGGSVPLPTVTLPQVVLFLEYLMQRFHGDLAQGLVAIAHLPPIQL
SALPAQLSALPAQLTALPARLDVVPIQPALAPPLVATLALPPPPPPPPAP
PPPPPPPPPAPPPALSEVSAQTPIEVVSPPPLVAPTPVTLVETPVPTYVE
TVTTPPPEVPAPSFEATPSASAVSTPPEIPTTDDVPTTQNGQESDGGSSG
QGSGHDTNTGGTGQGTDANSTESSGQGPSGSSGDSSGGDGSSSRSGAGSS
QGGTGADSGGASGGGSSGAG
392418402YP_006455007.1 glucosamine--fructose-6-phosphate aminotransferase- isomerizing [MyMCGIIACRTESPAIDYLLTALGRLEYRGYDSAGVAVQTVDGTVARLRTVD
RIGALRAAVTAWAGGHFGNVGVGHTRWATHGSVSVVNAHPHTDCSGQISL
VHNGIIENADDLRTALTASGHEFHSSVDSEVICHLIEDQLKISADLLEAV
QASLLALDGSWALAVLEECSGRIVVAARRSPLLVAHTPVGQFAASDITAI
AEWVDEFRVLEDGDVVELTDSGDSADGAAPALARCVWRSNDSELSGYVDY
MAKEIDEQPAAAARLIDEVAGGIANGKLWADLGLAPFERLQVLACGTSLN
AGHVIGNLVRRLGGLPASFIVASEAAGEIVEPHTLCLAISQSGETADVLA
AVEHRTPAESVLALTNNSHSTLARRADAYLTCAAGPEIGVAATKTFVCQV
IAGAALMISALVAVDRIAAADARTFVDDLRRLPDQLDAACVIAKYEVPRV
TEELSSAAGFIFMGRGSGVPYAAEGALKLKELTYRWAEHYPAGELKHGPL
ALIGPGTPVVVVDNAEPRLAANVAEVTARGALVIRIGPAGSTIPVVTHPV
APWGPLESVIPMQILARSLGLALGWDVDKPRNLAKSVTVE
392418400YP_006455005.1 glycosyl transferase [Mycobacterium chubuense NBB4]MTTDVTANGHQNGVLSTRLVGTEVEEQNAAAGAVAPRSRAKRGRPNLPRR
NPTVSLVIPVRNEARNIAWVLEQIADDVDEIILVDGNSTDATLITALRYR
PDIRVVPQEGVGKGSALRTGFFAATGDIIVMMDADGSMAPCEIRHYIHFL
NNGYDFVKGSRFTGGGGSLDITRFRRLGNRFLLTVFNTLYGAELTDLCYG
YCAFHRRYLETLALTATGFEIEAEMTVRAMQAGLRVAEVPSLEMPRRSGN
SNLHAIRDGVRVLKTVLDGRRTQTV
392418398YP_006455003.1 glycosyltransferase [Mycobacterium chubuense NBB4]MRILLLAQFLPPIIGGVERHVWTLATALAARTHEVTLLGLAAGDQDPGES
TVGGVRIVRVRAATSRLPFLYSDPARPHVLPVPDPLMSRAIRRELSEHRY
DIVHAHNWIVNSALGAATRARVPLVMTLHDYSHICTTARLMEKGRQRCSG
PSLGRCMSCASSHFGPGKGQAIVAANTWSAWRRSRSITRVAAVSAAVANA
VKADDSPAWISGAGLDAHVIPNFIPDEIVLDEIPSTSHDAPLLFVGDLVP
DKGVHILMEAYGHLDDPPPLVLAGRVGPELSLTIPDGVQLAGALPHDEVL
QLFRSARAVIVPSVWSDPCPTVVLEAMAAGRPVVAAASGGILDMVVDGVT
GLLVPPGDAFALAHAINAILRHPQSAHALGAAGRNRARSFTVSAVVDRIE
RMYGDAIMATNPGVAHVG
392418396YP_006455001.1 hypothetical protein Mycch_4620 [Mycobacterium chubuense NBB4]MISTVAAVQGARNATRSEAGDFTGQPTGAVWDLLIFQVVALTLQLVAVTM
AWRGVNEQANILSCGGIAMTFASALWALSRPRLDRALRNTAVVCLGITTT
VQWRMNDPLLFRGYDEQLHMRTLADIESSHSLFQPHPLLAVSPRYPGLEA
LAAFFTQLGLPVMIAATAVVLLARLALVLTLCAAVEHLTGSPRAGGLAVA
VYAISPQFVFFNSQFAYQTLSLPLALAAVAFIAQARRSDDARPLLAGATT
CLLAVAFTHHLTSLLTAAFLIVWAMAEPKGQVRRRVAFGAVVAVLATAFW
AAVQWSLLRDYFGPMIDDVVLQLTSGMQRSPFSETSADPKPSWERGLLLY
YALIVSLTVSFLVLLSSRSLVRRVRFASGRRRVATSTDDLRPWEPRIVLV
MMVAMIPLLFAARALPRWGEVGDRASTFLYLPFSLLVVGVALYWFRKPLF
ARKDGSDARHGRRCGATRARGRILIRPLALILGTAAFLGGYLLGSGSEWA
RLPGGYLPGGDGRSMDAETLAAVRWARDQLPAGSRIGADRLSATLLASRA
RLWPVLTHTDSPEVASLYKADGWGPGQSDIVRSKHLQYLYVDRRFAGAEP
RVGTYFDESPALKLTYAELTKFDRVPEIRQVYRHGPISIYDLSGLGVSIQ
RSGWFGQTRPSSIPTQVLIGLLYGTAFALIGRGAAGKRVTAAARSILTVA
GPFLSFTFGLAVLCVSSVMLLLFRIWLGPAIFISLVLAIALVNPRCILRA
VTSIATVIRWKWFVATVTLALAAAAVITLSALHASAAHRLAFEEDTILSA
TAAPAVEREIGCVLPYPTLRKGDVG
392418394YP_006454999.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MIQSVPILMYHAVADAPSAATRRLSVTPKSLIEQIAFLADSGYTGMTFSD
LASAFEEGAALPERPVVVTFDDGYADFAETAWPILERRGFPATVFVTSGW
VADAGSHAAGKPLDRMLTRAQIRGLAAAGVEIGAHSHSHPQLDQLDDATL
CEEIRFGRALLEESIGRPVRSIAYPFGYSSPRVRLAARAAGYRCAASVRN
LRATPSDNVFMLPRLTIRRSTDEDAFAAIVTGAHGPVLRQERVLTAGWAS
VRRSRRAAKWVLGHA
392418392YP_006454997.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMSGIAFPDTTTTIPAADVGDDVVADFAAAADRWPDRPALVHNGAVVTYGE
LMNRVRLLASRYRAHRSGDETRPDLIGALVSHAPGVVAHLFGILQAGATY
CPVDAALPEARRESIADVLGLDRLFATTAPSQHSTNLRIDTFDPSGGGLC
AEVLQPPWDPSYPAYVLCTSGSTGTPKPVMVSRHALTVTVRALRELFALT
PHDRVLQFASLGWDTCLEEILPALTAGSALVFDDAAHSGSFAPFLRMLAE
REITVVDLPTAFWHELVLFLHEEKAALPESIRLVVIGGERVDLTRLRQWR
NLELGHVGLLNTYGCTETTMITHAIQLCGPGTGPGIATSDTTAPIGRPLP
HVRDHITDDGELLVSGPGLATGYLGMPEKTASAFPVIDYGTGPERWFRTG
DIATRDERGLLYSQGRADEQVKVLGVRVHPAEVEMQLITHPAVTGAVVVG
EHRLGRTSLTAYVVASEATTAAEVKSHLRERLPNQFVPTRVNFVASLAYT
ASGKVDRAATRRAASENNNKGAGR
392418390YP_006454995.1 monoamine oxidase [Mycobacterium chubuense NBB4]MRVVVVGAGLAGLTAALELEAAGADVAVLEARDRVGGRMHGIRATPGVVA
DGGAAYLGVRHTELLALIREYGLRLASTEMLGESTFLIGTERTTTASRVP
PLDAIALGDLFDRLDDLVGQVRLDAPWQSPGAECLDRISAADWLADAVKR
PDAHTFFPLFLGEMMAADPAAISALHMAFYLRSGGGIRYLNAFEGGAQQW
RIDGGSHQLCEAMADRLGDRVRLGRTVRAIHQNRDGVVVRCVSDADAALT
EYPANRVVVALPPVLAQRIEFRPGLRAPRATATTGRGCAVKVHMGYQSPV
WRDHGLSGWSVSTSGPLLSTVDDSPPDGSAGVLTGFVTGAAATDFSALST
AQQMDSALAHARRLFPGLPAPMRCTVTDWLGEKYSRGCYAALFGPGDWLR
LGPTLTEPHGRVHWAGTETSLEFFGLMEGAIRSGRRVATELIEGADVATH
SRKVLSR
392418388YP_006454993.1 hypothetical protein Mycch_4612 [Mycobacterium chubuense NBB4]MQAKKTRRTSVDPIMDTDVAAVADFLSANHNDRVPWAQACSKPPWQVDAP
NRGFMLRDGQRVVGTLLALYSERMVAGRVERFCNLGSWCVLPEYRSRSLS
LLNAVLGQEGYNFTILSPDEGPQEILSFLGFRFLDTTSALVPNLPWPTLP
GRIRISADPDMIENRLAGSELKLYRDHRAALATHHLVLLHGDESCHVMYR
KFRYKGAPLFAIILHVSNADLFRRALVPLARHLLIHHRLVSTLVELRLVD
QRPRMSFAVTNWPKMYRSANLEPRQIDYLYSELTCVPW
392418386YP_006454991.1 glucosamine--fructose-6-phosphate aminotransferase- isomerizing [MyMCGIIACRTIQPAVEYLCTGLRRLEYRGYDSVGVALQTATAEVAHLRTVE
RIGALDELVRGWSGAPLNGVGIGHTRWATHGLVSEENAHPHADCNRRIFV
AHNGIILNADQLRDELTRSGHRIATAVDSEVLSHLIEDALSEHRDLFKAV
QTGLTRVQGTWAIAVLERGTGRIVVASNGSPLLVAHSAHGVFAASDIAAI
VDWTDEFQVLGDGDVVELVDGGQWVRAEADSVPLISRRCSWQGRDADLNG
YSDFMAKEINEQPAAACRVIDDLGTSIDSGELWTDRGLGTFDRLKIIGCG
TSMNAGLVIGNVVRRLGRIPVTCTIASEAADDIPETGQLTLAISQSGETA
DVLQALTSDAIGGAPLVALTNNQHSSLARRADAVLNCDAGPEIGVAATKT
FVCQVIAGAALMISGLSATGRIDRSAAARLTDDLRRLPEKLAAALNVAQC
RVPPLIEELSDCAGFIFIAKGSGLPYAAEGALKLKELTYRWAEHYPAGEL
KHGPLALIGAGTPVVVVDNGDTRLRANMAEIAARGGQLLTIGSADSAIDV
ASDPSAAWGPLEATVPLQVLARTLALSLGHDVDKPRNLAKSVTVQ
392418384YP_006454989.1 glycosyl transferase [Mycobacterium chubuense NBB4]MASPITVIAFACLILGFNTLFWATVGAGRYLGSRLTLMSRCVIEQSPESG
RHRRRSSRSGVAQQFTPDDVAVLIPAHNEAAVLERTVCAATRLVDAANIH
VVSDGSTDGTPNIALQLGVQVLDLPHNSGKARALRAAIEHFELAQRFRVV
LLLDADTRLSDDYLATGLPEFDDEGVVAVAGSVRCSLDPPPRKLMGRLLL
AYRARVYVGVQLLTKYGQAGRWADVVSIVPGFASMYRTDVLDSIDITAPG
LVIEDFNMTFEVHVKKLGRIAFRPCAAVAYTQDPDAFGDYVRQIRRWSLG
FWQTVRLHRKHFGRFWFALTAQVAELICGSVTLLCMPPLMLFAVYTEAVS
ATYGPPEVAGHELVGTLTPQIVALGFLVPDLLVTLLAVCALRRPRLLLFA
PLLPALRLLDAYVCLRSLVAATRTRSTGRWVSPVRRAAASTVAMLKTDDP
ASDFASAVTTCPVSRNS
392418382YP_006454987.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MHRSRNLPRQRLALALALVLLPVCGLTPAGCGIELRSASQPPPTTEVSSV
PSSGPRRLVELPLPPTDPLHVVQGQTVVSITFDDGRKSNIAAARMMTADG
LAGTFFVNSMTIGTKGYLSQADLVEIARMGHEIGGHTMTHPDLGELTGDE
VRRQICDDRENLLGWGFPIRSFAYPFASASTDAETAVRQCGYNSGRSLGE
LRTHRPPPNVDPMLSCQDCALAEVVPPADPMYTSAPAQVRSDWTASDLQQ
QVLDAMSVGGWIELTFHGLCPTDCNSLTTPQTEFGDFLAWLAGQQSAGKL
LVRTVGDVIGGPVRPPIAGPIAPPAPPGANGVKNSGLEQLSDGSPVCWLQ
ASFGRNRPEFSLSSDSHGGTTAGRLIMRDYVDGDAKLLQSTDLGHCAPSV
SPGGTYTVSAWYKSTAPTSFSIQFRHGLGRWAYGLNSPTFPASTDYTLAT
WSLPTMPSDVTAVSFGLALAENGELIADDYSLVDDATASK
392418380YP_006454985.1 hypothetical protein Mycch_4604 [Mycobacterium chubuense NBB4]MSIRRYLAAGATIGVTGAAMVGFGTLAFSDHDATAPASVSYAVRLASTGQ
GCGLAMGVICYPGEQPTRPLGGAIQPSAATPGTLKLRPMFGNGGWLVGNG
LDAVAGCTGTACNGGNGGLLGGNGGNGLNGGSGGNAGFWFGNGGNGGDAT
APGGAGGAGGNGSFFIGNGGNGGNGASITAAGNVTGGAGGTGGAAGMLGG
TPGKGGKGGDATSTGGNATGGKGGAGGRGGKAGGDGGAGGAATASTTGTT
ATGGAGGVGGFSAGISGKGGDGGAATATGSAKAVGGAGGAGGNSGNTGKG
GTGGRGGDATADTGSATGGNGGSGGKSVAGTSPGVLGDGGDGGSGGDGHN
TAKTGTGGAGGSGGNGGLLGQKGKAGSAGAGDTASGSAARHATRVRTRR
392418378YP_006454983.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMTEQEYDVVVVGSGAAGMVAALTAAHQGLSTVVAEKAPHYGGSTARSGGG
VWIPNNEVLERDGVSDTAEAARTYLHSIIGDVVPPEKIDTYLRRGPEMLS
FVLKHSPLKLCWVPNYSDYYPETPGGKATGRSVEPKPFDAKKLGPDVDGL
EPPYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAQATGKN
LVGMGRALIAPLRIGLQKAGVPVLLNTAMTDLYVEDGAVRGIYVVDAREP
GAEPHLIRARRGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAVANTGDG
ILAAEKLGAALDVMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNMSGKR
FMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLVFDQQYRDRYIFAGLQ
PGQRIPKKWMESGVIVKADTLDELAAKTGLPADAFKATVERFNGFARSGV
DEDFKRGESAYDRYYGDPTNKPNPNLGELSHAPFYAAKMVPGDLGTKGGV
VTDVHGRAQRDDGSIIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGYL
AALHLAGKE
392418376YP_006454981.1 acetaldehyde dehydrogenase [Mycobacterium chubuense NBB4]MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKL
GLETSHEGVDWLLAQSERPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTP
AAVGPGVIPPANLREHLDAPNVNMVTCGGQATIPIVHAVSRVVEVPYGEI
VASVSSASAGPGTRANIDEFTKTTSAGVQNIGGARRGKAIIILNPADPPM
IMRDTIFCAIPEDADREAIAASIRDVVAEVQTYVPGYRLLNEPQFDDPSI
NSGGQALVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKERASAG
TGAQA
392418374YP_006454979.1 hypothetical protein Mycch_4598 [Mycobacterium chubuense NBB4]MTTSANTVRRGLFGMFAGGLLAFGSAAILAPVASAQPAPAPAPGPDCSAA
SVAGTVSAATASEGAYLTANPQTNQALTEISTEPQPQAEQAYRTFFAQNP
QVEDQLKAIHQPVSALNDRCNVKLTPTAVAQAVWSVSDTGVPAQTPAAPG
EPATPGAPTGPAPAESPATPAQPMA
392418372YP_006454977.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPETSGRTSPPTDRVIAILDFFAGRPQERFGVSELARRLALSKPTCLGIV
TSLSEAGYLVRDTADKSYRLGPSLITLGHRAQESMRVSPAAREELRRLSA
RFGITAALSAVVDDRITLLDLVAPAGVRPGVEIGQSYPFAPPVGLMFVLW
DDGAAREWLAREPTIPLRTDTERLDRVIAECRADGYLVERLTPSGRRLYS
LMAGMSATLPDELRVLLGELVSDIGERVYLRGERTGRGRHDISVISAPVY
DHYRRQVMVASMHVGKSLPHSAITERARAVVTTADAVTAQLGGVKPIWR
392418370YP_006454975.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMAGALALLEGKVVVISGVGPALGTTLARRCAEAGADLVLAARTVERLEDV
AKQVTDVGRRAVSVGTDITDDAQVDNLVAQALDAYGRVDVLINNAFRVPS
MKPLANTTFDHMRDAIELTVFGALRLIQGFTPALAQANGSVVNVNSMVVR
HSQAKYGAYKMAKSALLAMSQSLATELGEHGIRVNSVLPGYIWGGTLESY
FTHQAGKYGTTVDEIYKATAAASDLKRLPTEDEVASAILFMASDLSSGIT
GQTLDVNCGEYKA
392418368YP_006454973.1 nucleotide sugar dehydrogenase [Mycobacterium chubuense NBB4]MTALYERPEVLDGMVDAAETETALPSVAAPASRSVGVVGLGYVGLPTALA
LAESGAAVLGCDISEAHIDAIKAQQVDLLEDKLATLRRLLDSDLLTLTTG
TAGLPFVDTVLICVPTPVDSHLVPDLTALRSACAVVVEAARPGQTIVLTS
TTYIGCTQELLVEPLRQRGFVVGRDVFVAFSPERIDPGSPSNVPELTPRV
VGGVTHACALRAMETLAMSAGSLHRVSCPEAAELTKLLENIFRAVNIALA
NEFASVAGHFDLDVMEVISAAATKPYGFMAFRPGPGVGGHCIPCDPHYLL
WQLKAGRLPSPVTEAAMASIAARPQAVVRRAQELMADRGRPLAGSRVLLV
GVAYKPAVADVRESPALHIIEELRRLGADVGFTDVMVDSISTSSGRIVCE
ADPAGRHWDLVIVHTVHPSADHSWLSDVPVLLDATYTLPELPQRSTL
392418366YP_006454971.1 hypothetical protein Mycch_4590 [Mycobacterium chubuense NBB4]MRHRRLTTRLVNLLYLAVGALIFLIVLTNGTLW
392418364YP_006454969.1 hypothetical protein Mycch_4588 [Mycobacterium chubuense NBB4]MDDKPDVDRLARSMLLLHGGHDDEYDHHPGGDTDSGGSWRKAPDFAQDPD
RAAAVRENTRRDRERYLTSGLASVDCRFCHVAVQVKKLGPAHTSVQWTTE
ATQRCAHFTEIREAGGDPARERSCPRLADSIRHAVAEGCLEEYSSAPSPG
DGGVNRRRARRWRGWAPSRPPRGSLG
392418362YP_006454967.1 arabinose efflux permease family protein [Mycobacterium chubuense NMTAAVVAPAGAQQRTRRSRRWLAVAAATFAIAWGGNEFTPLLAMYRTDDG
FSTLTVDLLLFAYVLGIVPALLIGGPLSDRFGRRPLMLPAPVLAAIGSIT
LALGADSAVALAVGRVFSGLALGLAMAVGGSWLKELSSPPWDSGNAGARR
AAMSLTAGFGLGAGTAGVLAEWAPAPSVLSYLVNAAMALAAAAVLVAAPE
TRPRAQASPGRPWWTDLAVPAASHRRFLFVVLPVAPWVFGAAGSAYAVLP
ALMAAHAGGAPIAFSALLCVVTLGVGFGVQQLGGSLGADGPRGVVVALLL
LVAGMGAAAWAAVVLTVWAALLAAAVLGAGYGVALLAGLQEIQRLAGPDD
LAGLTAVFYSLSYLGFAVPAVLAFVSTAGPSYPVMFGAGAVVALACLGVT
LFGIRRP
392418360YP_006454965.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMTRMKYTCSIAMGPIDQLIEIARTAEEVGFDSIALPDSLFYMEKQAADYP
YTPDGSRMWNEDTPWVDPLIAAGAMGAVTSRLRFYTNVMKLGSRNPLLLA
RQVGSVANLTGNRFGFGVGIGWAPEEFEWCGVPYAKRGKRVDEMIEVIKL
VLGGGMVEFHGEFYDFDRLQMSPAPSEPVPFYVGGHTDVALKRAARVGDG
WTSAMMTGDQLAETIATLNSLRAEYGRADEPFEFQAVCIDKFGVDGHREL
AEAGVTDNIVIPWVFDGLSFDAPLEQKKDSLKRFADTYIHSGWQDSPAG
392418358YP_006454963.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MTSDTSVAVVGFAHAPHVRRTDGTTNGVEMLMPCFAEIYGDLGITKADIG
FWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKI
LTGEVETALVYGFGKSSAGTLRRVLALQTDPYTVAPLWPDSVSMAGLQAR
FGLDSGKWTAEQMAQVALDAQAAAPRVDRLEPGSTVDELLEQPFFADPLR
RHDIAPITDGASAIVLAAGDRARELRERPAWISGFEHRIETPVLGARDLT
MSPSTAASAEAATGGDASSIEVAELYAPFSHQQLILKEAIGLPDSTRINP
SGGALAANPMFSAGLERIGFAARHIFDGNASRVLAHATSGPALQQNLVAV
LEGK
392418356YP_006454961.1 putative F420-dependent oxidoreductase- Rv3520c family [MycobacteriMKLGLQLGYWGAQPPTNHAELVATAEEVGFDTVFTAEAWGSDAYTPLAWW
GRETTRMRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGAKFPKPLARTREYVDILRQVWAREAPVHSDGPHYPLPLTGEGTT
GLGKNLKPITHPLRADIPVMLGAEGPKNVALAAEICDGWLPIFYSPRIAG
MYNEWLDEGFARAGARRTRETFEICATAQVVVTDDRPAIMELMKPHLALY
MGGMGAEDTNFHADVYRRMGYAEVVDDVTKLFRSGRKDEAATVIPDELVD
DSAIVGDLAYVQEQIKAWEAAGVTMMVVGARSPEQIRDLAGLV
392418354YP_006454959.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTVAPTKPDVDLADGRFYADGAAARAAYAWMRANQPVFRDRNGLAAATT
YQAVLDAERNPELFSSAGGIRPDQPGMPYMIDMDDPAHLLRRKLVNAGFT
RKRVMDRLPSIEALCDTLIDAVCDRGEADFVRDIAAPLPMAVIGDMLGVL
PTEREKLLQWSDDLVCGLSSHLDEQAVQMLMDTFAAYTAFTMEVIADRRA
NPRDDLFSILVHSEVEGSRMSDDEIVMETLLILIGGDETTRHTLSGGTEQ
LLRHQDQWAALVADERSREDHGRSSELLPGAIEEMLRWTSPVKNMCRTLT
ADTEFHGTSLKSGEKIMLMFESANFDESVFENPADFDIRRNPNSHLAFGF
GTHFCLGNQLARLELKTMLTKVLERLPDMRLADENMLPLRPANFVSGLES
MPVVFTPSARVLA
392418352YP_006454957.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMALNIADLAEHAIDAVPDRVALISGDQQLTYAELEEKSNRLAHYLIDQGV
KKDDKVGLYCRNRLEIVIAMLGIVKAGAILVNVNFRYVEGELKYLFDNSD
MVALVHERRYADRVANVLPETPKVKTILVVEDGSDEDYQRYGGVEFYSAL
EQGSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIADEYGLAKQAAESGPMVRYPIPPMIHGATQSATWMALFSGQTTVL
TPEFDAHSVWRTIHEHNVNLLFFTGDAMARPLLDALLAHQDAGEELDLSS
LFLLASTAALFSTSIKEKFLELLPNRIITDSIGSSETGFGGTSVVAKGQS
HTGGPRVTIDKNTVVLDEDGNEVEPGSGKRGIIAKRGHIPVGYFKDEKKT
AETFKTINGVRYAIPGDYAEVEADGTVTMLGRGSVSINSGGEKIYPEEVE
AALKGHPDVFDALVVGVPDPRFGQHVAAVVQAREGTRPTLADLDAFVRSE
IAGYKVPRSLWLVDEVKRSPAGKPDYRWAKDVTEERPADEVHEKHAAVNS
392418350YP_006454955.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMTIDVWMQHPTQRFLDNDMLASLRRWTGGAMPDGDLPIGVTIAAMDAADV
EFGLLSAWRGPNGLDLVSNDEVAGWVRAHPSRFAGLAAVDLDRPMHAVRE
LRTRVREDGFVGLRVVPWLWRLPPTDRRYYPLFAECGELGVPFCTQVGHT
GPLRPSETGRPIPYIDEVALDFPELVIVCGHVGYPWTEEMVAVARKHENV
YIDTSAYTVRRLPAELVAFMKTRTGQRKVLFGSNYPMIGHAHAVDGLGDL
GLSDEARHDFLHANAERVFTKLEGTRP
392418348YP_006454953.1 transposase [Mycobacterium chubuense NBB4]MFTERTSIGLDVHARSVVAAAIDGVTGEVTRTRLTPSFEHIQSWIRHLPG
PVAVAYEAGPTGFGLYRALTETGVRCEVVAPSKLQKPAGDRVKTDARDAL
NLARLLRLDEVTSVSIPSVNQEACRDLVRAREDCRGDLMRARHRLSKLLL
RHGIVYHGGGAWTDAHDRWLRAQAAPQLSTLATRMAFDSDYEHVLMLQAR
RRSLDSAIEDIAADSEFTPVVRRVSCLRGVGTLTAFALAVEIGDWNRFNG
NTIGSFVGLVPSESSSGSRRAQGPITKTGNTHVRRLLVEAAWHHRSKYQV
RAVMRSRWELAPAAARARGHEGNRRLHNRWLGFLARRKRSTVANVAIARE
LAGWCWSLAVMDD
392418346YP_006454951.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MSTQIREIDTGTAMTRFARGWHCLGLAESFRDGRPHGIEAFGTKLVVFAD
SRGDLKVLDGYCRHMGGDLSRGSVKGDNVACPFHDWRWGGDGKCALVPYA
KRTPRMARTRTWLTTEVNGQLLVWHDPERSTPPAELTPPTIEGYDQGIWS
PWQWSSILIEGAHCREIVDNNVDMAHFFYIHHAYPTYFKNVIEGHTASQY
MESKPRPDYTADPEKLWDGTHLRSEATYFGPAYMINWLHNDLGPGFTVEV
ALINCHYPVTHHSFVLQWGVSVQQMPGLPADKAAKLAAAMNRTFGEGFLE
DVEIWKNKTRIDNPLLTEEDGPVYQHRRWYEQFYVDAADVTPDMTDRFEQ
EVDTTHANDLWQQEVAQNLAARAAR
392418344YP_006454949.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMTHRDDIATMLLDRLGDERLGLRTRDREWSWDAVVRESAARAALATAVRD
ETLGDAPFHIGVLLDNVPDFVFWLGGAALAGAVIVGLNPTRGSAGLAADI
RHADCALIVTDSTGADRLAQLDHGVAPSRVLLVDDPAYQRRVDEHRAEPG
AAAGVGAASLFLLLFTSGTTGTSKAVRCSQGRLARIAYAATDKFGHHRED
VDYCCMPLFHGNALMALWAPALANGATVCLAPTFSASRFLPDVRHYGATF
FSYVGKALAYLMATPEQPDDADNTLTRGFGTEASPEDQVEFRRRFGAELF
EGYGSSEGGAVAATDPHAPPGALGRPAHPDVVVVDPETLAPCPTAVLDAQ
ARVLNPDEAIGEIVDRRGARDFEGYYRNDAADAERVRNGWYWTGDLGYID
GDGFLYFAGRRGDWIRVDGENTSALTIERVLRRHPGVVTAAVYGVPDPRS
GDQVMAAIEVADPAAFDLDGLVSFLLAQDDLGAKGFPRLLRVSDNLPTTG
SNKVLKRDLQAQKWHTREPIYRWPGRGRPVYQQMSDADRDALDAEFAAHG
RERHV
392418342YP_006454947.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFKTTEASDDLGGLVRTITESVCTPERQRELDGADERFDRDLWRKLIDA
DILSAAAPESLGGGGFGLLEQVAVLVALGRQMAAVPYLESAVLAAGALAK
FGSETQQQRWAVPAITGEKILTVALDGDMGEGPVQAHAVDGGYRLTGTRT
QVGFGPVADAYLVPAETDTGTRLFVVAADDPGVNIETLDTTGHGSVGHLT
LAGTDLGSDRVVGDGDQIVPWLTTLATLGRSAFQLGVLDRALELTASYAR
EREQFDRPIGSFQAVSARLADGYIDIKALRLTLTQAAWRLSEGLPAEVDV
NTAAFWAAEAGHRVAHTTVHVHGGVGIDTDHPVHRYFLAAKQTEFAVGGA
TGQLLRIGRELADTPA
392418340YP_006454945.1 ferredoxin [Mycobacterium chubuense NBB4]MRVEVDRDRCEGNAVCVGIAPDLFDLDDDDYAVVKADPVPAEEEALAEQA
IAECPRAALIRRD
392418338YP_006454943.1 ABC-type transport system involved in resistance to organic solventMIEQLAAPARAVGGFVEMSLDTFVKSFRRPFQFREFLDQTWMIARVSLVP
TLLVAIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTFVALLL
NGLVCLIGLAGGYVFSVFLQGVNPGAFINGLTVLTGLGELVLAEVKALLF
GVVAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVIMTAVGVR
VLAR
392418336YP_006454941.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MADGDAKRSHVRIAAAILAAVVVAAAVFTYLSYTAAFTPTDKVTVLSPRA
GLVMESKAKVKFRGIQVGDVESIEYAGDSAKLTLAIRSGEMRYIPSNATV
RIAGTTIFGAKAVEFLPPPKPDKASLRPGAEIRAQDVQLEVNTLFQSLTD
TLTKIDPVSLNATLSALAEGLRGHGEDAGAILSGLNSYLAQLNPKLPTLQ
DDFRKAAVVTNIYGDAGPDIATILDNAPSISQTIVDQQDNLNATLLAATG
LANNGTATLEPAADNYIAAIQRLRAPLKVIGEYSPEFGCILKGTANAIDR
FAPIIGGIRPGLFTSSSFVLGSPSYTYPESLPIVNATGGPNCRGLPDIPN
KQYGGSWYRSPFLVTDNAYVPFQPNTEVQFDAPSTLQFLFNGAFAERDDF
392418334YP_006454939.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MAKPDGGSPLRTGIFGIVLVTCLVLVSFGYANLPFMPQGKTYEAFFTDAG
GISPGNTVNVSGINVGKVKSVALAGDTAKVTFTVDRKVRVGDQSLVAIKT
DTVLGEKSLAVTPKGSGSVTSIPLGRTTTPYTLNTALQDLGQNASELDKP
RLEQALQTLTDSMREAKPQLRSTLDGVTNLSRSLNKRDAALEELLRHAKR
VSDTLAQRSGQVNQLIVDGNMLFAALDERRQALSNLISGIDDVSQQLSGF
VADNKREFGPALEKLNLVMDNLLQRKEHIGEALKRLPPYATALGEVVGSG
PGFHINLYGLPPASLAEVLLDTYFQPGKLPDSLADYLRGFISERLIIRPK
SP
392418332YP_006454937.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MRKALGVKTVKRTLALATGAALLAGCQFGGLNSLNMPGTAGHGPGSFSIT
VELPDVATLPQNSPVMVDDVTVGSVSGIDAVQRADGSFYAAVKLSLDKNV
VLPANAIAKVAQTSLLGSQHIELAEPPGKSVGRLENGSEIPIERAGRYPT
TEEVLSSLGVVVNKGNLGALQDITEEAYKAVAGREGTFTDLIPRLAELTG
SLDRQTNDIIAAMEGLDRFSGILAKSKDSLGRTLDTLPGALDVLNRNRSN
IIDAFAALRRFADVGSRVLAQTKDDFAADMKDLFPVIKSFNDNADDFVKS
LEFLPTFPFHYRYLRKAVRGDYLNVFATFDLTLRRLGETLFTTSLGLDPN
MKRMSEIINPPDFLVGSLANLSGQAADPFKIPPGTATQHQGAP
392418330YP_006454935.1 hypothetical protein Mycch_4554 [Mycobacterium chubuense NBB4]MTEVVPPQTGRPGRRRASRAAGPATASEAGASGAATAVLVDAPKSAKTPS
TTALSPPPRRAAHRGLVALISVLALLAAGGAVGGVVAWMLVQQRQEQAQL
DRDQRFVDTASQLVVNMFSYTQDNIDDSVNRFVNSTSGPLRDMLSQSNNV
ENLKAIFRDTNASSEAVINGAALEKIDEVSGNASVLVSARVTVTDMEGTN
KPSQPYRMRVIVHEDDNGHMTGYDLKYPNGGN
392418328YP_006454933.1 Trehalose-6-phosphate synthase [Mycobacterium chubuense NBB4]MSPQGGAEGRSGFADFVVVANRLPIDMVRQPDGTIEWKRSPGGLVTALEP
LLRRRRGAWIGWPGVPQEADDPDVSEEPIEQDGMHLVPVRLSATDVAEYY
EGFSNATLWPLYHDVIVKPIYHRAWWDRYVEVNRRFAEATARTASEGATV
WVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPWRTEITEGL
LGADLVGFHLPGGAQNFLILARRLVGANTSRGNVGVRSRFGEVQVGFRTV
KVGAFPISIDSTELDQQARTRTIRTRARKLREELGNPRKILLGVDRLDYT
KGIDVRLQAFSELLDEHRVNPEDTVLVQLATPSRERVESYIAMREDIERQ
VGHINGEYGEVGHPVVHYLHRPVPREDLLAFFVAADVMLVTPLRDGMNLV
AKEYVACRSDLGGALVLSEFTGAAAELRQAYLTNPHHLEGVKDAIEAALN
QTPEEGRRRMRALRRQVLAHDVDRWARAFLDALAGAETKSE
392418326YP_006454931.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMLDVANADQVTYETLDEGRIARIWLNRPDAQNAQSRTLLVQLDEAFGRAE
ADDEVRVVILAARGKNFSAGHDLGSEQALAERAPGPDQHPTFRSHGATRA
AVAERTYLQEWHYFFENTRRWRDLRKITIAQVQGNAISAGLMLIWACDLI
VASDDAKFSDVVGVRMGMPGVEYYAHPWEFGPRKAKELLLTGDSIDADEA
HRLGMVSKVFPRAELEDKTLEFAKRIAERPTMAALLIKDSVNAATEAMGF
TETLRHAFHIHELGHAHWAAHNENRYPVGLPPDVPDWRTLGAPKPSRRDE
P
392418324YP_006454929.1 aerobic-type carbon monoxide dehydrogenase- small subunit CoxS/CutSMHELPVEVSVNGRRYAASVEPRLTLADYLRERCGLTGTHLGCEHGACGAC
TVLLDGQAVRSCLIFAVQVDGQEITTVEGVADDGELSPVQAAMRDCHGLQ
CGFCTPGFVTSITALLRDNPTPTDAEIREGLSGNFCRCTGYQGIVNAVRR
ASESMS
392418322YP_006454927.1 hypothetical protein Mycch_4546 [Mycobacterium chubuense NBB4]MELNNEFRVAVPPAKVWEVFTDVERVAPCLPGATLLGVDGDTFDGAVKVK
VGPITVSYKGVASYQEKDAGARRIVLRAEGKETRGNGTAAATVTAQLQDE
GDATYVGIVTDLAISGKAAQFGRGVLADVSGNLIAQFARSLEAELLGDAP
SPSQTGSAATTSAAASEAGDSVDLLKVVAVPMAKRYAPVLGAALAAGAVG
FVLGRRRRKGPAAVLADDLQAVLARLLS
392418320YP_006454925.1 xanthine and CO dehydrogenases maturation factor- XdhC/CoxF family MRDVLDELLAVWRTGGTAGLSTVVRTMRSAPRPPGAAMVVSPDGSVAGSV
SGGCVEAAVYEVANDVVASGVPELQRYGVSDDEAFSVGLTCGGTIDVFTE
PVSRNTFPQLQSVADDIAAHRAVAVATIVAHPDHKRLGLRLIVGADSATG
SLGSARADAAVADDARGLLAAGRSAVLSYGPDGQRQEAGMEVFIASHAPR
PRMLVFGAIDFASALAQQGSLLSYRVTVCDARPVFTTAARFPAAEDVVVD
WPHRYLAAQAEAGAIDARTAICVLTHDPKFDVPVLEVALRLPEVGYIGVM
GSRRTHDDRMRRLREAGLTDSELARLASPIGLDLGARTPEETAVSIAAEI
IARRWGGGGRPLSGTGGRIHH
392418318YP_006454923.1 hypothetical protein Mycch_4542 [Mycobacterium chubuense NBB4]MGAASFVGRVGGLAVALGVGVAAFAGAGAAWADDTSSSPAKSSASENTSA
RAGTTTKDTTGDTAKDTATKTTGDRSTDTPKRRSPKKAGRGGDSGADGSD
NATPSEDADQKAPAEPEGTESTPTTSPSPSPSTGTSATTRASKPPRKPRP
ESSAASTPKSVKHTDAEPEPSKAASKTPDATATSTSTATSTSTATSTSAS
TKASTDPAEPPREAKTVTLFSHTSSLAADSSTAVAPTPKPNLVTAVVNVV
HSMLDWAHQKAGAGQNDPAQPPFLWALMSFARREFESLLAARSTTTAAVG
TAVASTSLALADQPAAAAATVLTPYSPWLNPQVSSSTNFVSWVTGNYVYG
DKTLANTLNRFQVYGTDVGTMWDNGMVDDPTTPYNEHQLLIAVGDTFGAA
NMTGRHIYNTLFRSSDTNLSDGMTIPNGEWFNGNMFGGAPLSQPTQARPI
INRPTWAPNSVTLIPTAGVSVNVPVTSETPYGTIQYVTFMSVSNWGSAGR
WTTNYAGIAYSTDNGENFTVDRGSVRYNSIFSGNKNFQQSAFVKGDDGYI
YMYGTPNGRQGAAYVARVAPDDILNLSKYQYYKAPSKTWFGTTVPGAWVT
GRPQSASAIIGKSGGFLGMTKPGYTVSEMSVQYNEYLGKYIVLYGDQSNN
IVMRTADTPEGVWSDPTILMTQQPGGIYAPMLNPWSPSTLGTGPDLYWNL
SLWSSYDVMMMHTDLTKL
392418316YP_006454921.1 transcriptional regulator- luxR family [Mycobacterium chubuense NBBMAQWVPPPLPAELLARRRGPFVGRAAELSAFEHAWEQVDEGRRHMVFIGG
EPGAGKSRLVAEIAGTLADHGVAVLVGSSTADAGVPYEPFAEALDRLLSA
GPAGCLAEPLADAGPQLERLSALVHRHLPGAESTDDAGTVRRVLFDALTG
FLRRLAAHRPIALILEDLHWAQLPTLAMLEHVLATCADIRLLIVATFRTT
APDRSDELVSRVAEMHRFDGVRRLDLEGLDTEAITEFVSRTQQLPPPTAR
TAAALLRDRTGGNPFFLTELCHHLGTRGGLAALSAHQTVPASIGDAITRR
LTGLGAGVQAIIEQAAVLGETFDLPALIAGSDTDVAATLAAVDSAEAVGL
IRAVQDSDGEFAFVHALTREAVVARMAPSRLRIMHARAAEALEGRADPAV
IPRLANHYLLAHVLGFHEQALRYARKAAAMAERSLAYEDAATWYGRAASL
PELDMVDRARLNLSAAGNHVRAGDFARARSMYESISAIDDPLVRLEAAVG
YEDANWRPGLADSKAADLLASALESCGLDVDDPRYVRALGSFGRALAFAG
ETARARDISNLAIDHARRIDDRAVIVHALETSLWHGLTPDMCEHQLERST
ELSRMALSRRDYEALGSASHFRALASYQAGRAEELAASAADMQRAGRASG
QPFFNFVGACAAGGMAYLRGDFDGAERWAEIALRTGGLLGGDTTEGSYGV
QMFMIRRETGALKRFSGFVDGSETFADRWVPGLLALYTEIGCERGMTRAL
NQLLSRDLGSRTEAAQWPMELVFMTEAALALGEREAAAVLRPFVARYEGK
NIMSGQFVAIFGSADRYLARIADLAGDHDAAEAHFAVALEMDRRMNSTVH
VAETLARQALFEDSRGHGADARRLADEARAIAAPIGQTRVLDLLDSMSRS
GPDGLTDREIDVLRLLAEGLSNRAIGERLYISTNTAANHVRSILLKTGAA
NRTQAAMYAADHELLA
392418314YP_006454919.1 putative protein-S-isoprenylcysteine methyltransferase [MycobacteriMSTVVDGRRSVAVRSAAVLYGVVCYMAFVVVFGYAIGFVTGALVPRSVDS
ALTAPVAQAVVIDVALLTVFALQHSVMARPGFKRWWARYVPAAIERSTYV
LFSSAALALVFWQWREIGTTVWQVDSEPVRLVLAVLAGVGWVTVVASTFM
IDHFEMFGLRQILHVWRAKPMSGKGFRMVLLYRLIRHPLYLGFLIAFWST
PTMTGGHLVFAATTTVYILVAVRFEERDLAAELGDPYRRYRQRVPMLCPF
PVRRAQ
392418312YP_006454917.1 ABC-type antimicrobial peptide transport system- ATPase component [MSAKPVLQLDGVGKTYRRGGEQVRVLVDFDFTLRAGEFVVVTGPSGVGKS
TLLHVAGGLDAPDSGTVAVAGQNVWSMSTAARAAFRRRNLGFVFQFFNLV
PMLTAMENVSLPLVLDGVSARSADARAEKLLERVGLGDRARHRPAELSGG
QMQRVAVARAVVARPSIVLADEPTGNLDSRSSTEVLDLLRSLSDEDGTAV
VMVTHDHAAAQYGSRELHLVDGRACPADPLAPVGEW
392418310YP_006454915.1 hypothetical protein Mycch_4532 [Mycobacterium chubuense NBB4]MNLARSLTELAFAPVRVGLAVADAGIGVASGALDMAQRTVGEADAGLRSR
PTSLAQMLGIDDAVERANRLARLMDEDQPLGRALAPDGPLDRLLKPGGVV
DRLTAPGGVLDKLTQEEGGLMRAIEPGGLVDQLLDEEGLVERLLAEDGLA
DRLLAEGGLIDKLTARNGPLEQLADVADTLNRLAPGLEALEPTIEALREA
VIMLSQVVNPLSSIADRIPLPGRRARRSAASRAVTSQRVIDVEE
392418308YP_006454913.1 signal transduction histidine kinase [Mycobacterium chubuense NBB4]MESNDLDNGGVPGPIKRGIPLRVGLVAATLLLVALGLLASGVAVTTIMHH
SLVNRVDDTLLDASRGWAQVPIQVPDDPTSGPNPARPPSDYYVRGIDSTG
REWTADNDRDAEPALPTDNDVGPVPVTVGSVGDSDVEWRAMTVRGLRGEV
TTVAIDLTDVKSTTRALIYAQIGIGTAVLLVLGIVGYAVVHRSLRPLAEV
EQTAAAIAAGQLDRRVPERDPRTEVGRLSLALNGMLAQIQRALASSESSA
EQARSSEDRMRRFITDASHELRTPLTTIRGFAELYRQGAARDVEMLMSRI
ESESRRMGLLVEDLLLLARLDAQRPLEQRRVDLLALATDAVHDAQSIAPR
RPIRMEVFDGPGTPEVLGDEARLRQVLSNLVANALQHTPETAGVTVRVGT
DGDDAVLEVCDEGPGMRAEDAQRVFERFYRADSSRARASGGTGLGLSIVD
SLVYAHGGRVSVDTAPGRGCKFRVSLPRIAEAAVPAELDASLN
392418306YP_006454911.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMLGLMQDRPLMISSLIEYAAAFHPDAEVVSRLPEGHIRRSNWREVNERSK
QVANALAELGIEEGDRVATLAWNSDRHLALYFGVSGSGAVMHTVNPRLFG
HQISYIINHAEDRVLFFDITFASLVSQLAPELSTVRTFVAMTDREHMPEV
PGVPEDRLLCWDEFIGRQSTHYDWPEFDELSASSLCYTSGTTGNPKGVLY
SHRSTMLHTLMAAARDANDVHSGSVILLVVPMFHANAWGTPYTAAMVGAK
LVLPGPHLDGESVYELMKTEGVNQSQGVPTVWMMLFAYLDEHPEIDPHEL
GLRVAGTGGAALPLSMIERFDRDFGADAMQGWGMTETSPLCVIGRLLPKH
ERLSDAEKAQIKLKQGRGICGVELKIVDDEGNRLPWDGKAFGEVWVRGPW
IASGYFKGEGGDKLDAEGFFPTGDVATIDPDGYLQLVDRAKDVIKSGGEW
VSSIDLENAAMGHPAVAEAAVIGMPHPKWQERPLLVVVLRNGADATRDEL
IDHLAGEVAKWWLPDDVLFVDELPHTATGKVSKLQLRERFRDYQLPTVAT
392418304YP_006454909.1 NTF2 domain-containing protein [Mycobacterium chubuense NBB4]MTETAELSPVVAASRESWRCVQTGDRAGWLSLMADDIVIEDPIGEAVTNP
DGAGVRGKEAVAAFYDTNIGPNQLRVTCHETFPSSSPTEIAYILELETTF
PNGFVATVRGAFTYRVNDSGLITNLRGYWNMDAMTFSQPESVD
392418302YP_006454907.1 hypothetical protein Mycch_4524 [Mycobacterium chubuense NBB4]MASRRELEDWVQRWLQANRDAEAAGDWKPLADFYTDDATYGWNIGPKEDV
MCVGKKEIRDVALGLEMEGLENWVYEYQKVLIDEKQNEIVGFWKQIANKS
DGSRDEIYGIGGSWFRLNDQLLIEWQRDFFDFGHVQKAFMKLIESGDLTP
TMQKRIERSLAGEKLPGYYPLGEAPVPIW
392418300YP_006454905.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTATVPRVSGGEEEHGHLEEFRTDPIGLMQRVREECGDVGWFQLVDKHV
ILLSGAEANEFFFRSADEDLDQAEAYPFMTPIFGKGVVFDASPERRKEML
HNSALRGEHMKSHAATIEGEVTKMIAGWGDEGEIELLDFFAELTIYTSTA
CLIGLKFREQLDHRFAEYYHQLERGTDPLCYVDPYLPIESFRLRDEARVK
LVALVQEIMDQRLANPPKDKSDRDMLDVLVSIKDSDGNPRFSADEVTGMF
ISLMFAGHHTSSGTSSWTLIELIRHPDVYAEVQAELDELYADGQEVSFHA
LRQIPKLDNVVKETLRLHPPLIILMRVAQGEFEVKGFPIHKGDFVAASPA
ISNRIPEDFPDPDAFKPDRYDKPEQADVVNRWTWIPFGAGRHRCVGAAFA
QMQIKAIFSVLLREYEFEMAQPADTYRNDHTKMVVQLERPAKVRYRKRVK
E
392418298YP_006454903.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTITETLLDPYDYDFHEDPYQYYQRLRDEAPLYRNEELGFWALSRHRDVL
AGFRNSTTLSNKFGVSLDPASRGPHASKTMSFLAMDDPDHLRLRTLVSKG
FTPRRIRELEPRVTEIATRHLDAMLEKARSSQTVDYVDEFAGKLPMDVIS
ELMGVPEADRAQVRAWADAVMHREDGVTDVPASAVEASLNLIVYYQDMVA
ARRKKLSDDLTSALLEAEIGGDRLTDDEIIGFMFLMVIAGNETTTKLLAN
AAFWGHRNPDQLTPVYDDLERVPLWVEETLRFDTSSQILARTVSGELTLY
DTVIPDGDVLLLLPGSAHRDERVFDNPDDYVIGREIGSKLMSFGSGAHFC
LGAHLARMEARVALAELFKRIRGYEVDEANAVRVHSSNVRGFAHLPIHVQ
IR
392418296YP_006454901.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MVLLADRESRLLIDGKLVAGSSGTFPTINPATEETLGVAADATADDMTSA
IGAARRAFDETGWSTDTELRVRCLRQLQQAMRDHIEELRELTIAEVGAPR
MLTSAAQLEGPVEDLSFCADTAESYQWTTDLGIASPMGIKTHRTIAREAV
GVVGAITPWNFPHQINLAKIGPALAAGNTLVLKPAPDTPWAAAVLGELIT
EHTDFPAGVINIVTSSDHGVGALLSRDPRVDMVSFTGSTNTGRAVMADGS
VTLKKVFLELGGKSAFLVLDDADLAGACAMSAFTASMHAGQGCAITTRLV
VPRNRYDEAVEAAAATMGGLKPGDPTDAGTICGPLISERQRDRVQGYLDS
ATAQGGTFACGGGRPADRDTGFFIEPTVIAGLDNNATVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVFSADEDRAAGIAARLRVGTVNVNGGV
WYSADMPFGGYKQSGIGREMGLAGFEEYLEIKAIATAAK
392418294YP_006454899.1 beta-hydroxyacid dehydrogenase- 3-hydroxyisobutyrate dehydrogenase MNEEVRFGYIGLGNMGAPMAKRLVEWPGGLTVFDVRTEAMTPLAELGAAL
ADSVADVAAAGIISVTVLNDEQVREVVSELAEHAKPGTVIAIHSTIRPET
AVELADQLRPRDIHIVDAPVSGGGAAAANGELAVMVGADREVYERVKPAF
KQFASMVIHAGEPGAGTRMKLARNMLTFVGYAAACEAMKLAEAGGISLQQ
LGRVVRHTDALTSGPGAIMVRDDMSVLEPDNFLYQSFTHARGLGEKDLSL
ALALGEETGVELPLAEIALKNLAAGLGVPHTSSTAKE
392418292YP_006454897.1 hypothetical protein Mycch_4514 [Mycobacterium chubuense NBB4]MTSRYAALSRDQLVVLVPELLLIGQLIDRSGMAWVISNFGREEMLQVAIE
EWMGASPIYTRRMQKALRYEGTDVVTIFKGLQLDIGAPPQFMDFRYTVHD
RWHGEFHLDHCGALLDVEPMGEEYVRGMCHDIEDPTFDATAVATNRRAQI
RPIHRPPRVPADRHPHCAWTVIIDESYPEVEDHPALEVIARTQAARTELD
PIDTADEGQSDYAGELLSDFDFAAFSHSALVRMADEVCLQMHLVNLSYVL
AVGARAGANVELAKGICVKQLTGVAGVAAERIHAALKLPGGVEGAVKTLE
LHPMFNPAAYVCADFGPDTVDVRRCPAHEDGAWVALTGPAERRPLQAVVR
AVDPHLDVEVTGSDTDWTARVFETDSAAEELPEVAVVKFSGGSTFEFENR
RSLPLTVV
392418290YP_006454895.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTTDTGPQSCPFLPSGYDFTDPDVLLAGIPVAEFAQLRKTAPVWWNAQA
ESIFDDGGYWVISRHEDIKSISRNSAAWSTNANGAVMRLPDGVTAEQLDL
TKALLINHDAPEHTRLRKIISRLFTPRAIAGMEEKLAVSAREIVRTAAEK
DTGNFVQDVAMLLPLQAIADLIGVPEADRGKLFGWTNAIMNTDDPEFDSD
PTTANAELMGYAYTMAEQRRRCPADDIVTRLIQADIDGEALGDVEFAFFV
ILLAVAGNETTRNAMTHGMNAFFDNPDQWELFRRERPETAVDEIIRWATP
VHCFQRTALEDVELGGVTIAKGQRAGLFYSSANFDEDVFDRPFAFDILRN
PNPHLAFGGNGAHFCIGANLARMEIKLMFDEIADQIPDISKLAEPQRLRS
GWINGVKDLQVSYH
392418288YP_006454893.1 hypothetical protein Mycch_4510 [Mycobacterium chubuense NBB4]MMARMPTISRREVLALGFRASVVTAAAATAVSASRAALATAAPPATSAAA
PTYATGSFVSAARGGVPTNWIIARPPGQSVPLRPVILLHGKDSNAQTVMS
MGAERFLADAVAAGLPPFALAAVDGGNGYWHRRASGDDPGAMVLDEFLPL
LGEQGLDTSRVGFLGWSMGGYGAMLLGARLGAPRTAAIVAVSPALWTSPG
AAAPGAFDGADDYNANSVWGLAGLNGIPLRIDCGYDDPFYSATKQFIAQL
PTPPAGGFSPGGHNPAFWSSQLTAELSWAAPLLA
392418286YP_006454891.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMSLADPLRALADVALDRSVVLGYTKIGSTVRRLWWPADPAPNAMAGKRVV
VTGATAGIGEAMVASFAQLGATVHLLGRDRAKVRRIAGAVRSSVSGAEIV
EEVCDVSDLDAVRAWTDDLSGRVETLHGLVHNAGLMPKVRAETAQGHETQ
LACHVLGPHVMTERLLEPLRNAGGSAVVFMSSGGMYTAPLKRWSAEEFES
RDGPYDGVRVYARTKRMQVVLAEAWAQRLAGTGIRVYSTHPGWVETPGVA
EALPGFRRLTRPLLRSPADGADTAVWLVAVRPDSGPGHFWHDRAQRPTTF
GWQRREDPGTASAFLDQVSALTQHSAAG
392418284YP_006454889.1 adenylosuccinate lyase [Mycobacterium chubuense NBB4]MSIPNVLANRYASEEMVAIWSPEAKIVAERRLWLAVLRAQAELGVDVPEG
VVADYERVLDNVDLDSIAARERVTRHDVKARIEEFNALAGYEHVHKGMTS
RDLTENVEQLQIRRSLELVHAHGVAVVARLAERAVLYRDLVMAGRSHNVA
AQATTLGKRFASAAQEMLVALQRVQELIARYPLRGIKGPMGTAQDMLDLF
DGDTERLAELERRVAQFLGFTEMLTSVGQVYPRSLDHDVVSALVQLGAGP
SSMAHTIRLMAGHELVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMAAELAGAQWNEGDVFCSVVRRVALPDAFFALDGQTETFLTVLDEF
GAYPAVIQRELDRYLPFLATTRILIAAVRAGVGRETAHEVIKEHAVAVAL
AMRERGAEPDLLDRLAADHRLPLDRAALDAALADKQAFTGAAGDQVDRVV
AAVDDVISRYPEAAKYTSGAIL
392418282YP_006454887.1 tellurite resistance protein-like permease [Mycobacterium chubuenseMRPDAFAAVMATGIVSVAVAGHGFRGLGDILLVLVAGLLPVLILAVAIAW
RRHRWRLRDLGVVLPLFTFVAANAVLATRLAGHRIAVGTLTVAALAAWLA
LVPIAARQMWRCGGADLRDQARGGWELASVATSGVAILLAEQRMVVQAVA
FWTVAIGFYVLMTSLIGWRVWHEADVSVLVPPDAWILMGALAIATLAGAH
IHHHTQGWAAADIRWVTAGTWAVATGWIPVLMFIALRHLRRLAALGAGAW
WWAMVFPLGMYSVATQALATETGWSPLRAVSWAFCWVALLGWLSLASGVL
ARTIGHWWSNSRREASA
392418280YP_006454885.1 hypothetical protein Mycch_4502 [Mycobacterium chubuense NBB4]MRSRWVPYASTPGRLLSQLFSDIVVVLWTAVWVFVGMAVHSAVATVAEFG
YRVESGANGVAGNLDSAGNSAGNVPLIGDDLAKPLSAAGDAAREIAGAGQ
SLGVTAGWLAWLLALAVAAPPILALMMPWLFLRVRYFRRKWTAVTLASTS
AGEQLLALRALANRPLPKLAAIHADPVGAWRNQDPVAIRGLAALELRASG
IRAANLWRAG
392418278YP_006454883.1 oligopeptidase B [Mycobacterium chubuense NBB4]MKPPVAKRVDHRREHHGDVFVDPYEWLREKSSPEVIDYLEAENSFTDHVT
ADLAPLRQKIFDEIKARTKETDLSVPIRRGDWWYYGRSFQGKQYGVQCRC
PVTDPDDWTPPQFDEDTEIPGEQVLLDENVEAEGHDFFSLGAATVSVDGN
ILAYSVDVTGDERYTLRFKNLRTGERYDDEIAGIGAGATWAADNATVYYV
TVDDAWRPDTVWRHRLGAGLPAERVYHEPDERFWVAVGRTRSNKYVIIAA
GSAVTSELRYGDAADPQTQFTTVWERRDSIEYSVDHAVVGGEDRFLILHN
DGAENFTLVEASVSDPTAYRTLIGHREDVRLDSVDAFEGHLVISYRRDAL
PRIQLWPVDDAGYGRQEDISFDSELMSVGLTANPNWSAPKMRIGATSFVT
PVRIYDLDLHTGERTLLREQPVLGDYRPEDYVERRDWAVASDGARVPISI
IHRAGLEYPAPVLLYGYGAYESCEDPRFSIARLSLLDRGMIYAVAHVRGG
GELGRPWYEHGKLLEKRNTFTDFISVASHLVGTDVTRPENLVAYGGSAGG
LLMGAVANMAPDLFAGILAAVPFVDPLTTILDPSLPLTVTEWDEWGNPLE
DPDVYRYMKSYSPYENVEAKSYPAILAMTSLNDTRVYYVEPAKWVAALRH
SQADPSGEAAKVLLKTEMNAGHGGISGRYERWKEAAFQYAWLLDVAKADT
NGDPSSR
392418276YP_006454881.1 glutathione peroxidase [Mycobacterium chubuense NBB4]MTDTALTEIPLTTLDGTPTTLGELADGAALVVNVASKCGLTPQYTALEHL
AQQYGGRGLTVIGVPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTEV
NGPGRHRLYEELTQTADDSGEAGDVQWNFEKFLVAPGGAVVKRFRPRTVP
DAPEVISAIESVLPQ
392418274YP_006454879.1 putative oxidoreductase [Mycobacterium chubuense NBB4]MAEDADVIVVGAGLAGLVAACELADRGKRVLIVDQENEANVGGQAFWSFG
GLFFVDSAEQRRLGIRDSHELALQDWLGTAGFDRPEDHWPRQWAHAYVDF
AAGEKRSWLRDRGLQTFALVGWAERGGYDARGHGNSVPRFHITWGTGPAL
VEIFARQLRGRAGVRFAHRHRVDELVTDGGAVTGVRGAVLEPTTAARGVA
TSRNTVGDFEFRAQAVVVASGGIGGNHDLVRKNWPPRMGRVPEQLLSGVP
AHVDGRMLGISEAAGAHVINSDRMWHYTEGITNYDPIWPRHGIRILPGPS
SLWLDATGKRLPAPLYPGFDTLGTLEYIARTGHDYTWFLLNARIIAKEFG
LSGEEQNPDLTGRSLRAVLDRARNGPAPVHAFVEKGVDFVSANSLRDLVT
VMNAVPDTEPLDFAVVEAEVTARDREVANRYTKDSQITAIRAARSYLPDR
ISRVVAPHRLTDPKAGPLIAVKLHILTRKSLGGLKTDLESRALRSDGSAL
PGLYAAGEAAGFGGGGVHGYRSLEGTFLGGCVFSGRAAGRAAARDVG
392418272YP_006454877.1 hypothetical protein Mycch_4494 [Mycobacterium chubuense NBB4]MQVRSVLALAVASAVATAWSLTGLVFSPGMARAAPGICPPFCDAIPDSAW
IESSSIPLSSVYRWPGLAGVAVTAAKPRFEFESWCASPAIPGDPRDYAVA
ARATVPNPDGQWNLQAQVLHWRGDTVTGGRTALATIERARMALSSCGATA
PTVSPSLTTSEADRLAAVISDPGSRVMHVYLLAEPSNSTVVEVVLWTTIP
AVVEWRAVSDAQIFDAMSTPLCAAYLGSCR
392418270YP_006454875.1 phosphoribosylformylglycinamidine synthase subunit I [MycobacteriumMTRVGVITFPGTLDDIDASRAVRLAGGEPVSLWHADADLKGVDAVIVPGG
FSYGDYLRCGAIARFAPVMGEVVAAAGRGMPVLGICNGFQVLCEAGLLPG
ALTRNAGLHFICRDVWLQVSSITTAWTSRFEWGAELLVPLKSGEGRYVAS
EQVLDELEGEGRVVFRYSENPNGSMRDIAGISSANGRVVGLMPHPEHATE
ALTGPSDDGLGLFYSALDAILVS
392418268YP_006454873.1 Dyp-type peroxidase family [Mycobacterium chubuense NBB4]MPAPLPQPVLAPLTPAAIFLVATIDAGGEAAVHESLGDIAGLVRAIGFRD
PSKRLSVVTSIGSDAWDRLFTGPRPRELHRFAELDGGRHRAPSTPGDLLF
HIRAESMDVCFELATKLVEAMDAITVVDETHGFRFFDNRDLLGFVDGTEN
PDGPLADSATRIGDEDPDFAGGCYVHVQKYLHDMAAWNALSTEEQERVIG
RTKLDDIELDDDVKPADSHVALNVVEDDAGNELKIVRHNMPFGEVGRGEF
GTYFIGYSRSAAVTERMLTNMFLGDPPGNTDHILDFSTAVTGSLFFTPIM
DFLENPPPLPDSATGPGGYAGSLAIGSVKGQPQ
392418266YP_006454871.1 hypothetical protein Mycch_4488 [Mycobacterium chubuense NBB4]MALDVAMITVDCTDPDMLADWWANAVGGDVNAVAPGEFVMVTRQGAPALG
FQRVPDPTPGKNKVHLDLHTPDKEAEVARLVGLGARETGRHSFGPDFDWV
VLADPEGNAFCVAGG
392418264YP_006454869.1 putative membrane protein [Mycobacterium chubuense NBB4]MTTETEDKHPVYLWAWNLLRLDFIGIVFGALFFCMSLTPSLLPRDWLFQG
LLGGINAAIGYGIGVFVAKMLRRFVPAERRWSPRASVAKLIKTAIVAVSA
AVCVLMVIPAAAWQRQVSSLMGMQGPGTAGYLRTLLLAAAVAGVCVAVTR
VLIDLIKTMARFLIRRWRLSDELALFIGTAIVVVLVITLVNGVLLQGFLA
GANRIFQPQNTTTMAGVLQPLDPERSGSPESFAPWDTLGYQGRNFVGTGP
SAAELSRINGRPAKVPVRVYVGLQTADTEEARMAVLLSELERTGAFDRKV
LVIVPTTGTGWVNPIAARSLEMMYNGDTAIVASQYSYLPSWISFIGDQQK
SLHAGRMLIDAVHDRWIQQPPQWRPRLMLYGESLGSMAGQGAFDWLPDIS
RMGFSSVLWVGPPNASRLWRGLTARRDPGTPEVEPRYDNGRTVRFSQAYD
AAEIAHDTAPPWEGTRVLYLQHSSDPIVWWSQDLLFTRPDWLSEPPGRDR
TASMRWYPIVTFWQVAADLTNAASVPRGHGHNYGDYILDGWAGVAAPAGW
TSADTERIRIALRETESEDGNQ
392418262YP_006454867.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MSEARDAPPYRRLGALLLVIAAALGLLVFFQFQGRFIPSVEVTLSSPRAG
LVVEKGAKVTFNGVEIGRVVGIAPAGTGDIPGADLTLHIDPAALHVIPAN
AVVEIRATTVFGNKYISFTSPENPSAQRLSANDVLHVRAVTTEFNTLFET
VTAIAEQVDPVKLNQTLAATAQALSGLGERFGDSLLDGNRILGDLDPRLP
RARHDIRALADLADLYADSSPDLWAGLADAVTTARTLDAHRDDVDAALMA
AIGFSGVATDPFERGGPYLVRGAEDLLPTTKLLDDYRGMILCTIRNYHDV
APDFARVLGGDNGYSLRSAGTALGAGNPFIYPDNLPRVNARGGPEGKPGC
WQKITRDLWPNPYLVMDTGYSLAPYNHFELGQPLFTDYVWGRQVGQLTIN
P
392418260YP_006454865.1 amidophosphoribosyltransferase [Mycobacterium chubuense NBB4]MTSEQLDNEPKEECGVFGVWAPGEEVAKLTYYGLYALQHRGQEAAGIAVA
DGSQVLVFKDLGLVSQVFDEQTLAAMQGHVAVGHCRYSTTGSTTWENAQP
VFRNTAAGTGVALGHNGNLVNTAELAARARDEGLMSNRGAAAATTDSDIL
GALLAHGAADSSLEQAALELLPTVRGAFCLTFMDENTLYAARDPYGVRPL
SLGRLDRGWVVASETAALDIVGASFVRDIEPGELLAIDADGVRSSRFAPP
TPKGCVFEYVYLARPDSTIVGRSVHATRVDIGRRLAREKPVDADLVIGVP
ESGTPAAVGYAQESGIPYGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNP
LKEVIRGKRLIVVDDSIVRGNTQRALIRMLREAGAVEVHVRIASPPVKWP
CFYGIDFATPAELIANASNADADEAEMLEAVRHAIGADSLSYISQHGMIA
ATEQPASRLCSACFDGNYPIELPGETALGKNVIEHMLTTAARTGIPIQPD
NDNASALRRP
392418258YP_006454863.1 phosphoribosylformylglycinamidine cyclo-ligase [Mycobacterium chubuMTERAEQHGISYASAGVDIEAGDRAVELFKPLAHKATRPEVRGGLGGFAG
LFALRGGYREPLLASSTDGVGTKLAVAQAMDKHDTVGIDLVAMVVDDLVV
CGAEPLFLQDYIAVGRTVPERVAELVSGIADGCVMAGCALLGGETAEHPG
LMAPDHYDISATGVGVVEADDVLGPDRVRPGDVIIAMASTGLHSNGYSLA
RHVLLEIDHMNLAGHVEEFGRTLGEELLEPTRIYTKDCLALAAETQVRTF
CHVTGGGLAGNLERVIPHGLTAELDRGTWTPAPVFGMIAQRGRIERTEME
KTFNMGVGMVAVVAPEDTDRALAVLTARHLDCWTLGTVQKGSKDSSRAVL
VGQHPRF
392418256YP_006454861.1 folate-binding protein YgfZ [Mycobacterium chubuense NBB4]MASTSTGVPAPDTGPDAGATWHYGDPFGEQRAAAQAAVVVDRSHRAVLSL
TGSDRKTWLHSISTQHVSELPDGVVTENLSLDGQGRVEDHWLQTQLEGVT
VLDTEPWRGESLLGYLRKMVFWSDVVVEPADLAVLSLLGPGVADTPVLDT
LGVSALPAPGTAVPLPAGGFLRRIAADDLEVDVVVPRDQVAQWRERLITA
GVRPAGVWAYEAHRVAALRPRLGVDTDERTIPHEVGWIGSAVHLDKGCYR
GQETVARVHNLGKPPRMLVMLHLDGTDDRPSAGDPVLAGGRTVGRLGTVV
DHVDEGTIALALVKRGLPADTALTTGGDVVVSATIDPDSMPAADTVGAGR
LAVERLRGGPQ
392418254YP_006454859.1 hypothetical protein Mycch_4475 [Mycobacterium chubuense NBB4]MRRLALAAAPAVALLAACSGPSDPVVSTAPFVTPSVGHGALAYCLGQHGI
PAPPGPVSGPPAGVDPADWEAAMSACSSLAPGPSNTAAPDPDMERPPSR
392418252YP_006454857.1 hypothetical protein Mycch_4473 [Mycobacterium chubuense NBB4]MPAERRLLPAVRLAVVVLFYEILLVAAVVVITWFALYALYRLITDES
392418250YP_006454855.1 Protein of unknown function (DUF1416) [Mycobacterium chubuense NBB4MPASVDLEKETVITGRVVDGSGQAVGGAFVRLLDSSDEFTAEVVASATGD
FRFFAAPGTWTLRALSPAGNGDASVAPSGAGIHEVDVKVA
392418248YP_006454853.1 hypothetical protein Mycch_4469 [Mycobacterium chubuense NBB4]MSNITSARTESGAAAWVDVRGPRFAAWVTTGVLVVILLVSHASALAAAVI
LGVQAVVFAVGALLGPRRHPYGVVFAKLVAPRLGPVGDREPVAPLQFAQL
VGLVFAVLGVLGFSGGIPLLGLIATGLALVAAFLNAAFGICLGCQLYPLV
SRLRPKPGNP
392418246YP_006454851.1 hypothetical protein Mycch_4467 [Mycobacterium chubuense NBB4]MIGVLGTLVVIGVGAVGTDFGAAIYAEYRLARSVRTSANLTWDPSVGILG
FPFIPQAMRHHYNEVEIKASGVDHAVVGKASLESTLHSVELGDSWLVPPD
ATLTVGKVESRIIIDSTHVGRFMGIPDLLVEAPTRETNDSTGGTTESGIS
SNRGVVFTGTPTKAGFDKKVSIAVDLSVTGPGATTLVLTATGVLTGAGTA
DQDVPQEQLPAVLAAFSTSLPGQKLPFGIAPTSEGARGSDIIIEGITQGV
TIDLNEFRLS
392418244YP_006454849.1 mycothiol synthase [Mycobacterium chubuense NBB4]MSASARIGWRERLSAADQRQIRDLVTAAAAADGIAPVGDQVLRELGHDRT
RHLVAVDDEGTVAGYLNLAPPTDEAPAMAELVVHPRLRRRGTGAAMIRAA
LPEGGDGTRIWAHGNLDAARATASALGLVVARELLQMRRPLAGLPPTPAV
DGVTIRTYAGPQDDTELLRVNNAAFSWHPEQGGWTEADIAERRAEGWFDP
AGLFLAFDEDSGDLLGFHWTKVHSATLGEVYVVGVDPAAQGRGLGGALTL
IGLHHLGERLGADGGGSAVMLYVEADNSAAVKTYRRLGFDVANTDVAYAE
LSTVHRSEN
392418242YP_006454847.1 phosphate ABC transporter membrane protein 1- PhoT family [MycobactMATKPTKSTGLRKSEGRVGDTLFKSVAIAAGATIIGVIALMGLFLLVRAV
PSLQANTANFITSSEFTTSEPMRFGIADLFRVTVLSSIFALVIAVPVAVG
IATFLTNYAPRRFARPFAILVDLLAAVPSIVFGLWGIFVLAPRLEPIQRF
LNDSLGWLFLFAPGNVSLAGGGTIFTAGVVLAVMILPIITSVSREVFTLT
PKGHVEAAQALGATKWEVIRMTVYPYGRSGMIAGSMLALGRALGETVAVL
IILRTAAQPGNWSLFDGGYTFASKIASAAAEFSAPLPTGAYIAAGFVLFA
LTFIVNAVARLAAGGRVSGG
392418240YP_006454845.1 phosphate ABC transporter ATP-binding protein- PhoT family [MycobacMAKRIDIKDLNIYYGSFHAVADVGLSVQPRSVTAFIGPSGCGKSTVLRTL
NRMHEVLPGARAEGSVLLDGEDIYGAGVDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRNKKTLDEVAERSLKGANLWTEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIAELKQDFTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKIFSNPTQKATE
DYISGRFG
392418238YP_006454843.1 transcriptional attenuator- LytR family [Mycobacterium chubuense NBMSDGDMEDAAATPGRPLPGDQNKPDGDWLTRSRQSAPAAAPWERTIDRSA
PVTVADLIAKIHGGAPPSEPKRHRAEPEQDIEPQPAPEPEPAPEQEPEAE
PYPADELDTTILPAVDAYSSELPDLAAPRTRQREAEASAGTAPRRARHRS
VILGRSVAALVAALALVLTGGAWQWQSAKNNLLNRVSALDPDSRDIVDPN
AQFGDENFLIVGVDSRFGDNSEMGVGTTADAAGSRSDTVMLVNIPANRKR
VVAVSFPRDLKIEPMKCEVWNPETRQYGPIYDEQTGTMGPDEAYTEYKLN
SAFSIGGPKCLVKVIQKMSGLHINRFMAVDFAGFSKMVDALGGVEVCSTT
PIEDYELGTVLSKAGRQIVDGRTALNYVRARQVTTETNGDYGRIKRQQLF
LSSLLRSLISKDTFFSLSKLNNVVNMFINDSYVDNLTTKDLVDLGQSVQG
VNAGRITFVTVPTVGYPDEWGNEIPRTDGLRALFDAIINDDPLPEERNAD
NTPVPGTPESLANSANGAPAPAPPAPSDGQIIDAVATSPGEVTVKVSNST
GESGLAATAADALETHGFNVTSPDDYPGPLEHTTVFFSPGNEKAAATVAS
SFPEPTIERATGLGDAVQVVLGSDFHSVVPPSPSGATVKVHVLRGTKNTH
TALPEDLTVTNAADTTCE
392418236YP_006454841.1 Fatty acid desaturase [Mycobacterium chubuense NBB4]MSKDLTDLQLLTELEPVVEQNVNRHMRMKKDWNPHDYIPWSDGKNYYALG
GQDWDPEQSQISEVARVAMLTNLLTEDNLPSYHREIAMNFGMDGPWGFWV
NRWTAEENRHGIALRDYLVVTRNVDPVELEMLRVEQMTRGFSPGQNQQGG
IELFAESLFDSVIYVTFQELATRVSHRNTGKACDDSIADQLLQRVSADEN
LHMIFYRDVSEAGFEIAPDQAMKSLHKVLRNFKMPGYTIPDFRRRAVTIA
TGGVYDPRIHLDDIVMPVLKKWRIFEREDFNGESARMRDDLGALVDELQE
AVDKFEVAKQRREERLAQMAEKKAAKAQLVGSSTS
392418234YP_006454839.1 hypothetical protein Mycch_4455 [Mycobacterium chubuense NBB4]MTQDTSAACPATSASGADEAVVAAGCPVTSGGYDAPPAPLGPDSLTWKYF
GQWTGMLQGPWAGSMQNMHPQLGAAVQHHSIFFLERMPRLFRSVYPIGGV
VFDGDRAPKTGAQVRDYHIGIKGVDDQGRRYSALNPDVFYWAHATFFKST
LLAAEWVGGGLTEAQKRQLFDEHVTWYRMYGMSMRPVPKSWEEFCQYWDH
MCHNVLENNWAAREVLDLSSMPKHPSLEWMPGWLWRLNVMAMQRFFNFTT
VGLFDPPVRELMGYTWSPRQERLHRLFGQAVYRITKVLPTRMTMHPRKRS
AWDRAHGRLPVDAPLVETPARNLPPVAYRDDPHYYSPKV
392418232YP_006454837.1 protein kinase family protein [Mycobacterium chubuense NBB4]MAAPEVLGGRYELRGVLGRGGMAEVRDGWDTRLGRPVAVKMLYPAVSVQS
DTRRRFVTEARAAATLNHPHVVAVHDSGVDHGRHYIVLERLPGQNLAGVL
ARGGPLPAGQVRAIMRDVLSALDAAHARGVLHRDIKPANLLFTPSGGVKI
ADFGVAKSPETPQTLTNRVFGTMAYLPADRIAGRPAVPSDDLYALGVVAY
EALTARRAYPQENLAALADAIAAGRVTPLTALRPDIDPALAMTIERAMSP
DPRWRFATAAQMRASLNATARRPQRAGVVLAAAAVLAVVVLAALLVAM
392418230YP_006454835.1 transcriptional regulator [Mycobacterium chubuense NBB4]MNSTPAATTLTADKSAFRQRLLDALEAAIAEQGYPKTTVADIVRGARTSR
RTFYEHFDSREACFVALLSDANADQVTQISEAVDPSAPWQKQVRQAIEAW
ISSAEARPALMLSWIRDVPSLGAAARHLQRDAMETFIAMVGALGAGDEFR
AAGIGPVSRRRIIMLLGGLRELTAITVEEGGRMSDVTDEAVDASIALLRP
QAG
392418228YP_006454833.1 transcriptional regulator [Mycobacterium chubuense NBB4]MQVNVTGQVLSTSGDVLPATRLAGAARGLRYVTHMVRPAQTARSERTREA
LRRAAVVRFLAQGIEETSAEQIAADAGVSLRTFYRHFASKHDLLFADYDA
GLHWFRTALAARSPDESIIESVQSAIMASPYDDWAVTEIASMRAQELDPG
RIVRHIRQVEADFAEAVEDHLAGADPPAPGTEQRMRVTVTARCIAAAVFG
AMEVWMLGEDRSLPELDRLCRHALELLRTGIDERV
392418226YP_006454831.1 hypothetical protein Mycch_4443 [Mycobacterium chubuense NBB4]MSKDKPQTTETDAGSDAADDDVMSDPSKGAQDGADWSDEGGATPGGPAPS
T
392418224YP_006454829.1 oligoketide cyclase/lipid transport protein [Mycobacterium chubuensMVYGRAMATKDSREVVIEATPEQILDVIADVEATPTWSPQYQKAEVLDRY
DNGKPKQVKMTVKAAGLTDEQVIEYTWADDKVTWTLVSANQLKAQDAGYT
LTPEGDKTRVRFDIAIDLSVPLPGFILKRTIKGGVETATEGLRKQVLKVV
KGG
392418222YP_006454827.1 response regulator containing a CheY-like receiver domain and an HTMRLSWPIVGRSHELRTIETALTTTDVSGVLLCGPTGVGKSRIAREALASA
ASRGCHTRWAVGTTSARGIPLGAFAAWAPSGASDTIALLRGVLESLTAAP
SGVDVVIGVDDYHLLDDLSTFVVQQLVARDAAKLILTVRESEPVAAHTQD
VLRAGHFERLGVRPLTLDETTALASAVLHGPIDAQAARRLWKLTGGNVLY
LRNIVEHEVADGRMVQQNGCWRWIGDPVMPPGLIEMIEARIGELPEQVDD
VMDVLSVGEPIELATLTRITGASALEEAEIRGLVALEPAGGGVEVRVAHP
LYGEVRRRRAAHTRLRRLRGLLAEALAASADSDDLRVVVRRATLTLDSDL
VPDADLLATAAQGAVWLGDLSLADRLADAAARAGAGPESVLLRAHALSWL
GCGELAEHLLAGVSGDRLTPCERARWAFLRSSNMLWALADPARAKELIDE
ASRSTPPEARTYIDAFLAVYWFAMDHPDKAVDASKNLAPEDIPVVGAETA
WALAQISADAGRAGEAVAAAEAGYAVATRSLDAPHMVFNIADAHTSALLL
AGRIPDALAVAERARRQAAELPGTAPLIGTAVAGRAALAAGDVCGACHLL
GQAVEALSGSHPLGWGFRYRIPYATALAMRGATDEAAAALAALDEVPRRF
RALRHEQCMARAWTVAGQGAVSEAIALLRSTAESCALAGQFGQEVQCLQM
AAQFGDRTTAPRLRELVSLAEGPRAAVAARFAAALHDGDAAELDAVSEAF
AQMGDPIAALDAAAHAAREYRRQDRRGSALRCSARADALASRCGVRTPAH
RQAGQTLPLTDRETEIVMLIGEGLSNRAVAERLTLSVRTVESHIYRAMSK
TGTTSRDELAALLHGD
392418220YP_006454825.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMHAPLIFAGMAVRASSETVIEAPPEAILDALADIESVTSWSSLHKDAEVL
DRHPDGRPHHVKATVKIMGINDKELLEYHWGDDWVVWDAERTSRQRCQHG
EYNLTPVGEQRTRVRFDLILDLAAPYPGFLVKRAKKMVLDVALENLRQRV
MAVAR
392418218YP_006454823.1 NADH:flavin oxidoreductase [Mycobacterium chubuense NBB4]MTFTLREDSALLKPVTVGGRTLANRVFMAPLTRTRAEADATPSELAATYY
AQRAGAGLIISEATAVSKSANGAYLNTPGMYNDRHQQRWAEIAEAVHAEG
GRMFVQLWHVGRMAHPDISGGETVGPSPVAADLMARTATGKKPLPVPRAL
STGEIAGIVADFRAAARRAVDAGMDGVEIHSANGYLLHEFLSDVVNRRTD
AYGGSPQNRARFTAEVVEAVAAEIGPERVGLRISPGNGAGDMSEVDEVSA
YELLLCRIASLGIAYLHVLIEPSQPAFAALRTQWEGTLVLNTPREIDSDF
GLLENLADWGVISAAAVGRAYLANPDLIDRLTAGAELNEPDPTTFYAPGP
AGYIDYPTLSELAEPRSA
392418216YP_006454821.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MSEEAFIYEAIRTPRGKQRHGSLNEVKPVNLVVGLINELRSRYPDLDETM
ISDVILGCVSPVGDQGGDIARTAGLLAGLPETTGGFQLNRFCASGLEAVN
LGAQKVRSGWDDLVIAGGVESMSRVPMGSDGGAWASDPETNYRLGFVPQG
IGADLIATIEGFSRDDVDAYALRSQQKAAAAWSGGYFAKSVVPVRDQNGL
VVLDHDEHMRPDTTMEGLAKLKTAFDGIGAMGGFDDVALQKYHFVEKINH
VHTGGNSSGIVDGAAVVLIGSESAGVSQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRNARRALITLCIGGGMGVATII
ERV
392418214YP_006454819.1 transcriptional regulator containing an amidase domain and an AraC-MHTVAILAYDEMTGFESGLAAEIFGMTELSEMFSAGIARPWYSVRLCSET
PEVRMLGGAVVRTSYGLDELARADTVVIPSVRDVTTPTSPELIEAIRAAY
ERGSRLVSICSGAFALAAAGVLDGRTATTHWIYVDLLAERYPDVVVDPAP
LYVDNGRILTSAGCAAGLDLCLHIVRSDHGVRVANDVARRLVISPHRSGG
QAQYIESPVPEPTADGRIASGMAWALENLDSPITLDDLAAHSAMSRRSYL
RQFAKATGTTPIKWLIEQRIQASLPLLESSALSIEQIATRVGFESPVTFR
YHFARQMRTTPSDYRSCFTGSDPEQQWRRAR
392418212YP_006454817.1 putative F420-dependent oxidoreductase- Rv1855c family [MycobacteriMRFGLFIPQGWRLDLVGIDPGEHWRVMSDLATYVDEGGIWDSLWVYDHFH
TVPVPTSEATHEAWSLMAAYAATTSRIKLGQMCTAMSYRNPVYLAKVAAT
ADIISGGRIQMGIGGGWYEHEWRAYGYGFPSAGVRLGRLDEGVQIMSDAW
REGVVSFEGKHYQVDKAIVAPKPLQRGGIPLWIAGGGEKVTLRIAAKYAQ
YTNFTSEPEGFAHKSQVLAGHCRDVGTDYEAIIRSANINAVVGDSEAEVK
DRLNGVRARISALTGETAADAMLNSMSTPQGGSGTPEQLVESLQKLRDLG
CEYVICYFPEAAYDRSSIEVFERKVIPALA
392418210YP_006454815.1 DNA/RNA helicase- superfamily II [Mycobacterium chubuense NBB4]MTDGPLIVQSDKTVLLEVDHEQAGAARAAIAPFAELERAPEHVHTYRVTP
LALWNARAAGHDAEQVVDALVTHSRYAVPQPLLVDIVDTMARYGRLQLVK
HPAHGLTLVSLDRAVLEEVLRNKKIAPMLGARIDDDTVIVHNSERGRIKQ
MLLKIGWPAEDLAGYVDGEAHHIGLEQDGWQLRDYQQMAADSFWDGGSGV
VVLPCGAGKTLVGAAAMAKAGATTLILVTNTVAGRQWKRELIARTSLTES
EIGEYSGERKEIRPVTIATYQVITRRTKGEYKHLELFDSRDWGLIIYDEV
HLLPAPVFRMTADLQSRRRLGLTATLIREDGREGDVFSLIGPKRYDAPWK
DIEAQGWIAPAECVEVRVTMTDNERMLYATAEPDERYKLCATAHTKIAVV
KSILERHPDEPTLVIGAYLDQLDELGAELDAPVIQGSTKTAEREALFDAF
RRGEIRTLVVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPK
AGGGGAVFYSVVSRDSLDAEYAAHRQRFLAEQGYGYVIKDADDLLGPAI
392418208YP_006454813.1 cyclic pyranopterin monophosphate synthase subunit MoaC [MycobacterMGSDPSGDVPALSHVDETGAAHMVDISAKDVTKRTAVAAGTVHTRPDVVE
MISANGLPKGDALATARVAGIMAAKRTSELVPLCHPLGITGVDIDFTVAH
NGDPGSVGITATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDRSARID
DIRVVHKEGGKTGTWAR
392418206YP_006454811.1 molybdopterin converting factor- large subunit [Mycobacterium chubuMTTVVRVALTEHPIDSPEHEALVAHHAAGAVVAFAGVVRDHDGGRGVTRL
EYSAHPTAEQTLSEVAAEIAATCQGVRAIAVSHRIGTLHIGDAALVAAVA
ADHRGAAFETCSRLVDAVKARLPVWKHQFFSDGTDEWVNSA
392418204YP_006454809.1 molybdopterin converting factor- small subunit [Mycobacterium chubuMQADVEVRVTVRFFAAARAAAGAEEEVVKLPAGATVADLIALLEARGETL
SRVLARCSYLCDGVAVRDTATALGDAQTLDVLPPFAGG
392418202YP_006454807.1 putative membrane protein [Mycobacterium chubuense NBB4]MRLILNVIWLIFGGLWLALGYLLAALICFILIITIPFGFASLRIALYALW
PFGRTIVDKPGARPGALVGNIIWIIVAGVWLALGHLVSAVAMAVTIIGIP
LALANLKLIPVSLMPLGKEIVPVDAARSTQVGVAL
392418200YP_006454805.1 putative glutathione S-transferase [Mycobacterium chubuense NBB4]MSYVADPSSSGGDFNRDTDYITTRITADGRDGYAVEPGRYRLVVARACPW
ANRTIIVRRLLGLEDVLSIGFCGPTHDERSWTFDLDPGEVDPVLGIHFLR
DAYNKRIADYPKGVTVPAIVDIPTGEVVTNDFAQITLDFSTEWSAHHRDG
APQLYPEPLRDEIDDVAQRIYTEINNGVYRCGFAGSQRAYERAYDRLFTA
LDWVSERLTDQRFLVGDTITEADVRLFTTLARFDPVYHGHFKANRSKLSE
MPVLWAYARDLFQTPGFGDTIDFVQIKQHYYIVHSDINPTGVVPKGPDLS
NWLTPHGREALGGRPFGDGTPPGPTRETERVPEGHGAD
392418198YP_006454803.1 Major Facilitator Superfamily transporter [Mycobacterium chubuense MANYPSDPVSDPGRRRGTPNSSANRWLPPLDDRERHHGYDQYDAGGRYGS
GGEKVTVTRAAAQRSREMGSKMYGLVHRAATADGADKSGLTALTWPVVAN
FAVDAAMAVALANTLFFAAATGESKSRVALYLLITIAPFAVIAPLIGPAL
DRLQHGRRVALAASFAFRTVLAVLLIANYDGATGSYPSWVLYPCALGMMV
LSKSFSVLRSAVTPRVLPPSIDLVRVNSRLTTFGLLGGTMIGGGIAAAAE
WGFQLFQMPGALYVVVAVTMAGGVLAMRIPKWVEVTEGEVPTTLSYRGDT
GETRRQPDSAKARQPLGRNIIAALWGNCTVKVMVGFLFLYPAFVAKAHDA
SGWEQLRILGLIGAAAAIGNFTGNFTAARLELGHPAQLVVRCAVAVTAMA
LATALTGNLLVAAAATLITSAASAIAKASLDASLQDDLPEESRASAFGRS
ESLLQLAWVVGGATGVLIYTELWAGFTTITGLLILGLAQTVFSYRGESLV
PGLGGNRPVLAAQQGVRADTAAVTLE
392418196YP_006454801.1 hypothetical protein Mycch_4413 [Mycobacterium chubuense NBB4]MAAPILQAQIDINAPVSTVWDLVSDLSKMPQWSPQCRWMKPVGGLRQGAR
TINLNRRGKLFWPTTCRITELVPEQKLAFRVNENNTVWSYELEPTEAGTR
LIETRHAENGTTATSNFLVGKFMGGVPNFEKELVEGMNQSLTRIKNAAEN
392418194YP_006454799.1 rRNA methylase [Mycobacterium chubuense NBB4]MRAEVVDVIDVADPADPRLDDFRDLNSVDPRPDLPTGKGLVIAEGVLVVQ
RMLASRFVARAFLGTDRRLTELGARLDGVGAPFYRVSAEVMAEVVGFHLN
RGVLASASRAPELEVPQILDTARTVAVLEGVNDHENLGSIFRNAAGLGVD
AIVFGSGCADPLYRRAVRVSMGHALLVPFARAANWPDDLNLLLSREFRLI
AMTPDPGALTLAEAVAGLAGERVAILVGAEGPGLQERTMRAADVRVRIPM
SRGTDSLNVATAAALAFYERDRLAP
392418192YP_006454797.1 Protein of unknown function (DUF3071) [Mycobacterium chubuense NBB4MRELKVVGLDVDGKRIICETDDSAEKFVLRSDDRLKAAVRGDWVGSNQTA
IDVEVPNMLRPKDIQAKIRAGASVEQVAAAAGADLARVERFAHPVLLERS
RAAELATAAHPVLADGPSVLTLLETVTAALVARGLDPDSPSWDAWRNEDG
RWTVQMAWKAGMSDNVAHFRYAPGVHGGTVTAFDDAASELIDPNFARPLR
PLAPVAQLALEEPQAPLSTPTEAPEPPPTTKPPRPRKTRPAVPAWEDVLL
GVRSSGGER
392418190YP_006454795.1 P-aminobenzoate N-oxygenase AurF [Mycobacterium chubuense NBB4]MAVKESRTRLVRRWRRNMDVLDDPEYVNTLQTLSEGSVRRNFNPYTDIDW
DSPEFAVTPNDERWILPATDPIGQHEWYRSQPRERQIEIGMWRQANVAKV
GLHFESILIRGLMEYAFWTPNGSPEYRYCLHEAVEECNHTLMFQEMVNHI
GADVPGMPRLLKWIQPVIPLVAGPLPIPFWFGILAGEEPIDHTQKNVLRE
GKTLHPIMERVMAIHVAEEARHISFAHEYLRKRVPDLPRRKRFWLSIYVP
IVMRVLCSAIIVPPRAFWKEFDIPRSVRKEIFFKSPESRLMLRDMFGDVR
MLAHDTGLMNPVAKLVWRICRISGKPSRYRSEPQRQHLVSVA
392418188YP_006454793.1 hypothetical protein Mycch_4405 [Mycobacterium chubuense NBB4]MLALLQFPPLIVGFLWVAAFVVISVGGLFVFRRAVSHTKLENANFVSGAV
FQVAGVLYAVLVAFVVVVVWEQFGDAEDASSKEASAVADLLRDSTALPPQ
YRAEVQQSLVAYSHDVVDNEFTRMRRGESIEEQSDALTRVWDSYLKVQPE
SRSEIAFFDYAISRLNDLSTNRKMRVSTGDASVPGELWVLLLGGGGVLMM
FTYLFGTRDVVVHAIAVGLTASLLAFVMYLIFALEHPYVGALSVKPTPYV
NMLKDWAGG
392418186YP_006454791.1 hypothetical protein Mycch_4403 [Mycobacterium chubuense NBB4]MSEPRAVFASAATGFASLVRSVPEDRWSDPGLGEWNVRDLVGHASRSLIT
VSTYLRTTAEREDVVSAADYYVAMHGYSAGLGAAAIVERGRQAGRDLGDD
PPAAVDELLARVLSDLEAVDDPLIEVIGGLGIRLSNYLPTRTFELAVHGL
DIAAAIGEDVVPPAEVLTEAVSLASRIGVKLGQGPAVLLALTGRAPLPAG
FSVI
392418184YP_006454789.1 Pyridoxamine 5'-phosphate oxidase [Mycobacterium chubuense NBB4]MRVEYGSVEKDGSRDLDADWLDVGWVALLNDWMAEAREAGVAEPNAMVVG
TVDAEGRPVTRTVLCKSVDDSGISFYTNYDSDKGVQLAGNPYASATFPWY
ALGRQVHVRGPVTKVSPEATAAYWARRPRGSQLGAWASQQSKPIASRAAL
LAQLAEITERFADADEVPVPPHWGGYVIAPEVVEFWQGRENRVHNRIRVR
GADDGTIERLQP
392418182YP_006454787.1 transcriptional regulator [Mycobacterium chubuense NBB4]MVDVRGEPALGLRERKKRRTRDTLINAAVGLCESQGFDGTTVDQIAAIAD
VSPRTFSRYFATKDAIVLALIDDVLDLVAGELERQPLALGNYEALRRAYV
AMALRTQVAGKGELSSDRLLQIMRILVSSPTLRMSALEFRGNPVDVVVAR
RMGVAVDDRRVQLVSVTFGAVLMTALTCLVDRGLQVGTVGVDDAVAVLEA
TYAEFESEMAGYPQPV
392418180YP_006454785.1 drug resistance transporter- EmrB/QacA subfamily [Mycobacterium chuMIETVGVMTPRRKAIILVSCCLSLLIVSMDATIVNVAIPAIRADLSASAA
QMQWVVDIYTLVLASLLMLSGATGDRFGRRRVFQIGLTVFAVGSLACSLA
PTIDTLIAARFLQGIGGSMLNPVALSIISQIFVGREERARALGVWGAVVG
ISMSLGPIVGGLLIETIGWRSVFWINLPICAAAIMLTAIFVPETKSTTMR
NVDPVGQGLAVLFLFGVVYALIEGPGLGWTSPRVVGIAVVAALAFVAFLR
YESRRQDPFLDLRFFRSIPFTSATVTAVSAFAGWGAFLFMMSLYLQGERG
YSAMHTGLIYLPIALGALLFSPLSGRLVGRYGARPSLLTAGVLISVAATM
LTFLTATTPVWQLLVVFAVFGIGFSMVNAPLTNAAVSGMPLDRAGAASAV
TSTSRQVGVSIGVALCGSVAGPAISVAGADFASAARPLWFVCIGLGLVIL
VLGTFSTTRRAHRSAERLAPLISGTPTLPEDAHVR
392418178YP_006454783.1 phytoene dehydrogenase-like oxidoreductase [Mycobacterium chubuenseMNAATGTDTDIVVVGGGHNGLVAAAYLAQAGRRVTVLERLDHVGGAAVSA
HTFEGVDARLSRYSYLVSLLPRRIVDDLGARVRLARRRWSSYTPDPSTGG
RTGLLIGPESTFAAVGAAGDERGFDDFYRRCRAVTSRVWPTLIEPLRTRS
QVHREVVAGGGPDAGAAWRAMIDEPIGGAITAAVGNDLVRGVMATDALIG
TFARLDDESLIQNVCFLYHLIGGGTGDWDVPIGGMGAVTGALAAAATGFG
AEIVTGAEVYAISPDGEVRYRRGDGEYRVVADRVLANVTPSVLARLVGDE
APDAQPGAQIKVNLMLRRLPRLHNDSVTAEQAFGGTFHINETYGQLDAAY
RQAAGGSVPEPLPCEVYCHSLSDPTILSESLRQSGAQTLTVFGLHTPHSL
VTSGTPERIRDSLTSAVLTSLNSVLAEPIQDVLMEDSWGRLCIEAKTTLD
LDASLGMTAGNIFHGGLSWPFVEDDEPLTTPAQRWGVATAFDRILLCGSG
SRRGGAVSGIGGHNAAMALLQA
392418176YP_006454781.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Mycobacterium chubueMTSNAGQKPEIDFPDGPAPTELVIEDIVVGEGAEAVPGANVEVHYVGVEY
DTGEEFDSSWNRGESIEFPLRGLIQGWQDGIPGMKVGGRRKLTIPPEQAY
GPAGGGHRLSGKTLIFVIDLLATR
392418174YP_006454779.1 response regulator with CheY-like receiver domain and winged-helix MDSGSPRVLVVDDDPDVLASLERGLRLSGFDVATAVDGAEALRSATETRP
DAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGA
DDYLVKPFVLAELVARVKALLRRRGSTATFSSETITVGPLEVDIPGRRAR
VDGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDV
FIGYLRRKLEANGAPRLLHTVRGVGFVLRQQ
392418172YP_006454777.1 ABC-type multidrug transport system- ATPase and permease component MSLETVARQSLYRQTHARGGDLHSLTDRRLLGRIWRFAGRHHHRLGVFVA
VSVLGAVLTVATPLLAGRVVDEITGAGTAGVVVLLAVVIAVVAVAEAATA
LLTRWLSSTIGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLGNDV
MGAQRAFSDTLSGVVSNVVTLTLTLAVMLSISWQVTVVSLALMPLFLIPA
RRIGSAMAALSREAAAHNATMNTQMTERFSAPGATLVKLFGDSAAESREF
RLRAGRVRDIGVRTAMLQSTFMNSLTLMSALALALVYGLGGALALGGHLQ
AGAIVSLALLLTRLYAPLTALANARVEIASALVSFERVFEVLDLVPLIRE
RPDAVAVPEGPVTVEFDDVRFSYPAADKVSLASLEEVAELDDRGGEEVLH
GVSFTAAPGQMVALVGSSGAGKSTTASLLARLYDVDSGAIRLNGVDVRDA
SFASLKATVGMVTQDGHLFHESIRSNLRLAAPHATDADLWEALKRARLDD
VVAAMPDGLDTIVGERGYRLSGGQRQRLTIARVLLAAPQVVVLDEATASL
DSESEAAVQQALAEALAGRTSLVIAHRLSTVRAADLILVVEDGRIVERGT
HTELLARGGRYAELYLTQFGPQSGPDRRTCIPRGPHSHLCARNASSAGEL
TACGQWEDLLSG
392418170YP_006454775.1 ABC-type multidrug transport system- ATPase and permease component MTATDWRGKFDEQSDLPIDETVPRRREARALLGSLLRPYRWAVALLAVVV
VVENAARLSVPLLVQKGIDDGIPPLLAGGPARTLISVVAALCVVVVIQAA
SRMFFLRRSGRIGQKVLRELRRRIFGHFGRLDVAFHDRYTSGRVVSRSTN
DVEAIQDMLETGFDSLITAVLTLVGTAVLLVTLDVELGLMCLAAFPVLVF
LVWWFHRESSKTYREVREISALVIVQFVETMTGIKAVQAYRREQRNQEIF
EDVADRYRVINERTFKLLAVFMPGVKLVGNLTTGVVLLYGGYRVLHGQMT
IGTLAAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAEKPAIAD
PAEPVALGAVRGEIAFRDVQFSYVQGRPVLPDLTLTIPAGQTVALVGTTG
AGKTTIAKLVSRFYDPVSGAVTLDGTDLRDVAQADLRRHVVMVTQENFMF
GGTVADNIRFGRPDASDEDVRAAARAVGADGFIAALPEGYDTDVAKRGGR
LSAGQRQLIAFARAFLADPAVLILDEATSSLDIPSERMVQRALETVLADR
TALVIAHRLSTVQIADRVLVLENGRIVEDGPPDELTARDDGHYAALHRSW
VQSLA
392418168YP_006454773.1 hypothetical protein Mycch_4384 [Mycobacterium chubuense NBB4]MVVSTPTLVLIAATTLAACLCLGGALYEVLVVDPAWPQRPGIIQSRNGGI
ARVRFWLPAPVAFEVLLIASLVFTWGDGEVGAALLVALVSHAAMRLWALF
HLIPKAVEFEREDPADVDEAAAVSWTRQNALRVLLLLVTSCAMLTALALA
392418166YP_006454771.1 hypothetical protein Mycch_4382 [Mycobacterium chubuense NBB4]MEALLHFAGNFWWLIFPLGGVVGGAVRTVAAANERRAQRRLERYRIKQET
KVALAREKASASAQTRAEGNRREMVKVAQRHDDTDARWLSYEIDVAKLLD
FPVMTDMREPLTLGFHKAKSRADLLRPARVEDILDDRDAQLEYRDAVNDY
VAAFDVAEAEAIRRRRSDFSSEDQDRLARAQHLLRLAADDAATPQERQNA
YGRAQKELAGLVVLPAAARAAIESKVIGEIEA
392418164YP_006454769.1 YhgE/Pip-like protein [Mycobacterium chubuense NBB4]MSLGTDLKRYSRGVLPRIALATIIVLPLLYGAMYLWAFWNPFAEVNKVPV
ALVNEDRGATAQGQQLRAGDEVARALLDSDQLKLTETSAAEAARGVAGGR
YYFSISLPPDFSERVASPSSDAPRQAAIHFTFNDANNYLATVIGQNASRE
VLNQVNAKIGQRTIGTVVTGLTDAGQGLDRAADGAQQLATGLATANDGAH
RLSGGADTLSSGLHSARTGSAQLAAGTRQLSGAIDEATGPLLDVLDRVGG
LNLNPDDVAVAAQQLSSAVRSTTDRIAALNVNNTQAAAIVDQTVGFLQNK
SDPAVRDAGQALAGAQRLLRAQGIDPTTDDGLVRLRDSASRLEGELGDPN
STLRVFLTRALNGGLRRDVVTLRSGVDQLDAGAQRLTAGLGQLADGGDQL
ASGAGELAEGTQRLQAGGQELATKLRQGAATVPSWSPRQRTDVARTLSAP
VGLDLVNTHPAATFGTGFAPFFLPLALFIGALIVWMLLTPLQSRPIVNGL
GALRVVLASYWPGLLVVVCQVVVMYAVVHFGVGLQARYPVATVGFLVLVA
GAFLALIQAFNAVFGVAVGRVVTLAFLMLQLVSAGGIYPVETTAEPFQII
HPFDPMTYAVNGLRQLTVGEIDSRLWVAIAVLAGLLAASLAASAWAARRN
RQYTMERLHPPIEV
392418162YP_006454767.1 acetyl-CoA carboxylase beta subunit [Mycobacterium chubuense NBB4]MSRIRALELRDAVLDEGSFHSWDAPPLDVPKSAQYRRELDAAAAATGLDE
AVLTGEGRVLGRRVALVVCEFDFLAGSIGVAAAERIVAAVHRATAEGLPL
LASPSSGGTRMQEGTVAFLQMVKITAAVQLHKRAHLPYLVYLRHPTTGGV
FASWGSLGHVTAAEPGALIGFLGPRVYEHLYGEPFPSGVQTAENLQRHGV
IDAVVPVDLLRSTLDRTLKVVSDPPGPPPAAPPQEELPDIPAWQSVEVSR
RPDRPGVGFLLRHGSTERVLLSGTGQGESATTMLALARFGGQPAVVLGQQ
RVVGGLIGPVALREARRGMALAAGLQLPLVLVIDTAGPALSTEAEEGGLA
GEIARCLADLVTLDTPTVSVLLGQGSGGPALAMVPADRVLAALHGWLAPL
PPEGASAIVYRDVDHAPELAAAQGIRSADLLRDGIVDAVVAEHPDAADEP
RAFTDRLSATIAAELHGLRSVPGEQRLAARLERYRRIGLP
392418160YP_006454765.1 putative Zn-dependent hydrolase of beta-lactamase fold protein [MycMVVRSALRFGFGTASLLAGGWVLRALQGTPASLGATPAEIAPVARQSPHF
RDGKFVNLEPPSGITMDREAQRVLLRDLANVGSAGKPPRPIPLAEPANVD
AEPGPAAASWYGHSSVLIEVDGYRVLADPVWSKRCSPSRAVGPHRMHDVP
VPLEALPAVDAVLISHDHYDHLDIDTIVALAHSQRSPFLVPLGIGAHLRK
WGIPESRIVELDWYESHKIGDLTLVCTPARHFSGRLFTRDTTLWASWVVA
GPAHRAYFGGDTGYTKSFAEIGAEYGPFDLTLLPIGAYHPAFADIHMNPE
DAVRAHLDLTDVEAGLMVPIHWATFRLAPHPWAEPAERLVAAAEPERVRI
SIPIPGARVDTETTFEPWWRM
392418158YP_006454763.1 P-type ATPase- translocating [Mycobacterium chubuense NBB4]MTTSTTQGLSDADVAQRVAEGKTNDVPTRAARSVPEIVRSNVFTRINAIL
GVLFVIVLATGSVINGAFGLLIIANSAIGIIQELRAKQTLDKLAIVGQAK
PLVRRQSGTSALAPSEVVLDDVIELGPGDQIVVDGVVLEEVSLEVDESLL
TGEADPIAKDAGDQVMSGSFVVAGSGAYRAAKVGREAYAAKLAEEASKFT
LVKSELRNGINKILQFITYLLVPAGALIIYTQLFTTGADWRESVLRMVGA
LVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVNELPAIEGLARVDVVCADK
TGTLTENGMRVAELKPLTAADVGNVLAQLAADDPHPNASMAAIAEAYKMP
PGWQASATAPFKSATKWSGTSYGDHGNWVIGAPDVLLDAESPAAEEAERI
GAQGLRVLLLGSSDLPVDHPDAPGTVTPVALVVLEQRVRPDARDTLDYFA
AQKVAVKVISGDNAVSVGAVAGSLGLDGETMDARHLPDRTDALADTLEHC
TTFGRVRPDQKRAMVHALQSRGHTVAMTGDGVNDVLALKDADIGVAMGSG
SSASRAVAQIVLLDNRFATLPYVVGEGRRVIGNIERVSNLFLTKTVYSVL
LAVLVGVAGLSAKIFDTDPLPFPFQPIHVTIAAWFTIGIPAFILSLAPNK
ERAHSGFVRRVMTSALPSGLAVGLATFASYLLAYPGRGAGAAEQTQASTA
ALITLLISAIWVLAVVARPYQWWRVALVAVSALAYVVIFSLPPLRKLFLL
DPSNLELSSMALGLGLLGAGVVEVIWWAQGAVLGERRRLWRERER
392418156YP_006454761.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMAKLSVSVDVPLPPERAWESASDLSRYKEWLSIHRVWRSKLPDTIEKGTT
LDSIVEVKGMPNRVSWTVVHYKPPEAMTLNGDGKGGVKVKLIGKVKPSEL
GSTVTFDVHLGGPALFGPIGMVVAGALKGDIQESLNRFKAVFAPS
392418154YP_006454759.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTVPESVETHARNWDLRHEDFNDPDLLYDVYAEMRQSCPIAHTDRPFLAD
TPDGAWVATRYADCYRIAQDWQHFSNNPIPDTVEHVAGDLVVMMDPPRQQ
KLRKVLNPYFSPARMKALRPQIAAETDLLIDEFIESGSGDLAQVAWRQPG
IVLFRYVLGMPTDDVSVCFDLTDTALNGATEQARMTAWGELYAHLHDTVA
ARAGRAPRDDMIDVLLNARIDGEKLPFTDVVSNAMLLVQAGLETTASAMS
FAFHHLATHPADRDRLTAEPELLPRAVEELIRYAGSIHGLHRTVIEDVEL
SGHTFRPGETVVVNFASANRDENVFPDADRCILDRRENRHLGFGAGVHRC
LGSNLARLEFQVAVERVLTRIPDYTLAPGRPATFHGNSITRGYRAIPVVF
TPGPTSGA
392418152YP_006454757.1 hypothetical protein Mycch_4368 [Mycobacterium chubuense NBB4]MTLPQTAVALEGHHEESRLAQRRADKWMIVGAALMGMWAPGLIGFPVFMR
GVWLQRQALRAGLSVRPMIVTLIGYLVLIDGMLNSLGWALDLVANHTLIN
RVLMIGWGNMFDAGYFWHYNELWIGGSAGPGEKAYVAGLIFTVFSMRVAA
AIGFLQMRRWGHQWMIVTCWMGVVIWSAYVFNMTMFADVRYAGVVFPVIG
WWLYDIFYITPFLAIPYLHTVNREIFTD
392418150YP_006454755.1 ATPase family protein associated with various cellular activities (MTGSFQPTDTYLANGNEVQLFEQAYRRQLPVMLTGPTGCGKTRLVEHMGL
LLERPVVTISCHDDLTSSDLVGRFIVTGGDVVWTDGPLTRAVKAGALCYL
DEVVEARHDSLAVLHSLTDHRRALYLDRAGEVVHAPDTFMLVCSYNPAYR
SSLKELKPSFRQRFVTLAMHYLPPDREAEVILAEADVALPTAQRLVRCAT
AIRSADEAFHFEPPSTRVLVTAAQLIAAGAGEFEAAQACVLAPLSSDGAL
THGLREVAAATFTDADSPT
392418148YP_006454753.1 hypothetical protein Mycch_4364 [Mycobacterium chubuense NBB4]MGWIWEILRYVAAWGGTGLIIWFWYWMFSNLGTF
392418146YP_006454751.1 hypothetical protein Mycch_4362 [Mycobacterium chubuense NBB4]MDLPAVKLGRGDRRDVTPRPSAGGLDEHMAASQQAQRRADKWLISGSLLI
GTAALGIFGLPLFLRGVWLLRTAQRDGLTVRPMLVTLLGYLVIIDAAINT
VGWALDLVANHTILARVLLNGWGNMFDAGYFWHYNELWLGGAAGPGEKAL
EVGLILTVFTMRIAAAIGFLQMKRWGHQWMVITCWMGIVIWCTYVFNMTM
FADVRFAGVVLPVVGWWLYDIFYITPFLAIPYLHSVNREIFSD
392418144YP_006454749.1 Kef-type K+ transport system- membrane component [Mycobacterium chuMPAAVAVHFFLELAVILAACRVVGWLAQRLGQPQVVGEMIAGVLLGPSLL
GRIAPDVQHALFPSGAANTVLYTLAQIGLVLYMFLIGLNFDVDLIKHRAG
TAVAVSAAGIATPLALGAVVAVPLLDGGTFFEDSVTPVMAMMFLGASIAT
TAFPMLARIIYEKRLSGTPLGTLALACGATDDVLSWCILATVLAMHRGSP
VTAVVAIGGGILYALVVLTVGRRSLQVLGPMSERRNTVSAPVLSTVLGLL
MVCAWFTDTIGIYAIFGAFILGVAMPSGFFAEHVTGRLEPLVTTLLLPLF
FVYSGLNTEIGLVDSPALWAVTLGILLVSIAGKGVACTVAARLRRVPVRE
SVALGSLMNARGLIELILLNIGLEAGIITPTLFTILVIVAIVTTLMTSPI
FEFVYGRHRKPTPAPVHRPEDVTNR
392418142YP_006454747.1 polyketide synthase family protein [Mycobacterium chubuense NBB4]MPVDQHREQDREPLAIVGIGCRFPGDVASPADYWNVLRHGTDATRTVPDA
RWNAGRYHDPNPAKAGKMVTRRGGFLDRIDQFDAQFFGITPREANLIDPQ
QRLLLQTTWEALEDGGIPAETLTGTDVGVFIGGFTLDYQLLQNQGRTSRF
RFKPHSATGMMMTMLANRISYTFDFRGPSMTIDTACSGSLVAVHLAAQSL
WNGECHLALAGGVNIMVGPNTAVAESKSGFLSPDGRCKAFDESADGYARG
EGGAVVVVKPLARALRDGDHVYAQILGTAVSQDGHTEGITVPSEDAQRIA
ITTALARAGVDPGEVGYVEAHGTGTPVGDPVEMRALAGALASARKAGDPL
LIGSVKTNIGHLEAGAGVAGLIKAALVLEHGHIPANLHLENPSSRIPFGE
LNIDVPRVGRPFPAGNRRVAGVNSFGFGGTNAHVVLAEPPAPLPAVDRMP
PWQPPLALLPISARSEEALAATAQGLAEHLGSGPDLTLADLGYTLSRRRS
HLTHREVLIVDSLEDARSQLESLAADTRVPAGRTSAPATKLAFVCTGMGP
QWWRMCRGLLDAYPVFADSIARSDEALSRYTDWSLIDELRRDENDSRMGE
TEVAQPANFAIQVALAEQLRHFGVTADAVIGHSAGEVAAHHLAGLLTFEQ
SIRVTHHRSRLQQRTSGLGRMLAVGLGADSLATVLDRRAFDEIGRRVSIA
AINSPFAVTIGGDPEILDDIARQLGEAQIFHRYLAGTVPYHTHFMDTVRD
DLHHALEGLSSGPASIPLYSTVTGERLSGYSAGAAYWWQNTRSTVLFESA
IRRMLDDGYTHFVELGPHPVLTASILEIAGSQRTVALPAQRRNDDDSRTL
MHCVGALYSHGYEIDWEALHPAQSARLVKLPSYPWQNKRFWNETPEAAED
LHYRPVHPLLGQPVRAVHPTWEVELSCTALPFLGDHQVQGSVVVPAAVFV
EMALAAATETYGSRHSVEDLVLHRALILDDRCDPTVRTTLDQDKGTIEFA
ALTATGDGDFTWAVTATAELNTAPQPPRRDEAPPEADGVVSMRGDDFYAR
TRDLGFGYGEAFRSVDSITAGDRWAVAEIVVPDKIADDLGAYRFHPALMD
GAFHTLFGTTFARDGGGTETHVPTRIRRGVVYGPPEDKMTVRVRVVSATE
EEIESDITVANRLGEPLAVYSGFTVRSLGASSAVSTERIDKGLYEIQWVP
QADDAGAGEFGARSWLVFADTTGFAASLVRHLRGRGQRVRTVSHGPVDAL
TENGDGFVTNPSLPEQVQELLETHVEREGELAGVVDCWPLDMAWGADEHN
QRIGVLTALHLVKALSERGAPALHVVTGNAQPALGGDLRAVDQAALWGLG
RVIGHQEFPGQWGGLIDIDDSDDCDATAARVCAHILSESTEDQVAIRGRS
TFVPRLRPCTDLTTPFPLKLTAHATYVVTGGLGALGLGMAAHLAERGARH
IVCFSRRTLPPRARWSQLTEADADFAVIEAVRRIERHGAEVSCAGVDVTD
AEQVHRWLSDHLGDGGRPVRGIVHAAGSVDDRLLVTMTEEQFASVMAPKV
TGTRVLDEAFDGHDLEFFVMFGSAGSVIAAPGQGNYAAANAFLDAFAHHR
RARGLPALTIGWGPWSVGMVEKLALERIYAQRGIELITPAAGVRIFDRLI
NQQVPTVVAISADWSRARQAGFGGSVPPMFSELQASEVVGAEGESDAPIL
DVLAATADSERLDVVVERLRLIVAAVFDCAVTDVEPDETLDDLGLDSMMA
MEFRVRINTMFSIDLPVLEILKGVSVNALAARVLAELHVCSPERQPSDVI
DSERAATEDVEELIGQLSDDDLRQLLAELEGGVGDQPDGERP
392418140YP_006454745.1 ABC-type multidrug transport system- permease component [MycobacterMAINHAENAVRTGRRADASEPALPSPLRIGVSRIVPELKMFYRQPAQMVL
TFSMPAVICILLGSIFSAKLPGSDTSTGAVIAASMLAYGILSTSFINLGI
SIAADRDTGALRRLRGTPATALSYFVGKVMLVCIASVAEAVLLLSVGIVV
FGLRLPTDLFGWFTLAWVFVLGVLSCSLLGLFISNLASNAVSAAVITNGP
AVGLQFLSGTYVPIMVLPAWMLTIGSLFPVKWMAQGFRSVLLPQQMAAFE
PAGSWEHWRTFLVLAAWSVGGLIACLSVFRWSDKE
392418138YP_006454743.1 asparagine synthase- glutamine-hydrolyzing [Mycobacterium chubuenseMCGITGWVAFDRDLTRDREVVEAMTETMSCRGPDAAGVWFDRHAALGHRR
LAVIDIPGGAQPMSVSTPNGDVAMVYSGEAYNFTELRDELIAKGETFTTS
SDTEVVLRGYLVWGEALADRLNGMYAFAIWDSRVRKLVMIRDRMGIKPFY
FSPTRDGVLFGSEPKAILANPLAGRTVDADGLREMFASVKTPRHAVWKGM
REVEPGTIVTVDERGVRERTYWRLESKLHTDDQDTTVGRVRDLLDDIVRR
QLVADVPECVLLSGGLDSSAITALSARELREPVRTFAVDFVEQAENFKPN
ELRPTMDTPYVHDVAQHVGSDHTDIVLDHTQLADLDIRRKVVAARDLPMG
IGDMDASLYLLFKAIREQSTVALSGESADEIFGGYRQFHDQAVQKTDAFP
WLAMVNSPLEGSDLVLAPELRTKLDLDTYLEDRYGEAVAEVERLDAEDEF
THRMRVMSYLHLTRFVRILLDRKDRMSMAVGLEVRVPFCDHRLVEYVYNT
PWSLKTYDGREKSLLRGATRDVLPESVVQRVKSPYPSTSDPRYGAALQAH
ARDILAADNDALFALVDRNVLSQIATLEADRVEAVQRSQLERTLDLSVWL
DMYKPDIAI
392418136YP_006454741.1 hypothetical protein Mycch_4352 [Mycobacterium chubuense NBB4]MKKFGLVGIVAGALSAAVIGFAGPAQADGNGFGFGGYGYGHNGYGYGYGP
DHSYPWINQLFPHVNVPHVDTTAHQ
392418134YP_006454739.1 hypothetical protein Mycch_4350 [Mycobacterium chubuense NBB4]MSQHARGTVRRVGAAFALGLCTLASAASLMTVGVGTASADDLVPDPSKAG
DGREPQGNVRESATQGDVRSSGIGEALAPAGGDVRGSSRAKPGTTAWVFP
GAAGDLSACVYSGPWCANWMKIPFDLNNP
392418132YP_006454737.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMQVAIVTGASSGIGFGCATTLAEQGMAVLGTGRDRDRLAELEKAVGSDRI
ATLAVDLTDDDAPSRIVDAALQRWGRIDYLVNNAGIGSPKPLHETDDETL
DRFLGIMLRAPFRLARDVIVHMQPGSAIINITSTFAVVGGLRGGAYSAAK
GGLTALTTHIACQYGPLGIRCNAVAPGVTVTPMVAKRLEDERFRKINTEM
TPHQRLGRVEDIAATVAFLCSEGGSFINGQTIVVDGGWSSTKYLSDYALN
AEWVPRR
392418130YP_006454735.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTTTAGDHRYLQVARALRKEIVDGVYPVGSQLPTEHELCERFAVSRYTIR
EALRRLRDDNLVASRPRAGTLVVPRPSTNSYAQDVMSIDDLLAFAQGARF
AIETNAMTTVDDALAERTGLSPGTEWLAASGFRRVDDDTAPVCRTEYYIN
RNFAAVGRLLQRHSGPIFPLIEDLFGVSVSEVHQEISAVVLPPDLAQRLQ
VQAGTAALQMQRTYTTSDGEIAQVTVNTHPSARFRHAMTLRRVRE
392418128YP_006454733.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSGVPLGMEGRIVVVSGAGGGGIGTTVTRMAAEAGATVVAVSRSQENLDE
HVGPLARQGLPVVAVAADASTEDGVATVLDQVRECDGDLYGLVNVAGGAA
PATWMPATRVSREDWHALFAANLETAFFMSQAVSRELLARGLTGSIVSVS
SISGMNTAPFHIAYGTAKAAVVAMTRTMAVELAPHGIRVNAVAPGVTETA
ASGTYVDEDPERDRKAIAMGRRGTPEEQAGAILFLLSDLSSYITGQTLLV
DGGLNLKWTHLGADNTSLFLADESFRDAMRRM
392418126YP_006454731.1 putative flavoprotein involved in K+ transport [Mycobacterium chubuMTTAENTCGPTDTPSDIDISALREKYAQERAKRLRPEGSKQYVELADDFA
GYYETDPYTPVAPRDPIAEDIDVVVLGGGFGGLLSAAYLKKAGVEDVRII
ELGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELDFMPSKKFADGPEIYQ
HCRNIGKHFGLYDNAIFSTQVRGLSWDEGLERWRVSTNRDDDIRARFVVL
ASGPFHRPKLPGIPGMKDFKGHSFHSSRWDYDYTGGDFTGGMDKLADKRI
AIIGTGATSIQCVPFLARDAQHLYVFQRTPSSVDVRDNAPTDPEWVKTLT
PGWQKERQRNFHAWTFEGMALGQPDLVCDFWTELGRNTAARVMALDDPAS
LTPEQFMGIREEEDYKIMERLRRRIASTVSDPDTAEILKPYYRFLCKRPL
SNDEYLPTFNRPNVTLVDVSDCKGVERITEKGLIVGGREYEVDCIIYASG
FEITTEISRRYSIESIQGRGGLSLYDYWHDGYKTLHGMTSRGFPNQFFTG
FTQVGISANIAANYELQGEHIAYIIAEALDRGATVVEPTAQAQEQWCATI
RENAVDNSAFDASCTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFGDLLA
EWRATGSLEGLELHG
392418124YP_006454729.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MPDTGPLAGIRVVDLTAMVMGPYCTQIMADMGADVIKVEPPQGDNTRYIS
VGPASGMSGVFVNVNRGKRSIVLDLRSEDGRAALRALVERADVFIHSMRS
KAIAKLGFGYADVAAMNPRIVYTNCYGYGRRGPERDRPAYDDTIQAECGL
PAVQKQLTGEADYVGTIMADKVAGLTALYATTMALFHRERTGEGQEVEVA
MFETMASFMLVEHANGAMFDPPLGPAVYPRTVAPNRRPYRTKDGYIAALI
YNDKHWNAFVTAVEPPWASDVYATLESRAHQIDTVYGLVAQTMAERTTDE
WLALFRDLEIPAAPLNTPDALFDDPHLNAVGLFETVDTPHGPVRFPGVPT
WFSRTPGKVRGPAPELGADTAAVLEELGLAAPDAVGSG
392418122YP_006454727.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MILDLGDDAQEYGRQARQAFAAGGGDRLVQQAETAPSTRESLVGPLLAEL
GAWELDPRTDADGLEAAAALCRSAGYWALPYPLAERLAQPADLDVDGLIV
VGGARPAGAVVGLECRWAAVTVDGRRALVTGQREPGPGFVAELDLEPVDD
TGARDVALGLALPCWTLLGMLDRALELTLAHVSLRKQFGQTLSSFQGVQF
QLTDAEVERNGLDILAKHALWSIATGRPDATEDAMALRMSALEAADIVFR
VCHQLHGAVGFCDETTLSWLSRYSQPLRRLPFGLSATRDHLTRTAGRRGL
TGLFT
392418120YP_006454725.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTDFAEFHDELRTVAGDLLAKDRETGWPVLVDAGWVGLEVPDELGGAGAT
FRETAVILDQIGRAAGANSYLGSAVLSVGVLKGLAPNAFRDQLLRSTAAG
DGRTAVVIGDFALAGGELTGRAEFVPDAVGADWLLVLVDGGVAVVRATDC
DITVQPVVDETRSLAAVVADAAAVEAVLAGPTEAVDSRAAVAIACDSLGL
AEQMLSATVDYVKVRHQFGRPIGSFQAVKHACADMLVRIEVSRQLIDEAV
EAVATGSDAAIAAAMAKSYTCSAAVDVAGKAMQLHGGIGYTWESGIHTYL
KRAALNRSLFGSPAAQRKQIAQRYRSQRKGI
392418118YP_006454723.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MREYLKHYIDGQWVEPLRPNTLEVDNPTTEEVSGKIALGSSADVDLAVQA
ARRAFETWSQTTREQRLDVLQAILAEYQKRAGDLAAAVSEEMGAPASLAA
GPQVNLGLGHLSTAIDVLKNFEFEEQHGSTLVVKEPIGVCGLITPWNWPI
NQIACKVFPALATGCTMVLKPSEVAPYSAQIFTEILDAAGVPAGVYNLVY
GDGPGVGAPMASHPDIDMVSFTGSTRAGIEVARNAAPTVKRVTQELGGKS
PNIVLDDDDFAKSVAAGTSVMMMNSGQSCNAPSRMLVPNSRMEEAAAIAR
ETASAVKVGDPGDKTAIGPVASRAQFEKIQGLIQKGIDEGATVVVGGPGR
PDGLEKGYYVRPTVFANVTNDMTIAREEIFGPVLCILGYDDLDQAVAIAN
DTEYGLAGYVSGADLDKARSVARRIRAGSVAINHGFDMNAPFGGYKRSGN
GREWGQFAFDEYLEVKAALGYAPA
392418116YP_006454721.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MVEKTAKPPEVGTNMEPHFEEVQAHYDLSDDFFGLFQDPSRTYSAAYYVR
DDMTLEEAQMAKIDLALGKLHLEPGMTLLDIGCGWGSVLKRAVEKHDVNV
VGLTLSRNQRKFAQELLDGLDTNRTRRILLRGWEQFDEPVDRIISIEAIE
AFPQERYGPFFKMCSSVLPDGGRMLLQAILGHPLKKWPELGIPITMTDLK
FMRFIAKEIFPGGSVPGEENIIELSAEAGLTLEHKQYLTDDYVRTLDTWA
QALEAHHDAAVEATSEEVYQRYMKYLVGCSDFFKRRVSELGQFTLVKV
392418114YP_006454719.1 hypothetical protein Mycch_4330 [Mycobacterium chubuense NBB4]MIDLPEWARRLDLSPHPEGGYFRETWRSDLTVPQSVLPPDYTGCRNAGTA
ILFLLLPGQQSAWHTVRSAEIWLYHRGGPLHLEVGAGQETAETHVLGADL
DAGETPQFVVPPGHWQRARPVGGDACLVSCIVVPGFDFADFALGAPTD
392418112YP_006454717.1 acetyltransferase- ribosomal protein N-acetylase [Mycobacterium chuMTGFVAPVKLTGQRWVALEPLSREHLPEIEVLAADGELGRLWFTGAPKAG
AAGDWVDMRLAVQTPQTGLTFMARTLDGALIGSSSYLNVDPANRRLEIGN
TWYAASARRSGANTEAKLLMLSHAFNELNCVAVEFRTHFFNSTSRAAIER
LGAKLDGVLRSHQLMPDGSRRDTVVYSILDIEWPAVRSNLRFRLDRNG
392418110YP_006454715.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAPAPNAVAQMLGLLGDEWTLLILQRAMLGARRYGDFHDELPVSNSVLSA
RLASLTHDELLVRREYQTRPPRSEYLLTPRSRSLWPMLTSIWAWEQRFVD
DHPQPLPAMQHRMCGAVFAPQVECRACDTPVSDKDVLAHWGPSGGWDRCI
PATTTRRRSGARRTPAAELFPQTMSVVGDRWGFALLVAAFVGLSRFTDFQ
NQLSAPPGTIADRLTLFTGEGILLNSEGRYRLTEKGRALFGVLVCALTWA
QRWFPAPDGPAAILTHTGCGQRFLPALTCDQCRNRLRGAQILAV
392418108YP_006454713.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MGAVWILGGYQSDFARNLDREGHDFSDLTAEVVTATLDAAGLDAADVGVV
HVANAFGELFARQGHLGAMPATVHDGLWDTPATRHEAACASGSVATLAAI
ADLRSGAYETALVVGVELEKTVPGDTATSILGTAAWTGHEGADAKYMWPH
MFDAVATEYDRRYGIDDEHLRAIAALNLANARANPNAQTRAWTVPQPLTG
DDIQNPVVEGRLRRFDCSQITDGGAGVVLVTDAWLRGHPRARPLGRIDGW
GHRTVGLGLRQKLEHSRDDPYVLPHVRGAVLDAFSRAHVTLDDLDGFEVH
DCFTPSEYLAIDHIGVTGPGESWKAVENGEIEIGGRLPINPSGGLIGGGH
PVGASGIRMLLDAARQVSGTAGDYQVDGAVTFGTLNFGGSTSTTVSFVVG
SHQ
392418106YP_006454711.1 hypothetical protein Mycch_4322 [Mycobacterium chubuense NBB4]MLTASVTAIVPSGGGDSPAPLAGGHVAGVAAAPSRGTGGNAAGAALSALD
TDAKPLQHMLFGSTARSSAGTQASPLFTRSANVSGGGRPTHSVSNSVVAL
APGSHQIMIGPGGWLIGNAVEPGQNGGLLIGNGADGGPGQDGGNGGLLFG
NGGNGGDPVVYGADGTKGGNAGLFGNGGAGGLGSRWGAGGAGGRGGWIAG
NGGAGGQGGIDLIHSRTATGGVGGAGGRAGLFGNGGAGGAGGAATAWSAG
FDSYGGAGGAGGAGGLIVGRGGDGGIAGDSTSMKANAFGATGGAGGRAGL
FGAGGNGGAAGLGKGILSAAAEDGGRGGDGGLIGGSGGNGGNGGALDGIG
TNPDAVAVAGRGGDGGRAGLLGRGGNGGSGGAGQLAAGIGAGGDGGDGGN
GGLIRGSGGVGGDGGSYDGVHSVQSEQGGNGGKGGNAGLTGKGGDGGSGG
AGVEYDHGVGGAGGDGGHAVTGTAGKGGKGGDGYTLSTLKGLGSAGGDGG
NGGNAPVGRGGNGGNGGNGLSPEGATGTGGAGGRGGHGLSRGTDGSRGSG
DGSAAGGA
392418104YP_006454709.1 hypothetical protein Mycch_4320 [Mycobacterium chubuense NBB4]MEKSRLIDIAPFVGAIAVQILTTPIQLTVACNLRRQHDNVKTTGSSPESL
PASIYDQFIVDSDCISSVAAGTTFVASAVVTLLAKTTFDPFALTSYILLG
IVAVFLSALIYLHYRRAPEIYVQRSPWKNRIAPLAMVVYGVNALGVIGFL
SLSP
392418102YP_006454707.1 hypothetical protein Mycch_4318 [Mycobacterium chubuense NBB4]MGSTPNSARWASIRRLFLVVAVELRPEEIRRLFQDLIGALEFSVLLLRLF
EPLRVGGRHPGHHAFVDVGLAHPSADRLDAGWPRAVPCPGWCPARCAGPA
PSAPRRPSPWSCSDASWASPQTVPSAYLHPRFQGQEPPTFPGRFKPPTPT
VWDQPKRDRQNRHRPIADSGLLVCHYHYRKSPYGLLRRRTQAWKRRPRLP
NANSVGPGVLLANRDRRFTAHLAQHPSQNIAPQITTLPYRAWCEKPKSSG
VRNEANPHVYSKRALLYVYTRGGTRLICGQLNGLSHWNTQ
392418100YP_006454705.1 transposase [Mycobacterium chubuense NBB4]MSLTWDVYYDTKTRPPSTRAVRDAELGPALRKLWEDNYRVYGVRKLWKAA
RRAGHGIGRDQVGRLMRRLGIEGVRRGNRVKTTAADTAAARHPDLVNRRF
SASAPNQLWVTDLTYVPTWSGVAYVCFIVDAFSRTIVGWRVASNMRTTMV
LDAVEMARWSRGNTLPGLRCHSDAGSQFTSIRYGERLAEIGALPSIGSVG
DSFDNALAETVNGYYKAELIYGPARTEPWKTVEDVELATLSWVYWHNTAR
LHSYLDDVAPTEFEAAFYDAQRIDQPLVEIQ
392418098YP_006454703.1 transposase [Mycobacterium chubuense NBB4]MDIISAYQQLGSYRAAAEQCGTTHKTVRRVVAKFEADQAGVVPAPRVERG
HNYDAVTDLVAERVEKSKGRISAKRLLPIARAAGYQGSARNFRRLVADAK
ALWRSANHRGRRPAVWEPGQYLVIDWAEAAPGLFLFCAVLAFSRWRFVRF
ATDQKASTTLALIAEALAAIGGVPARVLADRMACLKGGVVANVVVPTPDY
IRLAGHYGFAPDFCHAADPQSKGIVEHLCGYAQDDLAVPLLTEAAVAGTP
VTLREANAAALSWCAEVNAAIHSEICAVPDERLGVECELLQPLPSLRLQI
GAPSVLRKVDRLSCVRYGSARYSVPTRLIGSTVAVVVDHGAIVLLEPATG
VIVAEHELLAPGGTSILDEHYDGPRPAPSRGPRPKTTVERQFCDLGADAQ
AFLVGAAAIGNTRLGAELEILLALGAAHGEAALVAALHRAVAFRRFRAAD
VRSILAAGTGTPQPRPAGDALILDLPVAPTRSLDAYKVSTMVDGEVIP
392418096YP_006454701.1 hypothetical protein Mycch_4311 [Mycobacterium chubuense NBB4]MTDQWPLLVADPLEGEQLVSSQLRPRAGAVAIDRSDYPSACNRVRDLCGT
WGGAGIPLIPVTPSENVDPRWSRILNESNIDGIEGSDLLGDDAVSEYTDA
EGPASAQLIRVLVDLERRPTVQTVRGMSTDDPWHLAYLTVAGDLSSQPHP
QNTWNDLRRDLTFDDVLTIRGVSENGSAAGLLALVRDFSAATAVELSRSK
LPSGLQGGYNRGFPSSSRFAWSDDETSQRFGPNIVVVFEPGSSEDLALVW
NLRARFLHPLRFPLAVPLTSTVEDDIRHLIQSGADHHFGFDHNLALTSIS
VASDRVATLAKSVGFKAVDPWELLRPIGGYCSVSTDIVRFNGGKARVASF
TPSDFQAIGGSYLGSHQGTWMKRKTVVVDAPLPPSRTMRRQIYHGDSHYL
EGPITTGGRSDGFTLIRVPSGLEVVSALSVDHGLQLTESAPGKAAEHLIR
AAGRNLSMFGSAGVVETLTELTRGRSVSIVKRRLNQYLAEPQTDESSDRY
QTLLDRLNRGLGSPDAEELGYPTFDRMRQLLRMRRDAAQQWVSWAMAGGL
ILRGVEANCTRCGHKQWRPLSEAVPSLVCHACGQTIDSPHGYNQINFRYR
ASEVLLRAMSHDVLSHVLAMRYVCGKLGGRPLVFGGYPGVEFRPLDSERV
TAEADVIVVLRNGEIILGECKANARGLSQEELDKLWRSADQLGARATFAA
TLDRAVNCGEEWRVTEGPTGRPHFALTAEHLFDLGGTIGASGEDLFAWRT
DYSSRFSADHQELTGADLARRIDEEFSTYVERTATDYDQHTRAPWTRGPN
D
392418094YP_006454699.1 hypothetical protein Mycch_4307 [Mycobacterium chubuense NBB4]MAKVSKLRIVAGSVPGVELTLQRIGAWSGSIMIVLYGASFSGVAQLFPPL
SPASSADEIAAFFVDHKLWIRFGVSGALLSAAVALPFLAAVILRIRRVEG
GWGMLSVTQLMAATVFVPALIFPQFFLAVAAYRPEQRSAELTQALDDVFW
LWFIGIVGTIIVQNLTLAVAAFVDKTDPPTFPRWYGYLNLWVATLSLPGC
VVVVFNDGPLAWNGVFAFYIPGLVLVIWLFATTAVMLRSINAEQAALA
392418092YP_006454697.1 hypothetical protein Mycch_4305 [Mycobacterium chubuense NBB4]MTGLRLLRSRAGASWVFLVAATIVSWAVGAEHGTGSTVAVVVLAIAAIKV
RLVGLDFMELRHAPIPLRAAFECYCAGMWVLLSALYLWL
392418090YP_006454695.1 carboxylate-amine ligase- YbdK family [Mycobacterium chubuense NBB4MTNAPTLGVEEEFLLVDPDSGAPVAKNRQVAEYAAEHGVDLQLELTRCQV
ETATDVAHTTADLRDQLLRLRRVASGAAEQAGARLLAVALPPTLPTEFPV
TDTPRYRDIGERYGMIAHEQGICGCHVHVAVPDRDAAIDVGNRLRPWLPL
LLSLTANSAIYRNADTGHASWRSVLWARWPSAGPPPHFGSADEYDAAVQM
LCRAGVMRDDGMVYWDVRPSADFPTVEIRVADVPATVAETVLFAALVRGC
VMTALDDGRRGEPVQPLAPYVLKAAYWKAARDGLDGDGVDLENHGAAPAL
TLAERLVERVRPALETAGDYEMVSTELARIAGEGNGAMRQQRVWRRRHDV
SDVLAEAAAATLEAPS
392418088YP_006454693.1 RNA polymerase sigma factor- sigma-70 family [Mycobacterium chubuenMRACRLGSRLSVAHSRFPIPHGGDGVILTALALVGARLRLVTADLDALLR
QVARRDVDAFASFYDQTRARVYGLVTRVLRDPGYSEETTQDVYLQVWRSA
ESYDPSAGSPLAWLMTLAHRRAVDRVRSEQAASTRESRYGAANVDPPSDS
VADSVILSDERQQVADCLATLTDTQRECIQLAYYDGLTYVQVSERLSANL
ATIKSRMRDAIRGLRRCLGVA
392418586YP_006455191.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MNTPFTPPPGPFGGHPGPGFGFGFSPQDRRALHERRRQARRDFREHVREH
RGDAGFGPGFGPGFGPGFGFGFGPGGRGRRGGPRGAARGKRGDVRAAILT
LLTERPMHGYEMIQEIDERSQQLWKPSPGSVYPTLQLLVDEGLLVGTETE
GSKKLFELTEEGRAAAEKIETAPWDEITEGADPGAMGLRSAVGQLMGAVA
QSAHAATAEQQQRIVEIVNNARREIYHVLGED
392418585YP_006455190.1 lignostilbene-alpha-beta-dioxygenase-like enzyme [Mycobacterium chuMFLTIGGLLLACRSQDVTVDGMTEMETEQGDSADAEAFFRTGNYAPVADE
LTEFDLPVEGAIPPEIEGWYLRNGPNPRAAAGHWFTGDGMIHGVRLEGGR
AAWYRNRWVRTDSFVDPFPLYNDDGTRNLRASVANTHVVNHAGRTLALVE
SSLPYEITNDLETVGAYDFDGELVDSMTAHPKICPTTGEMHFFGYGSLFA
PYVTYHRADADGTLTVNRPLDVPGMTMMHDFALTANYVVFMDLPVVFDLE
TAMGGGGMPFRWSDSYGARFGVLRRDDAFGEVRWFDIDPCYVFHVVNAHD
DGRVLTVEAVRYPELWRGDSNSGGDSVMWSWTLDLGTGAVTERQLDDRTV
EFPRIDDRRATLPARYSVSVGDDRLVRHDLRSGEAVEHRFGTPDAPGGPG
EAVFVPSDSGPADESSGWYLAYVYDPVRDGSDLVIIDASEFSAPPVARIA
LPQRVPYGFHGNWIAG
392418584YP_006455189.1 Kef-type K+ transport system- membrane component [Mycobacterium chuMAVSGFGFATLALIVVIGMAGPLIASVGRFGIPAVIGELAAGIAFGSSGL
RIVDHTDPVFTLLADIGFALVMFVAGTHVPVRDASLRTALPAAAVRAVLA
GLGAAVLAVVLAQVFGTGHALLYAVLMASSSAALALPVIDSLGLTGPPVL
SVTAQIAIADTAAIVLLPLAIAPSQAGRASLGVLAVFGCAAVVYGLLRVA
DRRGWRRRAHRFTERYRVALELRVSLMLLFALCALAVTTRISIMLAGFAL
GLVVAAVGQPRRLARQLFGVTEGFFGPLFFVWLGASLNIGALGTNPKLIA
LGVALGLGAVLAHTAGRMLGQPVPLAVLSAAQLGVPVAAATLGSDRKILT
AGEPAALILGALVTVVAAAVAAAVLRRRQQAAPT
392418583YP_006455188.1 DNA-binding domain-containing protein- AraC-type [Mycobacterium chuMDAVTGLLDGVRARGAFVLRMMLDPPWSMSIRDEAPLTVICQTHGRAAVV
AAGGAISRLEPGDVALARGADPYVYADDPATPPMVVIHPGQRCTTVSGED
LRFEMALGVRTWGNSPAGRTRSVIGAYEGRSDVSARLLDALPAVAVLRAG
DWDSHLVGLLSQEAGRDGPGQEAFLDRLLDLLLIAALRAWFDRDAHAPTW
WRAEHDPLVGPALKLMYHHPAHRWTVADLAGAVGCSRAVFARRFADLVGE
PPIAFLTGWRLALAADLLRSGATVGAVARQVGYGSPFALSTAFKRAYGVS
PNAHRQVGAAC
392418582YP_006455187.1 putative integral membrane protein [Mycobacterium chubuense NBB4]MTDHSLTVLSTVAALASAVAGGMMFVFSTFVMRGLDRVGPLDAISAMRGI
NAEAESNALFLIVYFGAAVLAVAVGVLAGLRWHTPGSAWLLAGAVCGVVG
AIVTVAFNVPLNDRLDAGPVSAPAWNSYLDAWTRWNHVRTVSSLAAAALL
TVGAVQRADVAHRVTMAA
392418581YP_006455186.1 putative membrane protein/domain protein [Mycobacterium chubuense NMAGPHEPVVTGDAVVLDIQIAQLPVRALSALIDVIVVFIVYVLGVLLWAV
TLSQFDTAFSSAVMIVFTVLALVGYPVIFETATRGRTLGKMAMGLRVVSD
DGGPERFRQALFRALAGVIEIWMLTGGPAVICSLLSPKGKRIGDIFAGTV
VISERAPRMEPPPQMPPQLASWASALELSGLSPDRAELARQFLSRASQLH
PEVRDQMGYRITGEVLAQISPPPPPGAPPPMVLAAVLAERHRRELLRLQV
PATSLTGQATGPAPYPPGWPPPPPPGSGFTPPS
392418580YP_006455185.1 uncharacterized membrane protein [Mycobacterium chubuense NBB4]MDVDAFVQANRPAWDRLDRLVKKRRHLSGAEVDELVDLYQRVSTHLSMVR
SASTDAVLVGKLSSLVARARSVVTGAHAPLWREFTRFWTVSFPVVAYRSW
RWWLATAVAFFAVTGVIALWISGNPDVQAAVGSPAEIDQLVNNEFADYYR
EHPAGSFALSVWTNNAWVAAQCIGSSILLGLPVPYVLFQNAANLGVIAGL
MFESGRGDVFLGLITPHGLIELSAVFLAGAMGMRLGWSVISPGDRPRAQV
LAEQGRAVVSVAVGLVAVLLVAGLIEAFVTPSPLPTPLRVAIGVAALLGF
LGYVVHFGRRAVRLGETGDIEDAPDYVPTG
392418579YP_006455184.1 hypothetical protein Mycch_4810 [Mycobacterium chubuense NBB4]MQQRVKDLVARHGGYVSTAALLTVITRSQLDVLVRRRELIRIWHGVYGIA
EPTALGRLEAIDVYIGQPAVACMGTAAALYGFDTESTSALHVLDPGVRIR
PTVGLTIHQRLGAPLRRVQGRLATAPAWTAVEVARTLSRPRALATLDAAL
HTGSCTPADLASAIAEQKGRRGIVTVRELAPLADGRAESAMESEARLVML
DHGLPRPELQYTIGGASTSWRVDFAWPDQLVVAEYESIEWHAGRLAMLRD
KVRFAAIQQLGWTVIPIVVSDVRVTPERLTDRIREHLARGAVAL
392418578YP_006455183.1 hypothetical protein Mycch_4809 [Mycobacterium chubuense NBB4]MVITGRAGLIALLCVLPIALSPYPAATFAVLLTAVAVAVAVDAALAGSPR
ALRMTRGGETSARLGQPVGALLTVDNGGGTRFRGVVRDAWAPSANAAPRM
HDVNLAAGQKVTLSTRLAPSRRGDQVSALVTARSVGPLGLAGRQGSHRVP
WQVRILPPFLSRKHLPSRLARLRELEGMTPALIRGQGTEFDSLREYVVGD
DIRSIDWRATARRADVVVRTWRPERDRRVVIVLDTGRTSAGRVGVDPTSA
DPGGWPRLDWSMDAALLLAALAARAGDHVDLLAHDRVTRAGVFNASRTDV
LVRLVDAMAPLEPALVESDARAMVAAVQRRVRRRALVVLLTDLNASAIDE
GLLTVLPQLSAKHQVLVAAVSDPRVDRLATGRTDAVAVYDAAAAERARID
RRTVAALLRSHGVDVVDAPPEELAPALADHYLAMKAAGRL
392418577YP_006455182.1 MoxR-like ATPase [Mycobacterium chubuense NBB4]MTQPTAHEGARNALMALRAEIAKVVVGQDAVVSGLVIALLCRGHVLLEGV
PGVAKTLLVRTLAAGLQLDFKRVQFTPDLMPGDVTGSLVYDARTAAFEFR
AGPVFTNLLLADEINRTPPKTQAALLEAMEERQVSVEGEPRPLPDPFIVA
ATQNPIEYEGTYQLPEAQLDRFLIKLTVPLPPRDQEIAILDRHARGFDPR
DLSSVRAVAGPADLAAGRDAVRQVLVADEVLGYIVDIVGATRHSPSLQLG
VSPRGATALLSTSRAWAWLSGRTYVTPDDVKAMARPTLRHRVMLRPEAEL
EGSSADGVLEGILASVPVPR
392418576YP_006455181.1 hypothetical protein Mycch_4807 [Mycobacterium chubuense NBB4]MTVTGPSSAVGATLRQRWRGAKWVLAALVVIVAVAVLSTWLTAARPGGRL
DPESTSAQGARALVTLLREHGVDVVAATSLADVERQARPGTLLVIAQTFH
LTGDSATLRRLADLPGDRLLVEPASRTREALAPALRRSDSTAFGGLAPNC
DLREADRAGTVAFGAADAYEAAGSIPVTRCYDGVLARYSDGGRTITAVGS
AEFMVNSGLLDEGNAALAMNLAGAAPRVIWYAPQHSEGGETAGASTLSDL
IPTQVRWMVLQLMVVVALLALWKGRRVGPLVAEQLPVVVRASETAEGRGR
LYRSRRARDRAADALRTAALQRMLPRLGLGPTAPPPTVVAAVAARSGRDA
QVLARTLYGQPPAGDAELVDLARELDDIERQVAQS
392418575YP_006455180.1 hypothetical protein Mycch_4806 [Mycobacterium chubuense NBB4]MATTIDIDRDAAHDAAGRELGKLIYPKPSFTEQIADWIQRLLYRLTAGAA
SVPGGWLTIAVLLVLLALAIVVVVRIARNAMRSSRAGTVTLYGGHELSAA
EHRATAERYAAAGDWSPAIRHRLRAVARQLEESGVLDAVPARTATEFARA
AAEAFPDIRDQLTAAADAFNDVTYGELPGSEPQYRSVAGLDAEVGRRRAP
AHDGRPTETAAQPWAEVR
392418574YP_006455179.1 hypothetical protein Mycch_4805 [Mycobacterium chubuense NBB4]MAAPKPAAGGVTLSITGAIDKMGTMTYDAGGYGPAGSPPPGAPPTGYPPP
GPPGFPPPGYGPPPYGAYGPPPGYAGPGYGSAGYFAPPPVIRPGVVPLRP
LTLSDMFNGAIAYMRVNPKATLGLTTIVVVAAQLFGLALSLWPLAFAGQL
AGSLEGDANNGASLVLQNGSGLASLASSFAATVATTLSTILLSGLLTVVV
GRAVFGAGIGIGEAWRRLKPRLWALIGFTLAEGIGALVLIAIPVVIIAVV
AVAANGWAAFFFAIPLVLALIAALAYLGTMLAFAPAIIVLERGRIGYAVR
RSFSLIKGDFWRVFGIRVLAVVVAQIVAAAVAIPFSFGGQFLLTAAASTG
TAMIAMVLIAVGGAIGQIITGPFSAGVVVLQYTDRRIRAEAFDLVLQTGA
TTGWAAPPNSTDDLWLTGQR
392418573YP_006455178.1 F420-dependent oxidoreductase- G6PDH family [Mycobacterium chubuensMTRFGYTLMTEQSGPKDLVRYAVSAEQAGFDFEVSSDHYFPWLSSQGHAP
YAWSVLGAVAHATERVELMTYVTCPTLRYHPAIVAQKAATLQILADGRFT
LGLGSGENLNEHVVGKRWPTVARRHEMLREAIQIIRELHTGEMVDWKGEY
FEVDSARIWDVPEVPVPIAAAVSGDKSVERFAPLADHLIAVEPNKHLVDA
WHDARRATGLPGDVRVIGQIPICWDPDRDAAIERAHDQFRWFAGGWAVNS
DLPTTAGFDGATQFVRPEDTADSIPCGPDLDAIVEAVREYWEAGFTDIAL
VQVGGESQDQFFKEAAGPLLDKLRSASS
392418572YP_006455177.1 hypothetical protein Mycch_4803 [Mycobacterium chubuense NBB4]MTRGKGIYDDEKTSTASEETDTEKDADAETPDVDKDTGEPTA
392418571YP_006455176.1 PAP2 superfamily protein [Mycobacterium chubuense NBB4]MTRSQTRVALDGDHRLRRARHQWTAVLIAAVLFGIAVYLLAVQTTTGQRL
EDAALRGADQVDPELHRAALHAFHTITLTSQLVATVIVGVIGLLRRQVWL
AVAGVGIILGGQAITQLLKFHVLSRPDLVAVGGKYAENTLPSGHTTAAMC
LLFATLIVMPYRFRGVAMFVTLTWAVGIGAYTVIIQAHRLSDTLAGNAVA
LVVACTAAQLLAWTGRIRAVVSPSPGRYTLRTVFVVVVGVMGAASLALGA
VQMLHAAAAYVNDEPTAWRLFLSSQWLAAAGSIGAALLFWWTWYRLETKR
RHDPVAMR
392418570YP_006455175.1 cysteine synthase [Mycobacterium chubuense NBB4]MTPTGTSDCCRQSRSWVDNAVRLIETDARRSADTHLLRYPLPASWSTDCD
LALYLKDETTHITGSLKHRLARSLFLYALCNGWIGEGTTVIEASSGSTAV
SEAYFAAMLGLPFIAVMPASTSTTKIKLIESQGGRCHFVTEAAQVYAEAQ
RLAEETGGHYLDQFTNAERATDWRGNNNIAESIFDQMAMETHPIPTWIVV
GAGTGGTSATIGRYIRYRRHATRLCVVDPENSAFYPSYVNGDPDVVTGLS
SRIEGIGRPRVEPSFLPGVVDRMVTVPDAASIAAAHHVSRVIGRRVGPST
GTNIWGAFGLLAEMAAQGRSGSVVTLLADGGDRYAETYFCEEWLTSHGLD
PSEPAEVLAGFERSARWP
392418569YP_006455174.1 putative phosphohydrolase [Mycobacterium chubuense NBB4]MPDASPGSILKTTAAVSLGTLVAGIGYASLIERNAFVLREATMPVLSPGS
SPLKVLHISDIHMRPGQRRKQAWLRDLARWEPDLVVNTGDNLAHPKAVPA
VVQALGDLLSIPGVFVFGSNDYFAPRLKNPANYLTNPGHRIHGEPLPWQD
LRAAFTERGWLDMTHTRREFEVAGLHIAAAGVDDPHLSRDRYATIAGPAS
PAANLTLGLTHSPEPRVLDRFAADGYQLVMAGHTHGGQLCLPFYGAIVTN
CDLDRSRVKGPSRWGAHTQLHVSAGIGTSPFAPLRFCCRPEATLLTLVAA
PTGGSDVGSQSGQSHPTVSAR
392418568YP_006455173.1 membrane carboxypeptidase (penicillin-binding protein) [MycobacteriMPEHPPTSPTEPPPRSVTVIKLAWCVLLASVVAAGLMFPVVGGIGLMSNR
ASDVVANGSAQLVEGEVPQVSTMVDAKGNVIAWLYSQRRFEVPSDQIANT
MKLAIVSIEDKRFAEHNGVDWQGTLTGLSGYLSGNLDTRGGSTIEQQYVK
NYQLLVLAQTDAEKRAAIETTPARKLREIRMALTLDKTFTKSEILTRYLN
LVSFGNGAFGVQDAAQTYFGINASELNWQQAALLAGMVQSTSTLNPYTNP
DGALARRNLVLDTMIENLPEHADELRAARQQPLGVLPQPKELPRGCIAAG
DRAFFCDYALDYLARAGISKDQVAKGGYLIKTTLDPDVQNTVKSAITSFA
SPDLPGVASVMNVIRPGKDSHPVLAMASNRTYGLNLDAGETMQPQPFSLV
GDGAGSIFKIFTTAAALDMGMGINATLPVPGRFEAKGLGSGGAKGCPPAT
WCVQNAGSYKGSMDVTEALATSPNTAFAKLISQIGVPRTVDMAIKLGLRS
YALPGTARDYDPNSNESLADFIKRQNIGSFTLGPVEVNDLELSNVAATLA
SGGTWCPPNPIDKVVDRHGEEVSVTTETCEQVVPEGLANTLANALSHDDQ
GNGTAAGAAGSVGWNLPLSSKTGTTETHRSSGFLGFTNHFAAANYIFDDS
NSPGELCSFPLRQCGDGNLFGGNEPARTWFAAMKPLTAPFTDVTLPPTDP
RYVDGAPGSRVPSVSGMDQDTARKRLREAGFQVADQATPVNSSSDYGTVV
GTTPSGATVPGSIITIQISNGIAPAPPPPPPSAAIPGGPPPQVGSTVIQI
PGLPPITVPVLGPPPPAPPPPP
392418567YP_006455172.1 Transcription factor WhiB [Mycobacterium chubuense NBB4]MSGTKPAARRTTVNPSGQSILHGAEAEARIAWVSQARCRQTDPDELFVRG
AAQRKAAVICRHCPVIAECGADALDNRVEFGVWGGMTERQRRALLKQHPE
VVSWSDFFAAQRKHRTAG
392418566YP_006455171.1 oxyanion-translocating ATPase [Mycobacterium chubuense NBB4]MSTTPRALDMASILRDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRCV
VVLTIDPAKRLAQALGIRDLGNSPQRVPLAPEVTGELHAMMLDMRRTFDE
MVVQYSGSERADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLAEDKWDL
VVVDTPPSRNALDFLDAPKRLGSFMDSRLWRLLLAPGRGIGRLVTGAVGL
AMKGMSTILGSQMLSDAAAFVQSLDATFGGFREKADRTYELLKRRGTQFV
VVSAAEPDALREATFFVDRLSTEHMPLAGLILNRTHPMLCGLHGDKAAEA
ADELATSDPDSVAVAALRIHADRASTAKREVRLLSRFTGANPTVPIVGVP
SLPFDVSDLDALRAIADQITGEAA
392418565YP_006455170.1 oxyanion-translocating ATPase [Mycobacterium chubuense NBB4]MATTTPGAPDDPRPVGWPSRLTEARLHFVTGKGGTGKSTIAASLALALAA
GGRKVLLVEVEGRQGIAQLFDVPPLPYEEVKIATAEGGGQVNALAIDTEA
AFLEYLDMFYNLGLAGRAMRRIGAVEFATTIAPGLRDVLLTGKIKEIVTR
TPKEAKGKYGYYDAVVVDSPPTGRIARFLDVTKAVSDLAKGGPVHSQAEG
VVKLLHSGLTAIHLVTLLEALPIQETLEAIDELRELKLPIGSVIVNRNIP
AYLAPDDLAKAAEGGIDADAVQAGLKQAGITLSDKDFAGLLTETIQHATR
IAARAESSEQLVEVDVARLELPALPDGVDLGSLYELAEALAHQGVR
392418564YP_006455169.1 hypothetical protein Mycch_4794 [Mycobacterium chubuense NBB4]MSEPTRWEYATVPLLTHATKQILDQWGEDGWELVSVLPGPTGEQHVAYLK
RPK
392418563YP_006455168.1 putative translation initiation inhibitor- yjgF family [MycobacteriMSGWSARLAEQGITLPAVAAPLAAYLPAVRTQNLVFTAGQLPMVEGRLAA
TGKVGAEVSVDDAKRLARQCALNALAAVDSLVGIDAVVRVVKVVGFVASA
PGFHGQPAVVNGASEFFAEVFGDAGAHARSAVGVSELPLDAPVEVEIIVE
VA
392418562YP_006455167.1 Zn-dependent hydrolase- glyoxylase [Mycobacterium chubuense NBB4]MDHPAYGVLRPVTETASVLLCENPGLMTLDGTNTWVLRGPGSDEMVVIDP
GPDDKDEHIERLAELGPIPLVLISHRHGDHTGGIDRMVDLTGAVVRSVGS
GFQRGLGGPLADGEVIDAAGLRITVMATPGHTADSVCFLLDDAVLTADTV
LGRGTTVIDKEDGDLGDYLESLRRLHGLGHRMVLPGHGPDLQDSAAVTET
YLAHREERLDQVRAAVRELGEDATTRQVVEHVYTDVDEKLWDVAEWSVQA
QLNYLRR
392418561YP_006455166.1 cAMP-binding protein [Mycobacterium chubuense NBB4]MDEILARAGIFQGVEPSAVSALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDRDALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
392418560YP_006455165.1 hypothetical protein Mycch_4790 [Mycobacterium chubuense NBB4]MSWLLVALIPGLLMVATFGLERVEAGLRRESISAADVADFLDQAEASDVT
TLARDGMDTALHGLQQRRSERDYPEAKLSHPVPAPSLPTHAYFAQRANTE
FQQTRSVNPV
392418559YP_006455164.1 endonuclease III- DNA-(apurinic or apyrimidinic site) lyase [MycobaMTVSQTRAGEPAAGEPGRRASSKQAGKWDRETHLGLVRRARRMNRTLAQA
FPHVYCELDFTNPLELTVATILSAQSTDKRVNLTTPALFAKYRTARDYAG
ADRAELEELIRPTGFFRNKSGSLIKLGQELEERFDGEVPRTLDELVTLPG
VGRKTANVILGNAFDIPGITVDTHFGRLVRRWRWTSEEDPVKVEHAVGEL
IERSEWTLLSHRVIFHGRRVCHSRKPACGVCVLAKDCPSFGLGPTDPLVA
APLVRGPETEHLLALAGL
392418558YP_006455163.1 thiol-disulfide isomerase-like thioredoxin [Mycobacterium chubuenseMSASARWSIAALVVLVVLAMGLWSQLGSGDGPTSTPESVSARDRRDADTA
QALAAPRARADLAPCPSAGPGAGPEALRGIVLECAGDGADVDVAAALAGR
VTVLNLWAYWCAPCAAELPAMAEYQRRVGSRVTVLTVHQDENETAALTRL
AELGVHLPTLQDGRRRIAAALKVPNVMPATVILRADGSVAEILPRSFASA
DEISAAVDPKIGDA
392418557YP_006455162.1 ADP-ribose pyrophosphatase [Mycobacterium chubuense NBB4]MSWESRAGELTPGAAPPWLTPLVERPEAVKHAYRRRVPAEVLAALTAANA
TAAVTGARRDAAVLVLFSGPRDGAPGSLPDDADLLVTVRASSLRHHAGQA
AFPGGAADPGDQSPVHTALREATEETGIEAGRLAPLATLEKMFIPPSGFH
VVPVLAYSPDPGPVAVVDEGETALVARVPVRAFVNPENRIMVYRQQNTRR
SAGPAFLLNEMLVWGFTGQVVAAMLEVAGWSKPWDTDNLYELDDAMALLD
SQGSYGEAQR
392418556YP_006455161.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMTASQWLDIAVLAVALIAAVSGWRSGAPGSLLALVGVALGAVAGVLLAPH
VVDHISGPRTKLFVTLFLILGLVVIGEIAGVVLGRAVRGAIRSPGLRIVD
SVVGVALQLVLVLTAAWLLGTALVSSPQPNLAAAVQGSKVIAEVDSVAPN
WLRTVPGRLSGLWDTSGLHEVLKDFGPTPVAAVEAPDASLATSAVVGATK
SSVVKVRGVATSCQKVLEGSGFVVAPNRVMSNAHVVAGAETVTVEVDGQT
YDASVVSYDPNADISILDVPNLPSAPLQFADGQAPSGTDGIVMGYPGGGD
FTATPARIREVIELNGPDIYRSTTVTREVYTIRGTVKQGNSGGPMINRSG
KVLGVVFGAAVDDVDTGFVLTADQVSQQMAKVGNVARVTTGTCVNG
392418555YP_006455160.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMPPPDPSVVRIGGPWRHLDVHANGIRFHVVEAQRDADADDRSRPLTDRPL
VILLHGFASFWWSWRHQLKGLSGARVVAVDLRGYGASDKPPRGYDGWTLA
GDTAGLVRALGHNSATLVGHADGGLVCWATSVLHPRVVQAIAVVSSPHPA
ALRASTLRRRDQGRALLPWMLRYQVPMWPERALTRDNAAELEHLVRSRSS
AKWQASEDFAETIGHLRRAIQIPSAAHSALEYQRWAVRSQMRADGRRFMQ
SMKRQIPVPVLHLRGDADPYVLADPVYRTQRYAPHGRYVSIDGAGHFGHE
EAPEKVNDQLSRFLAQVYA
392418554YP_006455159.1 Protein of unknown function (DUF1469) [Mycobacterium chubuense NBB4MSDRRNGVPTTVTSIPLVDPHAPKPDPSIGDLVKDATAQVSTLVRAEVEL
AKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFLAELLDSWLWRWAA
FLIVFGIMVVVTVVLALFGYLKVRRIRGPQKTIETVKEIPDALTPGPDKR
AIATTDGKQAPTADPSGW
392418553YP_006455158.1 hypothetical protein Mycch_4783 [Mycobacterium chubuense NBB4]MKISGRGPTVRALLAALFAIALFAAVPAHADAPVTLGGGSGIVVNGDTLC
TLTAIGKDNRGSLVGFTSAHCGGPGAVVAAEGAENAGVVGTMVAGNDTLD
YAVIQFDPQKVRPVSEVNGFRIDGLGPDPRFGQVACKLGRTTGYSCGVTW
GPGEQPGTIVNQVCGQPGDSGAPVTVDNHLVGMIHGAFSQDLPTCVIKFI
PLHTPAVTMSINTQLADIVAKNRPGSGFVPVA
392418552YP_006455157.1 acetyl-coenzyme A synthetase [Mycobacterium chubuense NBB4]MQPWVTTLTTMTETHVDVQASYPPAPEFTANANASEALYEEAEADRLAFW
ATQADRLAWDTPYTEVLDWSDAPFAKWFVGGKLNVAYNCVDRHVEAGNGD
RVAIHWEGEPVGDARDITYAELKDEVSRAANLLTELGLRSGDRVAIYMPM
IPEAIVAMLACARLGAMHSVVFAGFSASALKARIDDARAKLVITSDGQYR
RGKAAPLKAGVDEAIDGLGEDSPVEHVLVVRRTGIDVPWTEGRDLWWDET
VPNASPEHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQASYTHH
HVFDVKPESDVYWCTADIGWVTGHTYIVYGPLSNGVTQVVYEGTPASPDE
HRHFQVIEKYGVTIYYTAPTVVRTFMKWGRELAFEHDLSSLRLLGSVGEP
INPEAWRWYRLVFGGDRTPVVDTWWQTETGGIMISPLPGVTSCKPGSAMH
ALPGISAKIVDDDGNELAPGTDHGEQASGYLVLDQPWPAMLRGIWGDPER
FKETYWSRFAEQGWYFAGDGARYGKDGEIWVLGRIDDVMNVSGHRISTAE
VESALVGHSGVAEAAVVGATDEHTGQGICAFVILKSHAKEMSRDQMIDEL
RAEVSREISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTST
LVDPSVFEAIRASK
392418551YP_006455156.1 hypothetical protein Mycch_4781 [Mycobacterium chubuense NBB4]MTDPLAPLTTLPGVAAAGEEAREALGRAHRHRVNLRGWPKTAAEAALRAA
RASSVLDGGPLQFDADAAPDPVLAGALRVAEAIEGGETALVGVWRRAPLQ
AIAKLHALAAADLVDDDALGRPRGGAEVGRRLELLADLVTGGTRVPAYVL
AAVAHGDLLTLEPFGSADGVVARAVSRLITIASGLDPHGLGVPEVHWMRR
SGDYRAAARGFASGTPDGLAAWLVFSSEGLHAGAREALSIAQAMGS
392418550YP_006455155.1 HAD-superfamily subfamily IB hydrolase- TIGR01490 [Mycobacterium chMTSPEPATGAFEPAERASQDRPIRTAAFFDLDKTVIAKSSTLAFSKPFFS
QGLINRRAVLKSAYAQFLFLMSGADHDQIDRMRSYLTNMCAGWDVEQVKG
IVGETLHDIVDPLVFAEAAELIADHKLCGRDVVVVSASGEEIVAPIARAL
GATHAMATRMVVEDGKYTGEIAFYCYGDGKVEAIRALAAREGYTLEHCYA
YSDSITDIPMLETVGHPTVVNPDRSLRKEAASRGWPVRTFSRPVSLRDRI
SAPSGAAVATTAAVGVSALAAGALTYSLLRRFAL
392418549YP_006455154.1 helicase/secretion neighborhood CpaE-like protein [Mycobacterium chMTTPEAVLALIDDRILANDVDRVVAAAGLRVVHAAEPSSRRVWLSAAAVL
LDAAAARRCAGRGLPRRARVVLISGEAPGPDAWEAAVCVGAQHVLTVPDQ
DRDLMAVLADAADAARDGGARGAVVAVLSGRGGAGASVFATAMAQAAADS
LLVDADPWGGGLDLVLGSETEPGLRWPDLSLAGGRLSYSALRDALPRRHG
VSVLAGSRVLSGERSSNDIDSLALGAVLDAGSRGGVTVVCDAARRPSPAT
ETALAAADLVVMVTPADVRSAAAAAATAQWVSGGNPNTGVVVRGPAPGGL
RPVDVARIVGLPVLASMRPQPGLDAALERGGLRLGRRSPLAGAARRVLEV
LVRNPHLDQVGEAA
392418548YP_006455153.1 Flp pilus assembly protein- ATPase CpaF [Mycobacterium chubuense NBMSAPLIDRVRERLAAERAALRPSIVAAAIRAESGGVLGDTEVLSSLRELQ
TELVGAGILEPLLCAPGTTDVLVTAPDAVFVDDGRGLRQTSVRFADEAAV
RRLAQRLALRAGRRLDEAQPWVDGHLSSVGGGHPDGPLTVRVHAVLPPIA
AAGTCLSLRVLRPATQDLDALVASGAIDAEADALLREIIASRLAFVVSGG
TGAGNTTTHL
392418547YP_006455152.1 hypothetical protein Mycch_4776 [Mycobacterium chubuense NBB4]MTPQLTRGTSRWPAYAWGVRDRDLIDSELRLVAAVRRTCAEMGDAMPTTV
VLDALLDERNAAAAIRLGERDPRRARKLDGASLRAVE
392418546YP_006455151.1 type I restriction-modification system methyltransferase subunit [MMVRLLSKDPKRTEADVQSDIKALLLQPNFGLEDQQVPKLEVQTEDGTRRR
IDILTGATVVEVKKDLTAAVRKEAEPQLSGYIDNRIELTGGRYNGILTDG
RSWVLYEVDPATNQLAVRSELAINAVGDTDRLVAWLSAVLATDHGLTPTP
RTIEERLGVESPAYAQDHAYLASLYDALHDDPTVSLKRALWARLLRSALG
VGFDAKEGRLFIDHTMLVIEATVIAHALMGFTEEELMADPAAMLAGERFT
EHDIHNAVEAGFFDWLLEHSDGQKFIRQLIRRVAVFDWDKAQHDVLKHLY
ESVVNAATRKTLGEYYTPDWLAEAVIDHTMGDDVLDKRVLDAACGSGTFV
FHAVRRYLAAADAAGHDPSNAIDGAQSHVFGLDIHPVSVALARTTYLMAL
GSRLTGPRGTITVPIFLGDAVQWASDASVAADTIKIPVDAHDLANSAAEP
TLIDIEQTLVFPLSSIDDPGTFDRLTTALTDLAQTVTGKSKRPSAASILS
SFSISPSSDDGKILTETFKLLCDLHAEGRDHIWSFFVRNQVRPLWFSLPG
RKVDVLIGNPPWVSYRHMTEAMQSKFQSFCTQRNLWHGKSLATHQDLVAL
FAVRACELYLKDGGTFGLVTPLAVLDRQQYEGFRAGNWGTYVRGQITEWW
DLEKVRPQPFPVPAGVAFGVHHAYDGVGIGSAAEPPHGSPSTKEAFAGRS
AATWEATEPQLTCTTEPNVGRSVDDTAASPYAAVTRQGANLVPRYLFLVE
RVAGGGKLGHAAGKQPIVSRRSTQEKAPWKDRPDVHGSVEKQFIHTALLG
ESIAPFRLLDPFETVVPVDNGSLLKQSDIDKNPGLAQWWNAVNAEWDEHK
TGQNRAKAVSLTQQADHMGKLTRQLGGAKHRVLYSKSGNTLAAVRTDNPD
HIVDHSLYVVPARNEPEAVYLTAVLNAPAVTAAVAQYQSKGLFGTRHFDK
YVWLLPIPQYNGSDALHEQIVELGRHAEEVAAAVDIPAGTGFQAARKLIR
QALIADGVSGALDTAVGPWLPTPAEIDATAAAVTPLGDEDSTGVDAASEV
LLDGS
392418545YP_006455150.1 hypothetical protein Mycch_4773 [Mycobacterium chubuense NBB4]MAGKPPLRAVKDGETPPAPKKRAPRKAAPRTMAHAAKLSRKTLLETMRDK
LAAAIDDPRAHPRDVAALMKSLEDVLVKLDNLDPKKAAAGMPKTAVAETP
DEPWDQSAI
392418544YP_006455149.1 hypothetical protein Mycch_4772 [Mycobacterium chubuense NBB4]MTTRTRTLSTAHEEHEAFALLDDAIAALSAIAYGNDTDQNTVPVDAVLIV
RVQRDDDDGDRTGHVAVYPRVGAQPASTRALIEKAGKLLDQATADGDAGD
DQPRPAGPGGWTPTPTPAAPPMA
392418543YP_006455148.1 hypothetical protein Mycch_4771 [Mycobacterium chubuense NBB4]MDYRVSARTQARAIEKAADTLGVPLPAGYLEQVAQAQAFADAAAHINGHD
LHAAVFDAIEAGRPYWSDKTVQRLALDHQLASHNIGIKVRTRADELRARA
LADHADNILEGWADALDQQADALVAAAAAVPNIDLRQGHEAATHGGDVLR
HWAAARTGLDAWNAAHQGFYALAAVAGISVKNTGHLALTPARKAELEPAD
DLARDARTEVDAWIIARCGLPLELATLGEFMSRAAQFNADREAEDRAAEQ
QRMERVQKTW
392418542YP_006455147.1 hypothetical protein Mycch_4770 [Mycobacterium chubuense NBB4]MSDTDSDADRRFAHNLFSGTDDDQAPAGKQKQRDRADDGQRDGDDDAEGR
RFAADLFAPDDPEANVLAGLTHGKTVGRWQHPEREPEDRGPWFDRRPPTD
DFFRI
392418541YP_006455146.1 hypothetical protein Mycch_4769 [Mycobacterium chubuense NBB4]MTAVDFDGRRPVVEGQDHAERAAGRARSDRDRRGAQGASGAPLTDTDRRL
ISEAAFVIADAIALLRVSRHRIPLRWLRLLDALNRCLSAGGHRERVDLSA
LKTTKQLAAEWGCDARTVRRKAETAGGRKVNGWIFPEDT
392418540YP_006455145.1 hypothetical protein Mycch_4768 [Mycobacterium chubuense NBB4]MPDWDTMRALLAGIPVLPGAPCKGRSDLFERTIGEHRAAGRLTTTEIDTA
RHEALRLCHDRCPALDACRAYLQALPIAHRPRGVVAGLVITSNGVPMKTG
GVIAGQVVKRP
392418539YP_006455144.1 hypothetical protein Mycch_4767 [Mycobacterium chubuense NBB4]MPDQERLSPTPAGIRADDALKYAAAKLRASLDAESDEPDDEWMAAGSAAG
AANAMRAVLAVLDRALCGDRTRYSDGRFVESTAEFLPAGNGIVHSAQHVW
HPDPAGEEPASSGAALPDDPDGQSLGFFQVMTEPATQQLRAYLVQPWRPD
PTEERTDPHA
392418538YP_006455143.1 hypothetical protein Mycch_4766 [Mycobacterium chubuense NBB4]MIRPIPAAYAGAIDVPCPTCSAEPGAFCLVEDGRRGPRRRRVPCVRRCPP
GPPDVEHQAPAYPTRSFSEPIHPHETQE
392418537YP_006455142.1 hypothetical protein Mycch_4765 [Mycobacterium chubuense NBB4]MKRPDFLQPLTADIGRVGDRGANILALVRYVTAHTEEIDGRKWLDDGEMW
WRATREDIGDALGGVSEKSVGGALRKLEDAGELLARPAKSFHGDRAKMYR
VPNMPQQGSDVPSDENGTGSDLPSDENAPPIGRNRPTPWDENVRPPGTKS
SDLPPIEELEEGEKARAAEPEPLDVKPVPDPDNAHPSQTVNGNSDSNATS
PPSPYCARHPNGTTTNCAPCGVARKQREAWDQELAAVIDAERAAIRAEIS
ACPDCDQNGLTEPEEGPTRRCTQHRQLADLPAVRRAS
392418536YP_006455141.1 hypothetical protein Mycch_4764 [Mycobacterium chubuense NBB4]MDARQFDGFALVDWARSACLCDVGAPGHSLAVAVTDDGRDVLWLIDDAEL
HAEHPRHGDSRQPHEQVGPLPERWRERVAWSAAFRCGRPTKSGRPCKLPV
DQAGGSCSFHRAANPDAERQAAS
392418535YP_006455140.1 hypothetical protein Mycch_4763 [Mycobacterium chubuense NBB4]MPQDIAPSVAKFRAQIAGLSRDRAPDDPELAEARQNLRAAKLEAHIEKAV
AEASPLTDQQRDRIVAILRSGA
392418534YP_006455139.1 hypothetical protein Mycch_4762 [Mycobacterium chubuense NBB4]MPVDIYCDGRRAAGQDAKHDPWLVARWVRIDGEWARTGRVADAGAQPRFL
KGQLAQLIQDGSPIESVDDWRPDARARYPMKCPRCRFDVVVTKSPKFVEF
LDAHEPEGTPSPLLSEMVASLR
392418533YP_006455138.1 site-specific recombinase- DNA invertase Pin [Mycobacterium chubuenMGVRAAIYVRISQDRDGTRLGVERQEQDCRKLAHTLGLDVRSVLVDNDIS
AYSGKRRPQYEALLADVEAGALDVVIAWHPDRLHRSPLELETYIDLSERF
AIQTHTVQAGAWDLSTPSGRAVARTLGAWARYESEHKGERIRRARQQQAK
AGGWHGGIRPYGFEKDGVTVRPSEAAEIAKATEAIVSGVSLRSLVRDLNE
RGIPTATGRGPWTSVALKDTIMRPRTAGLSSYHGEVVGPAVWAPIVPEDT
WRAACSILSDPARRTNGGRGGTVRWLGSGLYVCGVCNEAQLRVGTGGSVK
RNTYRCGNRNIRDGGSHVTREAGSLDAYVEEVIVRRLSEPGLLDRFLTAD
PEQDTTATRVELIAVRERQDDLAGLFAAGQITARQLAVGTEQLAAKEDQL
AKALASAGRRNPMQMVAGAKDLRALWFGTDEARSDGLTLGQRRAILDVLM
TVTVVPAPRTRGGFDPEYVRIEWKA
392418532YP_006455137.1 Flp pilus assembly protein TadB [Mycobacterium chubuense NBB4]MIGAALALAFAVLVSPDTARARVTVLMPALGKRRAVPGTWCAVVVWAALA
LVVPVTGVLAAGVLGATVLSRRRLRRRASVRVAEAAALQGALDLLVAELR
VGAHPVGAIEVAAAEADGQVAESLNAVAARALLGADVAAGLRAEAQRSTS
PGHWNRLAECWELAQRHGLAIATLLQAAQRDIAERERFRGRVEAGMAGAR
ATAAILAGLPALGVLLGHAIGAEPVRFLLSDGAGGGFLVVGTVLICCGLL
WSDRITSRVLA
392418531YP_006455136.1 Flp pilus assembly protein TadC [Mycobacterium chubuense NBB4]MSWAAVLLAAAVLAVPRVSSTRAHRVSPRAHDSRGPAVANDNLAVAASLD
VLAACLRSGMAVSAAASAVSAAAPAPMAAVLSRAADLLALGADPARAWAG
PDDSTDSAMQAFARMARRSAASGTALAHGVEDLAVQLRGEAADAASARAE
RASVLIAGPLGLCYLPAFLCLGIVPVVAGLAGEVLQSGVL
392418530YP_006455135.1 hypothetical protein Mycch_4757 [Mycobacterium chubuense NBB4]MLRERCRDLRDRVIVLAVADDGMSTVEYAIGTIAAAAFGAILYSVVTGDS
IVSALTNIISRALNTNV
392418529YP_006455134.1 helicase/secretion neighborhood TadE-like protein [Mycobacterium chMGDERGSATVLAVMMVLVLVAVTTGAAMVGSAVVARHRAQAAADLAAVRA
AAQVSSGPAVACATAKTVAEAMGAALTGCTVEELDVVVRVGVAAQLRGIG
SADAVARAGPAHRE
392418528YP_006455133.1 serine/threonine protein kinase [Mycobacterium chubuense NBB4]MSGREVLVGRYELRGVLGHGGMAEVRDGWDTRLCRPVAVKLVHPTLVSQP
DIRRRFADEARSAAVLEHPNIVAVHDFGDHDGTPFIVMERLPGHTLGDVM
AQGPMAPQQVRAMLDDVLSALAVAHGAGVLHRDIKPGNILVSASGDRLKV
GDFGIAKTGGAAATATGQIIGTMCYMSPERVAGAPASVADDLYAVGVIGY
EAVTGRRAFPQDNPLAVARAIMDDPPPPLAVCCPGLDPALAAVIDRAMAR
DPAQRFGSADQMRAALAGGAAPRPATRVLTQAPVPLTGYPVAPVRRPRRP
NTARGYLAAAAIVAAFLVSILTVAVIGRSSPPTPEPISTSTSVPAPPPTT
TPSPPVPAASSTVEQPAPQPAPPKKRPGNGHGRGHGD
392418527YP_006455132.1 hypothetical protein Mycch_4753 [Mycobacterium chubuense NBB4]MAHDWMLVETLGGEPAVVAEGAHTRNLLPISTVLRRNPHLMAIQTAISET
VRARTGLSSITPKNDRVIRTEVVQMSDGDIHGVQIWVGAADVEPPPRPLV
GPLLWDLTAGTATDTRESLEVGGWDPARQSTHGRAFADDLPRRDLNSNEA
TVLRMVIRPEPGVTICDTWDVTDFRGEQITVGFVARSMPEVAEDGTERLI
CRAMNWRSVREGPDLDGDVPSQRVLDKLARPGVYRALIDLRHWTLLKWLD
EPAPLFDWRAGLAGERTVHPDDKGAMAAMAGEFADGTTSGVLRMVDRDGA
WTPVHVSLHRVELDDGVHAGLAALREPTRDELAAAEMGGRGARVSRTRKS
RSRKDNGKA
392418526YP_006455131.1 helicase/secretion neighborhood putative DEAH-box helicase [MycobacMRDAASDFGRELLGCAVDGVAAGEEPLRHVADLPPRRAKTQPWPHWTAPD
VVRAFHDRGVEAPWSHQLVAADLAHNGRHVVVSTGTASGKSLAYQLPILT
ALTNNPRARALYLSPTKALGHDQLRAAAALTSSIPGLMDVAPTAYDGDSP
AEVRRLARERSRWIFSNPDMIHLSLLRNHARWAVFLRHLRYVVVDECHYY
RGIFGSNVAMVLRRLLRLCARYSPAGAESAAGPTVIFASATTSEPAITAS
ELIGQSVVEVTEDGSPQGARTVALWEPALIDDLVGENGAPVRRSAGSEAA
RVMADLVAEGARTLTFVRSRRGAELAALSARARLADTAPALAEQVASYRA
GYLAEERRALERALAEGELRGMATTNALELGVDIAGLDAVVLAGFPGTVA
SFWQQAGRAGRRGQGALVVLIARDDPLDTYLVHHPAALLDKPIERVVIDP
ANPYVLGPQLLCAATELPLTDAEVRMWDAEAVADALVDDGLLRRRPSGYF
PTPGVDPHPAVDIRGSTGGQIAILEAGTGRMLGSSGSGQAPAQVHPGAVY
LHQGESYVVDSLDFEDGIAFVHAEDPGYTTFAREVTDITVTGPGRRHDHG
PVTVGLVPVSVSNTVIGYLRRRLDGEIIDFVELEMPTRTLETMAVKCTIT
PEALLRNGIDPLRIPGSLHAAEHAAIGLLPLIASCDRGDIGGVSTAVGPV
DGLPTIFVYDGYPGGAGFAARGFGTMADWWEATASAIEACECPTGCPSCV
QSPKCGNGNDPLDKDGAVKVLRLVLDALGAPERLRRAQ
392418525YP_006455130.1 cold shock protein [Mycobacterium chubuense NBB4]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAV
392418524YP_006455129.1 hypothetical protein Mycch_4750 [Mycobacterium chubuense NBB4]MHCRPRQARRPGNTSVRAGCLTVFRVSQLSFFSAESVPPAIADLTGILAA
HGQAVLVGAGQEQAARLSVVVDRMWRAEGLAEMIAEAGLQPEIARTDERT
PLVRTGVDARLVGIAADWTRGAVKTVPPQWLPGPRELRAWTLAAGAPEAD
RYLLGLDPHAPDTHSALASAMMRVGIAPTLIGTRGSHPALRISGRRRLSR
LVENVGEPPEDAEALSQWPRI
392418523YP_006455128.1 DNA topoisomerase I- bacterial [Mycobacterium chubuense NBB4]MADRDRASGGNGVDEPRARRANGNVRRLVIVESPTKARKIAGYLGSNYIV
ESSRGHIRDLPRAAADVPAKYKSEPWARLGVNVDEDFEPLYIISPEKKST
VAELKDKLKSVDELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEIT
EPAIRAAAEDPRDLDNDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSA
GRVQSVATRIIVSRERERMAFRSAGYWDVTAELDASVSDAQASPPTFTAK
LNTVDGRRVATGRDFDSLGAVRKPDEVLVLDEAAANALATGLRGAQLAVS
SVEQKPYTRRPYAPFMTSTLQQEAGRKLRFSSERTMSIAQRLYENGYITY
MRTDSTTLSQSAIDAARNQARQLYGEEYVHPSPRQYTRKVKNAQEAHEAI
RPSGDGFQTPGQLHAQLDTDEFRLYELIWQRTVASQMADARGTTLSLRIA
GQAGTGEQVVFNASGRTITFPGFLKAYVESLDDQAGGEADDAESRLPNLT
QGQRVDAKELTADGHTTSPPARYTEASLIKALEDLGIGRPSTYSSIIKTI
QDRGYVHKKGSALVPSWVAFAVTGLLEQHFSRLVDYDFTAAMEDELDEIA
AGHERRTNWLNNFYFGGEHGVDGSIARAGGLKKLVGGNLEEIDAREVNSI
KLFDDAEGRAINVRVGRNGAYLERMVLDEDGELKPQRANLSDDLTPDELT
LELAEKLFATPQEGRSLGVDPETGHEIVAKDGRYGPYVTEVLPEPPGDEG
EAGSPAKKGKKPTGPKPRTGSLLRSMDLETVTLEDALKLLSLPRVVGVDP
ANGEEITAQNGRYGPYLKRGTDSRSLATEQQIFDITLDEALKIYAEPKRR
GRQGAATPPLRELGNDPVSGKPMVIKDGRFGPYVTDGETNASLRKGDDVL
SITDERASELLADRRARGPVKRTKKAPAKKAAKKAGAKKAAKKA
392418522YP_006455127.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MAAEAIETGRISAFVRWVARTPWPVFTLGMLQADVIGALLVLGFLRFGLP
PEDRIQLQDLPAYNLAIFLGYLFVSFTVASYLTLRMLIPVMRWQRRDMLL
GDRDPADTEVARMRALKMPFYRSVISATNWLLGSVVFIIASWPVASKSAP
VVAVATGLGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVILRQ
VLTWVLSTGVPVLAIVLALVASKFQVLTAPADRVITTILLLAIVALVIGL
SSTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLAERQRLRDLFGRYVGEDVARRALERGTELGGQEREVAVLFVDLVG
STHLAATIPAAEVVSLLNDFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDASGAALAASRELHDELIEVLGETDFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEKGHVLASAVAVSDALDAEALCWDVGETV
ELRGRTAPTQLARPLNLMTPASADREVTSDASK
392418521YP_006455126.1 DNA polymerase III- delta'' subunit [Mycobacterium chubuense NBB4]MPGVFTRLVGQDAVEQELTAAARAARGDSDHSVGAGEIGTMTHAWLITGP
PGSGRSVAALCFAAALQCTSGGVPGCGECRACTTTMAGTHADVRRIVPEG
LSIGVDAMRAIVQIASRRPGTGRWQIVVIEDADRLTEGAANALLKVVEEP
PPSTVFLLCAPSVDPEDIAITLRSRCRHVALVTPPVDAIARVLVESDGLP
ERDAAWAASVSGGHVGRARRLATDEQARERRLRALGLAQDAATPSRAFAA
AEELVATAEAEAKALTEGRNESEAEELRTALGAGGTGKGTAATMRGAAGA
LKDLEKRQKSRQTRASRDALDRALIDLATYFRDGLLVSSGAGAVAPSHPD
MVDKVAALAGHASPEALLRCIEAVLECREALAVNVKPKFAVDAMVGTVGR
ALRG
392418520YP_006455125.1 protein of unknown function DUF222 [Mycobacterium chubuense NBB4]MYVRVMVLGDLQGAVTALLGAFDEVADCEVDLATSTELVGVLDELETLWC
RLPAVRHRLLARLQTETTPQQLGAKSWKDALAIRWRISTSEAHRRLTDTA
LLAPRQAVTGPSLPPVLPATAAAQAHGLINGEHVEVIRKAVHRLPGFVDT
ATREQFEVDLVRLAVGVGPKELHDTAERTLFLLDQDGPEPDDTERARTRA
VVKHKQRRDAMTDLTATLNPQAWAVWEAIFAKYAAPGMCNPDDPHPCTTG
TPTQAQIDNDHRSLAQRQHDALLAAGRIALMSGQLGRLNGLPVSVIIRTT
LKDLESRAGIGVTGGGSVIPIADVIRMAGHANHYLAVFDHATGSALNLFR
AKRIATPAQRIMLIARDGGCTKPCCTVGAYGSQVHHVTTDWAAGGNTNLD
DLGLACPPDNRSVTPDGWTTHMNNHCEVEWTPPPHLDTGQTRLNYHHRPE
KLLRPPDQAESPPHNSTAEAASGEPTPDGPHRDDAFDPRPTDNTDHPGGP
APPDDQAA
392418519YP_006455124.1 hypothetical protein Mycch_4744 [Mycobacterium chubuense NBB4]MTSVRRLARRERERFADLLTGLTAEQWAAPSLCPGWSVRDVAAHTIGYLD
QSRIALLVNMIRSRGDVDRLNARLLPAYAALTPTRLVELMHRNARSSGAG
ALYGGRVALIECVVHQQDIRRPLGLSEPVSEDALRASLNYARISPVIGGA
RRIRGKRLVATDMEWSAGRGPELRGPGEALLLAMTGRLDAVRGELAGEGM
PRR
392418518YP_006455123.1 uncharacterized protein- gamma-carboxymuconolactone decarboxylase sMTDVREEGYRVFREMLPDALPEGGLPRGGFGDELLEIGIDNVFGRLWARE
GLSRRDRSLVTMGILIALGAHDEFGYHVQIARTNGLTDDEIAEVIYHSSG
YAGFPAANTACRIARQVLEG
392418517YP_006455122.1 hypothetical protein Mycch_4742 [Mycobacterium chubuense NBB4]MKARPNAFVDGLNSRDPKDVDLLRNISAVPGAEKGKAHIDQNIVAVSSLH
ET
392418516YP_006455121.1 hypothetical protein Mycch_4741 [Mycobacterium chubuense NBB4]MRADERLREEQVMNERLRKEQSNWVARAAVALIALQLIIRAVLAFGGYFY
WDDLILVGRAGTQGLLSPGYLFDDHDGHVMPGAFLVAGAITRLSPLNWVG
PAISLVVLALLASLALLRALHVILGWRPVLLVPLTFALFTPLAVPGFAWW
SAALNSLPMLTAMAWVCADAILLVRTGRQRYAVTGTLAYLCGLLFFEKTA
IVPFVAFTVAALYGHVTSSASVREIWRRGMRLWVVSLALTAGWIGVYLLV
VDQQRWSFDLPMTWDLLSRSFTHGIVPGLVGGPWDWQRWAPASPWATPPV
AVMVLGWVALGCVVAVTLVRKQRIGPVWGAALAYAVACQVPIYLMRSSRF
TALELAQTLRYLPDLVVVLALLAAVGLCAPNRPRRGWLDAARRRTVVTVC
LAVVFVASCLYSTATFLTSWRDNPAQPYLQNARAGLAAAHAASDAPMLDQ
EVDPLVLQRVAWPENLASHMFALLPDRPEFTSATSLLRMLDPAGNLVDAK
VTWVRSIRPGPAPQCGYLVQPDFPVRMPLDGPLLPADWTAEINYLANSDG
SMMLSLSEGPEVKVPVRPGLNRVYVRLPGAGDAITVRANTAALSVCVAAG
PVGFVAPR
392418515YP_006455120.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMRTLVTGAAGFIGSTLVDRLLADGHSVVGLDDLSSGRSENLGAAERSDDF
EFVKADIVDADLVALLAEVKPEVVFHLAAQISVKLSVDDPAFDSSVNVVG
TVRLAEAARRAGVRKIVHTSSGGSIYGVPPGYPTNEDMPVDPTSPYAASK
VCGEVYFGMFRNLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLAG
RPTKIFGDGSDTRDYVFVDDVVDAFVRASGDAGGGQRFNVGTGVETSTRE
MHTEIARAAGAPDEPDFQPPRLGDLRRSCLDFSRAESVLGWRPQVALADG
IARTVAFFRDRG
392418514YP_006455119.1 hypothetical protein Mycch_4739 [Mycobacterium chubuense NBB4]MNWIQVLLIASVLALLVYLLRSRSNARSKAWVKVGYVLFVIAGIYAIVRP
DDTTVIANWVGVARGTDLMEYVLIVAFAFTTLSTYMRFKDIELKYARLAR
AVALQNAQAPEQG
392418513YP_006455118.1 glycosyl transferase [Mycobacterium chubuense NBB4]MLRIGTSDTRYQDVWIVIPAYREATVVGDVVAEVRAVFPHVVCVDDGSDD
RTGAEALRAGAHVVTHPVNLGQGAAIQTGVEYARRQPGAAVFATFDADGQ
HRVADLVRMIDRLRASGVDLLVGTRFAGAASTTPPVKKAVLRAAARLSPR
NRRLGLTDAHNGLRVFNRRVAEQLEITINGMGHASEFIALAHENHWRVGE
EPVDIVYTDYSKSKGQPLLNGVNIVFDGLLRKRTTR
392418512YP_006455117.1 hypothetical protein Mycch_4737 [Mycobacterium chubuense NBB4]MTDATAGPSGAVTRGSVVRVGAATGVSALCGYAVLYLAARDLAPAGFSVF
GVFWGAFGLASGAAFGLLQETTREVRNRRTAPHGGEQTRPMRVAAGVGLA
AAVLIAVSAPLWSAHVFAADGLLSVALLSLGLAGFCLHTTLLGLLAGLDR
WSGYGALMVTDALARVAVAAVTFAVGWGLGGYLWATVAGSVGWLLMILVS
PATRAVARLSTPGGTGAFLRGTGHSIAAAGASAVLVMGFPVLLKATSGDL
GAAGGVVILAVTLTRAPLLVPLTAMQGNLIAHFVDQRAHRLRALVTPAVL
VGVLGAVGVTLAATFGPWLLREAFGAQYQAAGALLGWLTAAAVAIALLTL
TGAATVAAALHRAYATGWVSATVASALLLLLPVELEVRTVVALLCGPLIG
IAVHLAALAQVHAV
392418511YP_006455116.1 aminopeptidase N [Mycobacterium chubuense NBB4]MTGRRRAAKKGAPPVIDPYLPATGNFGYRVSRYELDLEYKVAINRLHGSA
TITAVTLAELKTFTLDLSDALSVSKVTVNGKRPAQFKTSGGKLHISLADR
LPAGAAMTIAVRYGGTPRPIRSLWGDVGFEELTEGVLVAGQPNGAASWFP
CDDHPSAKASFRIEIATETPYFAIANGKLLSRRARAGMTTWTYEQVEPTS
TYLITLQIGAYGRHRMSKNGVEIFSVLPDRLREDFDHDFGRQPQMMKLFV
KLFGPYPLSTGYTVVVTDDDLEIPLEAQGISIFGANHCDGRRGSERLIAH
EMAHQWFGNSVTVQRWRHIWLHEGFACYAEWLWSEHCGEESADELAAHYH
QRLTNAPQNLVLADPGPRDMFDDRVYKRGALTLHVLRRQIGDDNFFALLK
EWTARHRHGSVVTDDFTGLAAHYAEVSLRPLWTAWLYSPEVPPLDAWA
392418510YP_006455115.1 amino acid adenylation enzyme/thioester reductase family protein [MMTAADPTPQIPDQYVLSSSAPQARTLIDILYETARRHPDAPALDDGTVQL
TYAELIADVEDSVAWLAARGIGRGDRIGIRMPSGSYALYVAILATLATGA
AYVPVDADDPPERAELVFHEAGVVAIITERGLVRGPGSSRGWRATAPLSR
DDAWIIFTSGSTGTPKGVAVTHRSAAAFVDAEAQIFVRDAPLGPGDRVLA
GLSVAFDASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDITVVS
TVPTLASLWPAEALEAVRLLIFGGEACPPELAGRLAVDGREVWNTYGPTE
ATVVACAARLTGSGPVSIGLPLPGWDLAVVDGQGEPVGMGEVGELVIGGV
GLARYLDQDKDAEKYAAMPSLAWSRAYRSGDLVRLEFDGLYFVGRADDQV
KVGGRRIELGEVDTALVHLPNVTGGAAAVRRTPSGTPLLVGYVVVAPGAA
FDVADARARLSATLPAALVPRLVVVDELPTRTSGKVDRDALPWPVRGSGA
DEGHGTELGGTLGWLAGLWQEVLAAPVDGPEADFFALGGGSLSAAQLVAA
LRKRYPQVTVAELYDHPRLGSLAGYLDELAPPPEVQTRDVTPVPRLTQAV
QVALTVPLAVLTGIQWIVWLAVANNLAAQMHLVPWARPVSWWWILAGFLV
FVSPPGRMAIAAFGARVLLGNLAPGTYRRGGSVHLRVWLAERLAAASGAE
NMAGAPWLVYYARALGNSVGSGVDLHSAPPVTGMLTLGHRCSIEPEVDLS
GHWIDGDSFHVGPITVGNDATVGARTTLLPGAVVGKNADVAPGSGVVGKV
KNGQYWKGSPAVKSGKAKHPWPDHRPPRAPLWVAVFGITSLLLGALPVTA
LAAGLAVIGWGVRGTASLSAAIVPALVWLVPATAAAVAVYAVLTVLGVRL
LSIGLDEGYHPVRSRPGWQLWATERLMDAARNYLFPVYAGLLTPWWLRLL
GAKVGRGTEISTALMIPKFTVVEDSAFLADDTMVASYELGGGWIHVARAT
VGKRAFLGNSGITQPGRRVPDDGLVAVLSATPHKAKAGSSWLGSPPVRLR
RQPTAADALRTFHPSSRLKALRATVETFRFVPVVVTFALGVAVFFGVQAV
AVSVGWAWTIPAAGLILLAAGAVAGGVAVGAKWLVVGRITAIEHPLWSAF
VWRNEVSDTFVETVAAPWFARAATGTPVMNLWLRGLGAKIGRGVWCETYW
LPEADLVTLGDGATVNRGCVVQTHLFHDRIMRMDTVVLESGATLGPHCVA
LPAARLGAGATVGPASLVMRGDEVPPSTRWQGNPIAPWYPPRKKRDASPE
PKRKKPAAA
392418509YP_006455114.1 integral membrane protein- TerC family [Mycobacterium chubuense NBBMNVSALEWGITLSVTIAILLFDVVVIGRRPHEPSKRETGIALTVYIGLAV
AFGLWTLFFHGHQYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRVYQ
QQALLVGIILALIFRGIFIALGAVAIEQFSWVFYIFGAFLVYTALKLVRD
SDHDDDGDNAVVRFAQKRLKFTDNWDGVKLWVKENGSRLMTPMFLVIVAL
GTTDLIFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDMLKRL
VYLSQGLAFVLAFIGVKLLLHALHENEVPFINGGEPVAVPEIPTLLSLGV
IVVTLFITTVASLYKTRVHDVRKNDEEPESADPAPDPQTDSTR
392418508YP_006455113.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium cMSVNDVVHGHCDARFERLADALAEELAAGEELGASIAVDIGGELVADIWG
GSADRAKTRPWQRDTIVNVWSCTKTLTAMAALILVDRGALDPFAPVADYW
PEFAANGKRHIEVRHLLSHTSGVSGWQTPFPVERIYDWAAATAHLARQQP
WWEPGTASGYHAMNYGHLVGEVVRRITGKSLKEVVREEISEPLGADVQIG
ARTEDFGRIAELVAPPARDLHLDRLPPDHPAVLTFAAFPPGAYGVAVAET
PQWRQADIGGANGHGNARGLVRALTPISLGGSAFGVDLLSPETVELIFTE
QSNGVDQVLFEPLRFGIGFGLPTPRSVPAVPDGRVCWWGGWGGSLVVMDL
DRRATFAYVMNKMGPGTTGNARTNRYARLVNAALEDARA
392418507YP_006455112.1 hypothetical protein Mycch_4732 [Mycobacterium chubuense NBB4]MLCASDHDGVFLHQGIGLQAFNAMPMRRAVHAVYECCYSVPLAADLARAR
PFESHDALFRLADSLLFGLGEQSIDSILQAYPDVGRRPGSEKSQAEQCAI
ADERPEVMAELGGASKAYLEHFGFGFVMFVNGYRADDVLATMRDRLHNDY
ETERKIVRNELARINRTRLERMLGPEGGYDNW
392418506YP_006455111.1 inorganic pyrophosphatase [Mycobacterium chubuense NBB4]MQFDVLIEIPKGSRNKYEVDHETGRVKLDRYLFTAFGYPADYGYIEDTLG
EDGDPLDALVLLPEPVFPGCIVEARPVGMFQMTDEQGGDDKVLCVLADDP
RWEHVRDLSDISDFELDGIRHFFVHYKDLEPGKFVKAADWVGREAAEAEV
KRSIERFKSAGH
392418505YP_006455110.1 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) MRPTRWRRSTYAVVGVVVVLVIAAVVTAAALLANRPTPQKVAVEPAPAPA
TARPGVVPVSDTADEPTPAGLAAALAPALADPNLGKFTGRVTDAFSGQEL
WAQGAHVPMQPASVNKVLTTAAALLTLDRDARLTTRVLSTSPGVVVLVGG
GDPTLSAAPRGQDTWYRDAARIVDLADQVRRSGVAVRTVQVDVSAYSGPT
MAPGWDPLDIDGGDIAPMESVMLDGGRTQPVSVDSARSRTPALDAGRALA
VALHVDPATVTVLPSAATGKEIASVQSPPLMERLRDLMNASDNVMAESTG
RQVAAALHRPQSFDGAVGAVLNALERADIDTGGVHLVDSSGLSVDDRLTA
LTLDGVVNAAAGDTEPKLRPLVDLLPIAGGSGTLSNRYLDTAAGRAALGF
LRAKTGSLTATNSLAGVVTDASGRVLTFALLSNEAGPSGRTALDAVAATL
RSCGCRT
392418504YP_006455109.1 putative hydrolase/uncharacterized protein- coenzyme F420 biosyntheMSPAAKSSFSVGRAVDWNLAATVGGKLARPEPPATDYTRNQAIDQLTEAA
RAAEIPVREVTGLSEGGEIPEARILNRPDWIRAAAQSMRAMTGGDGEGRP
GVISGRIAGAQTGAVLAFVSSGILGQYDPFAVGGGELLLVYPNVIAVERQ
LHVAPADFRMWVCLHEVTHRVQFRANPWLAGHMSGALAVLTEDVADDVTH
VAGRLAEYVRDRRKHADDEASEPNSTGVLGLLRAVQSEPQREALDRLLVL
GTLLEGHADHVMDAVGPAVVPSVATIRHRFDQRRQRKQPPLQRLLRALLG
IDAKMAQYTRGKAFVDDVVTKVGMARFNAIWTSPETLPLPHEIDEPQRWI
DRVL
392418503YP_006455108.1 tRNA(Ile)-lysidine synthetase [Mycobacterium chubuense NBB4]MDRPGAVAQLRAAVTRFVGDHDLRDDRWCVALSGGPDSLALAAVAATVLP
TTALIVDHGLQPGSAAVAAAAREHALAVGCVAVQVIRVQVGAEGGPEAAA
RTARYRALEQARGGVPVLLAHTLDDQAETVLLGLGRGSGARSIAGMRPVD
PPWYRPLLGVRRALTHAACGELGLTAWQDPHNTDPRYTRARLRTEVLPLL
EDVLGGGVAEALARTATALREDTDTLDAMAEEFLAGAGAGLQPATLAPLP
PALRRRVIRGWLLAGGATGLTDKQIRAVDALVIAWRGQGGVAVGSAHPGQ
RLFAGRRKGVLMLYREPV
392418502YP_006455107.1 hypoxanthine phosphoribosyltransferase [Mycobacterium chubuense NBBMTYAVGVPAHTAELYPGDIKSVLLSEEQIRSKTTELATQIADDYRDAVTG
TGEQDLLLITVLKGAVMFVTDLARAIPLPTQLEFMAVSSYGSSTSSSGVV
RILKDLDRDINDRDVLIVEDIVDSGLTLSWLLRNLATRRPRSLRVCTLLR
KPDAVRADVDISYVGFDIPNEFVVGYGLDYAERYRDLPFIGTLEPKVYET
F
392418501YP_006455106.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMTRTALRICPFCEATCGLTLTIDDGRVTGARGDRDDVFSAGYICPKGASF
AELDNDPDRLTAPLVRRDGVLVEATWDEAFAAVAEGLGAAVRDHGGASVG
VYLGNPNAHTVAGALYPPLIIRGLGTHQVYSASTLDQMPKHVSLGLMFGS
PVAFTVPDLDRTDYLVIIGANPLVSNGSVATAADFGGKLRRLRRRGGRLV
VIDPARTRTAELADRHLAPRPGTDAALLFAVVHVLFDENLVDLGVLAEHV
AGLDKVRALAGDFAPETVGPYCGVDAAEIRALARELAAAPTAAVYGRIGT
STVEFGTLGSWLVDVVNILTGNLDRPGGAMFPLSPVAPAPRGHRPGRGFA
TGRWHSRVSGHPEVLSELPVAALAEEIETPGDGQIKAMITIAGNPVLSAP
DGNRLDRALAGVGFMLSIDPYLNETTRHADVILPPPPPSRSPHFDFALNG
LAVRNNARYSPPVLPLDGRPDEAEILSRIALVLYGIGYDADPALVDEQVI
ATTLAKETGDSSSPVAGRAVDELTAMLPDGPGYERRLDMMLRLGAYGDVF
GARPEGLTLERLKAAPHGIDLGPLQPRLLDVLRTPSGRIELAPPQLVDDT
ARLRAVLGDRAGGFVLIGRRHLRSNNSWMHNLPALAGGTNQCTVRMHPDD
AAELGVSDSVVIKGPAGELVVPVEVTDGIRRGVVSLPHGWGHDRGGTGQK
LAARQPGANVNQLNDGSVLDPLSGTAVLNGIPVVVEPVG
392418500YP_006455105.1 hypothetical protein Mycch_4725 [Mycobacterium chubuense NBB4]MPIPARAKTSGLKLAAAAAVGGTAMMLAGCDSQSGPTLQPSADTRQVTVV
GAGQVQGTPDTLTVNASMEFIAPDATTAMNQTNERQQAVIDGLAAMGIDR
KDIATTRADLQPQYGSDNTSIAAYRATNSINVKIRDLNKASNAIGLVVGT
GGNATRINSISYSIEDDSQLVKDARARAFEDARDRASQYAQLSGLNLGKV
ISISESGGETPPVPMPAAGPRAMEAAVPLQPGQQTVSFSVTVIWQLD
392418499YP_006455104.1 transcriptional regulator [Mycobacterium chubuense NBB4]MKLATTDRATGKKPTLDRAKMLAAVRSAFVDVGASASMHEIAQSSGIGVA
TLRQEFGERDALVTAVLDDILSVLRDDRDDGDQTPRNRKSRRLRRPRLRH
AVPPLAVLAALLPVGASPSVAAAASEPVPIPGPSASVLTVSPLWPVMPIN
GALSGSMCATNTCAPLQYVPFMTGLGVAALNAQLSDTTSIVSKAGPGDPT
VVFAFSNGAVVAQKWMEEHAGDPTAPSPDQLSFVFIGNPRRAYGGSLPVM
PPSDYPVIDIVQQYDPVADFPDHPNLLALLNIAAGNVSPLHLDYSKVDLQ
DPNNVVWTEGNTTYVFVPTENLPLLAPLRMMGMTKLADELNAPLKKIVEQ
AYDRPYLPSPTEPAVPANEPTASTDSASTRTLATTRTVAAPAVQARTTGT
DTTETKTAGADTTETAPADADTTQTKSPTETKPARKWGVKNRADNETSSS
TDGSTDSRPARHRWGAKARAGSDDTAKGDAAKSDTAGRHAAAAAGRKGSD
SPSS
392418498YP_006455103.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMVVLCHGFPQLAYSWRHQIEGLAEAGYHVLAPDQRGYGGSDKPADVDAYT
VVELSADVVGLLDDVSAQQAALVGHDFGAVVAWTAPLLHPARFSAVVGLS
VPPVPRPRIPTTQAFRRVFADRFFYILYFQQQGPADAELNRDPAKALRHL
FADPPTGDPEAASRMADPGPEGLLGRLGEPGGPPDWLSQADFDVYVKEFT
RGGFTGPLNWYRCFDRNWELTAHPTARTIGVPAMFVGGSADPSLIHTPRD
RVREVVTGNYREVMIEGAGHWLTEERPHSVTRLLRDFLEV
392418497YP_006455102.1 membrane protease FtsH catalytic subunit [Mycobacterium chubuense NMSMNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTSVAMAQISSD
NVNSAQIDDREQQLRLELKNGNSDTEDSTKIITKYPTGYGVPLFDALQAK
KAKVNTVVNQSSILGTLLIYMLPLLLLVGLFVMFSRMQTGGRMGFGFGKS
RAKQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKG
VLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLF
EQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGD
RQGVILIAATNRPDILDPALLRPGRFDRQIPVANPDMAGRRAVLRVHSQG
KPIAPDADLDGLAKRTVGMSGADLANVINEAALLTARENGTVITGPALEE
AVDRVVGGPRRKSRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTIL
ARGRTGGHALAVPEDDKGLLTRSEMIARLVFAMGGRAAEELVFREPTTGA
SSDIDQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSH
EVAQIIDDEVRKLIEAAHTEAWEILTEYRDVLDILAGELLEKETLHRAEL
EAIFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPVPE
PAFKTAIAQASKAAAEAAGKNGTNGSHAAAPPNGPTQPDYGAPAGWHAPG
WPPPPGSPPQHGGQPPHGYWYPPSGWQGAPPMPPGGAPAQYPPYQPYQPY
PQQQPGQHTAPPAGSNDEPGHDKGRDNGRADN
392418496YP_006455101.1 GTP cyclohydrolase I [Mycobacterium chubuense NBB4]MTRSHNHSATITTPEFDQARAEAAVRELLIAVGEDPDRHGLVDTPARVAR
AYREIFAGLYTDPDDVLNTTFDEQHDELVLVKDIPMYSTCEHHLVSFHGV
AHVGYIPGHDGRVTGLSKLARVVDLYAKRPQVQERLTGQIADALMRKLDP
RGAIVVIEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKASRAEALDLIL
RK
392418495YP_006455100.1 dihydropteroate synthase [Mycobacterium chubuense NBB4]MGVVNVTDDSFSDGGLFLDRDRAIEHGIELAAQGAAIVDVGGESTRPGAT
RVDPAVEIARVLPVVEQLARQGITISIDTMHARVALAALEAGAQIVNDVS
GGKADPDMARVVADAGVPWVLMHWRSVGSDTPHAVPAYRDVVAEVRDDLM
ACVDAAVEAGVDPAKLIIDPGLGFAKTAQHNWALLRALPEFVGTGMPVLV
GASRKRFLGTLLAGADGEPRPPGGRETATAVISALAGWHGVWGVRVHDVR
ASVDALTVVAAWSGTERHV
392418494YP_006455099.1 dihydroneopterin aldolase [Mycobacterium chubuense NBB4]MSDRIELRGLRVRGNHGVYDHERRDGQEFVVDITVWVDLHAAAASDDLTD
TLDYGALAQRAADVVGGPPRNLIETVAGEIAEDVMRDERVHAVEVVVHKP
SAPIPLDFADVAVVARRSRRGGRGAAP
392418493YP_006455098.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinaseMTTVVLSIGSNLGDRMARLQSVLDGLGHAVVAVSPVYETDAWGGVEQAPF
LNAVVIADDPALDSHGWLRRAHELEDAAGRVREQRWGPRTLDVDLVAVRD
GGVEVISHDDALTLPHPFAHVRAFVLVPWLAVDPEATLTVAARRRRIAAL
LDDVDASERAGVRPTDLRLRVGTEH
392418492YP_006455097.1 Protein of unknown function (DUF3180) [Mycobacterium chubuense NBB4MGPTRKRDLLAAVVVTAVAGYLLVRMVYRWFPPITMWTGISLLGVAVAVA
GWGFFVRARIRDGEIGVGRGRLHPLAVARSVLIAKASAWMGSVVLGWWLA
VVAYLLPRRSVLRVAAADTPGAVVAALCAFALVVAALWLQHCCKSPEDQP
PNADAAPG
392418491YP_006455096.1 hypothetical protein Mycch_4716 [Mycobacterium chubuense NBB4]MTCDGYSRPMTDPTRGARIRRSGSRRGWFLMTVLLVLAICASSALVFTSR
VELLKLAVILALWAAVVAAFVSVIYRRQSDSDQAKVRDLKLVYDLQLDRE
ISARREYELTVESHLRRELAAELRAQSADEVAALRAELAALRANLEYIFD
TDLSHRPAIETDHSRAESMGGWPSGPLSTETTGRVSSSRIDTEDLEDVHE
DEDFDGHAPDTVESPIIDVPAEPHPPEDEWAREAAEHGGAHRRAAQQWGP
PPPPAPHQQPAPPPSSPQPGPQFPWLPPTAPAPSEPQPAAPAGMRWQPAP
AEGQWIPAGEPGSNWVAPESQQDTGEYVGRRRAPDSGAPTPPEPPRGRHL
AEAESAGPSEPEPEPEPQPEFEAEEPEQEDGDGGAHTGGQSVAELLARLQ
ATPSGGGRRRRREE
392418490YP_006455095.1 hypothetical protein Mycch_4715 [Mycobacterium chubuense NBB4]MVQPPAGENVPHDGLRPARLTIGVISAGRVGAALGAALERADHVVAGCSA
VSRASRQRAQRWLPDTPVLPVDEVAGRAELLLLAVPDAELSALVAGLAAT
GAVRPDTIVVHTSGANGIGVLAPLAAQGCITLAIHPAMTFAGTDEDLDRL
RGTCFGITAADEIGYAIAQSLVLEVGGEPFRVREDARTLYHAALAHSSNH
VVTVLLDAVESLRAALWGQELLGQETVGDTPGGIAERIIAPLARASLENA
LQRGQGALTGPVARGDAAAVAGHLHALAEVNPGLAEAYRTNSLRTAQRAH
APQEVFDVLAEAGQS
392418489YP_006455094.1 pantothenate synthetase [Mycobacterium chubuense NBB4]MITRQAPKFVAGQLNVYSRPRDVGEVTRALRATGRRIMLVPTMGALHEGH
LTLIRAARRVQGAVVVVSIFVNPLQFGAGEDLDAYPRTLDDDLAALRAEG
VEIAFTPTESDMYPDGKRTTVVPGPLGGELEGTSRAGHFAGVLTVVLKLF
NAVGPDRAFFGEKDYQQLTLIRQMVDDLDLAVHVIGVPIVREADGLAMSS
RNRYLDPVEREQAGALSAALLAGMYAASTGVPAALDAARAVLDEVPALDV
DYLEVRDPMLGPAPAEGAGRMLVAARLGHTRLLDNIAIDIGADIEGHPRV
ASGESHELPWRN
392418488YP_006455093.1 L-aspartate 1-decarboxylase [Mycobacterium chubuense NBB4]MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDID
NGARLVTYAIAGKRGSGVIGINGAAAHLIHPGDLVILIAYATLTDAEIRN
HRPRVVFVDAANRPVDLGADPAHVPLDAAELLSPR
392418487YP_006455092.1 pantothenate kinase- type III [Mycobacterium chubuense NBB4]MLLAIDVRNTHTVVGLISGSGDHAKVVQHWRIRTESEVTADELALTIDGL
IGDDAERLTGAAGLSTVPSVLHEVRVMLEQYWPKVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYHKYGTAAIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAARSAALRRVELTRPRSVVGKNTVECMQAGAVFGFAG
LVDGLVTRVREDVDGFRGDDVAVVATGHGAPLVLADLHTVEHYDRHLTLD
GLRLVFERNRDIQRGKLKQAR
392418486YP_006455091.1 putative amino acid aldolase or racemase [Mycobacterium chubuense NMDTPAHPPVDLAALRALSEQPLDWSARAIPPQWWGRTPAQVVAEAPRLFE
AGVWGPVCVLRADALAHNLATMARWCREHRVELAPHGKTHMSPQLAARQL
EAGASAITVANVAQAAVYRAFGVHDLVLANELVDPAGLRWVAAELERDAA
LNFVCWVDSVRGVELMTSALADARRRVPVCVEVGVPGGRTGCRSREDVDD
VARAAAESPRLRLVGVAGYEAARGQDVTADSLAIVTGHVAALRAAVLRLA
PLIENDDVIVSAGGSTYFDAVADGLTGWAAGVAVRTILRSGCYLTHDHGL
YARTSPLTRDGGDGLHPALELHAQVISRPEPGLAIVAMGRRDVSFDQGLP
VPLDLPGATVTALNDQHAYLRLGGDPVEVGAWLRFGISHPCTVFDKWRVI
PVLDAGDRVVDLVRTYF
392418485YP_006455090.1 lysyl-tRNA synthetase (class II) [Mycobacterium chubuense NBB4]MTSDSGDRDLASDIPEQFRIRQAKRERLLAEGHEAYPADVGRTHTLAELR
RAYPELPADTATGEQVGVAGRVIFARNSGKLCFATLQEGDGTQLQAMISL
DRVGQASLDAWKADVDLGDIVFVHGEVISSRRGELSVLADSWQIASKALR
PLPVAHKEMSEESRVRQRYVDLIVRPQARSIARQRIAVVRAVRSALERRG
FLEVETPMLQTLAGGAAARPFVTHSNALDADLYLRIAPELFLKRCVVGGF
DRVFELNRVFRNEGADSTHSPEFAMLETYQAYGTYDESATMTREVIQEVA
DEAIGTRAVPLPDGTVYDLDGNWDTIQMYPSLSEALGEEITPATSTERLW
QIADRLGVEIPRDRGYGHGKLVEELWEFAVGDKLWAPTFVRDFPVETTPL
TREHRSIDGVTEKWDLYIRHIELATGYSELIDPVIQRERFEAQARAAAAG
DDEAMALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGLSIRETVLFPIV
RRHGN
392418484YP_006455089.1 Lsr2 [Mycobacterium chubuense NBB4]MAKKVTVTLVDDFDGEGAADETVEFGLDGVSYEIDLSAKNATKLRNDLKQ
WVEAGRRVGGRRRGRAVATGRGRAAIDREQSAAIREWARRNGHNVSTRGR
IPADVIDAFHAAT
392418483YP_006455088.1 ATPase with chaperone activity- ATP-binding subunit [Mycobacterium MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKET
AEAGSGGRGGEAGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGDVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVAHTIEILKGLRDRYEAHHRVSITDGAIAAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAASL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFTQGGGENNYERMKQKVNDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIKMVDLMIGRVGNQLRAKDMTME
LTDRAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQLV
TVDVENWDGEGAGEDAVFTFTGRRKPAVSAEPDLAQAGAAGTPSAAE
392418482YP_006455087.1 hypothetical protein Mycch_4707 [Mycobacterium chubuense NBB4]MILDVIDGHRNLVELQNGRATEKVRPDVRRTADWDAKSRKGSTVTSSTSP
QQGRARARAIDFSATKAALWLSLTAFLALVVLYFVGMDQGATSVFGNNTY
VHEFFHDARHLLGFPCH
392418481YP_006455086.1 putative cobalt transporter subunit (CbtA) [Mycobacterium chubuenseMERQIIWRGLLAGAAAGVLAFLFARIFVEPQINRAIDYEDGIGAAHEAMS
HGGHSHGEAGGGFTRAVQTNIGMGLGVLAFSVAIGALFAVIFAVAYGRVG
DVSARLLAVYVAGGMLLSLYVVPGLKYPASPPALGLDETIQQRTLLYVLM
VALSAALFAGAVYLGRRLAARLGAWNATLAAGGAYLVAMAAVMLVLPTID
ETPGPLVDDAGRVVYEGFPADVLYHFRLYSLGTQVVVYATIGLVFAALVS
RLLGERRHVVSPS
392418480YP_006455085.1 fructose-2-6-bisphosphatase [Mycobacterium chubuense NBB4]MSEVVRLTFVSHAMTDAVAAGRFPTDEGVNATGRAQLGGLDLGSAQRALC
GPEARTRQTAELLGLHAATEPRLADLDFGRWRGEVLGRVLPAELAVWLTD
PTQAPHGGETVVDLIDRVRGWMESLTSERTRVVAVTHPAVIRAAIVAVLD
APPKSFWRIDVAPASRTVMHFRGHAWTLRSNR
392418479YP_006455084.1 beta-lactamase class A [Mycobacterium chubuense NBB4]MQGLTQRPEAAGARRRATALTVALLLVAALACGCAATRPAPADAAYGVPI
QINTPQGLRAKQTMDMLNSDWPIGEVGVRTLAAPQVVENVGVTLDRIWWD
RPFTVTKIDVGAGNATLHVLNSYGVAQTISLRVDEAGMVDRFAVDLVPPQ
INTWADIDTELKKSGARYSYQVAKVTDGQCVKVAGTNTDLSLPLASIFKL
YVLLALSDAVKAGTVSWTDPLTITEEAKAVGSSGFDHMPPGSTVTVRDAA
QQMISASDNMATDLLIGKLSPGAIERALVEAGHHDPASMTPFPTMHELFS
VGWGEPDLREQWKQASPQARAKLLAQTNARPYEPDPKRTHTPASSIGAEW
YASAADICRLHAALQKSAVGQAAPIKDILAAIPGIDLDRTKWPYIGAKAG
NLPGDLTFSWYAVDSSAQPWVVSLQTNWSQYRSQTAAAWLLSIAKQMFRL
AQT
392418478YP_006455083.1 putative enzyme involved in biosynthesis of extracellular polysacchMPSQTPVVKINAIEVPPDAGPELEKRFAHRAHAVDSQPGFLGFQLLRPVK
GEDRYFVVTQWESEEAFQAWATGPAIEAHAGERANPVAKGASLLEFEVVL
DVAGTDTKA
392418477YP_006455082.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMDLLTARGGEGRPLVLVHGLMGRGSTWSRQVPWLTRFGRVFTYDAPWHRG
RDVADPHPVSTERFVDDLGQAVQSLGRPAVMIGHSMGALHSWCLAAARPE
LVEAVVVEDMAPDFRGRTTGPWEPWLHALPVEFGSAQQVYDEFGPVAGQY
FLEAFDRTPTGWRLHGDTGKWIEIAAEWGRRDYWAQWEAVSAPSLLLEAG
DSVTPAGQMQAMTQKAHRATYLHVPGAGHLIHDDAPRKYQQAVETFLTSF
TTRT
392418476YP_006455081.1 hypothetical protein Mycch_4701 [Mycobacterium chubuense NBB4]MTIALTFLILVSPFALAALLSWTASRSGSLRLHLDQFRLAAPMGGRLSED
RDALRVEHDVDAIRTRFEQQPSWPSSGARGERR
392418475YP_006455080.1 transcriptional regulator containing an amidase domain and an AraC-MAIRSVSALVLDNLAVFEFGVICEVFGIDRSADGVPNFDFKVCGPEPGKP
LRTSVGATIIPDHGLDDLVGADLVAIPAIGGSEYLPAALDAVRRAADAGS
IILTVCSGAFVAGAAGLLDGRPCTTHWMHADELARMYPTAKVDRNVLFVD
DGNLITSAGTAAGIDACLHLVRRELGSEITNTIARRMVVPPQRDGGQRQY
IDQPIPVRCSERFAPHLDWILANLDKPHTVATLARRAHMSGRTFARRFVE
ETGRTPMQWVTDQRVLFARRLLEETTLDIDHIADQSGFGNATLLRHHFRR
IIGVTPSDYRRRFASAADESECAVTA
392418474YP_006455079.1 A/G-specific DNA glycosylase [Mycobacterium chubuense NBB4]MIDAGDLIGWYARAQRDLPWRRPGVSPWQILVSEFMLQQTPVARVEPIWL
DWIARWPTPSATAAAGAADVLRAWGKLGYPRRAKRLHECATVIANDHDDL
VPDDVETLLSLPGIGTYTARAVACFAFRQRVPVVDTNVRRVVARAVHGLP
DAGSPSARDLADVAALLPDDETAPQFSVALMELGATVCTARSPRCGVCPL
RQCAWRAKGFPAGAGPVRRTQRYAGTDRQVRGRLLDVLRGSTSPVTRAEL
DLAWTTDTAQRDRCLDSLLVDGLAEQTADGRFVLFGGAGEAGGADAQAVT
AHSDSSAAEANRRR
392418473YP_006455078.1 carbonic anhydrase [Mycobacterium chubuense NBB4]MPNTNPLTAWKALKEGNERFVAGKPEHPSQSIERRASLTAEQKPTAVVFG
CGDSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVAILNVPLIV
VLGHDSCGAVGATLSALDDGAVPSGYIRDIVERVTPSILVGRRDGLTRVD
EFEARHVTETGKQLLSRSTTIAEAVRAGKLAIVGLTYHLADGQVVLRDHI
GDIGEG
392418472YP_006455077.1 hypothetical protein Mycch_4697 [Mycobacterium chubuense NBB4]MTWPYRDDVLDLEPHGPLPQQIYWRRRALALGVTVVVIGIIAAVVAVVVM
NSTSSEQPTANESSAPSGQAAPPPLPGENPGVKTPIQPPAQQAPPPTATP
TAAVVPPPILKEGDDCPDSTLAVKGITNQPQYVVGDQPKFTMVVTNIGLV
ACKRDVGAAVLAAYVYSLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEV
TWTGMSSAPNCPLPRQPIGAGTYNLVVQLGNLRSATVPFVLAQPAPPPAN
VPPQAPAPAPAPAPAG
392418471YP_006455076.1 putative nucleic-acid-binding protein (contains the HHH domain) [MyMKPATGRTARTVVPMSRPTLRETIARLAPGTPLRDGLERILRGRTGALIV
IGYDDSVEAICDGGFSLDVRYAPTRLRELSKMDGAVVLSSDGSRILRANV
QLVPDPSIPTEESGTRHRSAERSAIQTGYPVISVSHSMSIVTVYVAGERH
VVPESATILSRANQTIDTLERYKTRLDEVSRQLSTAEIEDFVTLRDVMTV
VQRLEMVRRISLEIDSDVVELGTDGRQLKLQLDELVGDNETERELIVRDY
HANPDPPTAAQVGATLEELDSLSDSELLDFTTLARVFGYPSTAEAQDSAM
SSRGYRAMAGIPRLQFAHVDLLVRNFGSLQGLLAASASDLQSVEGIGSMW
ARHIREGLSQLAESTIADRLA
392418470YP_006455075.1 DNA repair protein RadA [Mycobacterium chubuense NBB4]MARSSSKTRSQYRCSECHHVTPKWVGRCPDCGTWGTVDEVALTAVGGSAT
RRAVAPASPAVPISSIDPGHTRHFGTGVSELDRVLGGGLVPGSVTLLAGD
PGVGKSTLLLEVAHRWAMTGRRALYLSGEESAGQIRLRAERTGCTHDEVY
LAAESDLQTALGHIDAVQPSLVVVDSVQTMSTTEADGVTGGVTQVRAVTT
ALTMTAKTSGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALR
MVRGVKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKAVSGTAVTV
TLDGKRPMIGEVQALIGSPATGTPRRAVSGIDSSRAAMITAVLEKRAKLP
VGANDIYLSTVGGMRLTDSSSDLAVALSIASAFTDLALPTTAVAIGEVGL
AGDLRKVTGMDRRLAEAARLGFSRAVVPSGVTSVPPGLQLLPADDITSAL
QVLRRISHNDAN
392418469YP_006455074.1 hypothetical protein Mycch_4694 [Mycobacterium chubuense NBB4]MNPLERRTFVTATVAATGLALSLVLSACGAGQVSQTATQEPAVNGTSGKA
GEIALRNVHLRAPQTTDYIRPGSDAELIFVAANTSPDVNDKLVSITSDVG
SVTLKGKGDVPAGGALVVGTPDGQPTPLEAVEPADSSQATVKLSKPITNG
LTYDFTFRFEKAGEATLAVPISAGEAPRREAVAEAGGSEGHTGGH
392418468YP_006455073.1 CarD-like transcriptional regulator [Mycobacterium chubuense NBB4]MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDDKA
STILDEVLAAAS
392418467YP_006455072.1 2-C-methyl-D-erythritol 2-4-cyclodiphosphate synthase [MycobacteriuMPRVGLGTDVHPIETGRPCRLLGLMFEDADGCAGHSDGDVAAHALCDALL
SAAGMGDIGGVFGTDRPEWHGVSGADMLLHVRSLLDDSGVRIGNAAVQVI
GNRPKVGPRRAEAQQLLSTLLGAPVSVSATTTDGLGLTGRGEGLAAIATA
LVFTDERLREEPTNTDERLREEPTNTDERLREEPTNTDERLREEPTNTDE
RLREEPTNSDDDSG
392418466YP_006455071.1 cysteinyl-tRNA synthetase [Mycobacterium chubuense NBB4]MTERPAAVMRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRS
GVAFDVLRRWLTAKGFDVAFIRNVTDIDDKILTKAADAGRPWWEWAATYE
RAFSAAYDALGVLPPSAEPRATGHITQMVELIDRLIERGHAYTGGGDVYF
DVATLLDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEPSWPT
PWGRGRPGWHTECVAMAHEYLGAEFDIHAGGMDLVFPHHENEIAQAEAAG
DGFARFWLHNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYLGSAH
YRSMLEFSETALQDAAKAYAGIEDFLHRVRTRVGAVVPGEWTPRFAAALD
DDLSVPIALAEVHAARAEGNRALDAGDHDGALTQAMSIRAMMGILGADPL
DERWESRDETSAALAAVDVLVHAEVRRREDARARRDWAEADAIRDRLKEA
GIEVTDTADGPQWSLLDGSDK
392418465YP_006455070.1 rRNA methylase- putative- group 3 [Mycobacterium chubuense NBB4]MAGNSQRRGAIRKAGTKKGPTVGSGGVRRRGLEGKGATPPAHKRPHHPAA
KRAAKAARQQQGRHKKTDDTEIVLGRNPVVECLRAGVPATALYVALGTDS
DERLTEAVQTAGDRGIAILEVPRHDLDRIAANGMHQGLALQVPPYVYAHP
DDLLAEAKRDAAQPLLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRS
ASVTAVAWRTSAGAAARIPVARATNLNRTLKQWADAGVQVVGLDAGGDTA
IDEIDGEGPIVVVVGSEGKGLSRLVRENCDAIVSIPMAGPTESLNASVAA
GVVLAEIARQRRG
392418464YP_006455069.1 Na+/H+ antiporter NhaD-like permease [Mycobacterium chubuense NBB4]MELTLAVIALVAVLGVALLRPRFQAVIAVPAAAVVILAGAISWQDAVAEI
ARLAPVVGFLAAVLVLARLCDDEGLFHAAGVVMARATTGGQNRLLVSVFA
ISAGVTAILSLDATVVLLTPVVLATARTLAVPARPHAYATAHLANSASLL
LPVSNLTNLLAFSAAGLTFLHFASLMALPWLAAIAVEFVLLRWLFAKDLA
VEPRRDAGTEPIELPLFALVVVGLTLVGFAVTSLLGLSPAWAALAGAVVL
GVRALATHRTTLVRIGIAAEVPFLAFVLCLGVVVAAVMRNGLESSMHHVI
PDGHGLVALLGVAAVAAVLSNVVNNLPAVLVMLPLVTPTGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSVVGREVKAGFREFSRVGFCTTPLTLVAAVL
ALWAGLRLIGA
392418463YP_006455068.1 hypothetical protein Mycch_4688 [Mycobacterium chubuense NBB4]MRLKPGRPDLKAYSAYFDLPTAPSSAPLTVAWAGVTTLLVDDGDSTVMTD
GFFSRPGLLTVAARPLQSSLPRIESALARLGVDRLDAVTPVHTHFDHAMD
SAVVARLTGARLVGGTSAANIGRGHGLDRIDVAVPGTPVTAGNFDITLIE
GHHCPPDRFPGAITVPVPPQARASAYRCGEAWSTLVHHRPTDQRLLIVGS
AGFVPGALAGRRADVVYLGVGQLGLQPTRYLRQYWQETVRAVGARRVVLI
HWDDFFRPLDKPLRALPFAGDDLDASMRTLTALAAEDGVPLHLPTLWQRT
DPWS
392418462YP_006455067.1 arabinose efflux permease family protein [Mycobacterium chubuense NMVALDRPIGETQRWAYPLLLVLSGVALGVSGLPAPLYGIYESSWHLSPLA
TTIVFAVYAIAALAAVLVSGRISDVVGRKPVLLAALAALLVGLGVFLVAD
NMALLLLARTIHGAAVGSIVVAGAAALLDLRPDHGVRSGQLSGVSFNIGM
TVAIIGSALLAQYAPHPLRTPYAVVAVICLVVGAGVIALHEPHTARSRGP
IRIARPAVPPEIRADFWFSALGAMASWSVLGVLLSLYPSLAAQQTHIDNL
VFGGAVVGTTAFSAALAQLAATRLPARYSAIIGDVGMSVSLLLTIPVLLT
HEWQLVFVAAALLGTTFGLGFGGSLRHLADVVPVGRRGETMSAFYLAAYT
AMAVPTLVAGWAATQWDLAEVFPWFAGTVATACLGAAVAGLRSTRRMRTA
392418461YP_006455066.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAEDMLVADGAVRPVGSVQQVLGALHDPVRLEIVRRLYNADAPLQCGALY
DGINKSTATHHFRILREAGVLERLVLDGATCQRLRRDEVDAAIPGLLAAV
VGGLNSQGRR
392418460YP_006455065.1 putative lactam utilization protein B-like protein [Mycobacterium cMPTVTVDLNADLGESFGVWQLGDDDAMLDIITSANVACGFHAGDAATLAR
TCRAAAARGVRIGAQVSYRDLAGFGRRFIDVPPDELIADVIYQIGALQAL
AKASGAAVSYVKPHGALYNAIVTNQAQAGAVAAAVHTVDPNLPVLGLAGS
AFFVEAERVGLRTVPEAFADRSYRPDGRLVSRRERNAVLSDVDEISDRVA
SMVQRGRVAAVDGSTIPITVASVCVHGDSPGAVRIASAVRDRLTSDGVAL
APFS
392418459YP_006455064.1 ABC-type Mn2+/Zn2+ transport system- permease component [MycobacterMNDKLRELFSNFFAFDTTADLLSRDFVQQALLASALLALVSGLIGPFIVM
RQMSFAVHGSSELSLTGAAFALLAGFNVGVGSLLGCGLAAVLFGILGQRA
RERDSAIGVVLAFGLGLAVLFIHLYPGRTGTSFALLTGQIVGVGYSGLAL
LAVVTVLVIAVLAVAYRPLLFATVDPEVAAGRGVPVRALGIVFAALVGVT
AAQGVQIVGALLVMSLLITPAAAAARIFGSPMAAMLASVVFAEVAAIGGI
LLSLAPGVPVSVFVTTISFAIYLVCWLISSRRRDVAPH
392418458YP_006455063.1 ATPase component of Mn/Zn ABC-type transporter [Mycobacterium chubuMSAQPREVFSFTHACLAFGDRVLWDDLDLSVRAGEFVAVLGPNGTGKTSL
LKVLLGQVELSAGTATVGGEPVRAGSRSIGYVPQHRSIDRGVSLRGCDLV
GLGYDGHRWGVAGWQRETRNAKRDAVHRALAAVNGTHLSGVSVGVMSGGE
LQRVRIAQALATDPALLLCDEPLLNLDPANARLVCALIDQRRREAGTAVL
FVTHEVDPVLPYVDRVIYLVDGRFRIGTVEEVMTSQTLSELYRADIEVIK
VGGRYIVVGEHSQYQHNHAGHPGHVHE
392418457YP_006455062.1 ABC-type metal ion transport system- periplasmic component/surface MRALVAAGAAALLTVTVAACSHGQNAEHGTPNVVASTDVWGSVASAVVGD
HATVTSIVHGTAADPHSFEASPTEVAKVADASLVVYNGGHYDRWMEDILG
NAPAVPKVDAYSLLVPAQQPANEHVFYDLPTVKQVAEKIADTMGQADSAH
AADYTAKADRFGEALDTLAMAERAIGESHPGASVVATEPVAYYALRNAGI
QDKTPPSFANAMEEGSDPSPADVAAVLDLINAHKVSAIVINTQTESPVSK
RISDAARKAALPVISVTETLPAGMDYLQWQRKTVDEIGAALASAPAPTR
392418456YP_006455061.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSRSPTPRRRATLASLAAELKVSRTTVSNAYNRPDQLSAELRERVLSTAK
RLGYPGPDPVARSLRTRRAGAVGLMITEPLNYSFSDPAALDFVAGLAESC
EAVGQGLLLVAVGPNRSVTDGSAAVLAAGVDGFVVYSASDDDPYLPVVLQ
RHLPVVVVDQPKNIAGTSCVGIDDRAAMRGLAEYVLELGHREIGLLTMRL
GRELPHGGPRPALADPERVATPHFHVQSERIRGVYDAMTAAGLDPESLTI
VESYEHLPTSGGAGADVALEANPRITALMCTADVLALSAMDRLRARGIYV
PGQMTVTGFDGVPEARQRGLTTVVQPSVEKGRRAGELLHNPPRSGLPVTE
VLDTAVVRGRTSGPPA
392418455YP_006455060.1 trehalose 6-phosphatase [Mycobacterium chubuense NBB4]MSELPPELSTALDTVARTPRLLVTSDFDGTLSPIVSNPSDARPIPEAGRT
LVQLAELPSTSVALISGRALRDLRVLSSMPDIVHLVGSHGAEFDSGFSHD
IDEALLQTITDTLAGIASGRPGVTVETKPASVALHVRNASEDDAEAALAA
AWDAAAGWDAHTTTGKAVLEFAVISTDKGEAIEILRSEHDASAVVFFGDD
VTDEKAFRRLTDADVGVKVGPGDTLAGYRVDSPHDVAVALRYLLTSRAQA
D
392418454YP_006455059.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSGTSESPVGTPARAAGAGAESRPRQVMNVAVLAESELGSEAQRERRKRI
LDATLAIASKGGYEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALGRE
FERIDAKTDRAVLAAGATPYQRLNIMVGKLNRAMQRNPLLTEAMTRAFVF
ADASAAGEVDHVGKLMDSMFARAMSDGEPTEDQYHIARVISDVWLSNLLA
WLTRRASATDVSKRLDLAVRLLIGDGDQPKI
392418453YP_006455058.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MPAGSLKSSATINDEQSAARELVRSWAAGSSAVDAARDVEQGDAGAWRAP
YDGLAQLGIFGVALPEEHGGADGTVADLCAMVDEAAAALVPGPVATTALA
TLVLSDSHTELLEALATGGRTAGVALSADLTHADGRASGTAPYVLGADSD
GVLLLPAGEVWLLVDAAADGVTVEALKATDFSRPLARVVLDGAPAEELSV
PAQRVVDLAATVAAAEAAGLARWLLDTATEYAKVREQFGKPIGSFQAVKH
MCAEMLLRSEQASVAAADAARAAGEGDDDQLSVAAALAASVGVEAAKANA
KDCIQVLGGIGITWEHDAHLYLRRAYGIAQFLGGRSRWLRRVAELTQRGV
RRTLSIDLESVADLRPEIASAVADVAAAPSEKRQAALAEAGLLAPHWPRP
YGRAAGPAEQLLIDQELAKADVTRPDLVIGWWAVPTILEHGSAEQIEQFV
PATLRGELSWCQLFSEPGAGSDLAALRTKAVRAEGESASGTKVSGWKLTG
QKVWTSAAQKAHWGVCLARTDPDAPKHKGITYFLIDMRSPGIVIRPLREI
TGDELFNEVFFDDVFVPDELVVGQVNDGWRLARTTLANERVAMAQGTALG
NPMEELLRAVGELEFDGAQQDRLGALIVTAQVGSLLDQRIAQLAVGGRDP
GPQASARKLIGVRYRQALAEFRMELSEGAGLVENQQVHDFLNTRCLTIAG
GTEQILLTMAGERLLGLPR
392418452YP_006455057.1 hypothetical protein Mycch_4677 [Mycobacterium chubuense NBB4]MNRFAATSAAALLAVVLTHPASAQAASNTGTTSIAVDPATQIQMQVTANC
DAAQTRCFFNTTANLMTPGGPTGFPGDTWARQTITIRSSDRDVWQQAWYS
APSGNPRELKGANHENVLSKMYKSLDDVEISITYFGGGPIERFKADGDSV
PTEWRTGLPATKADFIACSQIQVVYGGVNLTTPTACAQTTFA
392418451YP_006455056.1 flavodoxin reductase family protein [Mycobacterium chubuense NBB4]MTDVKADEPLGSHVLELEIAEVIDETADARSLVFKSPADAPVPEDRLRYA
PGQFLTLRVPSERTGSVARCYSLCSSPFAGDPLTVTVKRTAEGYASNWLC
DNAHAGMRMHVLAPSGTFVPKTLDTDFLLLAAGSGITPMMAILKSALTEG
SGKVTLIYANRDEGNVIFARALRDLGAKYPDRLSIVHWLESLQGLPGEAA
LAELIAPHAAREAFICGPGPFMAAAEEALKTSGFPDERIHIEVFKSLESD
PFAAVVIEEDDSDEGPATAIVTLDGTTHEVTWPRRAKLLDVLLDKGLDAP
FSCREGHCGACAVVKKSGDTEMEVNDVLEQQDLDEGLILACQAHPRSDSV
EVTYDE
392418450YP_006455055.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTSIEQRDVQSVLAGIDDLLPRIAKRAASAEELRRLPDDTVNELDEVGFF
KLLQPEQWGGLQCDPTVFYEAVRRIASACGSTGWVASIIGVHNWHLALFD
QQAQDEVWGSDPTVRVSSSYAPMGAGTVVDGGYLVSGAWQWSSGCDHATW
AFLGGPVIKDGRPVDFGSFLIPRSEYRIDDVWNVVGLKATGSNTVVVKDV
FVPRHRFLSYRAMNDGSAGGYENNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYDAHVEHQGKRVRAAFAGEKSKEDPFAKIRIAEAASDIDAGWRQLIGN
VHDEYQLLQAGQEIPFSLRARARRDQVRATARAIASIDLLFEASGATALN
LDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
392418449YP_006455054.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMTSFAAEAAQQQEITFESTSRYAQVREDMRLHYHEAGVGNPETIVLLHGG
GPGASSWSNFGRNIPVLAQHFHVLAVDQPGYGYSDKHTEHEQYNRYSATA
LLNLFDHLGIDRAALVGNSLGGGTAVRFALDNPKRAGRLVLMGPGGLSVN
LFAPDPTEGVKLLGRFAAEPTRENIEKFLRIMVYDQSMITPELIEERFRI
ASTPESLAATKAMGKSFAGADFELGMMWRDVYKLRQPVLLIWGREDRVNP
LDGALIALKQIPRVQLHVFGQCGHWAQLEKFDEFNRLTIDFLGGAR
392418448YP_006455053.1 lactoylglutathione lyase-like lyase [Mycobacterium chubuense NBB4]MTIRSLGYLRIESTDVAAWREYGLKVLGMVEGSGSTEGALYLRMDEFPAR
LVIVPGEHDRLLVSGWETANAAALQEIRSRLDAHGTPYKEAAAAELAERR
VDEMIIFDDPSGNTLEVFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAETLRFYRDVLGFSLRDSMKLPPQLVGRPADGAPAWLRFLGVNPRHH
SLAFMPGETPSGIVHLMVEVENADDVGLCLDRALRRKVKMSATLGRHVND
KMLSFYMKTPGGFDIEFGCEGLEVDDHSWVARESTAVSLWGHDFSVGFK
392418447YP_006455052.1 conserved protein of DIM6/NTAB family [Mycobacterium chubuense NBB4MSSAPIDPRTFRSVLGQFCTGITVITTVHDGAPVGFACQSFAALSLEPPL
VLFCPTKLSRSWAAIEASGRFCVNVLHEKQKDVSARFGSREPDKFAGIDW
TPSTLGSPIIDGTLAHIDCTVHSVHDGGDHFVVFGAVHSLSDVPRKKPRP
LLFYQGQYTGIEPDKNTPADWRNDLEAFLTATTDDTWL
392418446YP_006455051.1 Protein of unknown function (DUF2867) [Mycobacterium chubuense NBB4MTIESDTLLACCTLARVDHVDTHVLPTARPTSRSPEMWMREILENTSAAM
RARLTAGWAMLGLKLHRGDTILGWPISHNDAEYVRLHRHSPVGLTGQLVT
RASGDGVQFATFVQLSNPAARALWRRVLPTHLEIVRSLLREAGERAH
392418445YP_006455050.1 transcriptional regulator [Mycobacterium chubuense NBB4]MRTSRDRWVATGLDLLAADGPDAVRIEVLAQRLGVTRGGFYRQFGGRREL
VEAMLDTWERRSIDDVRTRVEAEGGDAARKARRAGMLTFSPELLPLDLAV
REWARRDPGVAERLRRVDNRRMDYLRELISTTSDDADDVEARALLAFSLV
IGNHLIAADHPAGGRSRALRNATRLILG
392418444YP_006455049.1 lysophospholipase [Mycobacterium chubuense NBB4]MPFLEHDRGRAYYRHWAAAHPRAAIIFLHGFGEHTGLYHRYGFALNAAGI
DLWAVDQFGHGLSPGDRGDFGTIEDSSALAESLTALAQEEHEIPLLAQGH
SFGSVVTLFRLLENPQRYRAAIVSGAPLVPVPELLDSDTSMNLDPAWLSS
DPFYVDSLLNDPLAFVDADGAALARELDRAWDRFGSELPSLAVPTLAVHG
TNDPIAPIGAVRAYAEQIEALQLAEFPGARHDVLNDAEHREVATAIVDFV
DRVLD
392418443YP_006455048.1 transcriptional regulator [Mycobacterium chubuense NBB4]MQPLRTAMAKSAVSVCKNAYVSTANRRPSADDLLVLLSVGRTGRYTTAAE
ELGLNHTTISRRIAALEQSMGGRVLARVAGGWELTELGREALAAAEAVES
AVRSLSTDAGGRRALEGVVRISATDGFSAYIAAPAAAAVQRRHPKVAVEI
VATTRPASQQRSGLDVEVVVGEPKVHRAEALRLADYCLGLYGSRDYLAAH
GAPSSVADLHRFPLIYFIDSMLQVDDLDLAASFAPAMRESVTSTNVFVHV
EATRASAGLGLLPCFMADRHPDLVRVLAKPVSIRLAYWLVTRAETLRRPE
VAAVVEAIRDRVRAQHDVLLGAR
392418442YP_006455047.1 arabinose efflux permease family protein [Mycobacterium chubuense NMSAQQSSQPASITTGLKRVVVASMAGTVVEWYEFFLYATAATLVFNKVFF
SEGTSDSKAIIAALLTYAVGFVARPLGGVVFGHFGDKFGRKKLLQFAILL
VGVVTFLMGCLPTYAQIGVWAPILLVVLRFLQGFAVGGEWGGAVLLVAEH
SPNDSRGFWASWPQAAVPVGNMLATVVLLVLTGTLSDAAFLSWGWRVAFW
LSAVVVLIGYYIRTKVTDAPIFVEAQQEVERVKSVSYGVVEVLKRYPRGV
FTAMGLRFAENIMYYLVVTFSIVYLKTHVGADTSDILWWLLAAHAVHFLV
IPQVGRLSDRFGRRPVYIAGALLAGTWGFFAFPMMNSGDYLLIMGAIILG
LMIHALMYSPQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSVAPAIATWL
LDAFGSAVPIALYLAGAAVITLVAAWLTRETNGLDLKKLDEADREELAKA
GVL
392418441YP_006455046.1 3-hydroxybutyrate dehydrogenase [Mycobacterium chubuense NBB4]MSELGGRAALVTGAASGIGAACARELARRGAAVTIADVDDAAANALAGEI
GATAWVVDLSDVRALEGLRLQTDILVNNAGVQTVSEISEFPPERFRMMMA
LMVEAPFLLIRAALPHMYGSGFGRIINISSIHGLRASPFKVAYVTAKHAL
EGLSKVTALEGGPHGVTSNCVNPGYVRTPLVTKQIADQARTHGIGEDQVV
EEILLKESAIKRLVEPEEVGSLVAWLASSSAGMVTGASYTMDGGWSAR
392418440YP_006455045.1 acetoacetyl-CoA synthase [Mycobacterium chubuense NBB4]MTPQWVPTEADVDGARVTDFARFAEQRTGSAFPDYRSLWQWSVDDVEGFW
AALWDYFELGERSEEVLQHPEMPGAQWFPGTTVNYVDQVVRNARTDRPAI
VSVGEGRPDREVSWQELLERTAAFAEKLRAGGVGRGDRVVGYLPNIPEAV
IAFLATASIGAVWSACGQDYSAKAALDRLGQLEPTALVAADGYQFAGKYR
DKRDDVAALRKGLPTVRATFTMDDLAARSANPLDTVAVEFGHPLWILFSS
GTTGLPKGIMHGHGGVIVEHLKAVALQSDIGRDDTFFWYTSPSWMMWNFQ
VAGLLVGATIVCYDGSPNAPQPDALWDITARIGATVLGTSPGYVLGCIKA
DAHPSKTHDLSALRTVGITGSSLPPSSSLWLRDRVGEHVQVASISGGTDV
VSAFIGGVRTVPVWPGELSAPYLGVALDAWDEAGNPVRGEVGELVITKPL
PSMPVAFWNDPDGSRYHDAYFDVYPGVWRHGDWITLTDHGSVIVHGRSDS
TLNRHGIRMGSADIYQAVEGLPEVVEALVIGAEQPDGGYWMPLFVVLADG
VDLTDDVRGRINDVIRTEVSPRHVPDEIIVAPGIPHTRTGKKLEVPVKKL
FQGRDAAKVVERSAVDDPALLDWYVTQRRT
392418439YP_006455044.1 aspartate/tyrosine/aromatic aminotransferase [Mycobacterium chubuenMSSADTKNAAAHGPSCRAGIPPFYVMDVWLAAAERQRTHGDLVNLSAGQP
SAGAPSAVREAAVDALNRNQLGYTVALGIPELRTAIAGAYESRHGIVVDP
DDVVVTTGSSGGFLLAFLACFDVGDRVAIASPGYPCYRNILSALGCEVVE
LPCGPDTRFQPTLQMLTELDPPVKGVIVASPANPTGTVIPPEELAAIASW
CGSTGVRLISDEVYHGLVYPGSPPTSCAWETSRSSVVVNSFSKYFAMTGW
RLGWMLVPQELKRAVDCLTGNFTICPPVLPQLAAVSAFTPESIAEAEALL
EGYAANRTLLLDGLRSLGIDRLAPTDGAFYVYADVSHLTTDSLSFCSKLL
NDTGVAIAPGVDFDTVRGGAYVRLSFAGPTSDIEEALRRIGSWIS
392418438YP_006455043.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MDLKIGELARLTGTSAPTIRYYEDIGLLPPPHRAGGQRRYRDDDVRRLTF
VRRCRDFGFPIEAVRTLASLSADRDHSCIEARDIARTHLAAVHRRMVELR
ALEHSIAELVDAADGACSGGPGAECAVLRELARPAR
392418437YP_006455042.1 hypothetical protein Mycch_4661 [Mycobacterium chubuense NBB4]MEDPPLACTLSAGARQHRLTWIRELNAVALRDHRRDGARIELRYHPSAAP
RVRELVRRERDCCPFLQFTIVGDGDDLCLVIEAPDDVGDGAEALLAPYAA
T
392418436YP_006455041.1 Protein of unknown function (DUF3478) [Mycobacterium chubuense NBB4MIDFLDRSTGDVLGVRASGKLTAADYHHVLAPRIDSLVEQFATLKVLFLM
DRAFEGWTLRAAWANTVFDLAHRRHFDQIAMVGAPAWEEWCIKVPAAVLM
RGELRTFRREQLGEAWDWLLAA
392418435YP_006455040.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MSEERELLRDTVAALVEKHASPEAVRKAAASERGYDEALWKMLCEQVGAA
ALVVPEELGGAGGELADAAVVLEELGKGLVPTPLLGTTLAELALLSLDEP
DEDLLGALAEGSAIGTVVFDAGYVVNGNVADVVIAADGQTLTRWTSFTST
PAVAMDITRPLAAIDAGETSPLGSDPGLADTAAILLAAEQIGAASRCLDL
TVQYTKDRVQFGRPIGSFQALKHRMADLYVAVQSAKAVVDEAVADPSPTS
AALARLAASEAFSTVAAEAVQMHGGIAITWESDIQLYFKRAHGSAQLFGP
PREQLRRLESDVF
392418434YP_006455039.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MNFEIDEQQRDFAASIDAALGAADLPAAVRAWADGDTAPGRKVWAQLTDL
GVTALMVPERFDGIEAHPVDLVVALERLGRWNVPGPVTESIAVAPILLGD
DERSGALASGELIATVAAPPLVPRAVDADTAGLVLLAEDGQISEAAAGAE
HESVDPSRKLFDVSASGEARPSDVSRAVEFGALATAAQLIGAAQAMLDAA
VEYAKQRSQFGTVIGTYQAIKHKLADVLIAVELARPLVYGAALSLADQSA
DTARDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHNPSLLLLRVQALR
PAWGDPTWHRRRVLEALNQ
392418433YP_006455038.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDLNVDDTTLAFQAEVREFLAENKGSFPTKSYDTAEGFEQHRRWDKVLFD
AGLSVITWPEKYGGRDASLLQWVVYEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQCDRVLPKMASGEEIWAQAWSEPESGSDLASLRSTATKTDGGW
LLNGQKIWSSRAVFGDRAFGLFRSDPEAQRHKGLTYFMFDLRAGGVTVRP
IAQLGGDTGFGEIFLDDVFVPDEDVIGGVHDGWRAAMSTSSNERGMSLRS
PARFLAPAERLVAQWKDNPDPAFTDRVADAWIKAQAYRLHTFGTVTRVSN
GGELGAESSITKVFWSDLDVALHQTALDLRGADGELVDSVTEGLLFALGG
PIYAGTNEIQRNIIAERLLGLPRK
392418432YP_006455037.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMTAAARTTPAVLDRIAHELPDHDAVVTAAKTLTFAQLRAEVRQAAAAMIE
LGIAPGDRVAIWSPNTWHWVVACLAIHHAGGVLVPLNTRYTASEAVDILA
RTAAPLLFTSGEFLGADKAASIDGDMLPALRHIVRIPIDKADGTWDEFVA
RGADLAAVDARAAAVSPEDVSDILFTSGTTGRSKGVRCAHRQSLDASAAW
AACGQVTSDDRYLCINPFFHNFGYKAGILACLQTGATLYPELTFDPEKTM
RAVQEQGITVLPGPPTIYQTLLDHPRRAEFDLSSLRFAVTGAATIPVVLI
ERMQSELDIDIVLTAYGLTEASGFGTMCRAEDDAVTVATTSGRPIADFEL
RIGEQGEVLLRGPNVMLGYLDDAEATAAAIDAEGWLHTGDVGEVDEAGNL
KITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAAVIGVHDERLGEVGK
AFVVTLPGAELDEDAVIAYTREHLANFKTPRSVEFLDALPRNPGGKVVKP
QLRERI
392418431YP_006455036.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MIEVQEFRAEVRDWLADNLVGEYAALKGLGGPGREHEAFEERLAWNRHLA
AAGLTCLGWPVEHGGRGLSVAHRVAFYEEYAKANAPDKVNHLGEELLGPT
LIAYGTSEQQTRFLPRILDVTELWSQGYSEPGAGSDLANVSTTAVLDGDQ
WVINGQKVWTSLAHWAQWCFVVVRTEKGSKRHAGLSYLLVPLDQPGVEVR
PIIQLTGDSEFNEVFFTDARTDADLVVGEPGDGWRVAMGTLTFERGVSTL
GQQIRYAREHSNLVELAKRTGAADDPLIRERLTRSWAGLKAMRSYALATM
DVEQPGQDSVSKLLWANWHRELGEIAMDVQGMAGLTLPDGEFDEWQRLYL
FSRSDTIYGGSNEIQRNIIAERVLGLPREARH
392418430YP_006455035.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTDLSLAPKEIEGHGLLTGKVVLVTAAAGTGIGSTTARRALAEGADVVVS
DYHERRLGETRAELAALGLGKVDAVVCDVTSTEAVDALIASTVEKAGRLD
VLVNNAGLGGQTPVVDMTDDEWDRVLNVTLTSVMRATRAALRYFRDTGHG
GGIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEYGVRVNAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVAATIAFLASDYSSY
LTGEVISVSSQHP
392418429YP_006455034.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTGQRPAAVSPANTRRDELLALAATMFAERGLRATTVRDIADSAGILSGS
LYHHFSSKEEMVDEVLRGFLDWLFDRYQQIVATEPNPLERLKGLFMASFE
AIETRHAQVVIYQDEAKRLSAQERFSYVEERNREQRKMWVDVLNQGIKEG
YFRPDVDVDLVYRFIRDTTWVSVRWYQPGGPLTAEEVGRQYLSIVLGGIT
TASTQGV
392418428YP_006455033.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MPASQAYVIDAVRTAIGKRNGSLAGVHPVDLGAAGWRGLLGRVDVDPGAV
DDVIAGCVDAIGPQAGNIGRLSWLAAGYPEEVPGVTVDRQCGSSQQAISF
GAQAIMSGTADLIVAGGMQNMSQIPISSAMTVAEQFGFTSPTNESKSWLH
RYGDQEISQFRGAELIAEKWDISREDMEQYALTSHQRAQAAIRAGHFENE
IIEVDGFRIDEGPRDTSLEKMAGLKTLVEGGRLTAAMASQISDGASAVLL
ASEQAVKDHGLTPRARIHHISARGADPVFMLTGPIPATRYALDKTGLSID
DIDTIEINEAFAPVVQAWLKETKADPDKVNPSGGAIALGHPLGATGAKLF
ATMLNTLERTGGRYGLQTMCEGGGTANVTIIERL
392418427YP_006455032.1 oxidoreductase- Rxyl_3153 family [Mycobacterium chubuense NBB4]MKTNAAILWEYGSDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGAGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHVRGQDVGVMALVGTFSQYGTVPEASI
VKIDDDIPLSRACLLGCGVTTGWGSAVNTADVQPGDTVVVIGFGGIGSGA
VQGARLAGAEKIVVVEPVEEKRAKALALGATHFVTSLPEATALVAELTRG
VMADSAILTVGLLEGSMLEDAANIIRKGGAVVMTALATMADNSPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMRAGRNIRGVILHDH
392418426YP_006455031.1 hypothetical protein Mycch_4650 [Mycobacterium chubuense NBB4]MGALAVFLIAVGVADICRKLSAHRRLPLAAGPLTVVACAALAGLWHRGDV
VLLIVAAAVSVAWVALGSAAEHTGSRQGRALAVFGAGILLMVAFGGWSSE
VAGPVGRWLPWVGLEQVEPSRALMIVGVVLLQLVTANQLVRLILGAVGAV
RPAGVPQPSDRLKGGRLLGPMERLLIVGLALGGQFGAASAVIAAKGIIRF
PELNAARKESAEPGGSGIDEVTEYFLVGSFASWLIALAGLALTAA
392418425YP_006455030.1 hypothetical protein Mycch_4649 [Mycobacterium chubuense NBB4]MVQVKRGASTPRATLIGDVVGSREFADRRALHRRLTAALVTVADTAVDAP
AVTVGDEFQGAFRTVGQAIDAALTLRLTLAPDVDVRFGLGWGPITTLDEH
AGVQDGPGWWAAREAIEWTAAAQQQAGLTHVRTAFRNDTGEGADPHAVNA
ALMCRDHLIGSLDARSLRILAGMRAGLSKKELAMAEHISASAVSQRAGRA
GLDLILAAAEELRQI
392418424YP_006455029.1 hypothetical protein Mycch_4648 [Mycobacterium chubuense NBB4]MALEKHVGRVGALAVALGIGSAVAVMPGVAWAEPNNSGSAAASQNSGDSA
RGHGPLRHERARPAASTESAGSSESSEESSEATDRSAAKRRSHGSRRAPA
AGTHAAQAEADGRTTSQAKEDTDDTTSSKSARPRKAALGLDEPARTPVSV
PESRAHRISIKDVDPSPAGTGTDAVGVVSAAPEVPRTVKALFAPRATSHR
PDAPEPPGASPLLWTMLAAARRQLGELRDAAAFTRIAATGCEVAPDASST
STPGLATQPVVIGADGTIYQVTVEANATTGRLTGGTRVSIVGPDGRVLKT
RTLFGAPTEASNAVARDDGSLLVTTYSPLLNRTFVSEIGPSGLVRPAGSA
SGNVLAPVSLAADGTAYVETRINPSFDLGHKLIRISPNNTTRVYSAFISP
SPPVVAPDGSAYLLTQNLFSQATVLMAIGPDGTVRRTAPRSDVQVVGQPV
IGTDGRGYWAVTYDNADGARVTDVYTFTGNSSTIRHIDGDVSTYRLVPAG
DGVYVPVVNNAVGTTSIARIGATAIEISQPGIGYLIDPIDVTPDGTVYAS
VYDYVTKTYSVAVYRPDGSVTQTEIAGDIVQSGYPRPPTEGFPTPNPDNT
GYVAYTSGGHSYLAVLSADGTITGTVALPDGTEVTRPVSFDADGRAYQVV
ETPGSADHAVSVVSASTGAVTATLPGYLVTGHDSLEFGPDGTGYLITVEG
YATTLNPTYHIVSFDNTGTVVASLDVTGFLNRNPVDYRSQGYFNEPLTFG
PDGTAYASFGVFSSDQDGGVYALTPAGATRILAINDPKTSLMPVIVDSAG
TPYVTVTREDGDSYVTTVVPLTA
392418423YP_006455028.1 2-nitropropane dioxygenase-like enzyme [Mycobacterium chubuense NBBMSGARLKTPLTELVGIEHPVVQTGMGWVAGARLVSATSNAGGLGILASAT
MTLDELETAVAKVKAATDKPFGINIRADAGDANDRVDLLIREGVKVASFA
LAPKPDLIAKLKEAGVVVIPSVGLAKHAKKVAGWGADAVIVQGGEGGGHT
GPIATTLLLPSVLDAVADTGMPVIAAGGFFDGRGLAAALSYGAAGVAMGT
RFLLTSDSTVPDVVKQRYLQAALDGTVVSTRVDGMPHRVLRTGLVDKLES
GSPVRGFAAAVGNAQKFKKMTGMTWRSMIKDGMAMRHGKDLTWSQVVMAA
NTPMLLKAGLVEGNTDAGVLASGQVAGIISDLPSCAELVPAIVAEAIEHL
QSATGYIKQ
392418422YP_006455027.1 acyl CoA:acetate/3-ketoacid CoA transferase- beta subunit [MycobactMISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDILL
TDGEARLIADTPAIGAAAAIEGWMPFGRVFETLAWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHATSYWVGNHSKRVFGDSVD
VVSGIGWDKVDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRAVSLHPGV
EPGQVAENTAFEVHGLDEAATTRLPSGDEQKLLREVIDPKSLRDKEVRM
392418421YP_006455026.1 acyl CoA:acetate/3-ketoacid CoA transferase- alpha subunit [MycobacMSDKRTTLDEAVASVSSGMTIGIGGWGSRRKPMAFVRALLRTDVTDLTVV
TYGGPDLGLLCSAGKVKRAYYGFVSLDSPPFYDPWFAKARTSGAIEAREM
DEGMLRCGLQAAAQRLPFLPIRAGLGSDVRAFWGDELKTVRSPYPTPDIP
ESLRSSPPEDGYEELVAMPALRLDAAFVHMNVGDAQGNAAYTGIDPYFDD
LFLMSAAQRFLSVEKVVSTEELVKSVPPQALLINRMMVDSVVEAPNGAHF
TTAEPDYRRDEKFQRHYAEAAASEETWADFVNTYLSGSEADYQAAVRAFK
EAQA
392418420YP_006455025.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMTISTKTVEPGIASVTVDYPPVNAIPSRGWFELADAITAAGRDMGTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCFEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRLFFTAATVGAETLHQFGSVHEVVPRPELDEAALRVARDIAAKDTRV
IRAAKEALNFIDVQKVNSSYRMEQGFTFELNLAGVSDEHRDAFAGTGKGS
TK
392418419YP_006455024.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTDAVDSAISLGLTGRVVLVTGGVRGVGAGISKVFGDQGATVVTCARRPV
DGLPYEFRPCDIRDDDAVKALIDGIVADHGRLDVVVNNAGGSPYVPASDA
SAKFSTKIIALNLLGPLSVSSHANAVMQGQDSGGAIVNISSVSGHRPTPG
TAAYGAAKAGVDNLTATLAVEWAPKVRVNSVVVGMVETEQSELFYGDADS
IAAISKNVPLGRLAKPTDVGWATAFLASDAASYISGATLEVHGGGEPPHY
LSTTTADIR
392418418YP_006455023.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQGVVDEIVASGGEAVTSGANVADWAQAEGLIQTAVDSFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRAKSKAGDTVE
ARIINTSSGAGLQGSVGQANYSAAKAGIAALTLVGAAEMGRYGVTVNAIA
PSARTRMTETVFAEMMSTQDQDFDAMAPENISPLVVWLGSVESRDVTGKV
FEVEGGKIRLAEGWAHGPEIDRGARWDPAELGPVVGDLVGKARTPVPVYG
A
392418417YP_006455022.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MADPSRPLSDKQIKSLNSKPVGFGIKWMSRAQTWLFKKTNGRLGDKFLRG
SEVGILTTTGRKSGERREVPLLFLQEEQRIVLVASQGGRDTHPMWYLNLK
ADAQVTFQTKRETLELVAREATDAERDEYWPKLDAMYADYANYRSYTDRK
IPIIICDPA
392418416YP_006455021.1 hypothetical protein Mycch_4640 [Mycobacterium chubuense NBB4]MISDADRIAAAQAYISALASHDADTVPFAPGCTRVEVGIKTGFSGNHLRR
SLNGGLQYRVISSVGTPEFTVDGNTVRARFDLSTKPTLAGRRVGAHVDET
FLIPADDPSGRAQIHHINASIRPFLTR
392418415YP_006455020.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQRALVEKAGIDANEVEQ
VIGGCVTQFGEQSNNITRVGWLVAGLPEQVGATTIDCQCGSGQQANGLIA
GLIAAGAIDVGIACGIEAMSRVGLGANAGPDRSIIRPASWDIDLPNQFEA
AERIAKRRGITREDIDQLGFDSQRKAQQAWAEGRFDREISPIEAPVLDEN
KQPTSERAPVTRDQGLRETTLEGLASLKPVLDGGIHTAGTSSQISDGAAA
VLWMDSDVAKAHGFTPRARIVSQALVGAEPYYHLDGPVQSTAKVLEKAGM
KMGDIDITEINEAFASVVLSWARVHEPDMDTVNVNGGAIALGHPVGSTGS
RLITTALHELERTDKTTALITMCAGGALSTGTIIERI
392418414YP_006455019.1 cytochrome P450 [Mycobacterium chubuense NBB4]MPGPNSCPISPDFDFLDASLNLERLPVEELAELRKSEPIHWVDVPGGTGG
FGDKGYWLVTKHADVKEVSKRNDIFGSSPDGAIPTWPQDMTRDAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAIGRLEDELRARAQKIAETAKAEGSG
DFVEQVSCELPLQAIAELLGVPQDDRDKIFRWSNEMTAGEDPEYAEVDPA
MSSFELIQYAMKMAEERAKNPTEDIVTKLIEADIEGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSQNPEQWELFKKDRPETAADEIVRWATPVS
AFQRTALEDTELGGVKIKKGERVVMSYRSANFDEEVFDDPHSFNILRSPN
PHVGFGGTGAHYCIGANLAKMTINLIFNAVADHMPDLKPVGEPERLKSGW
LNGIKHWQVDYTGQCPVSH
392418413YP_006455018.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFSRDEGQQAVADVVTSVLDRDNTWDALVSGGVTALAVPERLGGDGVGL
AEIATALTEIGRHGTISPALMTLGATAVLLDLASEAQQDRYLAGVAKGSV
LTLAVNEPGCSMPDRPSTALSAGKLNGTKLAVGYAEAAEWIVVTTDSGVV
VVPGNAEGLTVTRTPASNGSDEFVVTFTDVAVADDDVLAGATANRVNQLA
LATLGAFAAGLVAGALRLTADYVATREQFGRPLSTFQTVAAQLSEVYIAS
RTLSLVSTSAVWLLSEGLDADDDLAILGYWLTSQAPPAMRLCHHLHGGMG
MDITYPMDRYFSSIKDLTRLLGGPSHRLDLVGA
392418412YP_006455017.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MYIELTPGQRQLQAELRQYFSTLITPEEAAAMESNRHNEAYRAVIKRMGS
DGKLGVGWPKEYGGLGFGPIEQQIFVNEANRADVPLPLVTLQTVGPTLQV
YGTEEQKKKFLPGILSGDIHFAIGYSEPDAGTDLASLRTTAVRHGDEFIV
NGQKMWTTGAHDADYIWLACRTDPDAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVRVPADMLVGEENGGWKLITTQLNHERVGLGPAGR
VAGIYDQVHAWASKPGSDGVTPIDQADVKRLLGQIKAIWRVNELLNWQVA
ASGETIAVADAAATKVFSTERIQEVGRLAEEIVGRYGNPADPETGELLDW
LDKMTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
392418411YP_006455016.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMSEQTSIDDISAAAERVKAEGKSAPRKGRHPVNQPMVDHWLDAMGDKNPI
YVDEDAAKAAGHPGIVAPPAMIQVWTMMGLGGVRPDDDPLGKIIELFDDA
GYVGVVATNCEQTYHRYLRPGEEVSVTAELTDVVGPKRTALGEGFFITQR
ITWTVGDEPVAEMMWRIMKFRPAEKDADATEASVPQDLDAAAMMRPASSK
DTKFFWAGVNAHELRIQKRPDGTLQHPPVPALWADPKDEVAPADYVVASG
KGTVFSFVVHHAPKVPGRTLPFVIALVELEEGVRMLGELRDVDPAAVKIG
MPVRATYIDFPDSESGPAWTLYAWEPAA
392418410YP_006455015.1 MaoC-like protein [Mycobacterium chubuense NBB4]MSTESVAVGTKLPELALYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRFITDWAGPTAVIKSISLRLGVPWYAYDTVTFKGEV
TDIVDDVITLKIVGSNSLGDHVIATATLVFGGAA
392418409YP_006455014.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MTGELSGKAAIVGIGATDFSKNSGRSELRLAAEAVLDALDDAGLAPADVD
GMVTFTMDSNTEVAVARATGIGELKFFSKIHHGGGAACATIQQAALAVAT
GVAECVVAYRAFNERSGMRFGQVQMRLVENADSTGVDNSFSYPHGLSTPA
AQVAMIARRYMHLSGATSKDFGVVSVADRKHAANNPKAYFYGKPITIEDH
QNSRWIAEPLRLLDCCQETDGGVALVVTTPERAKDLKHRPAVIEAASQGA
SPDQYSMVSYYRPELGLPEMGLVGRQLWEQSGLTPDDIQTAVLYDHFTPF
TLIQLEELGFCGKGEAKDYIADGAIEIGGRLPINTHGGQLGEAYIHGMNG
IAEGVRQLRGTSVNPVPDVEHVLVTAGTGVPTSGLILG
392418408YP_006455013.1 hypothetical protein Mycch_4632 [Mycobacterium chubuense NBB4]MSSREPEPNDEDTGPLHVNSARASAADAEDRRYDAPLSVNPRPVHRNRRP
VLLLAAAIAAVIALGVLAWLFWPSGGGSGSSAKNPGPTTETESRQAAEGH
LMGMLPRGYAPDACEVVVPAKGALAQVSCTNNTDPGGPLTATYTLAKDSD
SLKDLFDDVVSTSSVVDCPGNIQSPGPWRRNATPQQSAGTLVCGFQQSKP
TVAWSTDANLMLSEVQSGPQGPNMVQLYTWWASHS
392418407YP_006455012.1 protein of unknown function (DUF1942) [Mycobacterium chubuense NBB4MKIKPALAALTTAAAAAVGVAGAPFASADADVKYLGQPGELANGSVVQHW
TVTGLKPSTDTIPYRPAGQLWEATATDEAISGNVTPIVSNLNARAKNGDT
YRVLFGVATPQGVNPSTLAQGQKTTGKIYFDVTGEKPDSVFYSSGGPDEL
LWVEAPPAPASSPTGGSASTRTGTSPSASGTAETASPAPTAAPAAATPAP
TAPTATPAAAGSSGTPLPAGSSGTPLPAGSSGTPLPAGAAPAAEGGPAPA
PAAVSPAPAAPAPAGSAGTPLPQGSTGTPIEGVAPAQAPAGTAPATTVVM
PPPA
392418406YP_006455011.1 hypothetical protein Mycch_4630 [Mycobacterium chubuense NBB4]MRGDSCLITTIRGFYFVGRHSKNVARSATIRAYLTAGVTAGVTGAAMAGV
GALTLIDDHAPAPVRYEVQLASTGQDCGPGTGLSCDGNGDAQKIAAVDAP
AVAVRPMIGPGGWLYGDGADAADDCTGSACNGGNAGLLGGNGGDGANGGS
GGRAGLYFGNGGDGGDGVDAVYENGKLVSAATRGGNGGAAGLFGNGGNGG
NGGSNANTLDVPNNPDTPTDESTANNAVGAAGGTGGAGGRISGNGGAGGN
GGDASSAHGSSRGGSGGAGGDALNRGGTAGSGGNGGNAEADATGKSATGG
SGGAGGDGSRGTGGDGGDGGSADGGAGASATGGSGGSGGDIGHSGQAGNG
GDGGDADAIGGDATGGNGGSGGSSVVGTSPGLSGSGGDGGDGGDGTTSPT
KTGTGGSGGAGGNGGLFGRDGDDGADGTGSGTPPASASSTSASDSASD
392418405YP_006455010.1 hypothetical protein Mycch_4629 [Mycobacterium chubuense NBB4]MSDSATSHPARRSAPGWIAPAALAVAVVAVALAVWALVRAPESGQTAPAS
SEQSAQAKTQVCNAFTTVRSAVSLQTNANLGNDRVATQAVAANARLATLG
GGQYLLSRLTDAVPTDLADAVRSFANDLQDIGMGQLAGLRGDDPTQTGHM
NNAQKTAEKITGLCK
392418404YP_006455009.1 hypothetical protein Mycch_4628 [Mycobacterium chubuense NBB4]MIGRSDFARSSQPAIDGWRRSLPAETKYTRALGAAVVAGGLVFSASLYPL
PDGPSLFGALRPAEHGLLSRLPSLVESAGANHKIDFTAVALPELAHLVEV
MTQTFHAVPVETLLTMVEKFGLSNVVTSFEVLASSAAAAHDNSVSFAGGG
GGGGGGGGSVPLPTVTLPQVVLFLEYLMQRFHGDLAQGLVAIAHLPPIQL
SALPAQLSALPAQLTALPARLDVVPIQPALAPPLVATLALPPPPPPPPAP
PPPPPPPPPAPPPALSEVSAQTPIEVVSPPPLVAPTPVTLVETPVPTYVE
TVTTPPPEVPAPSFEATPSASAVSTPPEIPTTDDVPTTQNGQESDGGSSG
QGSGHDTNTGGTGQGTDANSTESSGQGPSGSSGDSSGGDGSSSRSGAGSS
QGGTGADSGGASGGGSSGAG
392418403YP_006455008.1 response regulator containing a CheY-like receiver domain and an HTMTLLGLRPDPEAEQGSDSDDTRVSRLSSGSEPMPTRRIPARTPEANLARL
VGGVAVSNHQVVAPKATVLTVAGVAQGSGGQIISLPPPDSPTSIRTDKNR
SLRGKFIDGDILIVDDCTLHRESLATVLSLRGIATVRVASDLPTLVAALE
GSEPRVILLNMDSRGVQRFLRAMSSLSTRAGVIVIAASLEDESAIIACAE
AGVAAYHMRTDSFSHLIALIERVAAGEVSCPAAVSAILLRHLSSLASRRD
SGGRDLVLTTRETQILQMLELGRSNQDIAAHLSIAVHTVKNHVHNLLTKL
GVSTRAEAAALSHAVRRAGQSQGTRSGSSQNWP
392418402YP_006455007.1 glucosamine--fructose-6-phosphate aminotransferase- isomerizing [MyMCGIIACRTESPAIDYLLTALGRLEYRGYDSAGVAVQTVDGTVARLRTVD
RIGALRAAVTAWAGGHFGNVGVGHTRWATHGSVSVVNAHPHTDCSGQISL
VHNGIIENADDLRTALTASGHEFHSSVDSEVICHLIEDQLKISADLLEAV
QASLLALDGSWALAVLEECSGRIVVAARRSPLLVAHTPVGQFAASDITAI
AEWVDEFRVLEDGDVVELTDSGDSADGAAPALARCVWRSNDSELSGYVDY
MAKEIDEQPAAAARLIDEVAGGIANGKLWADLGLAPFERLQVLACGTSLN
AGHVIGNLVRRLGGLPASFIVASEAAGEIVEPHTLCLAISQSGETADVLA
AVEHRTPAESVLALTNNSHSTLARRADAYLTCAAGPEIGVAATKTFVCQV
IAGAALMISALVAVDRIAAADARTFVDDLRRLPDQLDAACVIAKYEVPRV
TEELSSAAGFIFMGRGSGVPYAAEGALKLKELTYRWAEHYPAGELKHGPL
ALIGPGTPVVVVDNAEPRLAANVAEVTARGALVIRIGPAGSTIPVVTHPV
APWGPLESVIPMQILARSLGLALGWDVDKPRNLAKSVTVE
392418401YP_006455006.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMRALVTGAAGFIGSTLVDRLLRDGHDVVGIDNLSTGLMTNLDSAFDYYSH
GGCGRNRFTFVRNDIQAPELADIVMGSNPDVIFHLAAQVNLRASVTDPLF
DARSNVLGTVNLCEACREAGVRRVVYAASGGSRYGAPTHLPVSESVPLGP
LSPYAVAKVAGELYLRAYAEMYGISPICLALANVYGPRQNPLGEAGVITV
FASAMLTGRGTRIFGDGTSSRDYVYVDDVVDAFVRAGAAHDGVTDTFNIG
TGLQTTVGEVHRLVSDAVGSCASPAFNATHPGELHAIALDSSKAEAVLGW
KPTVGVADGVQKTIEWLRATLVPGSEAQAPPKALIGA
392418400YP_006455005.1 glycosyl transferase [Mycobacterium chubuense NBB4]MTTDVTANGHQNGVLSTRLVGTEVEEQNAAAGAVAPRSRAKRGRPNLPRR
NPTVSLVIPVRNEARNIAWVLEQIADDVDEIILVDGNSTDATLITALRYR
PDIRVVPQEGVGKGSALRTGFFAATGDIIVMMDADGSMAPCEIRHYIHFL
NNGYDFVKGSRFTGGGGSLDITRFRRLGNRFLLTVFNTLYGAELTDLCYG
YCAFHRRYLETLALTATGFEIEAEMTVRAMQAGLRVAEVPSLEMPRRSGN
SNLHAIRDGVRVLKTVLDGRRTQTV
392418399YP_006455004.1 glycosyltransferase [Mycobacterium chubuense NBB4]MTAIRRGPLRVAMVSAHALPEMGGIETHVHEVSTRLAASGADVEVLTTDR
SGELPIEEELPGYRVRRWHAYPGWGDYCLSPGLAQHLMTGRYDVVHVQGI
RTFLAPTALAAARRAKIPYVLTLHTGGHQSAIRHSLRPLQFRFSSPLLRR
AAAVVAVCEYERAMFARLLGVSDTAIRLIRNGCDPLPIDPAAEQQGGSPL
IVSGGRLERFKGHHRVLGAMPDILAEAPDARLVIVGEGPYEKSLRAMADE
LGVADRVSIRCYGPRERGSLGRLVADADVFCLLSESEAHPIAVMEAVGAG
TRALVADTTGLSELGRAGLVTAIPIRASASQIASAVLDLATAPGVAPTPS
MSWDECAAQLHELYCEVVR
392418398YP_006455003.1 glycosyltransferase [Mycobacterium chubuense NBB4]MRILLLAQFLPPIIGGVERHVWTLATALAARTHEVTLLGLAAGDQDPGES
TVGGVRIVRVRAATSRLPFLYSDPARPHVLPVPDPLMSRAIRRELSEHRY
DIVHAHNWIVNSALGAATRARVPLVMTLHDYSHICTTARLMEKGRQRCSG
PSLGRCMSCASSHFGPGKGQAIVAANTWSAWRRSRSITRVAAVSAAVANA
VKADDSPAWISGAGLDAHVIPNFIPDEIVLDEIPSTSHDAPLLFVGDLVP
DKGVHILMEAYGHLDDPPPLVLAGRVGPELSLTIPDGVQLAGALPHDEVL
QLFRSARAVIVPSVWSDPCPTVVLEAMAAGRPVVAAASGGILDMVVDGVT
GLLVPPGDAFALAHAINAILRHPQSAHALGAAGRNRARSFTVSAVVDRIE
RMYGDAIMATNPGVAHVG
392418397YP_006455002.1 membrane protein involved in the export of O-antigen and teichoic aMSAKRLLQQNGLLGIFASQVGSHVGGALLGLVFWLLAARTLTPGQLGLGA
ALVAAMTLLSMLGLFGIGTLLIERFKYVAVQERWPLMTTGLATAAAGGVF
ATLAWLVVSALAHFDGVLGDLSLNHVLLLIAATAIATVCSAFDQAAIGMG
AAHVQLRRNIIASCLRIAFLVGAIALDFISGEIILISWIFGLVGSLLVSR
FRSHVLPRSGVTARQRVNIVRDHWATAVSHHGLTLALASSSLMLPVVVAS
MMSAEQTAHFSQARLLADTALAIPYFLTIALFATVHDLEGFRRTARRTIA
LGMVLALCFFTGAVLLGRFLLLPFGSEYAEASPPLLVLMLAGGPVLVLKD
HFAVLRRLQGKRVSGAVAMALWAAAELTGAVVGGLRGSPAMACIGWLVTS
AVCALFALPVLIGGMRGSASSVASSDGPQVEADRKLAEFWTSYVEAGRSK
FRYVLLNPLCTFRALRGVRDLAVVRVARPSDGPGGRAVREVLDLRGPFGI
PARWFGSAAVNVPADASEHLTGAHAQTLRRKIRAAQRHGVSCRMVEQAER
SALLSRANTAEQVHRDQQYRVLAPHNDDLLEHDLWMVAEDSAGEPILLTV
IPIDGEFATLRYFRTLGAGDVFSLSRYTATHAVVEELSKRNVRWLLDTAP
SGGQTNGVRHFQRMVGFRYVRLVRNTVSAVSVPTTSREGMRRLETDHPAG
VRPEMQSAP
392418396YP_006455001.1 hypothetical protein Mycch_4620 [Mycobacterium chubuense NBB4]MISTVAAVQGARNATRSEAGDFTGQPTGAVWDLLIFQVVALTLQLVAVTM
AWRGVNEQANILSCGGIAMTFASALWALSRPRLDRALRNTAVVCLGITTT
VQWRMNDPLLFRGYDEQLHMRTLADIESSHSLFQPHPLLAVSPRYPGLEA
LAAFFTQLGLPVMIAATAVVLLARLALVLTLCAAVEHLTGSPRAGGLAVA
VYAISPQFVFFNSQFAYQTLSLPLALAAVAFIAQARRSDDARPLLAGATT
CLLAVAFTHHLTSLLTAAFLIVWAMAEPKGQVRRRVAFGAVVAVLATAFW
AAVQWSLLRDYFGPMIDDVVLQLTSGMQRSPFSETSADPKPSWERGLLLY
YALIVSLTVSFLVLLSSRSLVRRVRFASGRRRVATSTDDLRPWEPRIVLV
MMVAMIPLLFAARALPRWGEVGDRASTFLYLPFSLLVVGVALYWFRKPLF
ARKDGSDARHGRRCGATRARGRILIRPLALILGTAAFLGGYLLGSGSEWA
RLPGGYLPGGDGRSMDAETLAAVRWARDQLPAGSRIGADRLSATLLASRA
RLWPVLTHTDSPEVASLYKADGWGPGQSDIVRSKHLQYLYVDRRFAGAEP
RVGTYFDESPALKLTYAELTKFDRVPEIRQVYRHGPISIYDLSGLGVSIQ
RSGWFGQTRPSSIPTQVLIGLLYGTAFALIGRGAAGKRVTAAARSILTVA
GPFLSFTFGLAVLCVSSVMLLLFRIWLGPAIFISLVLAIALVNPRCILRA
VTSIATVIRWKWFVATVTLALAAAAVITLSALHASAAHRLAFEEDTILSA
TAAPAVEREIGCVLPYPTLRKGDVG
392418395YP_006455000.1 putative glycosyltransferase [Mycobacterium chubuense NBB4]MTVKSAGTSLTLGVVICAYTLERWDDVLAAVASIRNQTTAPQEIVVVVDH
NRDLFDRLRAAMPDVTVVENARQRGLSGGKDTGVEVTTTDVVAFLDDDAV
AHPDWLRHFRDAYIDDNIVGVGGTTLPRWESARPRWFPEEFDWVTGCTFT
GREPGPVRNLLGGNASFRREVFSVAGGFPSHIGRTSLQSRPLGCEETEFC
IRVSQHRPGWRFLFEPKAVIWHRVPAERERFSYFRSRCFAEGLSKAAVTR
SVGVTDGLSVERKYTTRILTRGIAKGFGDALRGDPAGIERSYAISVGLLS
AAAGYARGGVPLRRRNLVREAS
392418394YP_006454999.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MIQSVPILMYHAVADAPSAATRRLSVTPKSLIEQIAFLADSGYTGMTFSD
LASAFEEGAALPERPVVVTFDDGYADFAETAWPILERRGFPATVFVTSGW
VADAGSHAAGKPLDRMLTRAQIRGLAAAGVEIGAHSHSHPQLDQLDDATL
CEEIRFGRALLEESIGRPVRSIAYPFGYSSPRVRLAARAAGYRCAASVRN
LRATPSDNVFMLPRLTIRRSTDEDAFAAIVTGAHGPVLRQERVLTAGWAS
VRRSRRAAKWVLGHA
392418393YP_006454998.1 beta-glucanase/beta-glucan synthetase [Mycobacterium chubuense NBB4MVDDFSGPAGSPPNPTVWGYVTGHNWDRGVQAYRSSNAVLDGQGNLAISA
VRSGDGFSSGRVQTKDKLSLGYGKTTARIKMPAGQGLWPAFWMLGVDGGL
GEIDIVELVSDPSTYYATIHGPGGGSKPYQVQFTGSVGNLSTGFHDYWVT
HAPDVITVGIDGTTIGTFTPRSLPEGARWVFNQPTYAILNLAVGGSWAGP
PDASTPFPATMLVDWFRWDPL
392418392YP_006454997.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMSGIAFPDTTTTIPAADVGDDVVADFAAAADRWPDRPALVHNGAVVTYGE
LMNRVRLLASRYRAHRSGDETRPDLIGALVSHAPGVVAHLFGILQAGATY
CPVDAALPEARRESIADVLGLDRLFATTAPSQHSTNLRIDTFDPSGGGLC
AEVLQPPWDPSYPAYVLCTSGSTGTPKPVMVSRHALTVTVRALRELFALT
PHDRVLQFASLGWDTCLEEILPALTAGSALVFDDAAHSGSFAPFLRMLAE
REITVVDLPTAFWHELVLFLHEEKAALPESIRLVVIGGERVDLTRLRQWR
NLELGHVGLLNTYGCTETTMITHAIQLCGPGTGPGIATSDTTAPIGRPLP
HVRDHITDDGELLVSGPGLATGYLGMPEKTASAFPVIDYGTGPERWFRTG
DIATRDERGLLYSQGRADEQVKVLGVRVHPAEVEMQLITHPAVTGAVVVG
EHRLGRTSLTAYVVASEATTAAEVKSHLRERLPNQFVPTRVNFVASLAYT
ASGKVDRAATRRAASENNNKGAGR
392418391YP_006454996.1 phosphopantetheine-containing protein [Mycobacterium chubuense NBB4MTPEHIIQIFRRVLDTTEVDEHSDFFELGGDSLLATRVLSAIARQFEIEL
DYDDFADNPTPSALSDLAAVTP
392418390YP_006454995.1 monoamine oxidase [Mycobacterium chubuense NBB4]MRVVVVGAGLAGLTAALELEAAGADVAVLEARDRVGGRMHGIRATPGVVA
DGGAAYLGVRHTELLALIREYGLRLASTEMLGESTFLIGTERTTTASRVP
PLDAIALGDLFDRLDDLVGQVRLDAPWQSPGAECLDRISAADWLADAVKR
PDAHTFFPLFLGEMMAADPAAISALHMAFYLRSGGGIRYLNAFEGGAQQW
RIDGGSHQLCEAMADRLGDRVRLGRTVRAIHQNRDGVVVRCVSDADAALT
EYPANRVVVALPPVLAQRIEFRPGLRAPRATATTGRGCAVKVHMGYQSPV
WRDHGLSGWSVSTSGPLLSTVDDSPPDGSAGVLTGFVTGAAATDFSALST
AQQMDSALAHARRLFPGLPAPMRCTVTDWLGEKYSRGCYAALFGPGDWLR
LGPTLTEPHGRVHWAGTETSLEFFGLMEGAIRSGRRVATELIEGADVATH
SRKVLSR
392418389YP_006454994.1 lysine 2-3-aminomutase [Mycobacterium chubuense NBB4]MTTLTEPEEAGFTAVTDQPYSYVRRPLSEPDWRRYPGWAAVTESEWRDPQ
WQRAHSVKNIGQLRAVMGDLLDERFYDDLADDQQHRATMSMLLPPQMINT
MAPHWTPDSGALTDAFYVDPIRRYMLPLLSDRHAEWCSHPYAERDSLHES
DMWVVEGLTHRYPTKVLAELLSTCPQYCGHCTRMDLIGNSTPTVSKSRLT
LQPVDRQEQMLDYLRATPTVRDVVVSGGDVGNVPWPRLESFVMKLLDIDS
IRDIRLATKALAALPQHWLQEKVVDGVGRVARLAAARGVNLAVHTHINHV
QSVTPLVAAAARGLLDAGLRDVRNQGVLMRGVNATTEDLLDLCFALQGEA
SILPYYFYMCDMIPNAEHWRTSLAQAQKLQLSIMGYLPGFATPRVVCDVP
FVGKRWVHQVAEYDQNLGISYWSKNYRTGLEGADADALSRLYPYFDPIDT
LPALGQAWWRKNGDHHCDVSTSAGFASVGLSVDGGTVSEPYGAVEGVDAE
LDANSPPVITLAAVIPSGELPA
392418388YP_006454993.1 hypothetical protein Mycch_4612 [Mycobacterium chubuense NBB4]MQAKKTRRTSVDPIMDTDVAAVADFLSANHNDRVPWAQACSKPPWQVDAP
NRGFMLRDGQRVVGTLLALYSERMVAGRVERFCNLGSWCVLPEYRSRSLS
LLNAVLGQEGYNFTILSPDEGPQEILSFLGFRFLDTTSALVPNLPWPTLP
GRIRISADPDMIENRLAGSELKLYRDHRAALATHHLVLLHGDESCHVMYR
KFRYKGAPLFAIILHVSNADLFRRALVPLARHLLIHHRLVSTLVELRLVD
QRPRMSFAVTNWPKMYRSANLEPRQIDYLYSELTCVPW
392418387YP_006454992.1 response regulator containing a CheY-like receiver domain and an HTMLLDDCAVHREALAVLLRQRGVGQIREAWDLPSYVSVLAKTSPSVILLSM
DSEITEQLLRVVATMRSDIPVIAVMTSELDEAGIVACAEAGIAGYHMRNE
PTSVLLSLIGEVIAGGVRLPPRVSAILLRRLTTVAARRQTVPCDMALTSR
ELEILRMLEEGRSNQDIADELGIALHTVKNHVHNLFSKLGVRCRAEAATL
AKALRMERYGKSRMRARLV
392418386YP_006454991.1 glucosamine--fructose-6-phosphate aminotransferase- isomerizing [MyMCGIIACRTIQPAVEYLCTGLRRLEYRGYDSVGVALQTATAEVAHLRTVE
RIGALDELVRGWSGAPLNGVGIGHTRWATHGLVSEENAHPHADCNRRIFV
AHNGIILNADQLRDELTRSGHRIATAVDSEVLSHLIEDALSEHRDLFKAV
QTGLTRVQGTWAIAVLERGTGRIVVASNGSPLLVAHSAHGVFAASDIAAI
VDWTDEFQVLGDGDVVELVDGGQWVRAEADSVPLISRRCSWQGRDADLNG
YSDFMAKEINEQPAAACRVIDDLGTSIDSGELWTDRGLGTFDRLKIIGCG
TSMNAGLVIGNVVRRLGRIPVTCTIASEAADDIPETGQLTLAISQSGETA
DVLQALTSDAIGGAPLVALTNNQHSSLARRADAVLNCDAGPEIGVAATKT
FVCQVIAGAALMISGLSATGRIDRSAAARLTDDLRRLPEKLAAALNVAQC
RVPPLIEELSDCAGFIFIAKGSGLPYAAEGALKLKELTYRWAEHYPAGEL
KHGPLALIGAGTPVVVVDNGDTRLRANMAEIAARGGQLLTIGSADSAIDV
ASDPSAAWGPLEATVPLQVLARTLALSLGHDVDKPRNLAKSVTVQ
392418385YP_006454990.1 nucleotide sugar dehydrogenase [Mycobacterium chubuense NBB4]MTPIATRNNADTIEVDRERMYATIGESVREPGTIGVVGLGYVGLPTALAI
VEAGASVVGIDVSAARLADIRAHRVDLIESDRCRLGRFIDTERLSFSDDV
TRLRDADSIIICVPTPVDGHLVPDTTALSAACNSVVGVARPGQTIILTST
SYVGCTRELLVEPLRRRGFIPGSDIFVAFSPERIDPGSPSHLPKRTPRVL
GGVTTACTARAERTLAKSAPWVHVVSSPESAELTKLLENTFRAVNIGLAN
EFATIAGELGVDIMEVIAAAATKPYGFMPFHPGPGVGGHCIPCDPHYLLW
QLRANRIPTPITEAAMAAIAARPRAVVLRAQELLAESGRPLASSRILVVG
IAYKPGVADVRESPALQIIDELQDHGALVSFTDAMVESVITLAGPLKSEA
DPARDEWDLVIAHTLHPEVDHSWLSSHSLVLDATYRLSDAVGRHTL
392418384YP_006454989.1 glycosyl transferase [Mycobacterium chubuense NBB4]MASPITVIAFACLILGFNTLFWATVGAGRYLGSRLTLMSRCVIEQSPESG
RHRRRSSRSGVAQQFTPDDVAVLIPAHNEAAVLERTVCAATRLVDAANIH
VVSDGSTDGTPNIALQLGVQVLDLPHNSGKARALRAAIEHFELAQRFRVV
LLLDADTRLSDDYLATGLPEFDDEGVVAVAGSVRCSLDPPPRKLMGRLLL
AYRARVYVGVQLLTKYGQAGRWADVVSIVPGFASMYRTDVLDSIDITAPG
LVIEDFNMTFEVHVKKLGRIAFRPCAAVAYTQDPDAFGDYVRQIRRWSLG
FWQTVRLHRKHFGRFWFALTAQVAELICGSVTLLCMPPLMLFAVYTEAVS
ATYGPPEVAGHELVGTLTPQIVALGFLVPDLLVTLLAVCALRRPRLLLFA
PLLPALRLLDAYVCLRSLVAATRTRSTGRWVSPVRRAAASTVAMLKTDDP
ASDFASAVTTCPVSRNS
392418383YP_006454988.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMRTVITGGAGFIGSHLTDHLLEAGDTVVVLDDFSTGSIANLAHHAHDPRL
QVVEGTVLNRRVVEGVVADADRIFHLAAAVGVRRIIDEPLKSLRVNITGT
ENVLDAALARGVTMVLASTSEIYGKNTANRLSEDSDRILGSPLMSRWSYA
AAKAIDEALAHAYWRELGLKVATARLFNTVGPRQTGRYGMVVPTLVSQAL
RGETLTVFGDGRQTRCFSYVGDIVPALVSLSEVPAALGLAFNLGGLREVS
ILELAGRIIELLDSSSDIELVPYDKAYGEGFEDMRRRMPDISLAANVLHF
RPQTNLDEIIMRVAEGLSVASCLEASSASL
392418382YP_006454987.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MHRSRNLPRQRLALALALVLLPVCGLTPAGCGIELRSASQPPPTTEVSSV
PSSGPRRLVELPLPPTDPLHVVQGQTVVSITFDDGRKSNIAAARMMTADG
LAGTFFVNSMTIGTKGYLSQADLVEIARMGHEIGGHTMTHPDLGELTGDE
VRRQICDDRENLLGWGFPIRSFAYPFASASTDAETAVRQCGYNSGRSLGE
LRTHRPPPNVDPMLSCQDCALAEVVPPADPMYTSAPAQVRSDWTASDLQQ
QVLDAMSVGGWIELTFHGLCPTDCNSLTTPQTEFGDFLAWLAGQQSAGKL
LVRTVGDVIGGPVRPPIAGPIAPPAPPGANGVKNSGLEQLSDGSPVCWLQ
ASFGRNRPEFSLSSDSHGGTTAGRLIMRDYVDGDAKLLQSTDLGHCAPSV
SPGGTYTVSAWYKSTAPTSFSIQFRHGLGRWAYGLNSPTFPASTDYTLAT
WSLPTMPSDVTAVSFGLALAENGELIADDYSLVDDATASK
392418381YP_006454986.1 hypothetical protein Mycch_4605 [Mycobacterium chubuense NBB4]MTSARPVWRRLLLGAVLGTMAPLCTLCTFRHFAIADLSGRNYPWHHNIVA
TTFWVGEVVDPAKSDGSQVFSTYDPDWLANYGGCDGFVERGVCRSERRDA
SNGFFPKTMTPRQNPFYLDLPFDDVNNAAAFSMRATVVPWANDPGYAGRS
ADRSISFMKNRWVELRKDGAACFGQIQDAGPAIYDDAAYVFGGDDRRPRN
IRFNGAGLDVSPALNGCLAFARLDGAEDYVDWRFVEDVDVPDGPWKRLVT
TQPLVPW
392418380YP_006454985.1 hypothetical protein Mycch_4604 [Mycobacterium chubuense NBB4]MSIRRYLAAGATIGVTGAAMVGFGTLAFSDHDATAPASVSYAVRLASTGQ
GCGLAMGVICYPGEQPTRPLGGAIQPSAATPGTLKLRPMFGNGGWLVGNG
LDAVAGCTGTACNGGNGGLLGGNGGNGLNGGSGGNAGFWFGNGGNGGDAT
APGGAGGAGGNGSFFIGNGGNGGNGASITAAGNVTGGAGGTGGAAGMLGG
TPGKGGKGGDATSTGGNATGGKGGAGGRGGKAGGDGGAGGAATASTTGTT
ATGGAGGVGGFSAGISGKGGDGGAATATGSAKAVGGAGGAGGNSGNTGKG
GTGGRGGDATADTGSATGGNGGSGGKSVAGTSPGVLGDGGDGGSGGDGHN
TAKTGTGGAGGSGGNGGLLGQKGKAGSAGAGDTASGSAARHATRVRTRR
392418379YP_006454984.1 acyl dehydratase [Mycobacterium chubuense NBB4]MPINLDEAIGAELDPVEFSWTNSDVQLYHLGLGAGSDPMDKRELRYLADD
TPQVLPTFGNVAQSFHMTAPPTVKFPGIDIELSKVLHASEAVTVPGPIPP
SGTGIAVTRFTEIWDKGKAAVIWSETEVKDPAGTLLWTQKRSIFARGEGG
FGGDRGPSGSSSAPDRTPDLELSVPTSPQQALLYRMCGDRNPLHSDPDFA
AAAGFPRPILHGLCTYGMTCKALVDNLLDGDVSALKSYGARMAGVVFPGE
TLRVSVWKNSDDAQAAFTAVVTAPDRDNAVALAGVEFTPA
392418378YP_006454983.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMTEQEYDVVVVGSGAAGMVAALTAAHQGLSTVVAEKAPHYGGSTARSGGG
VWIPNNEVLERDGVSDTAEAARTYLHSIIGDVVPPEKIDTYLRRGPEMLS
FVLKHSPLKLCWVPNYSDYYPETPGGKATGRSVEPKPFDAKKLGPDVDGL
EPPYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAQATGKN
LVGMGRALIAPLRIGLQKAGVPVLLNTAMTDLYVEDGAVRGIYVVDAREP
GAEPHLIRARRGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAVANTGDG
ILAAEKLGAALDVMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNMSGKR
FMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLVFDQQYRDRYIFAGLQ
PGQRIPKKWMESGVIVKADTLDELAAKTGLPADAFKATVERFNGFARSGV
DEDFKRGESAYDRYYGDPTNKPNPNLGELSHAPFYAAKMVPGDLGTKGGV
VTDVHGRAQRDDGSIIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGYL
AALHLAGKE
392418377YP_006454982.1 2-keto-4-pentenoate hydratase [Mycobacterium chubuense NBB4]MLPDEVREKLAADLAQAERSREPISPLTDGHPDIDVVDAYEIQLINIRQR
VAEGARVIGHKVGLSSEAMQKMMNVDEPDYGHLLDEMEVFEDRPVKSANY
LYPRVEVEVGFILSDDLPGAGCTEDDVLAATAAFAPAIELIDTRITNWQI
KLCDTIADNASSAGWVLGEARVSPKDVDIRAIDAVLTNNGEVVAEGRSDA
VLGNPVTAVAWLARKVESFGVRLRAGDIVLPGSCTRAIDAPAGSRFVADF
SGLGSVRLDFE
392418376YP_006454981.1 acetaldehyde dehydrogenase [Mycobacterium chubuense NBB4]MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKL
GLETSHEGVDWLLAQSERPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTP
AAVGPGVIPPANLREHLDAPNVNMVTCGGQATIPIVHAVSRVVEVPYGEI
VASVSSASAGPGTRANIDEFTKTTSAGVQNIGGARRGKAIIILNPADPPM
IMRDTIFCAIPEDADREAIAASIRDVVAEVQTYVPGYRLLNEPQFDDPSI
NSGGQALVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKERASAG
TGAQA
392418375YP_006454980.1 4-hydroxy-2-oxovalerate aldolase [Mycobacterium chubuense NBB4]MNSEKRSGSRIDRADDIYFNPMWDIRMTDTSLRDGSHHKRHQFTTDEVGA
IVAALDAAGVPVIEVTHGDGLGGSSFNYGFSKTPEQELIKLAAETATESK
IAFLMLPGVGTKEDIKEAQNNGGSICRIATHCTEADVSIQHFGLARELGL
ETVGFLMMSHTISPDKLAAQARIMADAGCQCVYVVDSAGALVLEGVRDRV
AALVAELGDDAQVGFHGHENLGLGVANSIEAVRAGAKQIDGSCRRFGAGA
GNAPVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALI
MGYSGVYSSFLKHAIRQSERYGVPAHKLLHRAGQRKLIGGQEDQLIDIAL
EIKREMDAAT
392418374YP_006454979.1 hypothetical protein Mycch_4598 [Mycobacterium chubuense NBB4]MTTSANTVRRGLFGMFAGGLLAFGSAAILAPVASAQPAPAPAPGPDCSAA
SVAGTVSAATASEGAYLTANPQTNQALTEISTEPQPQAEQAYRTFFAQNP
QVEDQLKAIHQPVSALNDRCNVKLTPTAVAQAVWSVSDTGVPAQTPAAPG
EPATPGAPTGPAPAESPATPAQPMA
392418373YP_006454978.1 ATP-dependent DNA helicase- RecQ-like protein [Mycobacterium chubueMATRADAQEILEQLAGPDARLRDDQWTAIEALVVHRRRALVVQRTGWGKS
AVYFIAAKLLRAGGHGATVIVSPLLALMRNQVAAADRAGVHAATINSSNV
TDWDEIHQRVRSGELDVLLVSPERLNNPDFRDQVLPALARDAGLVVVDEA
HCVSDWGHDFRPDYRRIRTLIADLGADVPVLATTATANDRVVDDVATQLG
VGGQDTLVLRGGLDRESLHLSVVHAGNPAQRAAWLAAHLDALPGSGIVYT
LTVAQAHDVAALLREQGFPVAAYTGSTETAEREQLEADLLANRVKALVAT
SALGMGFDKPDLGFVVHLGAPSSPIAYYQQVGRAGRATEKAEVILLPGRE
DQDVWSYFASVAFPSEALVRKVIRELETERPLSTPALEPLVDLGRSRLEM
VLKVLDVDGAVRRVKGGWVGTGAAWEYDEPRYRRLDEARKREQQAMLDYQ
RTDDCRMAFLRRQLDDPDLAADERCGRCDNCTGARYSADVDAAAAEDTRR
ALMRPGVELAPRKQWPSGLGKLGLDLSGRIADGPESGRVIGRLTDLGWGA
RLRALLDGPDGEVPDDVAAAAVKVLAAWDWKVRPTAVMALDSDSHPVLIS
SLATRLAELGRLTDLGTLQYAPERRPVTAANSAYRVAALNGSWAPPAALG
PGAGPVLLVDDMTDTGWTITMAARVLRAAGATAVLPFALAGTA
392418372YP_006454977.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPETSGRTSPPTDRVIAILDFFAGRPQERFGVSELARRLALSKPTCLGIV
TSLSEAGYLVRDTADKSYRLGPSLITLGHRAQESMRVSPAAREELRRLSA
RFGITAALSAVVDDRITLLDLVAPAGVRPGVEIGQSYPFAPPVGLMFVLW
DDGAAREWLAREPTIPLRTDTERLDRVIAECRADGYLVERLTPSGRRLYS
LMAGMSATLPDELRVLLGELVSDIGERVYLRGERTGRGRHDISVISAPVY
DHYRRQVMVASMHVGKSLPHSAITERARAVVTTADAVTAQLGGVKPIWR
392418371YP_006454976.1 hypothetical protein Mycch_4595 [Mycobacterium chubuense NBB4]MYSPPLIDAIAEAEKLVAAAPFIESEADLLEGLQYLAGCVAACTHVAFDY
DRDHPFLHSGTGPFTKMGLDNPDTLYFGTRVVPGREYVVTGRRGTTTDLS
FQMLGGEYTDDNVPDSETAFDDRELDIAADGSFEWRIVPKSPAQLVIREV
YNDWSAQRGTLAIARTDTAGTAPPPLTRELIEKRYAVAGKQLVQRVKTWL
QFPQWFYNTLPVNTMIPPRLTPGGLATQYSSVGHFDLGPDQAMVITVPVS
DAPYMGFQLGSLWYISLDYINHQTSLNGTQAQADPDGKIRIVVSDANPGV
TNWVETLGHRKGYLQFRWQRVSRKMTEADGPSVEVVGIDQVPGVLPHYEH
DKISEEDWRARIARRQLQIGYRMVG
392418370YP_006454975.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMAGALALLEGKVVVISGVGPALGTTLARRCAEAGADLVLAARTVERLEDV
AKQVTDVGRRAVSVGTDITDDAQVDNLVAQALDAYGRVDVLINNAFRVPS
MKPLANTTFDHMRDAIELTVFGALRLIQGFTPALAQANGSVVNVNSMVVR
HSQAKYGAYKMAKSALLAMSQSLATELGEHGIRVNSVLPGYIWGGTLESY
FTHQAGKYGTTVDEIYKATAAASDLKRLPTEDEVASAILFMASDLSSGIT
GQTLDVNCGEYKA
392418369YP_006454974.1 sulfotransferase family protein [Mycobacterium chubuense NBB4]MARTNVGTVEDLHASAVKACGLDDFGSDDDNYREALGVLLDSYARDADFT
ELGSKMSRFFLRNALVARLVSEAAWKQYPQHADVDIVRPIFVTGLPRTGT
TVLHRLLAADPRHQGLELWLAEFPQPRPPRETWSQNPVFAQLDAQFTKAH
TENPDYTGLHYMTADEVEECWQLLRQSLHSVSYETLAHIPTYSRWLAGQD
WTRSYQRHRRNLQLIGLNDADKRWVLKNPSHLFALDALFATYPDALVVQC
HRPAETIMASMCSLAEHTTEGWSNAFVGKTIGADSLETWSRGLERFNAVR
AQHDPAQFYDMDYFDLIADPVATVDAIYRHFGIEMTDDARAAVQECHEES
RQGPRAPKHSYSLADYGLTDEQVKERFKGL
392418368YP_006454973.1 nucleotide sugar dehydrogenase [Mycobacterium chubuense NBB4]MTALYERPEVLDGMVDAAETETALPSVAAPASRSVGVVGLGYVGLPTALA
LAESGAAVLGCDISEAHIDAIKAQQVDLLEDKLATLRRLLDSDLLTLTTG
TAGLPFVDTVLICVPTPVDSHLVPDLTALRSACAVVVEAARPGQTIVLTS
TTYIGCTQELLVEPLRQRGFVVGRDVFVAFSPERIDPGSPSNVPELTPRV
VGGVTHACALRAMETLAMSAGSLHRVSCPEAAELTKLLENIFRAVNIALA
NEFASVAGHFDLDVMEVISAAATKPYGFMAFRPGPGVGGHCIPCDPHYLL
WQLKAGRLPSPVTEAAMASIAARPQAVVRRAQELMADRGRPLAGSRVLLV
GVAYKPAVADVRESPALHIIEELRRLGADVGFTDVMVDSISTSSGRIVCE
ADPAGRHWDLVIVHTVHPSADHSWLSDVPVLLDATYTLPELPQRSTL
392418367YP_006454972.1 glycosyl transferase [Mycobacterium chubuense NBB4]MAFARWIDSQPAHIRRGLRRVLVLAALMPLIVLIAVQAPFLLNAPLLLGY
GMCVLAATILMMYLGFARYEDPSVHPKPAPDIEIRVRHSRVRQARTFPAL
LEMPTVSMLVAVRDEVDDIEQCIRTMVGSDYPRLEVIVVDDASTDGTPEV
LRRLAAELPMTVLYNETNRGKKHALTDGVRIASGEVLAFTDSDCVLAPDA
LSRCVWALTANPDLGAVSGHARALNADETVLTRAQDTWYDGQFRVAKAAE
ATFGNVTCVSGPLAVFRRDAIANYLPAWANDTFLGREFRFATDRQLTGYV
LGQIWKGRELKRRYADDPLVAQQDHPERCWRVGYVRSAHVWTTVPARLRP
FLKQQVRWKKSFIRNLCFTGSFMWRRGLGGAVLFYSHVLFVAAAPVMAVR
HLVWAPVHGLYFLTFLYLCGVLTKGFAWAVAFKLANPGDSHWRYRPLMAV
FGSLVLSWLLPYSMVTIRKGTWARGAQ
392418366YP_006454971.1 hypothetical protein Mycch_4590 [Mycobacterium chubuense NBB4]MRHRRLTTRLVNLLYLAVGALIFLIVLTNGTLW
392418365YP_006454970.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MVTSAGNRVAAWPTRCAHGSIRAFFAVLTIALIATPFGVAWYLHVLGLQV
SEQHSVPPTALTPDQRALATAVDAGLPSHAPPVVLAYHDIRPVTAGGTDS
DRVRDSRHHFVVTPEAFDAQLAALDAAGYTSISSDQYVDYLAGGEVPKRS
VLITFDDGTHGLWTYADRILERHGMRAVSFLITGNVGANRPYYLSWQEIE
RMARSGRWDFQSHTRKMHARMPVDRAGTLASEMTHRRWLSGQNRLETSGE
FEAKIRKDLRGSIQDIADHGLPRPTLFAFPFSEGYNDNGDSRDPEAATIA
MSVIREMFAGALNNAPPLPLPPGARAVAHGMAGRIELNIDSTPEELLTAV
RARTPVTPAQAAPSARPDLWTKLSDDGTSAPVRADDEKLRFLGRDRWQGI
AFGRWATADWASYSVSLTMRGLSAEGVGNAALIARVGSGNEVSAQVSAGY
LRVSTGLGTNQRIVGDLPLTARDDHTVAMQVSPRVVEVVLDGLPMLSVPA
SGGPDGYGGIGLSSSRTMESAPWPVFADLSVATGPDLPNVRSGVGIPIRG
392418364YP_006454969.1 hypothetical protein Mycch_4588 [Mycobacterium chubuense NBB4]MDDKPDVDRLARSMLLLHGGHDDEYDHHPGGDTDSGGSWRKAPDFAQDPD
RAAAVRENTRRDRERYLTSGLASVDCRFCHVAVQVKKLGPAHTSVQWTTE
ATQRCAHFTEIREAGGDPARERSCPRLADSIRHAVAEGCLEEYSSAPSPG
DGGVNRRRARRWRGWAPSRPPRGSLG
392418363YP_006454968.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MSTDSRAGTASIREIDTGTLPDRFARGWHCLGPVENFTDGKPHGIEIFGT
MLVVFADSQGELKILDGYCRHMGGNLSQGTIKGDEVACPFHDWRWGGDGK
CKLVPYAKRTPRLARTRAWHTDVRGGLLFVWHDHEGNPPQEEVRIPEIPE
WASGEWTDWRWNSMLIEGSNCREIIDNVTDMAHFFYIHFGLPTYFKNVFE
GHVASQYLHNVGRPDVNDMGTAYGEAHLDSEASYFGPSFMINWLHNTYGD
FKAESILINCHYPVTQDSFVLQWGVIVEKPKGLDDKTTEKLAEAFTDGVS
KGFLQDVEIWKHKTRIDNPLLVEEDGAVYQMRRWYQQFYVDVADVTPEMT
DRFEMEVDTTVANEKWHVEVEENLKAREAEKQAT
392418362YP_006454967.1 arabinose efflux permease family protein [Mycobacterium chubuense NMTAAVVAPAGAQQRTRRSRRWLAVAAATFAIAWGGNEFTPLLAMYRTDDG
FSTLTVDLLLFAYVLGIVPALLIGGPLSDRFGRRPLMLPAPVLAAIGSIT
LALGADSAVALAVGRVFSGLALGLAMAVGGSWLKELSSPPWDSGNAGARR
AAMSLTAGFGLGAGTAGVLAEWAPAPSVLSYLVNAAMALAAAAVLVAAPE
TRPRAQASPGRPWWTDLAVPAASHRRFLFVVLPVAPWVFGAAGSAYAVLP
ALMAAHAGGAPIAFSALLCVVTLGVGFGVQQLGGSLGADGPRGVVVALLL
LVAGMGAAAWAAVVLTVWAALLAAAVLGAGYGVALLAGLQEIQRLAGPDD
LAGLTAVFYSLSYLGFAVPAVLAFVSTAGPSYPVMFGAGAVVALACLGVT
LFGIRRP
392418361YP_006454966.1 transcriptional regulator [Mycobacterium chubuense NBB4]MVNRRGRPRSEAVRTAVLEAAAELALHGGPGAATMDAIARRAEVSRTTIY
KWWPSAAAIVLEGLLESVRESITRPPGSTSVEAVVHHVSSLYGILADPAV
GPLLRNVIAASASDPAIERALLDQWIIPRRAAVTEVVQDAVERGELAAGT
DVEAAVDAMVTSPYYRLMFAMPALDEDAVEQMVHMVWRGCQPAGESCQPE
392418360YP_006454965.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMTRMKYTCSIAMGPIDQLIEIARTAEEVGFDSIALPDSLFYMEKQAADYP
YTPDGSRMWNEDTPWVDPLIAAGAMGAVTSRLRFYTNVMKLGSRNPLLLA
RQVGSVANLTGNRFGFGVGIGWAPEEFEWCGVPYAKRGKRVDEMIEVIKL
VLGGGMVEFHGEFYDFDRLQMSPAPSEPVPFYVGGHTDVALKRAARVGDG
WTSAMMTGDQLAETIATLNSLRAEYGRADEPFEFQAVCIDKFGVDGHREL
AEAGVTDNIVIPWVFDGLSFDAPLEQKKDSLKRFADTYIHSGWQDSPAG
392418359YP_006454964.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MAKKLAAVLGTGQTKYVAKRKDVSMNGLVREAIDRALDDAGVTLADIDAV
VVGKAPDFFEGVMMPELFMADATGATGKPLIRVHTAGSVGGSTSIVAASL
VQSGKYRRVLTMAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRA
YIRRSGAPTHIGAMVAVKDRLNGAKNPLAHLHQPDITLEKVMESPMLWDP
IRYDETCPSSDGAAAMVIGDEATADARVADGHPVAWIHATALRTEPLAYA
GRDQVNPQASRDAAAALWKAAGITSPIDEIDVAEVYVPFSWYEPMWLESL
GFAPEGEGWKLTEAGETAIGGRIPFNPSGGVLSSNPIGASGMIRFAESAI
QVMGKGGEHQVEGARKALGHAYGGGAQYYSMWVVGSEKPVQPS
392418358YP_006454963.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MTSDTSVAVVGFAHAPHVRRTDGTTNGVEMLMPCFAEIYGDLGITKADIG
FWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKI
LTGEVETALVYGFGKSSAGTLRRVLALQTDPYTVAPLWPDSVSMAGLQAR
FGLDSGKWTAEQMAQVALDAQAAAPRVDRLEPGSTVDELLEQPFFADPLR
RHDIAPITDGASAIVLAAGDRARELRERPAWISGFEHRIETPVLGARDLT
MSPSTAASAEAATGGDASSIEVAELYAPFSHQQLILKEAIGLPDSTRINP
SGGALAANPMFSAGLERIGFAARHIFDGNASRVLAHATSGPALQQNLVAV
LEGK
392418357YP_006454962.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMQIDPHEPPLSAPLKLAFDYTRSVGPLLGEFFTALRERRIVGVRGSDGRV
HVPPAEYDPVTWDRLTEIVPVASVGTVLSWTWQSEPLEGQPLDRPFAWAL
IQLDGADTPLLHAVNADGPDAVSTGARVHAHWIDEPVGAITDIAYFDVGD
QAEDVPPPAEGLDPVTMIVVPTAIEIQHTASMPESAFLRALEQGTLLGAR
TGDDGKVYFPPREANPSTGRPLDQFIELSDKGTVTTFAIINIPFAGQRIK
PPYVAAYVLLDGADIPVLHLVSDIEADKVRMGMRVEAVWKPREQWGLGID
NIEYFRPTGEPDADYDTYKHHL
392418356YP_006454961.1 putative F420-dependent oxidoreductase- Rv3520c family [MycobacteriMKLGLQLGYWGAQPPTNHAELVATAEEVGFDTVFTAEAWGSDAYTPLAWW
GRETTRMRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGAKFPKPLARTREYVDILRQVWAREAPVHSDGPHYPLPLTGEGTT
GLGKNLKPITHPLRADIPVMLGAEGPKNVALAAEICDGWLPIFYSPRIAG
MYNEWLDEGFARAGARRTRETFEICATAQVVVTDDRPAIMELMKPHLALY
MGGMGAEDTNFHADVYRRMGYAEVVDDVTKLFRSGRKDEAATVIPDELVD
DSAIVGDLAYVQEQIKAWEAAGVTMMVVGARSPEQIRDLAGLV
392418355YP_006454960.1 Acetoacetate decarboxylase (ADC) [Mycobacterium chubuense NBB4]MSHSTPVSQHTIAGTVLTMPVRVRTAHQHTAMFTVDADAAQRMIDYSGFR
VCRFGRNKALVVLMLMRYEDTDLGQYYEYGTNVMVNPPGSNARGLRALQS
AGAFVHHLPVDQSFTLEAGRTIWGYPKVMADFTVRGTDNRGDVRGADNPA
TVRGADNPGDVRDGRRFGFDVRIDGQLAVSMDFTPGLPVPAAFTARPQVH
STYSHLDGVTRETPGEMRMTGVRYRPGGVDIRLGDHPYAAELAALGLPKR
ALVSSSAANVDMTFGDAKEIV
392418354YP_006454959.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTVAPTKPDVDLADGRFYADGAAARAAYAWMRANQPVFRDRNGLAAATT
YQAVLDAERNPELFSSAGGIRPDQPGMPYMIDMDDPAHLLRRKLVNAGFT
RKRVMDRLPSIEALCDTLIDAVCDRGEADFVRDIAAPLPMAVIGDMLGVL
PTEREKLLQWSDDLVCGLSSHLDEQAVQMLMDTFAAYTAFTMEVIADRRA
NPRDDLFSILVHSEVEGSRMSDDEIVMETLLILIGGDETTRHTLSGGTEQ
LLRHQDQWAALVADERSREDHGRSSELLPGAIEEMLRWTSPVKNMCRTLT
ADTEFHGTSLKSGEKIMLMFESANFDESVFENPADFDIRRNPNSHLAFGF
GTHFCLGNQLARLELKTMLTKVLERLPDMRLADENMLPLRPANFVSGLES
MPVVFTPSARVLA
392418353YP_006454958.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMSEPDKQPDCLVEQRGHTLIVTMNRPEARNALSGEMLSIMVSAWDRVDDD
PEIRTCILTGAGGYFCAGMDLKAASAKPPGDSFKDGSYDPSRIDGLLKGR
RLKKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGG
SAVRLVRQIPYTIACDLLLTGRHITAAEAKEYGLIGYVVPDGTALDKALE
IAEVINNNGPLAVQAILKTIRETEGMHEEEAFKPDTANGIPVFLSEDAKE
GPRAFKEKRPPNFQMR
392418352YP_006454957.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMALNIADLAEHAIDAVPDRVALISGDQQLTYAELEEKSNRLAHYLIDQGV
KKDDKVGLYCRNRLEIVIAMLGIVKAGAILVNVNFRYVEGELKYLFDNSD
MVALVHERRYADRVANVLPETPKVKTILVVEDGSDEDYQRYGGVEFYSAL
EQGSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIADEYGLAKQAAESGPMVRYPIPPMIHGATQSATWMALFSGQTTVL
TPEFDAHSVWRTIHEHNVNLLFFTGDAMARPLLDALLAHQDAGEELDLSS
LFLLASTAALFSTSIKEKFLELLPNRIITDSIGSSETGFGGTSVVAKGQS
HTGGPRVTIDKNTVVLDEDGNEVEPGSGKRGIIAKRGHIPVGYFKDEKKT
AETFKTINGVRYAIPGDYAEVEADGTVTMLGRGSVSINSGGEKIYPEEVE
AALKGHPDVFDALVVGVPDPRFGQHVAAVVQAREGTRPTLADLDAFVRSE
IAGYKVPRSLWLVDEVKRSPAGKPDYRWAKDVTEERPADEVHEKHAAVNS
392418351YP_006454956.1 2-nitropropane dioxygenase-like enzyme [Mycobacterium chubuense NBBMRTELCDRFGIQYPIFVFTPSEKVAAAVSRAGGLGMLGCVRFNDADDLEN
VLQWMDENTDGKPYGVDIVMPAKVPAEGTAVDINKLIPQAHREFVDKTLA
DLGVPPLPVDEARSEGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKD
VIDQVHAAGVPVAALAGSAKHAQRHADNGVDIVIAQGHEAGGHTGEIASM
VLVPEVVDALDGKAAVLAAGGIGTGRQVAAALALGAQGVWMGSAFLTAAE
YDLGVRTEGGASVIQQALLAAGSGDTVRRRIYTGKPARLLKSRWTDAWDA
EGAPEPLPMPLQNILVSEAHQRMSESTDPTTVAMPVGQIVGRMNEIRPVA
EIIAELVSGFNEATKRLDGIREG
392418350YP_006454955.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMTIDVWMQHPTQRFLDNDMLASLRRWTGGAMPDGDLPIGVTIAAMDAADV
EFGLLSAWRGPNGLDLVSNDEVAGWVRAHPSRFAGLAAVDLDRPMHAVRE
LRTRVREDGFVGLRVVPWLWRLPPTDRRYYPLFAECGELGVPFCTQVGHT
GPLRPSETGRPIPYIDEVALDFPELVIVCGHVGYPWTEEMVAVARKHENV
YIDTSAYTVRRLPAELVAFMKTRTGQRKVLFGSNYPMIGHAHAVDGLGDL
GLSDEARHDFLHANAERVFTKLEGTRP
392418349YP_006454954.1 thiamine pyrophosphate-dependent enzyme- possible carboligase or deMNGAQALIRTLVGAGVDVCFANPGTSEMHFVAALDSVPQMRGVLGLFEGV
ATGAADGYARMAGRPAAVLLHLGPGLGNGLANLHNARRAATPVLVVVGDH
ATYHKRYDAPLESDIDAVAGSVSGWFRRTMRTSDVGTDAAEAVAAARAGA
VSTLILPADVSWTEGAEPADAAPVPPSPGVDDDAVRAALVALRSGAPTVL
LIGGDATREPGLTAAVRIAEAAGARVLCETFPARLQRGAGVPAVDRLAYL
AEAATEQLAGAQHLILAGAKSPVSFFAYPGKPSDLVPQGCAVHVLAGHLD
AAGALQQLADELAPGTSAPVAPATRPTPPSGDLNAFSAAAVIGALLPEGA
ILVDESNTAGIGVAAATAGAPAHDVLTLTGGAIGYGLPAAVGAAIAAPDR
PVLSLQADGSAMYTISALWTQAREQLDVTTVIFNNGAYDILRMELQRVGA
TDAATPGPKALTLLDLGSPAIDFVKIAEGMGVAARRVTTAEGLAAALTDA
FAEPGPHLIDAVMPSLLSG
392418348YP_006454953.1 transposase [Mycobacterium chubuense NBB4]MFTERTSIGLDVHARSVVAAAIDGVTGEVTRTRLTPSFEHIQSWIRHLPG
PVAVAYEAGPTGFGLYRALTETGVRCEVVAPSKLQKPAGDRVKTDARDAL
NLARLLRLDEVTSVSIPSVNQEACRDLVRAREDCRGDLMRARHRLSKLLL
RHGIVYHGGGAWTDAHDRWLRAQAAPQLSTLATRMAFDSDYEHVLMLQAR
RRSLDSAIEDIAADSEFTPVVRRVSCLRGVGTLTAFALAVEIGDWNRFNG
NTIGSFVGLVPSESSSGSRRAQGPITKTGNTHVRRLLVEAAWHHRSKYQV
RAVMRSRWELAPAAARARGHEGNRRLHNRWLGFLARRKRSTVANVAIARE
LAGWCWSLAVMDD
392418347YP_006454952.1 protein of unknown function DUF222/HNH endonuclease [Mycobacterium MLFGELAELTGQRNAIDGRIVEIVAEVDRDRLWAAAGARSVASLVAWKAG
VTPARAETIATLAHRLDGFPLCHQGLREGRLSLDQVGAIAKRAADGSDEH
YADLAASATVTQLRFALKLAPKPKPEPRPEPEVEPEPAPAPEPSISKTSD
GVCTTWRITLPALEAAKFEAALASHQDALITDWKRDHDTEAADGSGQRPP
MPTTADAFMALVEAGWDAETSRRPHGQHTTVVAHLDLDKPVAALHLGPLL
SDADRRYLTCDATCEVWFERHGQPIGAGRTTRTVSRRLRRALEHRDRTCA
VPGCGATRGLHAHHIRHWEDGGPTEMSNLVLLCPYHHRAHHRGLITITGP
ADRLVVTDGAGRALSSASLARTPTTPPPAVAPYKGPTGERADWWWYEPFQ
PQPPPSDN
392418346YP_006454951.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MSTQIREIDTGTAMTRFARGWHCLGLAESFRDGRPHGIEAFGTKLVVFAD
SRGDLKVLDGYCRHMGGDLSRGSVKGDNVACPFHDWRWGGDGKCALVPYA
KRTPRMARTRTWLTTEVNGQLLVWHDPERSTPPAELTPPTIEGYDQGIWS
PWQWSSILIEGAHCREIVDNNVDMAHFFYIHHAYPTYFKNVIEGHTASQY
MESKPRPDYTADPEKLWDGTHLRSEATYFGPAYMINWLHNDLGPGFTVEV
ALINCHYPVTHHSFVLQWGVSVQQMPGLPADKAAKLAAAMNRTFGEGFLE
DVEIWKNKTRIDNPLLTEEDGPVYQHRRWYEQFYVDAADVTPDMTDRFEQ
EVDTTHANDLWQQEVAQNLAARAAR
392418345YP_006454950.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMSDPGERVRDECERQWDETTDVLVAGSGAGGVTGAYTAAREGLDVILVEA
TEKFGGTTAYSGGGGMWFPCNPVLQRAGTDDTLDDALEYYRSVVGDRTPA
ALQETYVRSGAPLIEYLEADDQLKFQLLPWPDYFGRAPKARADGMRHIAA
KALKVAAAPDLRELIRGPLDTDRLGTPQPADYFVGGRALIARFLIALRRY
PHASARLNTALVQLVVADGRVTGAIVETEGRRRAIQTRRGVLLAAGGFEH
NDEMRARYGVPGDSRDSMGPWGNRGLAHLAGIAAGAGTDLMDQAWWSPGL
THPDGSSAFALWFTGGIFVDDHGRRFCNESAAYDRLGRAVLGAMADGLVT
LPYWMVYDDSAGGVPPVQATNVSMVEPQRYIDAGLWRSADTLEELAVEIG
VPAANLVETVARFNEFARRGVDDDFGRGDEPYDRAFSGGAPLYPIVKAPF
HAAAFGVSDLGTKGGLRTDSAARVLDAADNVIPGLYAAGNTMAAPSGTAY
PGGGNPIGTSMVFSHLAVRDMAGGQA
392418344YP_006454949.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMTHRDDIATMLLDRLGDERLGLRTRDREWSWDAVVRESAARAALATAVRD
ETLGDAPFHIGVLLDNVPDFVFWLGGAALAGAVIVGLNPTRGSAGLAADI
RHADCALIVTDSTGADRLAQLDHGVAPSRVLLVDDPAYQRRVDEHRAEPG
AAAGVGAASLFLLLFTSGTTGTSKAVRCSQGRLARIAYAATDKFGHHRED
VDYCCMPLFHGNALMALWAPALANGATVCLAPTFSASRFLPDVRHYGATF
FSYVGKALAYLMATPEQPDDADNTLTRGFGTEASPEDQVEFRRRFGAELF
EGYGSSEGGAVAATDPHAPPGALGRPAHPDVVVVDPETLAPCPTAVLDAQ
ARVLNPDEAIGEIVDRRGARDFEGYYRNDAADAERVRNGWYWTGDLGYID
GDGFLYFAGRRGDWIRVDGENTSALTIERVLRRHPGVVTAAVYGVPDPRS
GDQVMAAIEVADPAAFDLDGLVSFLLAQDDLGAKGFPRLLRVSDNLPTTG
SNKVLKRDLQAQKWHTREPIYRWPGRGRPVYQQMSDADRDALDAEFAAHG
RERHV
392418343YP_006454948.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMAAPVTPTVSSLLSALAMVDDRGVHAVQPGSDAVSFTSWREHIRDGAALA
AALRARLDADRPPHVGVLLGNTPFFGTVLVAAAMSGIVPVGLNPTRRGAA
LQRDIAHADCQLVLADSDGIQDGISAVDVESADFAAELDAHRDATVEFRT
ADPDDLFMLLFTSGTSGDPKAVCCTHEKVAVPGVMLAQRFGLGPADTCYL
SMPLFHSNAIMAGWAPAVAAGASIALRPRFSASQFMPDVRRFHATYANYV
GKPLSYVLATPERVDDADNPLRVAYGNEGAPRDVVRFAQRFGVQVVDGFG
SSEGGVAIARTPDTPDGALGPLLNGVTIVDVDTGAECAPGVIGELVNTEG
PGQFRGYYNDPGADAERMRDGIYHSGDLAYRDENGFAYFAGRLGDWMRVD
GENLGTAPIERILLRYPGITEVAVYPIPDPAVGDQVMAALVLPEGTAFDP
AEFTAFLRRQSDLGPKQWPAVVRVAAALPRTETFKVLKRRLSAEGTACAD
PVFLIERP
392418342YP_006454947.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFKTTEASDDLGGLVRTITESVCTPERQRELDGADERFDRDLWRKLIDA
DILSAAAPESLGGGGFGLLEQVAVLVALGRQMAAVPYLESAVLAAGALAK
FGSETQQQRWAVPAITGEKILTVALDGDMGEGPVQAHAVDGGYRLTGTRT
QVGFGPVADAYLVPAETDTGTRLFVVAADDPGVNIETLDTTGHGSVGHLT
LAGTDLGSDRVVGDGDQIVPWLTTLATLGRSAFQLGVLDRALELTASYAR
EREQFDRPIGSFQAVSARLADGYIDIKALRLTLTQAAWRLSEGLPAEVDV
NTAAFWAAEAGHRVAHTTVHVHGGVGIDTDHPVHRYFLAAKQTEFAVGGA
TGQLLRIGRELADTPA
392418341YP_006454946.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MRIGYTPEQEELRRELRAYFTKLMTPERAEALSSNDGEMGRGNVYRETVA
QMGKDGWLTLSWPEEFGGQARPPMDGLIFNDEAALANVPVPFLTINSVAP
TIMAFGTDEQKKFFLPKIASGDLHFSIGYSEPGAGTDLAALRTTAVRDGD
DYVINGQKMWTSLIAYADYVWLAARTNPEAKKHRGISMLIVPTTAEGFSW
TPVHTMAGVDTSATYYQDVRVPVTNLVGEENAGWKLVTNQLNHERVALVS
AQPIFLALNGVREWAQNTKDVHGKRLIDSEWVQLNLARVHAKAEVLKLIN
WELASASDPDTDAAPSPADASAAKVYGTELATEAYRLLMEVLGTAATLRT
NSPGALLRGRIERMHRSCLILTFGGGTNEIQRDIIGMVALGLPRVNR
392418340YP_006454945.1 ferredoxin [Mycobacterium chubuense NBB4]MRVEVDRDRCEGNAVCVGIAPDLFDLDDDDYAVVKADPVPAEEEALAEQA
IAECPRAALIRRD
392418339YP_006454944.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSSPSSASQTDLSGRVAVVTGAAAGLGRAEAIGLARAGATVVVNDIARAL
DQSDVLDEIATAGSKGVAVAGDISERSTADELVETADGLGGLGIVVNNAG
ITRDRILFNMTDEEWDAVIAVHLRGHFLLTRNAATYWRSKAKAGDGTIYG
RIINTSSEAGLSGPVGQPNYGAAKAGITALTLSAARALGRFGVRANAIAP
RARTAMTAGVFGDAPDLPNGVVDPLSPEHVVNLVRFLASPAAEAVNGQLF
IVYGPTVTLLAAPTAEKQFSADGDAWNPAALSETLQNYFADRDPERSFSA
AMGLGDRD
392418338YP_006454943.1 ABC-type transport system involved in resistance to organic solventMIEQLAAPARAVGGFVEMSLDTFVKSFRRPFQFREFLDQTWMIARVSLVP
TLLVAIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTFVALLL
NGLVCLIGLAGGYVFSVFLQGVNPGAFINGLTVLTGLGELVLAEVKALLF
GVVAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVIMTAVGVR
VLAR
392418337YP_006454942.1 ABC-type transport system involved in resistance to organic solventMSYDATVRFRRLFRGVPKAVDTVGEQALFYGESVRYIPNALTRYRKETIR
LIAEMTMGTGALVMIGGTVGVAAFMTLASGGVIAVQGYSSLGNIGIEALT
GFLSAFLNVRIVAPVIAGIALAATIGAGATAQLGAMRVAEEIDAVESMAV
HSVSYLVSTRLIAGLIAIVPLYALSVLAAFFAARFTTVYINGQSAGLYDH
YFNTFLIPSDLLWSFLQAIVMSVAVMLVHTYYGYNASGGPVGVGIAVGQA
VRTSLIVVVVIVLFISLAVYGASGNFNLSG
392418336YP_006454941.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MADGDAKRSHVRIAAAILAAVVVAAAVFTYLSYTAAFTPTDKVTVLSPRA
GLVMESKAKVKFRGIQVGDVESIEYAGDSAKLTLAIRSGEMRYIPSNATV
RIAGTTIFGAKAVEFLPPPKPDKASLRPGAEIRAQDVQLEVNTLFQSLTD
TLTKIDPVSLNATLSALAEGLRGHGEDAGAILSGLNSYLAQLNPKLPTLQ
DDFRKAAVVTNIYGDAGPDIATILDNAPSISQTIVDQQDNLNATLLAATG
LANNGTATLEPAADNYIAAIQRLRAPLKVIGEYSPEFGCILKGTANAIDR
FAPIIGGIRPGLFTSSSFVLGSPSYTYPESLPIVNATGGPNCRGLPDIPN
KQYGGSWYRSPFLVTDNAYVPFQPNTEVQFDAPSTLQFLFNGAFAERDDF
392418335YP_006454940.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MKRDRTLVYVSIFTVVMLVVAAALVVVFGQFRFGSDRDYHATFTDASRLK
SGQDVRIAGVPVGKVKGVKLKDDNSVDVAFTVSDRYQLYTSTRAAVRYQN
LVGDRYLEITSGPGELRKLPPGGTIVNTQPALDLDALLGGLRPVLKGLDG
QKVNAISSAVIELLQGQGGALSEMLSSTSAFTQNLAARDQLIGDVITNLN
TVLGTVDEKGAQFDASVDRLQKLLTGLAEGRDPIAGAIAPLASAENDLTD
MLKKSRRPLQGVIENARPLAQRLDERKADINKVIEPLAENYLRLNALGAY
GAFFNIYYCAVRMKINGPAGSDILIPFGGPPDPSKGRCSDNG
392418334YP_006454939.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MAKPDGGSPLRTGIFGIVLVTCLVLVSFGYANLPFMPQGKTYEAFFTDAG
GISPGNTVNVSGINVGKVKSVALAGDTAKVTFTVDRKVRVGDQSLVAIKT
DTVLGEKSLAVTPKGSGSVTSIPLGRTTTPYTLNTALQDLGQNASELDKP
RLEQALQTLTDSMREAKPQLRSTLDGVTNLSRSLNKRDAALEELLRHAKR
VSDTLAQRSGQVNQLIVDGNMLFAALDERRQALSNLISGIDDVSQQLSGF
VADNKREFGPALEKLNLVMDNLLQRKEHIGEALKRLPPYATALGEVVGSG
PGFHINLYGLPPASLAEVLLDTYFQPGKLPDSLADYLRGFISERLIIRPK
SP
392418333YP_006454938.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MSQSNSSSRTGRAMRLGLAAVLVVVLASAVYLVWPSRTGHKVVAYFQSAV
GLYPSDQVRIVGVPVGTIDSIEPRASDVKITMTIQDGVKVPENARALIIS
PNLVAARFIQLTPAYTGGPVMADGAEIGLDRTAVPVEWDEVKEQLTQLSA
QLGPQQGSVQGPLTEFVNQAADTFDGNGDSFRQALRELSQTAGRLGDSRT
DLFGTVRNLQVLVNALSNSNEQIVQFTNHVASVSQVLADSSTDLDKTLGT
LNQALSDVKGLLNDNNQALIDQVHKLADFTQILTDHSDDIEQVLHVTPNG
LSNFYNIYNPAQGTVGGLLSLPNFANPIQFICGGAFDIGASPDEYKRAEI
CRQRMGPVLKRITMNYPPVLFHPINTITAYKGQIIYDTPATEAKAQTPVP
YLQWQNAPGVTPPQIPPDADLTSLLVPPAPASAPTSHSGGQAGQGSGPAP
GPAPGPAPGPAPGPAPGPVPAPTQAGG
392418332YP_006454937.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MRKALGVKTVKRTLALATGAALLAGCQFGGLNSLNMPGTAGHGPGSFSIT
VELPDVATLPQNSPVMVDDVTVGSVSGIDAVQRADGSFYAAVKLSLDKNV
VLPANAIAKVAQTSLLGSQHIELAEPPGKSVGRLENGSEIPIERAGRYPT
TEEVLSSLGVVVNKGNLGALQDITEEAYKAVAGREGTFTDLIPRLAELTG
SLDRQTNDIIAAMEGLDRFSGILAKSKDSLGRTLDTLPGALDVLNRNRSN
IIDAFAALRRFADVGSRVLAQTKDDFAADMKDLFPVIKSFNDNADDFVKS
LEFLPTFPFHYRYLRKAVRGDYLNVFATFDLTLRRLGETLFTTSLGLDPN
MKRMSEIINPPDFLVGSLANLSGQAADPFKIPPGTATQHQGAP
392418331YP_006454936.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MLDRLTKIQLSIFAVVTVLTVGAISIFYLRVPEALGLNTYQVTANFETGG
GLYQNANVTYRGVTVGRVESIGLSNSGVVAHMRLNSGTPVPDNVTATVKS
VSAVGEQYVDLVPPAKPASATLSDGSDIGMDRTAVGQDIAQLLDQANALV
NSVSNSRVRDLLRETFKAFNGSGPELARLIQSSRSLIDEANANYGQTTQL
IDQAGPFLDAQIRSGDSIRSLADGLARFTGEVANADPQLRSVLQNAPSAA
DAADTTFEGIRPTFPILAANLANFGRIGVIYHKSIEHALVVFPALLAALN
TVAGGLPSDEGGKLDFKVDLGDPPPCSVGFIPPTQIRSPADTTLRELPTD
MYCKVPQNDPSVVRGARNYPCQEFPGKRAPTIQLCRDPKGYVPIGNNPWR
GPPVPVGTPIQDGRNILPPNKYPMIPPQVDPDPGPPVVQLPPGVAPGPGP
APHAPFPLPVPPNEPGIPPPWPYFAPPDQVVPPYGRTPPAPPAPPAAPAP
PAAPPAAPPAPGGPLLPAEATPQAVPQAMASYDKNGKFVDPEGGTGIYAP
GADKLAPAENWVDLMLSPKQA
392418330YP_006454935.1 hypothetical protein Mycch_4554 [Mycobacterium chubuense NBB4]MTEVVPPQTGRPGRRRASRAAGPATASEAGASGAATAVLVDAPKSAKTPS
TTALSPPPRRAAHRGLVALISVLALLAAGGAVGGVVAWMLVQQRQEQAQL
DRDQRFVDTASQLVVNMFSYTQDNIDDSVNRFVNSTSGPLRDMLSQSNNV
ENLKAIFRDTNASSEAVINGAALEKIDEVSGNASVLVSARVTVTDMEGTN
KPSQPYRMRVIVHEDDNGHMTGYDLKYPNGGN
392418329YP_006454934.1 hypothetical protein Mycch_4553 [Mycobacterium chubuense NBB4]MGDRVAKIVGALAVLLSVAFVGLAAVGGWLFWNRVELRGQQTTREELAPL
AAAQIPRVFGYDYQTVERSLNDVYPLLTPSYRHEFEDRATKDIIPQARDR
QLVSQANVVGVGVLDAQRDSASVMVYMNRTVTDKSRQPVYDGSRLRVDYQ
KVDGKWLINYITPI
392418328YP_006454933.1 Trehalose-6-phosphate synthase [Mycobacterium chubuense NBB4]MSPQGGAEGRSGFADFVVVANRLPIDMVRQPDGTIEWKRSPGGLVTALEP
LLRRRRGAWIGWPGVPQEADDPDVSEEPIEQDGMHLVPVRLSATDVAEYY
EGFSNATLWPLYHDVIVKPIYHRAWWDRYVEVNRRFAEATARTASEGATV
WVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPWRTEITEGL
LGADLVGFHLPGGAQNFLILARRLVGANTSRGNVGVRSRFGEVQVGFRTV
KVGAFPISIDSTELDQQARTRTIRTRARKLREELGNPRKILLGVDRLDYT
KGIDVRLQAFSELLDEHRVNPEDTVLVQLATPSRERVESYIAMREDIERQ
VGHINGEYGEVGHPVVHYLHRPVPREDLLAFFVAADVMLVTPLRDGMNLV
AKEYVACRSDLGGALVLSEFTGAAAELRQAYLTNPHHLEGVKDAIEAALN
QTPEEGRRRMRALRRQVLAHDVDRWARAFLDALAGAETKSE
392418327YP_006454932.1 hypothetical protein Mycch_4551 [Mycobacterium chubuense NBB4]MPAKSDPAEIGDVEPIADSTERQARRVVAAYATDADECRVFLSMLGIGPA
KLDA
392418326YP_006454931.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMLDVANADQVTYETLDEGRIARIWLNRPDAQNAQSRTLLVQLDEAFGRAE
ADDEVRVVILAARGKNFSAGHDLGSEQALAERAPGPDQHPTFRSHGATRA
AVAERTYLQEWHYFFENTRRWRDLRKITIAQVQGNAISAGLMLIWACDLI
VASDDAKFSDVVGVRMGMPGVEYYAHPWEFGPRKAKELLLTGDSIDADEA
HRLGMVSKVFPRAELEDKTLEFAKRIAERPTMAALLIKDSVNAATEAMGF
TETLRHAFHIHELGHAHWAAHNENRYPVGLPPDVPDWRTLGAPKPSRRDE
P
392418325YP_006454930.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMEISLSGRTVLVTGGGSGIGKAVAAEVVAAGGNAMLVGRNADKLAAAAQE
IGGSVRYEPADVTDEDEVARAVDAAAAWTGRLDGAVHCAGGSDTIGPITQ
LDSAAWRRLVDLNINGTFYVLKHAAREMVRGGGGSFVGISSIAASNTHRW
FGAYGVSKAGVDHLMQLAADELGPSLVRVNCLRPGLIRTDLVAAIFSSPE
VSGDYAAATPLPRPGEAEDVANAAVFLLSDAASYITGQLINVDGGMMLRR
GPDFSAMLEPVFGADGLRGVVPQ
392418324YP_006454929.1 aerobic-type carbon monoxide dehydrogenase- small subunit CoxS/CutSMHELPVEVSVNGRRYAASVEPRLTLADYLRERCGLTGTHLGCEHGACGAC
TVLLDGQAVRSCLIFAVQVDGQEITTVEGVADDGELSPVQAAMRDCHGLQ
CGFCTPGFVTSITALLRDNPTPTDAEIREGLSGNFCRCTGYQGIVNAVRR
ASESMS
392418323YP_006454928.1 aerobic-type carbon monoxide dehydrogenase- middle subunit CoxM/CutMKAAPFAYHRPDSVAGAVRLLGEYGEDAKILAGGQSLVPMLAMRLTHFEN
LIDISRVDELRDIDRRDDVVRIGAGTPHAFVGMDDEVAEAVPLLTLSTPH
IGHFQIRTRGTLGGAIAHADPAAEYAAVALTLDADIEATSARGTRRIPAS
EFFTGLWETALSPDEVLTAVAFPVWSGRCGFSVQEFARRHGDFAIAGATV
AVELDGDNTVTRCGIGLLGLGSTPERGTPAEQAVVGRPVTDITAEELGRL
AVSALEDVPADLQGTAAYRTRVGAAMVARAWTEATTEARDA
392418322YP_006454927.1 hypothetical protein Mycch_4546 [Mycobacterium chubuense NBB4]MELNNEFRVAVPPAKVWEVFTDVERVAPCLPGATLLGVDGDTFDGAVKVK
VGPITVSYKGVASYQEKDAGARRIVLRAEGKETRGNGTAAATVTAQLQDE
GDATYVGIVTDLAISGKAAQFGRGVLADVSGNLIAQFARSLEAELLGDAP
SPSQTGSAATTSAAASEAGDSVDLLKVVAVPMAKRYAPVLGAALAAGAVG
FVLGRRRRKGPAAVLADDLQAVLARLLS
392418321YP_006454926.1 aerobic-type carbon monoxide dehydrogenase- large subunit CoxL/CutLMTSAELAPPGGTAVTPRYAGARVPRVEDTRLLTGRGSFVDDITRPGMLHA
CFVRSPFARATINGIDAAAALALPGVHAVFTAADLNPEVKEAWHAVAGKD
VPDTPRPPLAEGEVKFVGDPVALVVADNRYIAEDAVDLVEVDYEQLPAVA
DFRKAVGGAEAGVPVVHADYPDNVAGGMGGMPPDEELFATAPHVVEQHIY
QQMYVPVPIETRGIVVEWTSATEELTVWASTQTPHELRAFAARLLGIPAQ
GVRVIMRDTGGAFGQKVVPMREDMCILLAARKVAAATSNAQSGVALKWIE
DRRENLMSAGQSRHVDGKVRMAFDADGKILAADIDFIQDIGSYPTPYPVL
TTAAIGMFFPGPYRVPKASFNYKTVFSNTPGLHAYRGPWQYETLTREMLL
DCAARKIGMDPVELRRINILRGDEMPYFNPNGMPYDNCAPADTFEQAVKI
LDHEGFRKEQADALAEGRYIGLGFSAYIEPTGAATGHLATEGATMRMEPT
GQINVYVNGGSSGNSIETTVVQLTADALGANIGDVSTIQGDTAVTPYGAG
TQGSRSGPMTAGAVNEAGAILRKQIIAIAAQILGVGEDDVELADSRATVR
GEPDKSVSFADIAYRSYYDPAQLGGVPPTLEATARFNSQAMIHWANATHV
CTCEVDIETGHVTLTRYIVSEDVGPMINPNVVEGQVAGGTAQGIGGALLE
QLAYDDAGNPVSSTFVDYLLPTATEVPPIEFGHVEIPGPGVGGYKGAGEG
GAIGSPPAVINAVNDALAPLGVTLTQLPATPAAIVDLIEKARKDH
392418320YP_006454925.1 xanthine and CO dehydrogenases maturation factor- XdhC/CoxF family MRDVLDELLAVWRTGGTAGLSTVVRTMRSAPRPPGAAMVVSPDGSVAGSV
SGGCVEAAVYEVANDVVASGVPELQRYGVSDDEAFSVGLTCGGTIDVFTE
PVSRNTFPQLQSVADDIAAHRAVAVATIVAHPDHKRLGLRLIVGADSATG
SLGSARADAAVADDARGLLAAGRSAVLSYGPDGQRQEAGMEVFIASHAPR
PRMLVFGAIDFASALAQQGSLLSYRVTVCDARPVFTTAARFPAAEDVVVD
WPHRYLAAQAEAGAIDARTAICVLTHDPKFDVPVLEVALRLPEVGYIGVM
GSRRTHDDRMRRLREAGLTDSELARLASPIGLDLGARTPEETAVSIAAEI
IARRWGGGGRPLSGTGGRIHH
392418319YP_006454924.1 D-alanyl-D-alanine dipeptidase [Mycobacterium chubuense NBB4]MYAYADGMGVVALRCLIIGFLSVAAAVLPPARAIPLSRASPVPPVSDQAR
AAGFVDVRSVVADAVIDLRYATPDNFVGIPVYPADARCLVHESLVPGLVA
AADRLRQGGERLVFWDCYRPHEVQVRMFEAVPNPAWVARPGRFARSHETG
RSVDVTLAGSNGLADMGTGFDDFSSRSHAEATEGVSAPAQANRARLRDAM
TAGGLTPYSGEWWHFDGPGAAQDRPILEVPLD
392418318YP_006454923.1 hypothetical protein Mycch_4542 [Mycobacterium chubuense NBB4]MGAASFVGRVGGLAVALGVGVAAFAGAGAAWADDTSSSPAKSSASENTSA
RAGTTTKDTTGDTAKDTATKTTGDRSTDTPKRRSPKKAGRGGDSGADGSD
NATPSEDADQKAPAEPEGTESTPTTSPSPSPSTGTSATTRASKPPRKPRP
ESSAASTPKSVKHTDAEPEPSKAASKTPDATATSTSTATSTSTATSTSAS
TKASTDPAEPPREAKTVTLFSHTSSLAADSSTAVAPTPKPNLVTAVVNVV
HSMLDWAHQKAGAGQNDPAQPPFLWALMSFARREFESLLAARSTTTAAVG
TAVASTSLALADQPAAAAATVLTPYSPWLNPQVSSSTNFVSWVTGNYVYG
DKTLANTLNRFQVYGTDVGTMWDNGMVDDPTTPYNEHQLLIAVGDTFGAA
NMTGRHIYNTLFRSSDTNLSDGMTIPNGEWFNGNMFGGAPLSQPTQARPI
INRPTWAPNSVTLIPTAGVSVNVPVTSETPYGTIQYVTFMSVSNWGSAGR
WTTNYAGIAYSTDNGENFTVDRGSVRYNSIFSGNKNFQQSAFVKGDDGYI
YMYGTPNGRQGAAYVARVAPDDILNLSKYQYYKAPSKTWFGTTVPGAWVT
GRPQSASAIIGKSGGFLGMTKPGYTVSEMSVQYNEYLGKYIVLYGDQSNN
IVMRTADTPEGVWSDPTILMTQQPGGIYAPMLNPWSPSTLGTGPDLYWNL
SLWSSYDVMMMHTDLTKL
392418317YP_006454922.1 hypothetical protein Mycch_4540 [Mycobacterium chubuense NBB4]MPIFMVERNYAEELEPNLDAADGINRINDQEGVRWLYSFLSADRRKTYCL
YEAPSPEAIRTAAIRAGLPADVVVEVTDRLTPDGAVARI
392418316YP_006454921.1 transcriptional regulator- luxR family [Mycobacterium chubuense NBBMAQWVPPPLPAELLARRRGPFVGRAAELSAFEHAWEQVDEGRRHMVFIGG
EPGAGKSRLVAEIAGTLADHGVAVLVGSSTADAGVPYEPFAEALDRLLSA
GPAGCLAEPLADAGPQLERLSALVHRHLPGAESTDDAGTVRRVLFDALTG
FLRRLAAHRPIALILEDLHWAQLPTLAMLEHVLATCADIRLLIVATFRTT
APDRSDELVSRVAEMHRFDGVRRLDLEGLDTEAITEFVSRTQQLPPPTAR
TAAALLRDRTGGNPFFLTELCHHLGTRGGLAALSAHQTVPASIGDAITRR
LTGLGAGVQAIIEQAAVLGETFDLPALIAGSDTDVAATLAAVDSAEAVGL
IRAVQDSDGEFAFVHALTREAVVARMAPSRLRIMHARAAEALEGRADPAV
IPRLANHYLLAHVLGFHEQALRYARKAAAMAERSLAYEDAATWYGRAASL
PELDMVDRARLNLSAAGNHVRAGDFARARSMYESISAIDDPLVRLEAAVG
YEDANWRPGLADSKAADLLASALESCGLDVDDPRYVRALGSFGRALAFAG
ETARARDISNLAIDHARRIDDRAVIVHALETSLWHGLTPDMCEHQLERST
ELSRMALSRRDYEALGSASHFRALASYQAGRAEELAASAADMQRAGRASG
QPFFNFVGACAAGGMAYLRGDFDGAERWAEIALRTGGLLGGDTTEGSYGV
QMFMIRRETGALKRFSGFVDGSETFADRWVPGLLALYTEIGCERGMTRAL
NQLLSRDLGSRTEAAQWPMELVFMTEAALALGEREAAAVLRPFVARYEGK
NIMSGQFVAIFGSADRYLARIADLAGDHDAAEAHFAVALEMDRRMNSTVH
VAETLARQALFEDSRGHGADARRLADEARAIAAPIGQTRVLDLLDSMSRS
GPDGLTDREIDVLRLLAEGLSNRAIGERLYISTNTAANHVRSILLKTGAA
NRTQAAMYAADHELLA
392418315YP_006454920.1 FAD/FMN-dependent dehydrogenase [Mycobacterium chubuense NBB4]MSIAETSGIGGLTGEVILPGDAGYDDARAVYNAMIDKRPAVIARCRSAGD
IAAALDHARRSNLAVAVRGGGHNGPGFGTVEGGLVIDLSRMNHIDVDPHA
RTATVQGGATWGQVDAATHAYGLATPSGVIASTGVGGLTLGGGHGYLSRK
YGLTIDNLLEAEVVLSDGRAVTASETEHADLFWALRGGGGNFGVVTSFTF
RLHPVHTVICGPTAWPVSATADILGWFRDFLPAADEDLYGFFATMTVPPA
DPFPEVFHLQKACSIVWCYTGDPARAEEVFAPVRRMQPAFEGIGPVPYPA
LQATFDGLYPPGLQWYWRGDFFRTVDDAAVQAHAEFAAELPTMHSAMHLY
PIDGAVHRVGQTDTAWAYRDVNFSQVIVGVDPDPANADTVRRWATSYSDA
VHRYSAGGAYVNFMMDEGQDRVRATYGPNYQRLTEVKRDYDPDNVFHVNQ
NIRPAGS
392418314YP_006454919.1 putative protein-S-isoprenylcysteine methyltransferase [MycobacteriMSTVVDGRRSVAVRSAAVLYGVVCYMAFVVVFGYAIGFVTGALVPRSVDS
ALTAPVAQAVVIDVALLTVFALQHSVMARPGFKRWWARYVPAAIERSTYV
LFSSAALALVFWQWREIGTTVWQVDSEPVRLVLAVLAGVGWVTVVASTFM
IDHFEMFGLRQILHVWRAKPMSGKGFRMVLLYRLIRHPLYLGFLIAFWST
PTMTGGHLVFAATTTVYILVAVRFEERDLAAELGDPYRRYRQRVPMLCPF
PVRRAQ
392418313YP_006454918.1 ABC-type transport system- involved in lipoprotein release- permeasMPRVRAGWVCFRRVHLAALIADRRRTLLSAIGVAVGVTVILGTLILKFEL
TRPFDSFGPSLAHAADIGVVEVTPDISGRLPMTTVHRLHDEVPGADAVIP
VVAGLAPVNVGGESHGYFLLGGTCQIERLVGSFDCEQRARDERPADGPGM
PLQIPAVIAERHGLHLGDELRIPGLPSGSAHLGWTFPEFDRVQGINHGYV
LLAPSADVAARLLGAPGYATAAFVLPKQGADVAADVERVITGVATAGPPR
PRLPAVFENATQSFNLTVLAGLLIGLLIAVNTIVLAVEDRRPVMGTIGAI
GAKPLGLLGGMLGEGAVVGVLGGLIGVLPGFLLGTFLVNRFGRSMLAGSG
GTVAAQFTPRLIVIGVLAGAVSGVLAMLGPSLKLVRDGPLASMASAGGAQ
RARTIPLWSLIAGAGALAVAVVVSRIFEHGSLPLNVGIYAMTVGLCGVVL
VTAWLAPRGAGLAIGLLTLARPATGRLLGADVRRYAVLFALSAALLAQGA
SSAISSHSMQLLGTTQIGQQKADRLPDSLLITAQSVFDQRDSQIADATAA
LVDRAAGGYSVTSRSRSTIGAGTLSRLVFGVTPGDWYSRAFYEPTDVPDK
FWEGLREGQIGLSEIAAGRLAVAAGDTVELPTVAGPKRYRVAGVFRPRMV
NDAAVGDIVLASEGLARTDWAAVRDQIAVAYPSADAATAHRDDFVDLGAG
LRVYDNQQWRSEAAAGITRFLEPFTISGYVVMAAAGLSVLNVFVLALVQR
RRERAALRAIGMTSGQEQAVIIFSAVLLGVLVAGTAILGGLFLTYLWSLG
SPVFYGTTIEFGVLPAALRTGVDAVFVLVLMAAAYPVIHARRLEAVETLR
SS
392418312YP_006454917.1 ABC-type antimicrobial peptide transport system- ATPase component [MSAKPVLQLDGVGKTYRRGGEQVRVLVDFDFTLRAGEFVVVTGPSGVGKS
TLLHVAGGLDAPDSGTVAVAGQNVWSMSTAARAAFRRRNLGFVFQFFNLV
PMLTAMENVSLPLVLDGVSARSADARAEKLLERVGLGDRARHRPAELSGG
QMQRVAVARAVVARPSIVLADEPTGNLDSRSSTEVLDLLRSLSDEDGTAV
VMVTHDHAAAQYGSRELHLVDGRACPADPLAPVGEW
392418311YP_006454916.1 hypothetical protein Mycch_4534 [Mycobacterium chubuense NBB4]MTEAITAYCKVCGHPKEHHDLDVHLDPEKSYEKRREEGEHGYGACRDMSY
GDHHCLCVEYQSWT
392418310YP_006454915.1 hypothetical protein Mycch_4532 [Mycobacterium chubuense NBB4]MNLARSLTELAFAPVRVGLAVADAGIGVASGALDMAQRTVGEADAGLRSR
PTSLAQMLGIDDAVERANRLARLMDEDQPLGRALAPDGPLDRLLKPGGVV
DRLTAPGGVLDKLTQEEGGLMRAIEPGGLVDQLLDEEGLVERLLAEDGLA
DRLLAEGGLIDKLTARNGPLEQLADVADTLNRLAPGLEALEPTIEALREA
VIMLSQVVNPLSSIADRIPLPGRRARRSAASRAVTSQRVIDVEE
392418309YP_006454914.1 response regulator with CheY-like receiver domain and winged-helix MAMPAHENVPEARVLVVDDEANIVELLSVSLKFQGFEVHTASNGPAALDI
AREVRPDAIILDVMMPGMDGFGLLRRLRADGIDAPALFLTARDSLQDKIA
GLTLGGDDYVTKPFSLEEVVARLRVILRRSGRGVEEPRTSRLTFADIELD
EDTHEVWKAGEPVSLSPTEFTLLRYFIINAGTVLSKPKILDHVWRYDFGG
DVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
392418308YP_006454913.1 signal transduction histidine kinase [Mycobacterium chubuense NBB4]MESNDLDNGGVPGPIKRGIPLRVGLVAATLLLVALGLLASGVAVTTIMHH
SLVNRVDDTLLDASRGWAQVPIQVPDDPTSGPNPARPPSDYYVRGIDSTG
REWTADNDRDAEPALPTDNDVGPVPVTVGSVGDSDVEWRAMTVRGLRGEV
TTVAIDLTDVKSTTRALIYAQIGIGTAVLLVLGIVGYAVVHRSLRPLAEV
EQTAAAIAAGQLDRRVPERDPRTEVGRLSLALNGMLAQIQRALASSESSA
EQARSSEDRMRRFITDASHELRTPLTTIRGFAELYRQGAARDVEMLMSRI
ESESRRMGLLVEDLLLLARLDAQRPLEQRRVDLLALATDAVHDAQSIAPR
RPIRMEVFDGPGTPEVLGDEARLRQVLSNLVANALQHTPETAGVTVRVGT
DGDDAVLEVCDEGPGMRAEDAQRVFERFYRADSSRARASGGTGLGLSIVD
SLVYAHGGRVSVDTAPGRGCKFRVSLPRIAEAAVPAELDASLN
392418307YP_006454912.1 HIT family hydrolase- diadenosine tetraphosphate hydrolase [MycobacMATVFTKIINGELPGRFVYEDDDTVAFLTIEPMTQGHTLVVPRAEIDQWQ
GVEPAVFGKVMSVAQLIGRAVVKAFDADRAGLIIAGLEVPHLHVHVFPAR
NLADFGFANVDRNPSPESLDDAQQRIQAAIAALT
392418306YP_006454911.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMLGLMQDRPLMISSLIEYAAAFHPDAEVVSRLPEGHIRRSNWREVNERSK
QVANALAELGIEEGDRVATLAWNSDRHLALYFGVSGSGAVMHTVNPRLFG
HQISYIINHAEDRVLFFDITFASLVSQLAPELSTVRTFVAMTDREHMPEV
PGVPEDRLLCWDEFIGRQSTHYDWPEFDELSASSLCYTSGTTGNPKGVLY
SHRSTMLHTLMAAARDANDVHSGSVILLVVPMFHANAWGTPYTAAMVGAK
LVLPGPHLDGESVYELMKTEGVNQSQGVPTVWMMLFAYLDEHPEIDPHEL
GLRVAGTGGAALPLSMIERFDRDFGADAMQGWGMTETSPLCVIGRLLPKH
ERLSDAEKAQIKLKQGRGICGVELKIVDDEGNRLPWDGKAFGEVWVRGPW
IASGYFKGEGGDKLDAEGFFPTGDVATIDPDGYLQLVDRAKDVIKSGGEW
VSSIDLENAAMGHPAVAEAAVIGMPHPKWQERPLLVVVLRNGADATRDEL
IDHLAGEVAKWWLPDDVLFVDELPHTATGKVSKLQLRERFRDYQLPTVAT
392418305YP_006454910.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMNAAFAGRGAVVVGGTRGVGLAVAELLATLGAGVVVNGRDESAAHEAAQH
IPGAVAHPGSPAEPAVADALIDRCVEAFGLIDVLINCAGTAEPPGSSILN
VTSAQFRDLLDAHLQTVFETCRAAAPLMVAQGGGAIVNTSSFAFLGDYGG
TGYPAGKGAVNGLTLAIAAELAEHGVRANVVCPGAKTRLSTGPEYEAHIA
ELNRRGLLDTVSMEGALDAAPPSYAAPTYAYLASDLAKGVTGEIFIAAGG
FVGRFDRQTPSIVAYRDHHETPPWTIDEIAAQVR
392418304YP_006454909.1 NTF2 domain-containing protein [Mycobacterium chubuense NBB4]MTETAELSPVVAASRESWRCVQTGDRAGWLSLMADDIVIEDPIGEAVTNP
DGAGVRGKEAVAAFYDTNIGPNQLRVTCHETFPSSSPTEIAYILELETTF
PNGFVATVRGAFTYRVNDSGLITNLRGYWNMDAMTFSQPESVD
392418303YP_006454908.1 oxidoreductase- Rxyl_3153 family [Mycobacterium chubuense NBB4]MKTKGALIWDFNQPWSIEEIEIGDPVKDEVKIQMEASGMCHSDHHLVTGD
IPMAGFPVLGGHEGAGIVTEVGPGVEGLEPGDHVVLSFIPSCGSCPSCQA
GLRNLCDLGAMLLQGTAVSDNTHRIHAVKDGTPVIPMTLLGTFSPYMVVH
KSSVVKIDPSIPFEVACLVGCGVTTGYGSAVRSANVRPGDDVVIAGIGGV
GMGALQGALNAGARNIFAIDPVEWKRDQALKFGATHAYPDIASAMMGVAE
ITQGRMASKTIITTGELKGEEIDNYLNITAKGGTCVVTAVANMASSDVTL
NLSMLTLLQKNLQGTIFGGGNPHFDIPQLLSMYKAGRLNLDDMVTRQYKL
EQINEGYRDMLEGRNIRGVIRYTDADR
392418302YP_006454907.1 hypothetical protein Mycch_4524 [Mycobacterium chubuense NBB4]MASRRELEDWVQRWLQANRDAEAAGDWKPLADFYTDDATYGWNIGPKEDV
MCVGKKEIRDVALGLEMEGLENWVYEYQKVLIDEKQNEIVGFWKQIANKS
DGSRDEIYGIGGSWFRLNDQLLIEWQRDFFDFGHVQKAFMKLIESGDLTP
TMQKRIERSLAGEKLPGYYPLGEAPVPIW
392418301YP_006454906.1 ferredoxin [Mycobacterium chubuense NBB4]MGSYRIEVDADLCQGHAMCELEAPDVFRVPKRGFVEITDPEPSDDLREDV
ERAVEMCPTRALSIIEND
392418300YP_006454905.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTATVPRVSGGEEEHGHLEEFRTDPIGLMQRVREECGDVGWFQLVDKHV
ILLSGAEANEFFFRSADEDLDQAEAYPFMTPIFGKGVVFDASPERRKEML
HNSALRGEHMKSHAATIEGEVTKMIAGWGDEGEIELLDFFAELTIYTSTA
CLIGLKFREQLDHRFAEYYHQLERGTDPLCYVDPYLPIESFRLRDEARVK
LVALVQEIMDQRLANPPKDKSDRDMLDVLVSIKDSDGNPRFSADEVTGMF
ISLMFAGHHTSSGTSSWTLIELIRHPDVYAEVQAELDELYADGQEVSFHA
LRQIPKLDNVVKETLRLHPPLIILMRVAQGEFEVKGFPIHKGDFVAASPA
ISNRIPEDFPDPDAFKPDRYDKPEQADVVNRWTWIPFGAGRHRCVGAAFA
QMQIKAIFSVLLREYEFEMAQPADTYRNDHTKMVVQLERPAKVRYRKRVK
E
392418299YP_006454904.1 short-chain alcohol dehydrogenase [Mycobacterium chubuense NBB4]MPRFDPLPDRRPALVAGASSGIGEATAISLAAHGFPVALGARRVEKCQEI
AEAIRADGGEAIAVHLDVTDPDSVKAAVEQTTSELGDIEVLVAGAGDTYF
GKLDSISTEQFESQVQIHLIGANRIATAVLPGMIERRRGDLIFVGSDVAL
RQRPHMGAYGAAKAALAAMVTNYQMELEGTGVRASIVHPGPTKTSMGWSL
PAELIGPALEDWAKWGQARHDYFLRASDLARAITFVAETPRGGFIANMEL
QPEAPLADSKERQQLKLDEENLNQ
392418298YP_006454903.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTITETLLDPYDYDFHEDPYQYYQRLRDEAPLYRNEELGFWALSRHRDVL
AGFRNSTTLSNKFGVSLDPASRGPHASKTMSFLAMDDPDHLRLRTLVSKG
FTPRRIRELEPRVTEIATRHLDAMLEKARSSQTVDYVDEFAGKLPMDVIS
ELMGVPEADRAQVRAWADAVMHREDGVTDVPASAVEASLNLIVYYQDMVA
ARRKKLSDDLTSALLEAEIGGDRLTDDEIIGFMFLMVIAGNETTTKLLAN
AAFWGHRNPDQLTPVYDDLERVPLWVEETLRFDTSSQILARTVSGELTLY
DTVIPDGDVLLLLPGSAHRDERVFDNPDDYVIGREIGSKLMSFGSGAHFC
LGAHLARMEARVALAELFKRIRGYEVDEANAVRVHSSNVRGFAHLPIHVQ
IR
392418297YP_006454902.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSSDAVAALTDGARPTPRNRRQEETFRKVLAAGLEMLRESSYADLTVRAV
AARAKVAPATAYTYFSSKNHLIAEIYLDLVQQVDYFTDVNDSRVDRVEKT
LRSMALMVADEPEVAAACTAALLSGNDAAVRTVRERIGGEIHRRIRAAVG
PNADPRTLAALEMTFFGALVNAGSGAFTYHQIADRLSYVVGLIVGDDK
392418296YP_006454901.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MVLLADRESRLLIDGKLVAGSSGTFPTINPATEETLGVAADATADDMTSA
IGAARRAFDETGWSTDTELRVRCLRQLQQAMRDHIEELRELTIAEVGAPR
MLTSAAQLEGPVEDLSFCADTAESYQWTTDLGIASPMGIKTHRTIAREAV
GVVGAITPWNFPHQINLAKIGPALAAGNTLVLKPAPDTPWAAAVLGELIT
EHTDFPAGVINIVTSSDHGVGALLSRDPRVDMVSFTGSTNTGRAVMADGS
VTLKKVFLELGGKSAFLVLDDADLAGACAMSAFTASMHAGQGCAITTRLV
VPRNRYDEAVEAAAATMGGLKPGDPTDAGTICGPLISERQRDRVQGYLDS
ATAQGGTFACGGGRPADRDTGFFIEPTVIAGLDNNATVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVFSADEDRAAGIAARLRVGTVNVNGGV
WYSADMPFGGYKQSGIGREMGLAGFEEYLEIKAIATAAK
392418295YP_006454900.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGLYGDQFKEKVAIVTGAGGGIGQAYAEALAREGAAVVVADINNDGAQKV
ADGIKGEGGNALAVRVDVSDPDSAKEMAAQTLSEFGGIDYLVNNAAIFGG
MKLDFLITVDWDYYKKFMSVNLDGALICTRAVYRKMAKRGGGAIVNQSST
AAWLYSNFYGLAKVGINGLTQQLATELGGQNIRINAIAPGPIDTEANRTT
TPQEMVADIVKGIPLSRMGEPEDLVGMLLFLLSDQAKWITGQIFNVDGGQ
IIR
392418294YP_006454899.1 beta-hydroxyacid dehydrogenase- 3-hydroxyisobutyrate dehydrogenase MNEEVRFGYIGLGNMGAPMAKRLVEWPGGLTVFDVRTEAMTPLAELGAAL
ADSVADVAAAGIISVTVLNDEQVREVVSELAEHAKPGTVIAIHSTIRPET
AVELADQLRPRDIHIVDAPVSGGGAAAANGELAVMVGADREVYERVKPAF
KQFASMVIHAGEPGAGTRMKLARNMLTFVGYAAACEAMKLAEAGGISLQQ
LGRVVRHTDALTSGPGAIMVRDDMSVLEPDNFLYQSFTHARGLGEKDLSL
ALALGEETGVELPLAEIALKNLAAGLGVPHTSSTAKE
392418293YP_006454898.1 uncharacterized protein- gamma-carboxymuconolactone decarboxylase sMDELRRKGLEKMNEVYGWEMPDMPGDYFALTADHLFGTIWTRPGLSMRDK
RIMTLTVVTALGISDLAEIQANAALANGELTEDELKEMAIFLTHYLGFPL
GSKLDGVVTKVAKQRRKAAEKGEGEDKKGNVNSALKMHSGSSLDDQ
392418292YP_006454897.1 hypothetical protein Mycch_4514 [Mycobacterium chubuense NBB4]MTSRYAALSRDQLVVLVPELLLIGQLIDRSGMAWVISNFGREEMLQVAIE
EWMGASPIYTRRMQKALRYEGTDVVTIFKGLQLDIGAPPQFMDFRYTVHD
RWHGEFHLDHCGALLDVEPMGEEYVRGMCHDIEDPTFDATAVATNRRAQI
RPIHRPPRVPADRHPHCAWTVIIDESYPEVEDHPALEVIARTQAARTELD
PIDTADEGQSDYAGELLSDFDFAAFSHSALVRMADEVCLQMHLVNLSYVL
AVGARAGANVELAKGICVKQLTGVAGVAAERIHAALKLPGGVEGAVKTLE
LHPMFNPAAYVCADFGPDTVDVRRCPAHEDGAWVALTGPAERRPLQAVVR
AVDPHLDVEVTGSDTDWTARVFETDSAAEELPEVAVVKFSGGSTFEFENR
RSLPLTVV
392418291YP_006454896.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSYSSFVRTHGWSGAKPASDEEAIARILAAAGKAIEDHGADFSISDVART
VGVTRQTVYRYFSSTEALLVAAAVHAVDGFLDRLTAHMAGVSDPAEAVTE
AVATALEWLPREKYIGLIMVPGGSKHVESVTSDVALRFARTMVDRLDVDW
AAAGFGDDDLDELAEHLLRIIQSFVVDPGRPPRHGAALRAYLRRWVGNAL
VTRR
392418290YP_006454895.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTTDTGPQSCPFLPSGYDFTDPDVLLAGIPVAEFAQLRKTAPVWWNAQA
ESIFDDGGYWVISRHEDIKSISRNSAAWSTNANGAVMRLPDGVTAEQLDL
TKALLINHDAPEHTRLRKIISRLFTPRAIAGMEEKLAVSAREIVRTAAEK
DTGNFVQDVAMLLPLQAIADLIGVPEADRGKLFGWTNAIMNTDDPEFDSD
PTTANAELMGYAYTMAEQRRRCPADDIVTRLIQADIDGEALGDVEFAFFV
ILLAVAGNETTRNAMTHGMNAFFDNPDQWELFRRERPETAVDEIIRWATP
VHCFQRTALEDVELGGVTIAKGQRAGLFYSSANFDEDVFDRPFAFDILRN
PNPHLAFGGNGAHFCIGANLARMEIKLMFDEIADQIPDISKLAEPQRLRS
GWINGVKDLQVSYH
392418289YP_006454894.1 phosphoribosylamine--glycine ligase [Mycobacterium chubuense NBB4]MADEVRLGWAAVHVLVIGSGAREHALLLALRRDPQVDGLSVAPGNAGTAA
VADQYDVDVTSGEAVTALARRIGADLVVIGPEVPLVLGVADAVRAAGIAC
FGPTKDAARIEGSKSFAKDVMTAAGVRTAASEIVDNPAHLDAALDRFGPA
SGDSAWVVKDDGLAAGKGVVVTADRDTARAHAAGLLEAGHPVLLESFLDG
PEVSLFCVVDGETVVPLLPAQDFKRVGDGDTGPNTGGMGAYTPLSWLPDE
VTRRIVDEIVKPVAAELVKRGSAFSGLLYAGLAITSRGPAVIEFNCRFGD
PETQAVLALLESPLGQLLRAAATGELAGHPPLRWRDGSAVTVVVAAENYP
GRPRVGDVIHGADRDGVLHAGTARRDDGALVSSGGRVLSVVGTGADLAAA
RAAAYATLESIRLPGSHFRTDIGQAAAEGKISL
392418288YP_006454893.1 hypothetical protein Mycch_4510 [Mycobacterium chubuense NBB4]MMARMPTISRREVLALGFRASVVTAAAATAVSASRAALATAAPPATSAAA
PTYATGSFVSAARGGVPTNWIIARPPGQSVPLRPVILLHGKDSNAQTVMS
MGAERFLADAVAAGLPPFALAAVDGGNGYWHRRASGDDPGAMVLDEFLPL
LGEQGLDTSRVGFLGWSMGGYGAMLLGARLGAPRTAAIVAVSPALWTSPG
AAAPGAFDGADDYNANSVWGLAGLNGIPLRIDCGYDDPFYSATKQFIAQL
PTPPAGGFSPGGHNPAFWSSQLTAELSWAAPLLA
392418287YP_006454892.1 hypothetical protein Mycch_4509 [Mycobacterium chubuense NBB4]MLEVTAAVTPKGERRRYALVSAAADLLCEGGFDAVRHRAVARRAGLPLAS
TTYYFSSLDDLIAKAVEHVGLRETQQLQDRVSALSRRRRGAESTADILVD
LLVGDSPERATEQLISRYERYVACARQPGLRDIQRRILKQRTDAVVEVVE
RSGRSVRADLLTALVCAVDGAVVAALVGDGDGPRATARATLIDVIDVLAP
VNERSLSPTVPG
392418286YP_006454891.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMSLADPLRALADVALDRSVVLGYTKIGSTVRRLWWPADPAPNAMAGKRVV
VTGATAGIGEAMVASFAQLGATVHLLGRDRAKVRRIAGAVRSSVSGAEIV
EEVCDVSDLDAVRAWTDDLSGRVETLHGLVHNAGLMPKVRAETAQGHETQ
LACHVLGPHVMTERLLEPLRNAGGSAVVFMSSGGMYTAPLKRWSAEEFES
RDGPYDGVRVYARTKRMQVVLAEAWAQRLAGTGIRVYSTHPGWVETPGVA
EALPGFRRLTRPLLRSPADGADTAVWLVAVRPDSGPGHFWHDRAQRPTTF
GWQRREDPGTASAFLDQVSALTQHSAAG
392418285YP_006454890.1 hypothetical protein Mycch_4507 [Mycobacterium chubuense NBB4]MYFVGLDLAWGQRKPTGVAVIDDAGRLVTVTAATDDPSIVAAVQPYVQGE
CVVGIDAPIIVRNAAGQRPAERALNADFARFQAGTHPSNTGKPEFADGTR
AGRLAETLQLDIDPHAAAPRRAVEVYPHAASVALFRLGRTLKYKAKPGRG
VAQLRAELLRLMDHVEGLGTAEPPLRVEGCADWAPLRAMAENAERKSDLR
RVEDPVDAVVCAYVAMYLARRPHDVTFYGDADTGYIVTPTLPTDLRPAPP
EPTPGAVHDAVTAYAERRPLLQQSTERYLSAVTGLLDDAGINYVSVTART
KTVESFAAKADRQVDGRRLYTDPLSEITDQIGLRVITYLRDDVDAVANLL
AEEMRLLDDRDMGVETASEGRWGYASRHLLLAVEGEQQPASVQVRTILQH
AWAEFEHDIRYKGSVPEEDAPDLDRRFTLAAGLLELADREFSAIRERLRS
ATPAESTPQPTSDPRIPTPVLATYLANRFPDAGWSRTDHYSWIAGLMLDL
GIDSIDKVDAVLQGIDTDAVNTAMDYRFPPGAVRRLDDALLAVYGRRYID
LDGNAHRTTLLHNRFVRLRDAGIP
392418284YP_006454889.1 adenylosuccinate lyase [Mycobacterium chubuense NBB4]MSIPNVLANRYASEEMVAIWSPEAKIVAERRLWLAVLRAQAELGVDVPEG
VVADYERVLDNVDLDSIAARERVTRHDVKARIEEFNALAGYEHVHKGMTS
RDLTENVEQLQIRRSLELVHAHGVAVVARLAERAVLYRDLVMAGRSHNVA
AQATTLGKRFASAAQEMLVALQRVQELIARYPLRGIKGPMGTAQDMLDLF
DGDTERLAELERRVAQFLGFTEMLTSVGQVYPRSLDHDVVSALVQLGAGP
SSMAHTIRLMAGHELVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMAAELAGAQWNEGDVFCSVVRRVALPDAFFALDGQTETFLTVLDEF
GAYPAVIQRELDRYLPFLATTRILIAAVRAGVGRETAHEVIKEHAVAVAL
AMRERGAEPDLLDRLAADHRLPLDRAALDAALADKQAFTGAAGDQVDRVV
AAVDDVISRYPEAAKYTSGAIL
392418283YP_006454888.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTRTVELSRIDFTDLDNFADGFPHHLFALHREQAPVYWHDPTENTPDGEG
FWSVATHADTLAVLRDPDTYSSVTGGDRPFGGTLLQDLSIAGQLLNMMDD
PRHAAVRRLVSSGLTPRMIRRVEDDLRVRARRLLDDVPRGEPFDFLTDIA
AEVPMQMICILLGVPESERHWLFEAIEPSFDFGGSRSASISRLSVEEAGS
RMFTYGQELIAAKKVAPSDDMLSVVVNSGDPELSDIESYLFFNLLFSAGA
ETTRNAIAGGLLALIENPDAYRELRADPGLLPTAIEEMVRWTSPSPSKRR
TATRAASLGGHEVEPGQKVLVWEGSANRDAAVFDAPDRFDIRRKPNPHMG
FGHGVHYCLGANLARLELRVIFEELLSRYSSVRLAEPVEWTRSNRHTGIR
HLVVEPSA
392418282YP_006454887.1 tellurite resistance protein-like permease [Mycobacterium chubuenseMRPDAFAAVMATGIVSVAVAGHGFRGLGDILLVLVAGLLPVLILAVAIAW
RRHRWRLRDLGVVLPLFTFVAANAVLATRLAGHRIAVGTLTVAALAAWLA
LVPIAARQMWRCGGADLRDQARGGWELASVATSGVAILLAEQRMVVQAVA
FWTVAIGFYVLMTSLIGWRVWHEADVSVLVPPDAWILMGALAIATLAGAH
IHHHTQGWAAADIRWVTAGTWAVATGWIPVLMFIALRHLRRLAALGAGAW
WWAMVFPLGMYSVATQALATETGWSPLRAVSWAFCWVALLGWLSLASGVL
ARTIGHWWSNSRREASA
392418281YP_006454886.1 protein of unknown function (DUF1707) [Mycobacterium chubuense NBB4MDTGQPEIRASDADRAAVTQILEQAVGQGMLTLDEYTERVDVVLAARTRR
ELDTVIADLPHVRRQPAPAEPEVVRSWMSSITRKGWWTVPPRLRLVTRMC
STTLDFTTAALTGPVVHIEIDDYFGSVELILPDGATADLDGVADFGASTT
VKVPSSPASQRLHVVVTGRVRFGSLTARHPFGTTLKRLLR
392418280YP_006454885.1 hypothetical protein Mycch_4502 [Mycobacterium chubuense NBB4]MRSRWVPYASTPGRLLSQLFSDIVVVLWTAVWVFVGMAVHSAVATVAEFG
YRVESGANGVAGNLDSAGNSAGNVPLIGDDLAKPLSAAGDAAREIAGAGQ
SLGVTAGWLAWLLALAVAAPPILALMMPWLFLRVRYFRRKWTAVTLASTS
AGEQLLALRALANRPLPKLAAIHADPVGAWRNQDPVAIRGLAALELRASG
IRAANLWRAG
392418279YP_006454884.1 phosphoribosylaminoimidazole-succinocarboxamide synthase [MycobacteMRPALSDYQHLASGKVRELYRVDDGHLLFVATDRISAYDHILESEIPDKG
RVLTAMSVFFFDLLDAPNHLAGPPDDERIPEEVLGRALVVDQLEMLPVEA
VARGYLTGSGLIDYQKTGAVCGIALPSGLVEASRFAEPLFTPATKAELGE
HDVNITFDDVVGLVGAERADELRALTLQTYGQGADHALTKGIIVADTKFE
FGVDAHGVLTLADEVFTPDSSRYWRADDYTEGVVQQSFDKQFVRNWLTGA
ESGWDRHGDDPPPALPPHIVDATRARYIEAYERISGLRFDDWIGVTA
392418278YP_006454883.1 oligopeptidase B [Mycobacterium chubuense NBB4]MKPPVAKRVDHRREHHGDVFVDPYEWLREKSSPEVIDYLEAENSFTDHVT
ADLAPLRQKIFDEIKARTKETDLSVPIRRGDWWYYGRSFQGKQYGVQCRC
PVTDPDDWTPPQFDEDTEIPGEQVLLDENVEAEGHDFFSLGAATVSVDGN
ILAYSVDVTGDERYTLRFKNLRTGERYDDEIAGIGAGATWAADNATVYYV
TVDDAWRPDTVWRHRLGAGLPAERVYHEPDERFWVAVGRTRSNKYVIIAA
GSAVTSELRYGDAADPQTQFTTVWERRDSIEYSVDHAVVGGEDRFLILHN
DGAENFTLVEASVSDPTAYRTLIGHREDVRLDSVDAFEGHLVISYRRDAL
PRIQLWPVDDAGYGRQEDISFDSELMSVGLTANPNWSAPKMRIGATSFVT
PVRIYDLDLHTGERTLLREQPVLGDYRPEDYVERRDWAVASDGARVPISI
IHRAGLEYPAPVLLYGYGAYESCEDPRFSIARLSLLDRGMIYAVAHVRGG
GELGRPWYEHGKLLEKRNTFTDFISVASHLVGTDVTRPENLVAYGGSAGG
LLMGAVANMAPDLFAGILAAVPFVDPLTTILDPSLPLTVTEWDEWGNPLE
DPDVYRYMKSYSPYENVEAKSYPAILAMTSLNDTRVYYVEPAKWVAALRH
SQADPSGEAAKVLLKTEMNAGHGGISGRYERWKEAAFQYAWLLDVAKADT
NGDPSSR
392418277YP_006454882.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSRDTYHHGDLRAVILARAAELVAERGADGVSLRELARAAGVSHAAPAHH
FLDRRGLFTALAAQGWRMLAAALSDVRGEFSDAALAYVRFALDHPGHYSV
MFDRALVNPDDPELVAARGAAGDELSRGVGTLVDPRAEDDPESAALAAWS
LVHGFAMLWLNGAIDTRSDPIATAQRVARMLFSR
392418276YP_006454881.1 glutathione peroxidase [Mycobacterium chubuense NBB4]MTDTALTEIPLTTLDGTPTTLGELADGAALVVNVASKCGLTPQYTALEHL
AQQYGGRGLTVIGVPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTEV
NGPGRHRLYEELTQTADDSGEAGDVQWNFEKFLVAPGGAVVKRFRPRTVP
DAPEVISAIESVLPQ
392418275YP_006454880.1 putative deacetylase [Mycobacterium chubuense NBB4]MAGQLIVSISGVCDRTFDDVTTFQARLQDRGVPASFLVAPRLKGGYRLDR
DQATVDWLVARRAAGDAVVLHGFDEAATKKRRGEFATLQAHEANLRLMAA
DRILEHLGLRTRLFAAPGWNVSQGAVTALPRNGFRLLAGLSEIIDLVRGE
SVRSRVLGIGEGFLSEPWWCRTLVLSAERTARRGGIVRVAVAARHLRRPG
PRQAMLDAVDLAMMHSCIPTVYEWRPRPALTDAA
392418274YP_006454879.1 putative oxidoreductase [Mycobacterium chubuense NBB4]MAEDADVIVVGAGLAGLVAACELADRGKRVLIVDQENEANVGGQAFWSFG
GLFFVDSAEQRRLGIRDSHELALQDWLGTAGFDRPEDHWPRQWAHAYVDF
AAGEKRSWLRDRGLQTFALVGWAERGGYDARGHGNSVPRFHITWGTGPAL
VEIFARQLRGRAGVRFAHRHRVDELVTDGGAVTGVRGAVLEPTTAARGVA
TSRNTVGDFEFRAQAVVVASGGIGGNHDLVRKNWPPRMGRVPEQLLSGVP
AHVDGRMLGISEAAGAHVINSDRMWHYTEGITNYDPIWPRHGIRILPGPS
SLWLDATGKRLPAPLYPGFDTLGTLEYIARTGHDYTWFLLNARIIAKEFG
LSGEEQNPDLTGRSLRAVLDRARNGPAPVHAFVEKGVDFVSANSLRDLVT
VMNAVPDTEPLDFAVVEAEVTARDREVANRYTKDSQITAIRAARSYLPDR
ISRVVAPHRLTDPKAGPLIAVKLHILTRKSLGGLKTDLESRALRSDGSAL
PGLYAAGEAAGFGGGGVHGYRSLEGTFLGGCVFSGRAAGRAAARDVG
392418273YP_006454878.1 putative Zn-dependent hydrolase of beta-lactamase fold protein [MycMQLTHFGHSCLLASFSGPSASEGDTTVLFDPGTFSHGFEGITGLSAILIT
HQHPDHADTERLPALVEANPQAALYADPQTAAQLGGPWQAVHVGDQLSIG
HLSVRGVGGQHAVIHPEIPMIDNISYLVGDGEHAARLMHPGDALFVPDEP
VDVLATPAAAPWMKISEAVDYLRAVAPTHAVPIHQAIIDPSARGIFYGRL
SEMTDADFQVLDPEDAREF
392418272YP_006454877.1 hypothetical protein Mycch_4494 [Mycobacterium chubuense NBB4]MQVRSVLALAVASAVATAWSLTGLVFSPGMARAAPGICPPFCDAIPDSAW
IESSSIPLSSVYRWPGLAGVAVTAAKPRFEFESWCASPAIPGDPRDYAVA
ARATVPNPDGQWNLQAQVLHWRGDTVTGGRTALATIERARMALSSCGATA
PTVSPSLTTSEADRLAAVISDPGSRVMHVYLLAEPSNSTVVEVVLWTTIP
AVVEWRAVSDAQIFDAMSTPLCAAYLGSCR
392418271YP_006454876.1 phosphoribosylformylglycinamidine synthase- purS protein [MycobacteMAKVVVHVMPKTEILDPQGQAIVGALKRLGFGGISDVRQGKRFELEVEDG
IDDEKLAEIAESLLANTVIEDWTVTREGSA
392418270YP_006454875.1 phosphoribosylformylglycinamidine synthase subunit I [MycobacteriumMTRVGVITFPGTLDDIDASRAVRLAGGEPVSLWHADADLKGVDAVIVPGG
FSYGDYLRCGAIARFAPVMGEVVAAAGRGMPVLGICNGFQVLCEAGLLPG
ALTRNAGLHFICRDVWLQVSSITTAWTSRFEWGAELLVPLKSGEGRYVAS
EQVLDELEGEGRVVFRYSENPNGSMRDIAGISSANGRVVGLMPHPEHATE
ALTGPSDDGLGLFYSALDAILVS
392418269YP_006454874.1 uncharacterized protein- linocin/CFP29 [Mycobacterium chubuense NBBMNNLYRELAPVTAAAWDEIEQEATRTFKRHIAGRRVVDVSEPGGPVTAAV
STGHLLDVAAPGDGVIAHLREARPLVRLRVPFTVSRHAVDDVERGSQDSD
WDPVKEAARKLAFAEDRAVFEGYEAASIDGIRKCSSNPALALPDDPREIP
DIIAQALSELRLAGVDGPYSVLLSAEVYTRVAETTAHGYPILEHINRLVD
GDIIWAPAIDGAFVLSTRGGDFDLQLGTDMSIGYLSHDAGTVQLYLEETL
TFLCYTAEASVALTP
392418268YP_006454873.1 Dyp-type peroxidase family [Mycobacterium chubuense NBB4]MPAPLPQPVLAPLTPAAIFLVATIDAGGEAAVHESLGDIAGLVRAIGFRD
PSKRLSVVTSIGSDAWDRLFTGPRPRELHRFAELDGGRHRAPSTPGDLLF
HIRAESMDVCFELATKLVEAMDAITVVDETHGFRFFDNRDLLGFVDGTEN
PDGPLADSATRIGDEDPDFAGGCYVHVQKYLHDMAAWNALSTEEQERVIG
RTKLDDIELDDDVKPADSHVALNVVEDDAGNELKIVRHNMPFGEVGRGEF
GTYFIGYSRSAAVTERMLTNMFLGDPPGNTDHILDFSTAVTGSLFFTPIM
DFLENPPPLPDSATGPGGYAGSLAIGSVKGQPQ
392418267YP_006454872.1 aspartyl aminopeptidase [Mycobacterium chubuense NBB4]MAASPQGLCEFVDASPSPFHACRTAADRLRAAGFTELAEGDAWPAAGDHF
AVRAGSLIAWRARDDSAVAPFRIVGAHTDSPNLRVKQHPDRFVSGWQVVA
LQPYGGAWLNSWLDRDLGVSGRLSVRAGNAADHVLVRLDEPVLRVPQLAI
HLAEDRKAVELNPQRHVNAVWGVGTGTRSFLAYVAGQAGVDADEVLGFDL
MTHDINPSRLAGTAGELVSAPRLDNQATCYAGLEAFLTAPASEVVPVLVL
FDHEEVGSQSDHGAQSDLLLTVTERITLAAGGGREDFLRRLSASMVASGD
MAHATHPNYPERHEPGHLIEVNAGPVLKVQPNLRYATDGRTAAAFAMACA
QAGVPLQRYEHRADLPCGSTIGPMTAARTGIPTVDVGAAQLAMHSAREVM
GAGDVADYSAALQAFLSPA
392418266YP_006454871.1 hypothetical protein Mycch_4488 [Mycobacterium chubuense NBB4]MALDVAMITVDCTDPDMLADWWANAVGGDVNAVAPGEFVMVTRQGAPALG
FQRVPDPTPGKNKVHLDLHTPDKEAEVARLVGLGARETGRHSFGPDFDWV
VLADPEGNAFCVAGG
392418265YP_006454870.1 phosphoribosylformylglycinamidine synthase subunit II [MycobacteriuMTSGLTHEVDTVDHASATPDQPQPFRELGLKDDEYQRIREILGRRPTDAE
LAMYSVMWSEHCSYKSSKVHLRYFGETTTEKMRESMLAGIGENAGVVDIG
DGWAATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLR
FGAADAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETIFDASYAGNPLVNA
LCVGVLRTEDLQLAFASGAGNKIILFGARTGLDGIGGVSVLASETFGDES
GAGRKKLPSVQVGDPFTEKVLIECCLELYAGDLVVGIQDLGGAGLSCATS
ELASAGDGGMRVELDTVPLRAANMTPAEILSSESQERMCAVVTPDNVEAF
LAVCRKWDVLATVIGEVTDTGRLEITWHGETVVDVPPRTVAHEGPVYERP
VERPATQDALNADTSASLPRPSTGEELRATLLALLGSPQLCSRAFITEQY
DRYVRGNTVLAENADGGVLRVDEETGRGIAISTDASGRYAALDPYAGAQL
ALAEAYRNVAVTGATPIAVTNCLNFGSPEDPGVMWQFSQAVRGLADGAAA
LGIPVTGGNVSFYNQTGTTAILPTPVVGVLGVIDDVKRRIPTGFGNEPGE
TLILLGDTRDEFDGSIWAQVTADHLGGLPPKVDLERERLLADVLTAASRD
GLVSAAHDLSEGGLIQAVVEAALTGETGCRLVLPEGFQEGTAPFVFLFSE
SAGRVLVAVPRTEESRFVSMCEARGLPATRIGVVDEGPHGGQAAVEVQDL
FTVTLEELRRTSEGVLPGFFG
392418264YP_006454869.1 putative membrane protein [Mycobacterium chubuense NBB4]MTTETEDKHPVYLWAWNLLRLDFIGIVFGALFFCMSLTPSLLPRDWLFQG
LLGGINAAIGYGIGVFVAKMLRRFVPAERRWSPRASVAKLIKTAIVAVSA
AVCVLMVIPAAAWQRQVSSLMGMQGPGTAGYLRTLLLAAAVAGVCVAVTR
VLIDLIKTMARFLIRRWRLSDELALFIGTAIVVVLVITLVNGVLLQGFLA
GANRIFQPQNTTTMAGVLQPLDPERSGSPESFAPWDTLGYQGRNFVGTGP
SAAELSRINGRPAKVPVRVYVGLQTADTEEARMAVLLSELERTGAFDRKV
LVIVPTTGTGWVNPIAARSLEMMYNGDTAIVASQYSYLPSWISFIGDQQK
SLHAGRMLIDAVHDRWIQQPPQWRPRLMLYGESLGSMAGQGAFDWLPDIS
RMGFSSVLWVGPPNASRLWRGLTARRDPGTPEVEPRYDNGRTVRFSQAYD
AAEIAHDTAPPWEGTRVLYLQHSSDPIVWWSQDLLFTRPDWLSEPPGRDR
TASMRWYPIVTFWQVAADLTNAASVPRGHGHNYGDYILDGWAGVAAPAGW
TSADTERIRIALRETESEDGNQ
392418263YP_006454868.1 putative metal-dependent membrane protease [Mycobacterium chubuenseMRDKVRAVLLAALLIGWSAVTPRLPPRWNPLPHIVFGTSMAALTRAPLGL
RPPALWSGLRWGLAAAAPVVVGVGSAVAIAPVRNGMAARTLPPSVMRWLL
LHIPIGTVWAEEAGYRAALGTAAAGAFGEPGGRLFTAAVFGLSHVPDARA
TGEPLLGTVLVTGAAGWLFAWLVGRSGSLAAAMLAHLAVNEAGAVAAVAV
QRRRRVTD
392418262YP_006454867.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MSEARDAPPYRRLGALLLVIAAALGLLVFFQFQGRFIPSVEVTLSSPRAG
LVVEKGAKVTFNGVEIGRVVGIAPAGTGDIPGADLTLHIDPAALHVIPAN
AVVEIRATTVFGNKYISFTSPENPSAQRLSANDVLHVRAVTTEFNTLFET
VTAIAEQVDPVKLNQTLAATAQALSGLGERFGDSLLDGNRILGDLDPRLP
RARHDIRALADLADLYADSSPDLWAGLADAVTTARTLDAHRDDVDAALMA
AIGFSGVATDPFERGGPYLVRGAEDLLPTTKLLDDYRGMILCTIRNYHDV
APDFARVLGGDNGYSLRSAGTALGAGNPFIYPDNLPRVNARGGPEGKPGC
WQKITRDLWPNPYLVMDTGYSLAPYNHFELGQPLFTDYVWGRQVGQLTIN
P
392418261YP_006454866.1 hypothetical protein Mycch_4482 [Mycobacterium chubuense NBB4]MAVRRSADPAKTRAAVAAVADWLRDERLPAPGRTEIAEAVRSTARTLAAA
APGAAVEVRVPPFVAVQCIPGPKHTRGNPPNVVETDPRTWLRLATGLTSV
DDAAAAGTLQLSGSRAAEIAASLPLVALPD
392418260YP_006454865.1 amidophosphoribosyltransferase [Mycobacterium chubuense NBB4]MTSEQLDNEPKEECGVFGVWAPGEEVAKLTYYGLYALQHRGQEAAGIAVA
DGSQVLVFKDLGLVSQVFDEQTLAAMQGHVAVGHCRYSTTGSTTWENAQP
VFRNTAAGTGVALGHNGNLVNTAELAARARDEGLMSNRGAAAATTDSDIL
GALLAHGAADSSLEQAALELLPTVRGAFCLTFMDENTLYAARDPYGVRPL
SLGRLDRGWVVASETAALDIVGASFVRDIEPGELLAIDADGVRSSRFAPP
TPKGCVFEYVYLARPDSTIVGRSVHATRVDIGRRLAREKPVDADLVIGVP
ESGTPAAVGYAQESGIPYGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNP
LKEVIRGKRLIVVDDSIVRGNTQRALIRMLREAGAVEVHVRIASPPVKWP
CFYGIDFATPAELIANASNADADEAEMLEAVRHAIGADSLSYISQHGMIA
ATEQPASRLCSACFDGNYPIELPGETALGKNVIEHMLTTAARTGIPIQPD
NDNASALRRP
392418259YP_006454864.1 putative nucleoside-diphosphate sugar epimerase [Mycobacterium chubMPDPGTGHPRAMSAERVRCLVTGATGYIGGRLIPELLERGHAVRAMARTP
GKLDDAAWRDRVDVAKGDLTDPESLTSAFDGMDVVYYLVHSMGTSKDFVA
DEARSARNVVAAAKRDGVRRIVYLGGLHPAGTELSRHLASRVEVGEILME
SSIETVVLQAGIVIGSGSASFEMVRHLTDRLPVMTTPKWVHNKIQPIAIG
DVLHYLAEAATAPVPESRTWDIGGPDAMEYGEAMQIYADVAGLRRRVMVV
LPFLTPTIASLWVGLVTPIPAGLARPLVESLECDAVCHEHDIDAVIPPPP
GGLTGYRDAVVQALRAEGNEGRHGRRRHLLKFSPGQPQ
392418258YP_006454863.1 phosphoribosylformylglycinamidine cyclo-ligase [Mycobacterium chubuMTERAEQHGISYASAGVDIEAGDRAVELFKPLAHKATRPEVRGGLGGFAG
LFALRGGYREPLLASSTDGVGTKLAVAQAMDKHDTVGIDLVAMVVDDLVV
CGAEPLFLQDYIAVGRTVPERVAELVSGIADGCVMAGCALLGGETAEHPG
LMAPDHYDISATGVGVVEADDVLGPDRVRPGDVIIAMASTGLHSNGYSLA
RHVLLEIDHMNLAGHVEEFGRTLGEELLEPTRIYTKDCLALAAETQVRTF
CHVTGGGLAGNLERVIPHGLTAELDRGTWTPAPVFGMIAQRGRIERTEME
KTFNMGVGMVAVVAPEDTDRALAVLTARHLDCWTLGTVQKGSKDSSRAVL
VGQHPRF
392418257YP_006454862.1 Protein of unknown function (DUF3073) [Mycobacterium chubuense NBB4MGRGRAKAKQTKVARELKYSSPQTDFTQLQRELSGSSHDDHLNGSDVPSD
DGWADEDDWRR
392418256YP_006454861.1 folate-binding protein YgfZ [Mycobacterium chubuense NBB4]MASTSTGVPAPDTGPDAGATWHYGDPFGEQRAAAQAAVVVDRSHRAVLSL
TGSDRKTWLHSISTQHVSELPDGVVTENLSLDGQGRVEDHWLQTQLEGVT
VLDTEPWRGESLLGYLRKMVFWSDVVVEPADLAVLSLLGPGVADTPVLDT
LGVSALPAPGTAVPLPAGGFLRRIAADDLEVDVVVPRDQVAQWRERLITA
GVRPAGVWAYEAHRVAALRPRLGVDTDERTIPHEVGWIGSAVHLDKGCYR
GQETVARVHNLGKPPRMLVMLHLDGTDDRPSAGDPVLAGGRTVGRLGTVV
DHVDEGTIALALVKRGLPADTALTTGGDVVVSATIDPDSMPAADTVGAGR
LAVERLRGGPQ
392418255YP_006454860.1 branched-chain amino acid aminotransferase/4-amino-4-deoxychorismatMADGASVVVTLDGQLHDPRTPLLFADDLAAVRGDGIFETLLIRHGRPCLL
DAHLARLTHSAKLVDLPAPDLPRWRSAVRVAVDRWVADGGDEGVLRLVYS
RGRESGGGPTAYATIAPLPDRVAQVRRGGVAALTLDRGLPSDAADTMPWL
LAGAKTLSYAVNMAALRHAERHGAGDVIFLSTDGHLLEGPRSTVVIATTS
EDGRTCLLTPPPWYPILRGTTQQALFEVARNKGYDCDYQALKPSDLVAAQ
GVWLVSSITLAARVHTLDGTPLPSAPQPDDIAELVDAAILSDR
392418254YP_006454859.1 hypothetical protein Mycch_4475 [Mycobacterium chubuense NBB4]MRRLALAAAPAVALLAACSGPSDPVVSTAPFVTPSVGHGALAYCLGQHGI
PAPPGPVSGPPAGVDPADWEAAMSACSSLAPGPSNTAAPDPDMERPPSR
392418253YP_006454858.1 protein of unknown function (DUF1794) [Mycobacterium chubuense NBB4MTSGDEAVAAAAERARQTAARNIPVFGDLPLPADTANLREGANLDDQLLA
LLPLVGVWRGEGEGRGSHGDYRFGQQIVVSHDGGDYLNWEARSWRLTDEG
EYHSPTLRETGFWRFVSDPNDPVESQAIELLLAHSVGYVELFYGRPLNQS
SWELVTDALARSKSGMLVGGAKRLYGIIEGGDLAYVEERVDADGGLVPHL
SARLSRFAG
392418252YP_006454857.1 hypothetical protein Mycch_4473 [Mycobacterium chubuense NBB4]MPAERRLLPAVRLAVVVLFYEILLVAAVVVITWFALYALYRLITDES
392418251YP_006454856.1 Protein of unknown function (DUF732) [Mycobacterium chubuense NBB4]MKITIACAAAVACAAALAGAPAALADPEGDFLTVISKGGITWPSEKTRQV
IETGYAVCQDWENGATFEKEVADLTSVTDWTDYQAGYFVGAATGAFCPEY
ESKVS
392418250YP_006454855.1 Protein of unknown function (DUF1416) [Mycobacterium chubuense NBB4MPASVDLEKETVITGRVVDGSGQAVGGAFVRLLDSSDEFTAEVVASATGD
FRFFAAPGTWTLRALSPAGNGDASVAPSGAGIHEVDVKVA
392418249YP_006454854.1 rhodanese-related sulfurtransferase [Mycobacterium chubuense NBB4]MARSDVLVTADWAESNLDAPNTVFVEVDEDTSAYDTGHIPGAVKLDWKTD
LQDQVKRDFVDTEQFSKLLSERGIANDDTVILYGGNNNWFAAYAYWYFKL
YGHEDVKLLDGGRKKWELDARPLSTETVSRPSTSYTAKAPDTSIRAFRDE
VIAAIGTKNLVDVRSPDEFSGKILAPAHLPQEQSQRPGHVPGAINVPWSK
AANEDGTFKSDEQLAKLYADAGLDGEKETIAYCRIGERSSHTWFVLQELL
GHTNVKNYDGSWTEYGSLVGAPIELGS
392418248YP_006454853.1 hypothetical protein Mycch_4469 [Mycobacterium chubuense NBB4]MSNITSARTESGAAAWVDVRGPRFAAWVTTGVLVVILLVSHASALAAAVI
LGVQAVVFAVGALLGPRRHPYGVVFAKLVAPRLGPVGDREPVAPLQFAQL
VGLVFAVLGVLGFSGGIPLLGLIATGLALVAAFLNAAFGICLGCQLYPLV
SRLRPKPGNP
392418247YP_006454852.1 Thioredoxin [Mycobacterium chubuense NBB4]MSASWIAVIAVLIAALGLAYVIGRLLTLRAGLMKATTDIPQVDTSELGLS
DTGPTVVHFSAVWCGPCAGVRRVVDQVCAELPAVAHVEIDMDANPEAARR
LSVLSLPTTFIFDGDGRQRYRASGVPSAAELRSALEPLLA
392418246YP_006454851.1 hypothetical protein Mycch_4467 [Mycobacterium chubuense NBB4]MIGVLGTLVVIGVGAVGTDFGAAIYAEYRLARSVRTSANLTWDPSVGILG
FPFIPQAMRHHYNEVEIKASGVDHAVVGKASLESTLHSVELGDSWLVPPD
ATLTVGKVESRIIIDSTHVGRFMGIPDLLVEAPTRETNDSTGGTTESGIS
SNRGVVFTGTPTKAGFDKKVSIAVDLSVTGPGATTLVLTATGVLTGAGTA
DQDVPQEQLPAVLAAFSTSLPGQKLPFGIAPTSEGARGSDIIIEGITQGV
TIDLNEFRLS
392418245YP_006454850.1 response regulator with CheY-like receiver domain and winged-helix MDLLLLTVDPHPESVLPSLSLLAHNVRTAPTEVSSLLEAGSADVAIVDAR
TDLAAARGLCRLLGSTGTSVPVVAVVNEGGLVAVSIEWGLDEILLPGTGP
AEIDARLRLLVGRRGGMANQENVGKISLGELVIDEGTYTARLRGRPLDLT
YKEFELLKYLAQHAGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYESLIGTVRNVGYKAVRPARGRTAPADADVPEDMTEDIDDDAYDDAA
APHMESLSRDGVSQALGDALPSQ
392418244YP_006454849.1 mycothiol synthase [Mycobacterium chubuense NBB4]MSASARIGWRERLSAADQRQIRDLVTAAAAADGIAPVGDQVLRELGHDRT
RHLVAVDDEGTVAGYLNLAPPTDEAPAMAELVVHPRLRRRGTGAAMIRAA
LPEGGDGTRIWAHGNLDAARATASALGLVVARELLQMRRPLAGLPPTPAV
DGVTIRTYAGPQDDTELLRVNNAAFSWHPEQGGWTEADIAERRAEGWFDP
AGLFLAFDEDSGDLLGFHWTKVHSATLGEVYVVGVDPAAQGRGLGGALTL
IGLHHLGERLGADGGGSAVMLYVEADNSAAVKTYRRLGFDVANTDVAYAE
LSTVHRSEN
392418243YP_006454848.1 phosphate ABC transporter substrate-binding protein- PhoT family [MMKPNRLGAALSLAAAGTLLLSACGSDNNTASSGGSSSASGGAASGNIQCG
GKKSLKASGSSAQANAMTRFVTAYEGACSGYTLNYTSSGSGAGVSEFIGG
QTDFGGSDSPLNAEKGEVEKAAARCGNNPAWNLPTVFGPIAVTYNVQGVD
SLVLDGPTLAKIFNGSVKTWDAPEIAGLNPGKTLPANPINVLFRSDESGT
TDNFQKYLTAASDGAWTQGAGKTFNGGVGEGAKGNEGTSAAIKNTPGSIT
YNEWSYAKSQGLQVAKIVTSAGPDPVELSTESAGKAIDAVKIKGDGNDLV
LDTASFYKPTQAGSYPIMLGTYEIVCSKYADADTATAVKAFLHAALGPGQ
SGLEDNGYIPVPDKFKERLTSAVDAISATT
392418242YP_006454847.1 phosphate ABC transporter membrane protein 1- PhoT family [MycobactMATKPTKSTGLRKSEGRVGDTLFKSVAIAAGATIIGVIALMGLFLLVRAV
PSLQANTANFITSSEFTTSEPMRFGIADLFRVTVLSSIFALVIAVPVAVG
IATFLTNYAPRRFARPFAILVDLLAAVPSIVFGLWGIFVLAPRLEPIQRF
LNDSLGWLFLFAPGNVSLAGGGTIFTAGVVLAVMILPIITSVSREVFTLT
PKGHVEAAQALGATKWEVIRMTVYPYGRSGMIAGSMLALGRALGETVAVL
IILRTAAQPGNWSLFDGGYTFASKIASAAAEFSAPLPTGAYIAAGFVLFA
LTFIVNAVARLAAGGRVSGG
392418241YP_006454846.1 phosphate ABC transporter membrane protein 2- PhoT family [MycobactMTDTVLESPLKGPTFHPISTSRKVKNRVAETLFAAAFLIAMVPLVWLLYT
VVSRGYTAVISSTWWNRSLAGVLPEQFAGGVYHAIYGTIIQAALAAVLAV
PLGMMAAVYLVEYGRGWFARTVTFMVDILAGVPSIVAALFIFALWIATMG
FPQSALAVSLALVLLMLPVVVRNTEEMLKLVPDELREASYALGVPQWKTI
LRIVVPTALPGIISGILLALARVIGETAPVLVLVGYARSINYDPFEGNMA
SLPLLIYTELINPEPAGRMRVWGAAMTLILIVAALYIAAAFVIRFLNRNR
T
392418240YP_006454845.1 phosphate ABC transporter ATP-binding protein- PhoT family [MycobacMAKRIDIKDLNIYYGSFHAVADVGLSVQPRSVTAFIGPSGCGKSTVLRTL
NRMHEVLPGARAEGSVLLDGEDIYGAGVDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRNKKTLDEVAERSLKGANLWTEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIAELKQDFTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKIFSNPTQKATE
DYISGRFG
392418239YP_006454844.1 phosphate uptake regulator- PhoU [Mycobacterium chubuense NBB4]MRTAYHEQLATLTSQLGEMCGLAGVAMERATQALLQADLALAEQVITDHD
QIAAMSVRAEENAFVLLALQAPVAGDLRAIVSSIQIVADVDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGHSAQEVLITHDPEKAARI
REEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLGRFYERFADHAVEV
ARRVIFQVTGRTADEEQLPAR
392418238YP_006454843.1 transcriptional attenuator- LytR family [Mycobacterium chubuense NBMSDGDMEDAAATPGRPLPGDQNKPDGDWLTRSRQSAPAAAPWERTIDRSA
PVTVADLIAKIHGGAPPSEPKRHRAEPEQDIEPQPAPEPEPAPEQEPEAE
PYPADELDTTILPAVDAYSSELPDLAAPRTRQREAEASAGTAPRRARHRS
VILGRSVAALVAALALVLTGGAWQWQSAKNNLLNRVSALDPDSRDIVDPN
AQFGDENFLIVGVDSRFGDNSEMGVGTTADAAGSRSDTVMLVNIPANRKR
VVAVSFPRDLKIEPMKCEVWNPETRQYGPIYDEQTGTMGPDEAYTEYKLN
SAFSIGGPKCLVKVIQKMSGLHINRFMAVDFAGFSKMVDALGGVEVCSTT
PIEDYELGTVLSKAGRQIVDGRTALNYVRARQVTTETNGDYGRIKRQQLF
LSSLLRSLISKDTFFSLSKLNNVVNMFINDSYVDNLTTKDLVDLGQSVQG
VNAGRITFVTVPTVGYPDEWGNEIPRTDGLRALFDAIINDDPLPEERNAD
NTPVPGTPESLANSANGAPAPAPPAPSDGQIIDAVATSPGEVTVKVSNST
GESGLAATAADALETHGFNVTSPDDYPGPLEHTTVFFSPGNEKAAATVAS
SFPEPTIERATGLGDAVQVVLGSDFHSVVPPSPSGATVKVHVLRGTKNTH
TALPEDLTVTNAADTTCE
392418237YP_006454842.1 putative TIM-barrel protein- nifR3 family [Mycobacterium chubuense MRIGPLALRSPVVLAPMAGVTNVAFRTLCRELELARAGTVSGLYVCEMVT
ARALVERHPVTMHMTTFAPEESPRSLQLYAVDPANTYAAAKMIVDENLAD
HIDMNFGCPVPKVTRRGGGAALPYKRRLFGKIVGAAVAATEGTDIPVTVK
FRVGIDDGHHTHLDAGRIAAEEGAAAVALHARTAAQRYSGTADWDQIAAL
KAHVSGIPVLGNGDIFDARDALAMMAATGCDGVVIGRGCLGRPWLFAELS
AAFTGAEPVTPPTLGEVASIIRRHGELLAAHFGEDKGMRDIRKHVAWYLH
GFPAGADLRRSLALVKTISELDDLLAQLDGDVPFPAAANGPRGRQGSAAS
VTLPEGWLDDPDDCTVPAGADVMHSGG
392418236YP_006454841.1 Fatty acid desaturase [Mycobacterium chubuense NBB4]MSKDLTDLQLLTELEPVVEQNVNRHMRMKKDWNPHDYIPWSDGKNYYALG
GQDWDPEQSQISEVARVAMLTNLLTEDNLPSYHREIAMNFGMDGPWGFWV
NRWTAEENRHGIALRDYLVVTRNVDPVELEMLRVEQMTRGFSPGQNQQGG
IELFAESLFDSVIYVTFQELATRVSHRNTGKACDDSIADQLLQRVSADEN
LHMIFYRDVSEAGFEIAPDQAMKSLHKVLRNFKMPGYTIPDFRRRAVTIA
TGGVYDPRIHLDDIVMPVLKKWRIFEREDFNGESARMRDDLGALVDELQE
AVDKFEVAKQRREERLAQMAEKKAAKAQLVGSSTS
392418235YP_006454840.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPSGQRRGRWSGVPLQDRQARRRDELITAGIGLLGSPGGPSLTVRAVCRA
AGLTERYFYESFTDRDDYVGAVYDEVCTAAMSTLMDSASMRDAVERFVAL
MIDDPARGRVLLLAPEAEPVLARSGARWMPNFIELLQRNLTRITDPTSQA
MVATGLIGALTALFTAYLDGRLTASREQFIDHCAELLLSRAADGIAPPTC
G
392418234YP_006454839.1 hypothetical protein Mycch_4455 [Mycobacterium chubuense NBB4]MTQDTSAACPATSASGADEAVVAAGCPVTSGGYDAPPAPLGPDSLTWKYF
GQWTGMLQGPWAGSMQNMHPQLGAAVQHHSIFFLERMPRLFRSVYPIGGV
VFDGDRAPKTGAQVRDYHIGIKGVDDQGRRYSALNPDVFYWAHATFFKST
LLAAEWVGGGLTEAQKRQLFDEHVTWYRMYGMSMRPVPKSWEEFCQYWDH
MCHNVLENNWAAREVLDLSSMPKHPSLEWMPGWLWRLNVMAMQRFFNFTT
VGLFDPPVRELMGYTWSPRQERLHRLFGQAVYRITKVLPTRMTMHPRKRS
AWDRAHGRLPVDAPLVETPARNLPPVAYRDDPHYYSPKV
392418233YP_006454838.1 hypothetical protein Mycch_4454 [Mycobacterium chubuense NBB4]MLGKLGIGPLLLIAAVAMADNAAAQPESDTRAQMIVVNAPAANSAVGELT
TYQRVDGRWEKVLGPTRADFGELGVGAPADDVFRTPVGTFPLGQAFGREP
NPGTRMPYFQATDEDWWDEDVDSPTYNTHVRAAEIDSEDAENLYDSGAIY
DYAVLIDHNPERVPGRSAGIFLHVSDGDPTWGCVAIGRDEMRSVLQWLDP
AQHPQITIGVGLDGAPATN
392418232YP_006454837.1 protein kinase family protein [Mycobacterium chubuense NBB4]MAAPEVLGGRYELRGVLGRGGMAEVRDGWDTRLGRPVAVKMLYPAVSVQS
DTRRRFVTEARAAATLNHPHVVAVHDSGVDHGRHYIVLERLPGQNLAGVL
ARGGPLPAGQVRAIMRDVLSALDAAHARGVLHRDIKPANLLFTPSGGVKI
ADFGVAKSPETPQTLTNRVFGTMAYLPADRIAGRPAVPSDDLYALGVVAY
EALTARRAYPQENLAALADAIAAGRVTPLTALRPDIDPALAMTIERAMSP
DPRWRFATAAQMRASLNATARRPQRAGVVLAAAAVLAVVVLAALLVAM
392418231YP_006454836.1 chorismate mutase- putative [Mycobacterium chubuense NBB4]MNIRRIRRAAAAAVVFALTAAPLAHAQPPNPLLPLVDAAAARLQVAEPVA
ADKRRTGGPVEDSAREQQVLDAVAADARSRQIDPAYAAAAFRDQIDATVA
VEYSRLAQWKLDPASAPTDAPDLASSRATIDALNQTMVAEMAAQWGLLHS
PQCGADLDAAKSAVLHTRALDPLYRQAIDFATRNYCR
392418230YP_006454835.1 transcriptional regulator [Mycobacterium chubuense NBB4]MNSTPAATTLTADKSAFRQRLLDALEAAIAEQGYPKTTVADIVRGARTSR
RTFYEHFDSREACFVALLSDANADQVTQISEAVDPSAPWQKQVRQAIEAW
ISSAEARPALMLSWIRDVPSLGAAARHLQRDAMETFIAMVGALGAGDEFR
AAGIGPVSRRRIIMLLGGLRELTAITVEEGGRMSDVTDEAVDASIALLRP
QAG
392418229YP_006454834.1 Zn-dependent hydrolase- glyoxylase [Mycobacterium chubuense NBB4]MRVHHLNCGSMRPLMVGAMVCHVLLVETDNGLVLVDSGFGSRDCERPARL
GTIRRHLIRPVLDPTETASSQIERLGFQRSDVRHVIITHFDADHIGGLAD
FPDAQVHITSAEAFGAMRSRAVRDRIRFRSTQWAHGPKIVEHSADGESWR
GFAAAKELDDIGPGFALVSLPGHTAGHACVAVDAGHRWLLHAGDAFYHYG
TADGARIPPWTARLEKLVAYDRKRVRENHARLAELYRRGDPDLMILCSHD
PTLFERAKASALV
392418228YP_006454833.1 transcriptional regulator [Mycobacterium chubuense NBB4]MQVNVTGQVLSTSGDVLPATRLAGAARGLRYVTHMVRPAQTARSERTREA
LRRAAVVRFLAQGIEETSAEQIAADAGVSLRTFYRHFASKHDLLFADYDA
GLHWFRTALAARSPDESIIESVQSAIMASPYDDWAVTEIASMRAQELDPG
RIVRHIRQVEADFAEAVEDHLAGADPPAPGTEQRMRVTVTARCIAAAVFG
AMEVWMLGEDRSLPELDRLCRHALELLRTGIDERV
392418227YP_006454832.1 phytoene dehydrogenase-like oxidoreductase [Mycobacterium chubuenseMTDFDAIVVGAGHNGLTAATLLQQAGLRTLCLDAKLYAGGMASTVELFDG
FRFEIAGSVQVPTSAVVSRALRLEELPTVELDVMSVQLRGDGDDPVIYYT
DPMKLLAHLNDVHGAGAVNGMAGLMAWCQAPTRALGRFDAARPPKTLDEM
FACATGEFERQAVSDMLFGSVTDVLDRYLPDREKYGALRGMLAFLAVNTT
YRGPATPGSAAALAFGLAVPDENATLIKKFRGGMGAVTEHLLAMFTAGGG
QLRLRTRVEEIRVTDGRVRGVRTDDGSTLSAPVVVSGVAPDLTVNTLVDP
TAVPADLRARFGRIDHRGSYLQMHFALDGPPTFAEPYEVLNDPEYQSAIG
IFTTPEDLQQQWEDSTRGLVPGDPAIALQIPSANDPGLAPPGKHAVSAFS
LWFPIGEGRSSYGERKTEMGRRVIEKITKLAPDFESLILRHTTFTPRHMG
TMFGAPGGDYCHGLIHPEQMGPNRPGPKGYADQPIPVEGLYLGSAGCHGG
PGITFIPGYNAAMAVLADRA
392418226YP_006454831.1 hypothetical protein Mycch_4443 [Mycobacterium chubuense NBB4]MSKDKPQTTETDAGSDAADDDVMSDPSKGAQDGADWSDEGGATPGGPAPS
T
392418225YP_006454830.1 Zn-finger-containing protein [Mycobacterium chubuense NBB4]MSGAPNEPVDPTVPPSGTGCLECDAAGGWWVHLRRCAACGHIGCCDDSLE
RHASAHWRRTGHPVIRSFEPGEDWFWDYRTDSYYDGPPLAAPQSRPADET
VPGPRGRVPADWMAQLQARRG
392418224YP_006454829.1 oligoketide cyclase/lipid transport protein [Mycobacterium chubuensMVYGRAMATKDSREVVIEATPEQILDVIADVEATPTWSPQYQKAEVLDRY
DNGKPKQVKMTVKAAGLTDEQVIEYTWADDKVTWTLVSANQLKAQDAGYT
LTPEGDKTRVRFDIAIDLSVPLPGFILKRTIKGGVETATEGLRKQVLKVV
KGG
392418223YP_006454828.1 cation diffusion facilitator family transporter [Mycobacterium chubMSAATDATDSTSSDTKGESTLTVIVALAANLAVAIAKTVAAVISGSASMT
AEATHSWADTANQGFLIVANRRSGRPPDAERPLGYGREAYVWSLLAAVGL
FVVGGTVSVWHGVTEIIHGESGPENYLVAYIVLGVAFVLEGSSLFQAFRQ
LRGEADEFNRDLLAHVLDTSDPTTRAVFAEDTAALIGIVFALLGIGLHQL
TGQAVWDAIGSIAVGLLLGVVAVILIDRNRRFLVGEPASPQLREAAIERL
KNLPEVASVRFIRLVFVGPKQLFLVASVDLVGDAVESSIADTLRNLENQL
QAEPYIVDAVLTIAEPDALDRLA
392418222YP_006454827.1 response regulator containing a CheY-like receiver domain and an HTMRLSWPIVGRSHELRTIETALTTTDVSGVLLCGPTGVGKSRIAREALASA
ASRGCHTRWAVGTTSARGIPLGAFAAWAPSGASDTIALLRGVLESLTAAP
SGVDVVIGVDDYHLLDDLSTFVVQQLVARDAAKLILTVRESEPVAAHTQD
VLRAGHFERLGVRPLTLDETTALASAVLHGPIDAQAARRLWKLTGGNVLY
LRNIVEHEVADGRMVQQNGCWRWIGDPVMPPGLIEMIEARIGELPEQVDD
VMDVLSVGEPIELATLTRITGASALEEAEIRGLVALEPAGGGVEVRVAHP
LYGEVRRRRAAHTRLRRLRGLLAEALAASADSDDLRVVVRRATLTLDSDL
VPDADLLATAAQGAVWLGDLSLADRLADAAARAGAGPESVLLRAHALSWL
GCGELAEHLLAGVSGDRLTPCERARWAFLRSSNMLWALADPARAKELIDE
ASRSTPPEARTYIDAFLAVYWFAMDHPDKAVDASKNLAPEDIPVVGAETA
WALAQISADAGRAGEAVAAAEAGYAVATRSLDAPHMVFNIADAHTSALLL
AGRIPDALAVAERARRQAAELPGTAPLIGTAVAGRAALAAGDVCGACHLL
GQAVEALSGSHPLGWGFRYRIPYATALAMRGATDEAAAALAALDEVPRRF
RALRHEQCMARAWTVAGQGAVSEAIALLRSTAESCALAGQFGQEVQCLQM
AAQFGDRTTAPRLRELVSLAEGPRAAVAARFAAALHDGDAAELDAVSEAF
AQMGDPIAALDAAAHAAREYRRQDRRGSALRCSARADALASRCGVRTPAH
RQAGQTLPLTDRETEIVMLIGEGLSNRAVAERLTLSVRTVESHIYRAMSK
TGTTSRDELAALLHGD
392418221YP_006454826.1 adenylate/guanylate cyclase family protein [Mycobacterium chubuenseMAASAVCATCGTTLRRGAKFCDECGARTRTAADVPEYKQVTVLFADVVRS
MGIAAAVDIERLREIMTDLLERSAAVVRRYGGSVEHTGDGVMAIFGAPIA
LEDHAFRACLAALDIQEQTRRLASEVARRDGLELQVRTGLNSGRVIAGDI
GSGSLGYAATGETVGMAQRMESVAPPGGVMLSESTSRLVERVVRLSEPQW
VRIKGADEPVLARRLLTTGPPEEPVRRAEASLVGRHGEMAALDAMVRRML
DGEGGIATVVGAAGIGKSRVARELAALAADRGVVVHWAFCESHARDISFG
VVSRLLRAGTGVVDLDREAARDRLRERLPNADPQDLLLLDDLLGVADGGA
PLPPIGADARRRRLTKLVIDAAEARTEPVLSIIEDAQWIDAVSESMVADF
LTVVARTPSMVLVTARPEYTGALRQIPGALTTTLTPLQDSDAAALLRELL
GTHESVGGLATVIADRAAGNPFFAEEMVRELAQRGVLEGDRGRYVCRADV
ADVSVPATVQAAIEARIDRLSTPAKRTLNAASVIGARFEVELLTALGIEP
AVDELLGVELIDQVKRGTRAEYAFRHPLIRAVSYESQLRADRTLSHRRLA
RAIAEREPDSVEENAALIAEHLEASGDLQEAYGWHMRAGAWSTIRDIHAA
RLSWERACRIADSLFADDRSRWPLRIAPRSMLCATDWQAREVNTSRGRFA
ELRELCAAAEDNVSLAIGMTGLATELLYAGRPGEGSRLASEQMALLESIG
DANLTTGLAFVAFANWFNAGDIDAIARWSQTVIDLADGDPSKGAGFGVGS
PLAIATAFRSISRWWLGRPGWREDLENSLTIARNSDPATLALAIAWTYAL
AIGAGVLLADDVIVTEIEKTVEAAARFSNDFALHGSELALALALLHRDSE
PERRRGLELMVQARDVHMPVSAPSLVPTAQLWASREMARRGDQGDPVAAM
RRAVTELRTSGRLGWALLGTGVLVDVLLERGTDSDLVETEETLQWLASLP
ATEGWAIRDIMLLRQRARLARARGDHASHHDLAGRYHTMAKSLGFEGHTF
YAEALCTATQSP
392418220YP_006454825.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMHAPLIFAGMAVRASSETVIEAPPEAILDALADIESVTSWSSLHKDAEVL
DRHPDGRPHHVKATVKIMGINDKELLEYHWGDDWVVWDAERTSRQRCQHG
EYNLTPVGEQRTRVRFDLILDLAAPYPGFLVKRAKKMVLDVALENLRQRV
MAVAR
392418219YP_006454824.1 aspartate/tyrosine/aromatic aminotransferase [Mycobacterium chubuenMTVERLRPYAVTIFAETSALAARIGAVNLGQGFPDEDGPAAMLETAANAI
ADGVNQYPPGLGIEPLRQAIAEQRRRRYGIEYDPDTEVLVTVGATEAIAA
SVLGLVEPGSEVLLIEPFYDSYSPVIAMAGCRRRAVPLRQDGHGFAIDVE
ALRHAVTPTTKALIVNSPHNPTGMVASDAELRALAELAVSADLLVITDEV
YEHLVFDGHRHLPLAGYPGMAERTVTISSAAKMFNVTGWKIGWACGPSNL
IAGIRAAKQYLSYVGGAPFQPAVAQALNTEDAWVDALRDSLQSRRDRLGS
ALTDIGFDVHDSSGTYFLCADPRPLGYDDSTTFCAQLPERVGVAAIPMTA
FCDSAAAHADEWKHLVRFGFCKRDETLDEGVRRLQALRRRG
392418218YP_006454823.1 NADH:flavin oxidoreductase [Mycobacterium chubuense NBB4]MTFTLREDSALLKPVTVGGRTLANRVFMAPLTRTRAEADATPSELAATYY
AQRAGAGLIISEATAVSKSANGAYLNTPGMYNDRHQQRWAEIAEAVHAEG
GRMFVQLWHVGRMAHPDISGGETVGPSPVAADLMARTATGKKPLPVPRAL
STGEIAGIVADFRAAARRAVDAGMDGVEIHSANGYLLHEFLSDVVNRRTD
AYGGSPQNRARFTAEVVEAVAAEIGPERVGLRISPGNGAGDMSEVDEVSA
YELLLCRIASLGIAYLHVLIEPSQPAFAALRTQWEGTLVLNTPREIDSDF
GLLENLADWGVISAAAVGRAYLANPDLIDRLTAGAELNEPDPTTFYAPGP
AGYIDYPTLSELAEPRSA
392418217YP_006454822.1 hypothetical protein Mycch_4434 [Mycobacterium chubuense NBB4]MAKYRVLNPKGDVVDTKDIDSADDAHAWFVDQRADNSELGWRMEVEHDGE
WSFFDDTEGSPD
392418216YP_006454821.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MSEEAFIYEAIRTPRGKQRHGSLNEVKPVNLVVGLINELRSRYPDLDETM
ISDVILGCVSPVGDQGGDIARTAGLLAGLPETTGGFQLNRFCASGLEAVN
LGAQKVRSGWDDLVIAGGVESMSRVPMGSDGGAWASDPETNYRLGFVPQG
IGADLIATIEGFSRDDVDAYALRSQQKAAAAWSGGYFAKSVVPVRDQNGL
VVLDHDEHMRPDTTMEGLAKLKTAFDGIGAMGGFDDVALQKYHFVEKINH
VHTGGNSSGIVDGAAVVLIGSESAGVSQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRNARRALITLCIGGGMGVATII
ERV
392418215YP_006454820.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVEKLVRLVA
EDPASITGVVIASAKKTFFAGGDLKGMMKVGPENAAESFAEVEFIKADLR
QLETLGVPVVAAINGAALGGGLEIALACHHRIAADVKGVVIGLPEVTLGL
LPGGGGVARTVRMFGIQKAFMEILSQGTRFKPGKAKDIGLVDELVGSVEE
LIPAAKAWIKANPDAHTQPWDQKGYKMPGGTPSHPALAAILPSFPALLKK
QLKGAPMPAPRAILDAAVEGAQVDFDTATRIESRYFTTLVTGQTAKNMIQ
AFFLDLQHINGGGSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGYDV
VLKDVSQEAADKGKGYSEKLEAKALERGRTTQEKSDALLSRIHPTADPQD
LKGVDFVIEAVFENQELKHKVFQEIEDIVEPNALLGSNTSTLPITGLATG
VKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTPI
VVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYPAPPLQL
SDELNMELMQKIATATRKAVEETGATYEPHPAEAVVNKMIEIGRPSRLKG
AGFYEYVDGKRAGLWEGLKDTFNSGSADIPLQDMIDRMLFAEALETQKCL
DEGVLTSTADANIGSIMGIGFPPYTGGSAQFIVGYQGPGGTGKEAFVARA
KELAARYGDRFTPPASLTS
392418214YP_006454819.1 transcriptional regulator containing an amidase domain and an AraC-MHTVAILAYDEMTGFESGLAAEIFGMTELSEMFSAGIARPWYSVRLCSET
PEVRMLGGAVVRTSYGLDELARADTVVIPSVRDVTTPTSPELIEAIRAAY
ERGSRLVSICSGAFALAAAGVLDGRTATTHWIYVDLLAERYPDVVVDPAP
LYVDNGRILTSAGCAAGLDLCLHIVRSDHGVRVANDVARRLVISPHRSGG
QAQYIESPVPEPTADGRIASGMAWALENLDSPITLDDLAAHSAMSRRSYL
RQFAKATGTTPIKWLIEQRIQASLPLLESSALSIEQIATRVGFESPVTFR
YHFARQMRTTPSDYRSCFTGSDPEQQWRRAR
392418213YP_006454818.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMHDSFTGQFSAGLASYGSRPCIEFEGRWYTGDEITAYAEALSSALKDSGV
DDRASVGLVVRNRLQHAAAIIGFLAAGRPVSMIYSFQSPDAIARDIETLQ
LSAVIADREDWTDEVIAAAKRAGSAGVAISLTAPTVTPVVGLHRRDSSRR
HAQAEPGVALHILTSGTTGPPKRQAIKASVLERTVFSVTSGEAAPSDAPP
EFAYWQFGGIGVCQLVAGIHNGRRIVMLERFSVDGWVDVVRRHHITRSGV
QPAVIRMLLDADVPAGHLRSLEFLISASGPLDPQTRDEFERRYAIPIRLA
YGATEFAGSLCAWTPEMLQEFGDAKRNSVGRALPDVRLRVVDPDSGAELP
PGQQGLLEAMVAPISSDWIRTTDFASIDDDGFVTLHGRADGAINRGGFKV
LPETVRDVLVQHPSVRDACVVGVPDARLGQVPFAAVEVVPGSSPPSEDEL
KAIVRQRLPVYNVPVSFALVDELPRNPALKVSLPAVAALYRAGGQSA
392418212YP_006454817.1 putative F420-dependent oxidoreductase- Rv1855c family [MycobacteriMRFGLFIPQGWRLDLVGIDPGEHWRVMSDLATYVDEGGIWDSLWVYDHFH
TVPVPTSEATHEAWSLMAAYAATTSRIKLGQMCTAMSYRNPVYLAKVAAT
ADIISGGRIQMGIGGGWYEHEWRAYGYGFPSAGVRLGRLDEGVQIMSDAW
REGVVSFEGKHYQVDKAIVAPKPLQRGGIPLWIAGGGEKVTLRIAAKYAQ
YTNFTSEPEGFAHKSQVLAGHCRDVGTDYEAIIRSANINAVVGDSEAEVK
DRLNGVRARISALTGETAADAMLNSMSTPQGGSGTPEQLVESLQKLRDLG
CEYVICYFPEAAYDRSSIEVFERKVIPALA
392418211YP_006454816.1 hypothetical protein Mycch_4428 [Mycobacterium chubuense NBB4]MCATPARHRAARKDDLGPGPDFWAAKALVEGGRQGRAAKHARKVSAKYGL
HIGRVGALAVSLGVGLAVANSAGVAYADSDSDSSVSPSSKPDHAASTAPH
KPARKSTDKSDASSTDDPGSQGGDAGQDADEKPAPDSQDADPEPGTDEPA
DEDVPGEETASPLPGETDNHRRPSRKVSDHHWRRSSAPTHDEPSSTVEAS
TGASAGSDPTPDESPVAGSGEAGAATDEVKETGKHAPQPESVSVEVAATK
SRTPKASAAIAETRTVKPVNIVSALVSSVVSPFVNPNAPAQAPWFDAMLA
WVRRQINHTFFNKTPVPGQVTTSQILTGQVLVDVPAYDPNGDPLTFNIIQ
PKYGQVYRDPITGQFVYTPTSIVTGTPLNDSFQVVISDSSEHLKGRIGAV
EAVFHTLARTIGIAQVDTVTVTIPITVNPIVELPPTVVTAGLPIFKLGGS
PVKVVSTATITDLDSDLLSSATIRILTGGKSGDVLAYTGASGPIAASWDA
ATQTLTLTGAATAAEYEAAIKAVTFSTTEGGLPRSVTINVTDDGGHTSLV
PGAALITVIGLPPLVTAGGLPIFKLGGSPVKVISAVQITDLDSTQFSSAT
LQLTSVKPGDVLAYTGGAGAISASWDAASQTLTLSGTASAAEYEAAIKAV
TFSTTEGGLPRGLTLSVTDDSQVSSLVPAAALITVIGLPPLVTATGLPIF
KLGGAPVKVISAVQITDVDSTQFSSATMQLTGGKTGDVLAYTGGAGAISA
SWDAASQTLTLSGTASAAQYEAAIKAVTFSTTEGGLPRGLALSVTDDSAV
SSLVPAAALITVIGLPPLVTATGLPIFKLGGSPVKVISAVQITDLDSTQF
SSATLQLTGAQASDVLSYSGTGVISASWDAASQTLTLSGTASAAEYEAAI
KAVTFSTTEGGLPRGLTLSVTDDSAVSSLVPAAALITVIGLPPLVTATGL
PIFKLGGSPVKVISAVQITDLDSTQFSSATLQLTGAQASDVLSYSGTGVI
SASWDAASQTLTLSGTASAAEYEAALKAVTFSTTEGGLPRGLTLSVTDDS
AVSSLVPAAALITVIGLPPLVTATGLPIFKLGGSPVKVISAVQITDVDST
QFFSATLQLTGGQASDVLSYSGTGVITASWDAASQTLTLTGDASAAEYEA
AIKAVTFSTTEGGLPRGLALSVADDSAVSSLVPAAALITVIGLPPLVTAT
GLPIFKLGGAPVKVISAVQITDVDSTQFSSATLQLTGAKSGDVLAYTGGP
GSITASWDAASQTLTLSGTASAAEYEAAIKAVTFSTTEGGVARGLTLSVT
DDSAVSSLVPAAALITVIGLPPLVTATGLPIFKLGGSPVKVISSVAISDL
DSTTFSGATLQLTGAQASDVLSYSGTGVISVSWDAASQTLTLTGDASAAE
YEAAIKAVTFSTTEGGVARGLTLSVTDDSAVSSLVPAAALITVIGLPPLV
TATGLPIFKLGGAPVKVISSVVISDLDSTTFSSATLQLTGGKTGDVLAYT
GGPGAITASWDAASQTLTLSGAASAAEYEAALKAVTFSTTEGGVARGLAL
SVTDDSAVSSLVPAAALITVIGLPPLVTATGLPIFKLGGAPVKVISAVQI
TDVDSTQFFSATLQLTGGQASDVLSYSGTGVITASWDAASQTLTLTGDAS
AAEYEAAIKAVTFSTTEGGLPRGLTLSVTDDSAVSSLVPAAALITVIGLP
PLVTATGLPIFKLGGAPVKVISAVQITDVDSAQFSSATLQLTGAKSGDVL
AYTGGPGSITASWDAASQTLTLSGTASAAEYEAAIKAVTFSTTEGGVARG
LALSVTDDSQVSSLVPAAALITVIGLPPLVTATGLPIFKLGGAPVKVISA
VQITDVDSTQFSSATLQLTGAKSGDVLAYTGGPGAITASWDAASQTLTLS
GTASAAEYEDAIKTVTFSTTEGGVARGLALSVTDDSAVSSLVPAAALITV
IGLPPLVTATGLPIFKLGGAPVKVISSVAISDLDSTTFSGATLQLTGSQA
SDLLSYSGTGVIRASWDAASQTLTLTGDASAAEYEAAIKAVTFSTTEGGV
ARGLTLSVTDDSAVSSLVPAAALITVIGLPPLVTATGLPIFKLGGSPVKV
ISAVQITDVDSAQFSSATLQLTGAKSGDVLAYTGGPGSITASWDAASQTL
TLSGTASAAEYEAAIKAVTFSTTEGGVARGLALSVTDDSAVSSLVPAAAL
ITVIGLPPLVTATGLPIFKLGGSPVKVISSVAITDPDSTTFSGATLQLTG
AQASDVLSYSGTGVITAAWDAASQTLTLTGDASAAEYEAAIKAVTFTTTE
GGVARGLTLSVTDVSAVSSLVPAAALITVIGLPPLVTATGLPIFKLGGAP
VEVISSVAISDLDSTQFFSATMQLTGAKSGDVLAYTGGAGSITASWDAAS
QTLTLSGTASAAEYEAAIKAVTFSTTEGGVARGLALSVTDDSAASSLVPA
AALITVIGLPPLVTAGGLPIFKLGGSPVKVLSSVAITDPDSTTFSNATLQ
LTGGKTGDVLAYTGGPGAITASWDAASQTLTLSGAASAAEYEAAIKAVTF
STTEGGVARGLALSVTDDSQVSSLVPAAALITVIGLPPLVTATGLPIFKL
GGSPVKVLSSVAITDPDSTTFSSATLQLTGGKTGDVLAYTGGPGAITASW
DAASQRLTLIGDASAAEYETAIKAVTFSTTEGGVARGLALSVTDDSQVSS
LVPAAALITVIGLPPLVTATGLPIFKLGGAPVRVFSVATITDLDSDTLSG
ATITLTGGKPSDKLGFNDAGTIHGQWDAQTQTLTLTGAATKAEYEAALKA
VTFTTTEGGATRSVTVAVTDDVNVASAVSVPVLISVIGLPPLVTATGLPV
FKLGGAPVRVFSVATVTDLDSDTLSGATVTLAGGKPSDALGFNDTGTIHG
EWDSTTQTLTLTGIATKAEYEAALKAVTFSTTEGGSARSVSVSVTDDVNV
ASAASVPVVISVIGLPPLVTATGLPIFKLGGAPVRVFSVATITDLDSDTL
SGATVTLAGGKPSDTLAYSDTNTIHGTWDAQTQTLTLTGAATKAEYEAAL
QAVTFTTTEGGATRSVTVAVTDDVNVASAASVPVLISVIGLPPLVTATGL
PVFKLGGAPVRVFSVATVTGLDSDTLSGATVTLTGGKPSDALGFSDTGTI
RSTWDAQTQTLTLTGAATKAEYEAALQAVTFSTTEGGATRSVSVVVIDDV
NVASAASVPVLISVIGLAPVVTATGLPVFKLGGAPVQVFSVATVTDLDSD
TLSGATVTLAGGKSSDVLGYVSALGDSIHGTWDAQTQTLTLTGSATKAEY
EAALKAVTFSTTEGGATRSVSVVVIDDVNVASAASVPVLISVIGLPPLVT
ATGLPIFKLGGAPVQVFSVATVTDLDSDTLSGATVTLAGGKSSDVLGYVS
ALGDPIQGSWDAETQTLTLTGAATKAEYEAALQAVTFSTTEGGATRSVSV
MVIDDVNVASAASVPVLISVIGLPPVVTATGLPIFKLGGAPVRVFSVVTV
SDLDSGTLSGATVTLAGGKSSDVLGFSDTGTIHGEWDAQTQTLTLTGSAT
KAEYEVALKAVTFTTTDGGGTRSVSVSVTDDVNVASAASVPVVISVIGLA
PVVTATGLPVFKLGGAPVRVFSVATITDLDSDTLSSATVTLAGGKPSDTL
AYSDTGTIHGTWDAQTQTLTLTGSATKAEYEAALQTVTFSTTDGGATRSV
SVSVTDDVNVASAASVPVLISVIGLPPVVTATGLPVFKLGGAPVRVFSVV
TVSDLDSNTLSGATVTLAGGKSSDVLDYVSALGDPIQGSWDAQTQTLTLT
GSATKAEYEAALQAVTFTTTDGGATRSVSVAVTDDVNVASAASVPVLISV
IGLPPVVTATGLPIFKLGGAPVRVFSVATITDLDSDTLSGATVTLAGGKS
SDVLNYVSALGDPIHGSWDADTQTLTLTGSATKTEYEAALQAVTFSTTEG
GATRRVTVVVTDDVNVASAASVPVLVSVIGLAPVVTATGVPVFKLGGAPV
RVFSVATVTDLDSDTLSGATVTLAGGKPSDALGFSDTGTIRSTWDAQTQT
LTLTGSATKAEYEAALKAVTFSTTEGGATRSVSVVVIDDVNVASAASVPV
LISVIGLPPLVTATGLPIFKLGGAPVQVFSVATVTDLDSDTLSSATVTLT
GGKSSDVLGFSDTGTIHGEWDAQTQTLTLTGSATKAEYEVALKAVTFTTT
DGGGTRSVSVSVTDDVIVASAASVPVVISVIGLAPVVTATGLPVFKLGGA
PVRVFSVATITDLDSDTLSGATVTLAAGKSSDVLGYVSALGDPIQGSWDA
QTQTLTLTGSATKADYEAALQTVTFSTTEGGATRSVTVAVTDDVNVASAV
SVPVLVSVIGLPPLVNATGLPIFKLGGAPVRVFSVATITDLDSDTLSGAT
VTLAGGKSSDVLGYVSALGDPIQGSWDAQTQTLTLTGSASKAEYEAALQA
VTFTTTEGGATRSVTVTVTDDVNVASAASVPVLISVIGLPPVVTATGLPV
FKLGGAPVRVFSAATITDLDSDTLSGATVTLAGGMSSDVLNYASALGDPI
QGSWDAQTQTLTLTGSATKAEYEAALKAVTFSTTEGGAVRSVTVAVTDDV
NVASAASVPVLVSVIGLAPVVTATGLPVFKLGGAPVRVFSVATVTDLDSD
TLSGATVTLAGGKSSDVLGYVSALGDPIQGSWEAETQTLTLTGSATKAEY
EAALQAITFRTTEGGATRSVTVVVTDDVNVASAASVPVLISVIGLPPVVT
ATGLPIFKLGGAPVRVFSVATITDLDSDTLSGATVTLAGGKSSDVLGFSD
TGTIHGEWDAQTQTLTLTGSATKAEYEVALKAVTFTTTDGGGTRSVSVSV
TDDVIVASAASVPVVISVIGLPPVVTATGLPVFKLGGAPVRVFSVATITD
LDSNTLSGATVTLAGGKSSDVLDYVSALGDPIQGSWDAQTQTLTLTGSAT
KAEYEAALQAVTFSTTEGGATRSVTVVVTDDVNVASAASVPVVISVIGLA
PLVTATGLPIFKLGGAPVRVFSVATVTDLDSDTLSGATITLAGGKPSDTL
AYSDTGIIHGAWDSTTQTLTLTGSATKAEYEAALKAVTFSTTEGGSARSV
SVVVTDDVSVASAASVPVVVTVIGLPPSIVTVGAPVFKLGGSPVKIVTSA
TISDVDSDQLSKAALTITGSQAGDVLSYVAPSGVSIQSLWDAATSTLTLS
GLASKADYESAIEAVTFSTTDGGPVRGVTIVVTDDSTVDSLLSSGTLITV
VGLPPSVTTVGAPIFKLGSSPVTVVSVATIIDADSTQMSQAVVKIASGGK
DGDILSYTAPEGVSIQGSWDAVSQTLTLSGIATTAEYEAAIKAVTFSTTA
GGAARSISVSVTDDVGVTSAVPGSALVTVVGLPPSLTVLGAPVHTIGAPP
VKVASAVSISDADSQYLSKATVAISLLGQTGDVLGYAGPAAGPISASWDA
DSLTLTLSGQATLAEYETALANVTFAATQSVLIARTISFSVTDDTQVSAL
LPATVTAGARYSLAPTITTTGGATYTFGKAPVTFISAAGIADADSDYMSQ
ATVKITAFGQSGDALAYATISGIPITASWDAASSTLTLSGVATKAQYEQA
LEAVTFSASGGAGIIRTVSVSVSDDTGVSSVLPGTVTVSAANPLAPLVTT
TGRLLSYGVGDPAVNPVATASVLDGDSDYMTEATLRISNNFVNGDVLAYV
AIAGNPIQSSWDSATRTLRLYGTATKAQYEQALQAVTFSATTFGGGVLDL
IWIRSIAIVVKDDSGQTASAGVTLSVTR
392418210YP_006454815.1 DNA/RNA helicase- superfamily II [Mycobacterium chubuense NBB4]MTDGPLIVQSDKTVLLEVDHEQAGAARAAIAPFAELERAPEHVHTYRVTP
LALWNARAAGHDAEQVVDALVTHSRYAVPQPLLVDIVDTMARYGRLQLVK
HPAHGLTLVSLDRAVLEEVLRNKKIAPMLGARIDDDTVIVHNSERGRIKQ
MLLKIGWPAEDLAGYVDGEAHHIGLEQDGWQLRDYQQMAADSFWDGGSGV
VVLPCGAGKTLVGAAAMAKAGATTLILVTNTVAGRQWKRELIARTSLTES
EIGEYSGERKEIRPVTIATYQVITRRTKGEYKHLELFDSRDWGLIIYDEV
HLLPAPVFRMTADLQSRRRLGLTATLIREDGREGDVFSLIGPKRYDAPWK
DIEAQGWIAPAECVEVRVTMTDNERMLYATAEPDERYKLCATAHTKIAVV
KSILERHPDEPTLVIGAYLDQLDELGAELDAPVIQGSTKTAEREALFDAF
RRGEIRTLVVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPK
AGGGGAVFYSVVSRDSLDAEYAAHRQRFLAEQGYGYVIKDADDLLGPAI
392418209YP_006454814.1 hypothetical protein Mycch_4426 [Mycobacterium chubuense NBB4]MNGSSSAGSGKVTSPNGERAPVRSAASSLTAWSSASVVGQPGSTYRFFLS
SATGTLWQADRALASSGGCFTLVTMSANTPGVPLGAWLAELDDERLIRLL
RLRPDLTQPPPGTIAALAARAAARQSVKAATDDQDFLHLTVLDAMLTLHA
DTVAVTTAELRDVLGQRAADADVVGAVEDLRELALIWGESSGDGALRVVA
EAANSLPWYPGQATLETTAMSVDDVAGALSALDAPARDLLDKLRDGSPIG
RTRDALPDTPPERPVPRLLAAGLLRRLDADTVILPRLVGQVLRGEVPGPV
KLTKPDPTVSSTAVRDVDAVAAGAAIDLLREVEILLETLSTAPVPELRSG
GLGIRDVKRLTKTTGIDERRLGLLLEVSAAAGLIAAGMPDPGPPDAAGTY
WTPTVAADRFIESATSVRWHLLASAWLDLPGRPSLVGARGPDGKPYAALS
DSLFSTAAPLDRRLLLEVLAELPPGSGVDADSASRAMVWRRPRWSVRLQP
DPVADLLTEAHAMGVVGRGAIASPIRRMLAGEPEDAVVAAMDKALPTPID
HFLLQADLTVIVPGPLERPLAEQLASVATVESAGAAMVYRIDESSIRRAL
DTGKTAGELHALFARHSKTPVPQALTYMIDDVARRHGQLRVGMASSFVRC
EDPALLAQAVAAPATASVELRLLAPTVAVSQAPIADVLAALRRSGFAPAA
EDSTGTIVDLRSRGARVPAVGRRRGYRHTPAPTDQTLAAIVAVLRKVAAA
PPSGLRLDPAVAILELQQAAHHQESVVIGYVDPAGVATQRVVAPINVRGG
QLTAYDPASGRVREFAIHRVTSVVSAESG
392418208YP_006454813.1 cyclic pyranopterin monophosphate synthase subunit MoaC [MycobacterMGSDPSGDVPALSHVDETGAAHMVDISAKDVTKRTAVAAGTVHTRPDVVE
MISANGLPKGDALATARVAGIMAAKRTSELVPLCHPLGITGVDIDFTVAH
NGDPGSVGITATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDRSARID
DIRVVHKEGGKTGTWAR
392418207YP_006454812.1 molybdopterin adenylyltransferase [Mycobacterium chubuense NBB4]MSRTGVVIIASTRASAGVYEDRCGPVIVDWLNERGIATSAAVVVADGEPV
GSALRDALVREADVVITSGGTGISPTDSTPQVTAALLDYEIPGLADALRR
SGLPRVPTSVLSRGVCGVSGRTLIVNLPGSVGGVRDGLGVLADVLDHALD
QLRGKDHSR
392418206YP_006454811.1 molybdopterin converting factor- large subunit [Mycobacterium chubuMTTVVRVALTEHPIDSPEHEALVAHHAAGAVVAFAGVVRDHDGGRGVTRL
EYSAHPTAEQTLSEVAAEIAATCQGVRAIAVSHRIGTLHIGDAALVAAVA
ADHRGAAFETCSRLVDAVKARLPVWKHQFFSDGTDEWVNSA
392418205YP_006454810.1 transglycosylase-like protein [Mycobacterium chubuense NBB4]MSGRHRKPTSSAVNVAKIAFTGAVIGGGSLALAGNASAATDSEWDKVASC
ESGGNWAINTGNGYQGGLQFSASTWSGHGGGEFAPAAHLATKDEQIAVAE
RVLATQGKGAWPVCGGPLSAATPRNVVEQPPAPLNPLLANGQLPPPPPLD
PFAPPPPPAPAPFDAMSASPAACTRRSAAARARGRPTTRSRPDGRTAAPA
ASRSPVVDVANWDPAHGPAPADQPQVWALHTGDVPLQPAPTDPAPAPAPA
PAPNAVAAPAPDPLAPLGALNVPGPAYDVANQAISGDLPLPDGVPHLASP
QNLPPGTTADPSQLPGAGSPNVSYLKDIWHAIQTQEISGKDALLALTQRP
MTTPGTTGGPAPELPAPPAPGTPPAAPVPGPAPVVPPA
392418204YP_006454809.1 molybdopterin converting factor- small subunit [Mycobacterium chubuMQADVEVRVTVRFFAAARAAAGAEEEVVKLPAGATVADLIALLEARGETL
SRVLARCSYLCDGVAVRDTATALGDAQTLDVLPPFAGG
392418203YP_006454808.1 molybdenum cofactor biosynthesis protein A [Mycobacterium chubuenseMTVVALGLPSVQRPLPAAPTDGPLIDTFGRVATDLRVSLTDLCNLRCTYC
MPAEGLDWLQGEQKLRPAELNRLISIAVTRLGITSVRFTGGEPLVVPHLE
EVIAATAVLRPRPEITLTTNGVGLARRAAGLKAAGLDRINVSLDTVDAAR
FAAITRRDRLADVVDGLQAAQAAGLDPVKVNAVLDPVTGLDDAVALLRFC
LRHGYQLRIIEQMPLDAGHAWERDRAVRADDILAELRRHFTLNPDPAPRG
SAPAELWQVDDGTGATGRVGIIASVSHAFCAACDRSRLTADGQVRNCLFA
REETDLRALLRSGADDAALEAAWRAAMWAKAAGHGINEPDFVQPDRPMSA
IGG
392418202YP_006454807.1 putative membrane protein [Mycobacterium chubuense NBB4]MRLILNVIWLIFGGLWLALGYLLAALICFILIITIPFGFASLRIALYALW
PFGRTIVDKPGARPGALVGNIIWIIVAGVWLALGHLVSAVAMAVTIIGIP
LALANLKLIPVSLMPLGKEIVPVDAARSTQVGVAL
392418201YP_006454806.1 cold shock protein [Mycobacterium chubuense NBB4]MPTGRVKWYDAEKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
AAGRRGPQALSLKLIDPPPSLTRTRREAAAAEHKHTPDELHGMVEDMITL
LEGAVQPELRKGRYPDRKVARRVSEVVRAVARELDA
392418200YP_006454805.1 putative glutathione S-transferase [Mycobacterium chubuense NBB4]MSYVADPSSSGGDFNRDTDYITTRITADGRDGYAVEPGRYRLVVARACPW
ANRTIIVRRLLGLEDVLSIGFCGPTHDERSWTFDLDPGEVDPVLGIHFLR
DAYNKRIADYPKGVTVPAIVDIPTGEVVTNDFAQITLDFSTEWSAHHRDG
APQLYPEPLRDEIDDVAQRIYTEINNGVYRCGFAGSQRAYERAYDRLFTA
LDWVSERLTDQRFLVGDTITEADVRLFTTLARFDPVYHGHFKANRSKLSE
MPVLWAYARDLFQTPGFGDTIDFVQIKQHYYIVHSDINPTGVVPKGPDLS
NWLTPHGREALGGRPFGDGTPPGPTRETERVPEGHGAD
392418199YP_006454804.1 Protein of unknown function (DUF2771) [Mycobacterium chubuense NBB4MKRIIAVLAAVALVSSIATGVLVWRLTRHHTAELPQISAYTHGHLARVGP
YRFCQVLNPTDCVVPGDQGELPVTARDPIQLSVPPAVSRAPWVLLRAYED
ADVVSEFRPDTRLAVTIPTVDPQRGKLTGIAVQLPTLVRDEAGNEFPVPH
AEWSVRTVWG
392418198YP_006454803.1 Major Facilitator Superfamily transporter [Mycobacterium chubuense MANYPSDPVSDPGRRRGTPNSSANRWLPPLDDRERHHGYDQYDAGGRYGS
GGEKVTVTRAAAQRSREMGSKMYGLVHRAATADGADKSGLTALTWPVVAN
FAVDAAMAVALANTLFFAAATGESKSRVALYLLITIAPFAVIAPLIGPAL
DRLQHGRRVALAASFAFRTVLAVLLIANYDGATGSYPSWVLYPCALGMMV
LSKSFSVLRSAVTPRVLPPSIDLVRVNSRLTTFGLLGGTMIGGGIAAAAE
WGFQLFQMPGALYVVVAVTMAGGVLAMRIPKWVEVTEGEVPTTLSYRGDT
GETRRQPDSAKARQPLGRNIIAALWGNCTVKVMVGFLFLYPAFVAKAHDA
SGWEQLRILGLIGAAAAIGNFTGNFTAARLELGHPAQLVVRCAVAVTAMA
LATALTGNLLVAAAATLITSAASAIAKASLDASLQDDLPEESRASAFGRS
ESLLQLAWVVGGATGVLIYTELWAGFTTITGLLILGLAQTVFSYRGESLV
PGLGGNRPVLAAQQGVRADTAAVTLE
392418197YP_006454802.1 Protein of unknown function (DUF3027) [Mycobacterium chubuense NBB4MGAQATGVAAPRRFRAVLGAMDSVTDPDHQQVVQAQDQESAPDVSAAAPD
PGEVPAELAELLLGAVAEARAAIVESSGENTVGEYLGAGFEDPASATHRF
LAEMPGYRGWQWAVVVAACPGATQATISEVVLVPGPTALLAPQWVPWEER
VRPGDLSPGDLLAPPADDPRLVPGYMATGDPQIDDVAVEVGLGRRQVLSL
WGRNDTAQRWHDGDHGPGSAMARATRRVCRDCAFYVPLGGSLGVLFGVCA
NEFAADGHVVDAEYGCGAHSDTPAPHGGGSPLYDPYDDGVLDFVERPD
392418196YP_006454801.1 hypothetical protein Mycch_4413 [Mycobacterium chubuense NBB4]MAAPILQAQIDINAPVSTVWDLVSDLSKMPQWSPQCRWMKPVGGLRQGAR
TINLNRRGKLFWPTTCRITELVPEQKLAFRVNENNTVWSYELEPTEAGTR
LIETRHAENGTTATSNFLVGKFMGGVPNFEKELVEGMNQSLTRIKNAAEN
392418195YP_006454800.1 Protein of unknown function (DUF2530) [Mycobacterium chubuense NBB4MDESPQPPPLPAALLTPWPVIVVITCGWVIATILAFTVSSLQDWRPICLA
GLGVGVLGTSIFLWQRHAVRRGSRGAQSGLS
392418194YP_006454799.1 rRNA methylase [Mycobacterium chubuense NBB4]MRAEVVDVIDVADPADPRLDDFRDLNSVDPRPDLPTGKGLVIAEGVLVVQ
RMLASRFVARAFLGTDRRLTELGARLDGVGAPFYRVSAEVMAEVVGFHLN
RGVLASASRAPELEVPQILDTARTVAVLEGVNDHENLGSIFRNAAGLGVD
AIVFGSGCADPLYRRAVRVSMGHALLVPFARAANWPDDLNLLLSREFRLI
AMTPDPGALTLAEAVAGLAGERVAILVGAEGPGLQERTMRAADVRVRIPM
SRGTDSLNVATAAALAFYERDRLAP
392418193YP_006454798.1 Protein of unknown function (DUF2537) [Mycobacterium chubuense NBB4MSDDSTPWATGLTVAAFVAAVVAAAIIVLSIGLTRVHPLLAVGLNLVAVG
GLAPTVWGWRKVPVWRWFVLGAGVGVAGAWIALLALAAAGTHA
392418192YP_006454797.1 Protein of unknown function (DUF3071) [Mycobacterium chubuense NBB4MRELKVVGLDVDGKRIICETDDSAEKFVLRSDDRLKAAVRGDWVGSNQTA
IDVEVPNMLRPKDIQAKIRAGASVEQVAAAAGADLARVERFAHPVLLERS
RAAELATAAHPVLADGPSVLTLLETVTAALVARGLDPDSPSWDAWRNEDG
RWTVQMAWKAGMSDNVAHFRYAPGVHGGTVTAFDDAASELIDPNFARPLR
PLAPVAQLALEEPQAPLSTPTEAPEPPPTTKPPRPRKTRPAVPAWEDVLL
GVRSSGGER
392418191YP_006454796.1 phosphoserine aminotransferase apoenzyme [Mycobacterium chubuense NMAALSIPDNLKPRDGRFGCGPSKVRPEQLAALAAAGDLFGTSHRQAPVKN
LVGRVRDGLRQLFSLPDDYEVVLGNGGSTAFWDAAAFGLIEKRSLHLTYG
EFSSKFASAVAKNPFVGDPVVVKADAGSAPKPVSDPSVDLIAWAHNETST
GVAVPVERPDGSGDALIAIDATSAAGGLPVDITAADVYYFAPQKNFASDG
GLWLAVMSPAALARVEAIAAAGRWVPEFLSLPIAIENSVKNQTYNTPAIG
TLILLAEQIDWMLGNGGLDWATKRTADSSGRLYSWAEASPFATPFVTDPA
LRSQVVGTVDFADEVDAAAVAKTLRENGIVDTEPYRKLGRNQLRVGMFPA
VEPDDVSALTACIDWVVQRLAAT
392418190YP_006454795.1 P-aminobenzoate N-oxygenase AurF [Mycobacterium chubuense NBB4]MAVKESRTRLVRRWRRNMDVLDDPEYVNTLQTLSEGSVRRNFNPYTDIDW
DSPEFAVTPNDERWILPATDPIGQHEWYRSQPRERQIEIGMWRQANVAKV
GLHFESILIRGLMEYAFWTPNGSPEYRYCLHEAVEECNHTLMFQEMVNHI
GADVPGMPRLLKWIQPVIPLVAGPLPIPFWFGILAGEEPIDHTQKNVLRE
GKTLHPIMERVMAIHVAEEARHISFAHEYLRKRVPDLPRRKRFWLSIYVP
IVMRVLCSAIIVPPRAFWKEFDIPRSVRKEIFFKSPESRLMLRDMFGDVR
MLAHDTGLMNPVAKLVWRICRISGKPSRYRSEPQRQHLVSVA
392418189YP_006454794.1 NADPH-dependent glutamate synthase beta chain-like oxidoreductase [MPHVITQSCCSDGSCVYACPVNCIHPSPDEPGFATAEMLYIDPVACVDCG
ACVSACPVGAIAPDTRLEPAQLPFIELNAAFYPKREGKLPPTSKLAPVLE
APVVRRRSKAPLTVAIVGSGPAAMYAADELLTQKGVRVNVFEKLPTPYGL
ARAGVAPDHQHTKRVTTLFDKIAARRGFSFYLNVEVGSDVTHDELLEHHH
AVLYAVGSPTDRRLDVDGIGLPGTATATEVVAWYNGHPDFAGLTVDLNTE
QVVIIGNGNVALDVARILTMDPDVLSRTDIADHALQALRSSRVREVVIAA
RRGPAASAFTLPELIGLTSTGDVVLDAADHERVLADLSTETDPLTRNKLE
VLSGLGDASAPITRPRIRFAYQLTPRRVLGTDSAQGIQFEVTGTDDVAQI
STGLVLTSIGYRGVPIRGLPFDESAAVVPNDGGRVLDPATGAPLPGSYVA
GWIKRGPTGFIGTNKSCATETVHNLVADYNDGLLSEPAHTGSALDRFVRG
RQPAVIDAAGWKAIDAAETARGGGVRPRAKFSSVAEMLEAAADVPAPPVH
RRLLAGLRR
392418188YP_006454793.1 hypothetical protein Mycch_4405 [Mycobacterium chubuense NBB4]MLALLQFPPLIVGFLWVAAFVVISVGGLFVFRRAVSHTKLENANFVSGAV
FQVAGVLYAVLVAFVVVVVWEQFGDAEDASSKEASAVADLLRDSTALPPQ
YRAEVQQSLVAYSHDVVDNEFTRMRRGESIEEQSDALTRVWDSYLKVQPE
SRSEIAFFDYAISRLNDLSTNRKMRVSTGDASVPGELWVLLLGGGGVLMM
FTYLFGTRDVVVHAIAVGLTASLLAFVMYLIFALEHPYVGALSVKPTPYV
NMLKDWAGG
392418187YP_006454792.1 hypothetical protein Mycch_4404 [Mycobacterium chubuense NBB4]MAIENTPMLVPHLVVDDAAAALDFYAKAFGAEEMVRMPGPGGKLIHACMR
INGSLVFLNDDFPEFNDGRSSTPTALGGTPVTIHLQGPDVDARFQRALDA
GATVVNPLEDQFWGDRYGVVRDPFGHHWSLAETVREVDMAELLAQMNAQA
392418186YP_006454791.1 hypothetical protein Mycch_4403 [Mycobacterium chubuense NBB4]MSEPRAVFASAATGFASLVRSVPEDRWSDPGLGEWNVRDLVGHASRSLIT
VSTYLRTTAEREDVVSAADYYVAMHGYSAGLGAAAIVERGRQAGRDLGDD
PPAAVDELLARVLSDLEAVDDPLIEVIGGLGIRLSNYLPTRTFELAVHGL
DIAAAIGEDVVPPAEVLTEAVSLASRIGVKLGQGPAVLLALTGRAPLPAG
FSVI
392418185YP_006454790.1 citrate synthase [Mycobacterium chubuense NBB4]MTAVPKDFVPGLAGVVAFETEIAEPDKDGGALRYRGVDIEDLVSEHVTFG
DVWGLLVDGRFGSGLPPAEPFPLPIHSGDVRVDVQAGLAMLAPIWGYSPI
LDIDDETARDQLARASVMALSYVAQSARGIYQPAVPQRTVDECGTVTARF
MTRWQGDPDPRHVEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALS
GAIGAMSGPLHGGAPARVIPMIEEAERSGDARAVVRGILDRNEKLMGFGH
RVYQAEDPRARVLRATAERLEAPRYDVAAALEQAALSELRERRPDRAIET
NVEFWAAVILDFAQVPPRMMPAMFTCGRTAGWCAHILEQKRLGKLVRPSA
VYVGPGPRSPQSVEGWDRLRHG
392418184YP_006454789.1 Pyridoxamine 5'-phosphate oxidase [Mycobacterium chubuense NBB4]MRVEYGSVEKDGSRDLDADWLDVGWVALLNDWMAEAREAGVAEPNAMVVG
TVDAEGRPVTRTVLCKSVDDSGISFYTNYDSDKGVQLAGNPYASATFPWY
ALGRQVHVRGPVTKVSPEATAAYWARRPRGSQLGAWASQQSKPIASRAAL
LAQLAEITERFADADEVPVPPHWGGYVIAPEVVEFWQGRENRVHNRIRVR
GADDGTIERLQP
392418183YP_006454788.1 protein of unknown function (DUF894) [Mycobacterium chubuense NBB4]MAGRLLADTTPLQTPDFRRLWLAGIVTVIGANLTIFAVPVQLYALTQNSA
YVGLSGLFALVPLIVFGLWGGAWADAMDRRKLLIIASCGLAAASVLLWLQ
AALALNNVWVVLCLLSVQQAFFAINSPTRSAAIPRMLPGDQLPAANSLNM
TVMQFGAIAGPLLAGVMLRWVDLSTLYLIDALTCLAPIWATIRLAPMPPL
NEVAAGLGLAAVRSVIDGFRYLAGSPVVLMSFVVDLIAMIFGMPRALFPQ
MAHESFGGPVEGGTTIALLSAAISAGAVVGGLFSGWLPHVRRQGLAVVVA
ILVWGVAMVGFGIAAGFAHGHAGLLLWIALLFLAIGGAADMVSAAFRSTI
LQQVASDDLRGRLQGVFTVVVAGGPRLADAVHGAAAAAVGTTVAAVGGGG
LVVIGVTIAALAVPAFARYRVNGAR
392418182YP_006454787.1 transcriptional regulator [Mycobacterium chubuense NBB4]MVDVRGEPALGLRERKKRRTRDTLINAAVGLCESQGFDGTTVDQIAAIAD
VSPRTFSRYFATKDAIVLALIDDVLDLVAGELERQPLALGNYEALRRAYV
AMALRTQVAGKGELSSDRLLQIMRILVSSPTLRMSALEFRGNPVDVVVAR
RMGVAVDDRRVQLVSVTFGAVLMTALTCLVDRGLQVGTVGVDDAVAVLEA
TYAEFESEMAGYPQPV
392418181YP_006454786.1 citrate synthase I- hexameric type [Mycobacterium chubuense NBB4]MADNAEAGQEHATLQYPGGELELDIVKASEGADGIALGSLLAKTGYTTYD
GGFVNTAPTKSAITYIDGDAGILRYRGYPIEQLAEKSNFIEVSYLLIYGE
LPTEEQLEKFTTQIQRHTLLHEDLKRFFDGFPRDAHPMPVLSSAVNALSA
YYQDSLDPFNPQQVELSTIRLLAKLPTIAAYAYKKSEGQPFLYPDNSLTL
VENFLRMTFGFPAEPYEVDPEIVRALDMLFILHADHEQNCSTSTVRLVGS
SQANLFTSISGGINALWGPLHGGANQAVLEMLEKIRLSGGDVETFVKKVK
NREDNVKLMGFGHRVYKNYDPRARIVKEQADKILAKIGVQDELLDIAKSL
EEIALTDDFFVERKLYPNVDYYTGVIYRAMGFPTRMFTVLFALGRLPGWI
AHWREMHGEPNKIGRPRQIYTGYTERDYAQLDAR
392418180YP_006454785.1 drug resistance transporter- EmrB/QacA subfamily [Mycobacterium chuMIETVGVMTPRRKAIILVSCCLSLLIVSMDATIVNVAIPAIRADLSASAA
QMQWVVDIYTLVLASLLMLSGATGDRFGRRRVFQIGLTVFAVGSLACSLA
PTIDTLIAARFLQGIGGSMLNPVALSIISQIFVGREERARALGVWGAVVG
ISMSLGPIVGGLLIETIGWRSVFWINLPICAAAIMLTAIFVPETKSTTMR
NVDPVGQGLAVLFLFGVVYALIEGPGLGWTSPRVVGIAVVAALAFVAFLR
YESRRQDPFLDLRFFRSIPFTSATVTAVSAFAGWGAFLFMMSLYLQGERG
YSAMHTGLIYLPIALGALLFSPLSGRLVGRYGARPSLLTAGVLISVAATM
LTFLTATTPVWQLLVVFAVFGIGFSMVNAPLTNAAVSGMPLDRAGAASAV
TSTSRQVGVSIGVALCGSVAGPAISVAGADFASAARPLWFVCIGLGLVIL
VLGTFSTTRRAHRSAERLAPLISGTPTLPEDAHVR
392418179YP_006454784.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSGDALADEVWRDLSAVVLDHRDGWKRAVVERSGLPFSRIRILKRLSRAP
MTVKQLAAAATIDAPAATVAVNDLEDRGLVVRRVDPANRRCKVVSLTDAG
RDTVRAIDAVHDPAPEILTALDAGELATLRAILDKMAGS
392418178YP_006454783.1 phytoene dehydrogenase-like oxidoreductase [Mycobacterium chubuenseMNAATGTDTDIVVVGGGHNGLVAAAYLAQAGRRVTVLERLDHVGGAAVSA
HTFEGVDARLSRYSYLVSLLPRRIVDDLGARVRLARRRWSSYTPDPSTGG
RTGLLIGPESTFAAVGAAGDERGFDDFYRRCRAVTSRVWPTLIEPLRTRS
QVHREVVAGGGPDAGAAWRAMIDEPIGGAITAAVGNDLVRGVMATDALIG
TFARLDDESLIQNVCFLYHLIGGGTGDWDVPIGGMGAVTGALAAAATGFG
AEIVTGAEVYAISPDGEVRYRRGDGEYRVVADRVLANVTPSVLARLVGDE
APDAQPGAQIKVNLMLRRLPRLHNDSVTAEQAFGGTFHINETYGQLDAAY
RQAAGGSVPEPLPCEVYCHSLSDPTILSESLRQSGAQTLTVFGLHTPHSL
VTSGTPERIRDSLTSAVLTSLNSVLAEPIQDVLMEDSWGRLCIEAKTTLD
LDASLGMTAGNIFHGGLSWPFVEDDEPLTTPAQRWGVATAFDRILLCGSG
SRRGGAVSGIGGHNAAMALLQA
392418177YP_006454782.1 Protein of unknown function (DUF2630) [Mycobacterium chubuense NBB4MAKDEDILAQVNQLVAEEKELRSKLQHHDIDQTEEHKRLRAVEVQLDQCW
DLLRQRRALRDTGADPRAAEVRPADEVEGYLS
392418176YP_006454781.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Mycobacterium chubueMTSNAGQKPEIDFPDGPAPTELVIEDIVVGEGAEAVPGANVEVHYVGVEY
DTGEEFDSSWNRGESIEFPLRGLIQGWQDGIPGMKVGGRRKLTIPPEQAY
GPAGGGHRLSGKTLIFVIDLLATR
392418175YP_006454780.1 signal transduction histidine kinase [Mycobacterium chubuense NBB4]MVDLTRIFRRTPSLRTRVAFATAIAAAIVVGIVGTVVWIGITNDRKERLD
RRLDEAAGFAIPFLPRGLDQIPPSPNDQDAIITVRHQDGQVTSNSKVVLP
ELEPGYADTYVDGIRYRVRTVDLSTPSPMQVAVGATYDATINDTNNLHRR
VLIICTLAVGASTLGGWLLAAFAVRPFKRLAQQTRSIDAGDERPDVEVRG
ATEAVEIGDAVNGLLQRIWTEQDRTKAALASARDFASVSAHELRTPLTAM
RTNLEVLSTLDLAEEQRKEVVNDVIRTQTRIEATLGALERLAQGELSTAD
DHVPVDITELLDRAAHDAMRVYPDLEVSLVPAPTVIIVGLPAGLRLAVDN
AIANAVKHGGATRVQLSAVSSRAGVEIAIDDDGVGVPEEERKVVFDRFSR
GSTASHSGSGLGLALVAQQAELHGGTASLEASPLGGARLLLRLPGPR
392418174YP_006454779.1 response regulator with CheY-like receiver domain and winged-helix MDSGSPRVLVVDDDPDVLASLERGLRLSGFDVATAVDGAEALRSATETRP
DAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGA
DDYLVKPFVLAELVARVKALLRRRGSTATFSSETITVGPLEVDIPGRRAR
VDGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDV
FIGYLRRKLEANGAPRLLHTVRGVGFVLRQQ
392418173YP_006454778.1 Kef-type K+ ransport system- predicted NAD-binding component [MycobMTAQTKLDAWEQRTEWPLAGAAVIFLVAYAVGVLDQPAGAAAAAVGMVTA
VTWALFAMDYVVRLWLAPRRWRWFYRHLFDLAIVVLPLLRPLRLLRLVTL
IAVLQRAAGRAIRGRVVLYTVSGAILLVFVASLAVLEAERGQPDAHIVNF
ADALWWSMTTITTVGYGDMTPVSTTGRVIAVLLMIGGISLVGSITATLAS
WIVQRVADEDNAGRVVTTAHIERLMDEIQQLRGEVQRLQGVPARGDRPDG
392418172YP_006454777.1 ABC-type multidrug transport system- ATPase and permease component MSLETVARQSLYRQTHARGGDLHSLTDRRLLGRIWRFAGRHHHRLGVFVA
VSVLGAVLTVATPLLAGRVVDEITGAGTAGVVVLLAVVIAVVAVAEAATA
LLTRWLSSTIGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLGNDV
MGAQRAFSDTLSGVVSNVVTLTLTLAVMLSISWQVTVVSLALMPLFLIPA
RRIGSAMAALSREAAAHNATMNTQMTERFSAPGATLVKLFGDSAAESREF
RLRAGRVRDIGVRTAMLQSTFMNSLTLMSALALALVYGLGGALALGGHLQ
AGAIVSLALLLTRLYAPLTALANARVEIASALVSFERVFEVLDLVPLIRE
RPDAVAVPEGPVTVEFDDVRFSYPAADKVSLASLEEVAELDDRGGEEVLH
GVSFTAAPGQMVALVGSSGAGKSTTASLLARLYDVDSGAIRLNGVDVRDA
SFASLKATVGMVTQDGHLFHESIRSNLRLAAPHATDADLWEALKRARLDD
VVAAMPDGLDTIVGERGYRLSGGQRQRLTIARVLLAAPQVVVLDEATASL
DSESEAAVQQALAEALAGRTSLVIAHRLSTVRAADLILVVEDGRIVERGT
HTELLARGGRYAELYLTQFGPQSGPDRRTCIPRGPHSHLCARNASSAGEL
TACGQWEDLLSG
392418171YP_006454776.1 ABC-type multidrug transport system- ATPase and permease component MADTRSAPPPAGLRAAPAIAPPPKRTRASSDLWRMLPYLIPYRVRWVSMF
VVALLSLVATVSIPLMTKAVIDGPVRHQDQQGLWVLGTAAVGVGVAEAVL
WFIRRWLVSRATMGVEADIRKDLYARLQILPMSFHSRWQSGQLLSRIMND
LSTIRRFMSFGLTFLVLNILQITVVTAILLVMYWPLGVVVLVSIVPITLT
VLHFQQEYTRLSRLAQDQAGHVATHVEEAALGLRVVKSFGREDYVYDRFD
EQLTGLYDTQVSRVSVSAKFWTLLEIIPNLTLIIVLGFGAYAAGHGYVTM
GTLVAFITMMLSLVWPIASLGFLLSMTQESFTAANRIAEIFDAPREITDG
PRDEAPRGGRLELVDVGFRFPDSGEWVLRHLDVTVEPGETLALVGATGSG
KSVLIGLLSRLYDVTEGEIRVDAQDIRELSLDALRQAVATAFEDPTLFSM
SVAENLRLGKPDATDEELRQAIDVAAARSVYDLPFGLDTRIGEQGMSLSG
GQRQRLSLARAILAGPRILVLDDTLSALDVHTEAVVEEALRRVLHSVTGV
VVAHRASTVLLADRVALLQHGTITHVGTHAQLLAQVPEYRYLLAADDELD
DGCERQCGWEDELRPQRAGTDDDRSLLEREVLERRP
392418170YP_006454775.1 ABC-type multidrug transport system- ATPase and permease component MTATDWRGKFDEQSDLPIDETVPRRREARALLGSLLRPYRWAVALLAVVV
VVENAARLSVPLLVQKGIDDGIPPLLAGGPARTLISVVAALCVVVVIQAA
SRMFFLRRSGRIGQKVLRELRRRIFGHFGRLDVAFHDRYTSGRVVSRSTN
DVEAIQDMLETGFDSLITAVLTLVGTAVLLVTLDVELGLMCLAAFPVLVF
LVWWFHRESSKTYREVREISALVIVQFVETMTGIKAVQAYRREQRNQEIF
EDVADRYRVINERTFKLLAVFMPGVKLVGNLTTGVVLLYGGYRVLHGQMT
IGTLAAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAEKPAIAD
PAEPVALGAVRGEIAFRDVQFSYVQGRPVLPDLTLTIPAGQTVALVGTTG
AGKTTIAKLVSRFYDPVSGAVTLDGTDLRDVAQADLRRHVVMVTQENFMF
GGTVADNIRFGRPDASDEDVRAAARAVGADGFIAALPEGYDTDVAKRGGR
LSAGQRQLIAFARAFLADPAVLILDEATSSLDIPSERMVQRALETVLADR
TALVIAHRLSTVQIADRVLVLENGRIVEDGPPDELTARDDGHYAALHRSW
VQSLA
392418169YP_006454774.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMPAVRPFRIAVPDADLADLRRRLQHTRWPEAECVNDWGQGVPLVYTRELA
QYWADEYDWRTREAALNRFDQFTTDIDGLPIHFIHQRCGRDDAFPVLITH
GWPGSVVEFGKVIGPLTEAGFDVVCPSLPGYGFSGKPSATGWGVERIAEA
WDELMVRLGYSRYGAQGGDWGAAVTTQIGRNRGHCVAIHTNMPMGRPPKN
LADPTPDEAAALDRLSYYRRWDSGYSKQQSTRPQTLGYGLTDSPVGQLAW
IVEKFWSWTDCDGHPENVLSRDELLDNVMLYWVTGTGASSARLYWESFGS
FGAGSPVTLPTGVAAFPKEILRSPRSWCEPNYHITRWTAMPRGGHFAAFE
QPELYVDDVSAFFAEFR
392418168YP_006454773.1 hypothetical protein Mycch_4384 [Mycobacterium chubuense NBB4]MVVSTPTLVLIAATTLAACLCLGGALYEVLVVDPAWPQRPGIIQSRNGGI
ARVRFWLPAPVAFEVLLIASLVFTWGDGEVGAALLVALVSHAAMRLWALF
HLIPKAVEFEREDPADVDEAAAVSWTRQNALRVLLLLVTSCAMLTALALA
392418167YP_006454772.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMNYETLHCTVDNDGVALLTLSRPEQLNAFTVTMARELEQFFTVDARDDGI
RAVVVTGAGRAFCAGMDLSAQGNVFGLDESLAPTPEQMHTAYDTEPLHSG
VRDTGGKVTLAIHALPKPVIAAINGAAVGIGATMTLAMDIRLASDNARIG
FVFGKLGIVPEACSSWFLPRLVGIQQALDWVYSADIITAEDALRGGLLRS
VHSPESLVDDALALARSYVSRRSPVALALAKKLLYRNGAADSPLQAHLSD
SLAMFYTSIGDGKEGVAAFREKRPPQFTGSATALPRVFPDDE
392418166YP_006454771.1 hypothetical protein Mycch_4382 [Mycobacterium chubuense NBB4]MEALLHFAGNFWWLIFPLGGVVGGAVRTVAAANERRAQRRLERYRIKQET
KVALAREKASASAQTRAEGNRREMVKVAQRHDDTDARWLSYEIDVAKLLD
FPVMTDMREPLTLGFHKAKSRADLLRPARVEDILDDRDAQLEYRDAVNDY
VAAFDVAEAEAIRRRRSDFSSEDQDRLARAQHLLRLAADDAATPQERQNA
YGRAQKELAGLVVLPAAARAAIESKVIGEIEA
392418165YP_006454770.1 hypothetical protein Mycch_4381 [Mycobacterium chubuense NBB4]MTETSTVEPAVVARAITMRGPWGPVYGPVDLDVQAGGVTVLVCPAGSGRT
ALLTTLAGRMQPVSGSLSVFGRTRAKDIFAHAALAAIDELDTVAEPVTVR
DLITEQLRWDAPWYKLIRRADDVDRARVCAPVFGDLPLPPLSEYVEELTE
LDGILLRIALANTLRPPLLVVGDLEQVTSDRSRDLLLARLVELGREQTVI
TASVNGVVGHAVTQLEVDNASREELASGQRGGR
392418164YP_006454769.1 YhgE/Pip-like protein [Mycobacterium chubuense NBB4]MSLGTDLKRYSRGVLPRIALATIIVLPLLYGAMYLWAFWNPFAEVNKVPV
ALVNEDRGATAQGQQLRAGDEVARALLDSDQLKLTETSAAEAARGVAGGR
YYFSISLPPDFSERVASPSSDAPRQAAIHFTFNDANNYLATVIGQNASRE
VLNQVNAKIGQRTIGTVVTGLTDAGQGLDRAADGAQQLATGLATANDGAH
RLSGGADTLSSGLHSARTGSAQLAAGTRQLSGAIDEATGPLLDVLDRVGG
LNLNPDDVAVAAQQLSSAVRSTTDRIAALNVNNTQAAAIVDQTVGFLQNK
SDPAVRDAGQALAGAQRLLRAQGIDPTTDDGLVRLRDSASRLEGELGDPN
STLRVFLTRALNGGLRRDVVTLRSGVDQLDAGAQRLTAGLGQLADGGDQL
ASGAGELAEGTQRLQAGGQELATKLRQGAATVPSWSPRQRTDVARTLSAP
VGLDLVNTHPAATFGTGFAPFFLPLALFIGALIVWMLLTPLQSRPIVNGL
GALRVVLASYWPGLLVVVCQVVVMYAVVHFGVGLQARYPVATVGFLVLVA
GAFLALIQAFNAVFGVAVGRVVTLAFLMLQLVSAGGIYPVETTAEPFQII
HPFDPMTYAVNGLRQLTVGEIDSRLWVAIAVLAGLLAASLAASAWAARRN
RQYTMERLHPPIEV
392418163YP_006454768.1 hypothetical protein Mycch_4379 [Mycobacterium chubuense NBB4]MATDDADTRRLKDFAGTVVFLLVQAAVWRAAAFLTHGRPVVVLYIGLALL
MVVLGVSVWRVARRRSAVWFALAGCVLQLVLGAVALSL
392418162YP_006454767.1 acetyl-CoA carboxylase beta subunit [Mycobacterium chubuense NBB4]MSRIRALELRDAVLDEGSFHSWDAPPLDVPKSAQYRRELDAAAAATGLDE
AVLTGEGRVLGRRVALVVCEFDFLAGSIGVAAAERIVAAVHRATAEGLPL
LASPSSGGTRMQEGTVAFLQMVKITAAVQLHKRAHLPYLVYLRHPTTGGV
FASWGSLGHVTAAEPGALIGFLGPRVYEHLYGEPFPSGVQTAENLQRHGV
IDAVVPVDLLRSTLDRTLKVVSDPPGPPPAAPPQEELPDIPAWQSVEVSR
RPDRPGVGFLLRHGSTERVLLSGTGQGESATTMLALARFGGQPAVVLGQQ
RVVGGLIGPVALREARRGMALAAGLQLPLVLVIDTAGPALSTEAEEGGLA
GEIARCLADLVTLDTPTVSVLLGQGSGGPALAMVPADRVLAALHGWLAPL
PPEGASAIVYRDVDHAPELAAAQGIRSADLLRDGIVDAVVAEHPDAADEP
RAFTDRLSATIAAELHGLRSVPGEQRLAARLERYRRIGLP
392418161YP_006454766.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMIQATRDGHVLTLEMQRPERRNALNAELVDGLREAIEKAATEDVRAIVLT
GQGHVFSSGADLSGGQGVADELPDKAKALNLAIDSAPVPVIGAVNGPAIG
AGVILSMICDLRVVAPDAYFQFPVAKYGIALDNWSIRRLTSLVGAGRARG
MLLAAERLTAEAALQTGMANRIGTLADAQAWAAEIGGFAPLALQHAKRVL
NDDGAYEEPWPAHQELFDRAWASQDIIEAQVARIEKRAPKFQGA
392418160YP_006454765.1 putative Zn-dependent hydrolase of beta-lactamase fold protein [MycMVVRSALRFGFGTASLLAGGWVLRALQGTPASLGATPAEIAPVARQSPHF
RDGKFVNLEPPSGITMDREAQRVLLRDLANVGSAGKPPRPIPLAEPANVD
AEPGPAAASWYGHSSVLIEVDGYRVLADPVWSKRCSPSRAVGPHRMHDVP
VPLEALPAVDAVLISHDHYDHLDIDTIVALAHSQRSPFLVPLGIGAHLRK
WGIPESRIVELDWYESHKIGDLTLVCTPARHFSGRLFTRDTTLWASWVVA
GPAHRAYFGGDTGYTKSFAEIGAEYGPFDLTLLPIGAYHPAFADIHMNPE
DAVRAHLDLTDVEAGLMVPIHWATFRLAPHPWAEPAERLVAAAEPERVRI
SIPIPGARVDTETTFEPWWRM
392418159YP_006454764.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium cMNPPARVAVLVSLVALLAACGSDSTRGADTTPSPSSQSAEVPPPLMPAMP
LPDNAVADAVAELDGMAEALMTKSGIPGMAVAVVHGGKTVYAKGFGVKNT
FAPDGAGNRVDADTVFQLASLSKPLSATVVARQVSRNAITWDTPIVSRLP
WFALSDPAVTKTVTVGDMFSHRSGLPDHAGDRLEDLGYDRRQVLERLRQL
PLAPFRISYAYTNFGLTAGAEAVAAAAGEDWETLAQDELFGPLGMASTSY
RFTDFQARRDRAVGHIHVDGRYEPRYVRDPQAQSPAGGVSSSVNDMTRWM
TMMLADGQRDGAPFIDPKALLPALTPQIVSSRGSEPSMRSGFYGYGFNVG
TTSGARTELSHSGAFELGAGSNVLVLPSADVAIVALTNATPAGVPEALTA
QFADLVQFGKVREDWYALYHKAFADMEQPVGSLAGQQRPAGAKPPAPLAT
YTGTYRNDFWGPATVTERDGRLELTVGPRGTFELQPWDGNVFTFSFVTEN
APPGTVSKATFDGNTLTLEYFDEEHNGVFLR
392418158YP_006454763.1 P-type ATPase- translocating [Mycobacterium chubuense NBB4]MTTSTTQGLSDADVAQRVAEGKTNDVPTRAARSVPEIVRSNVFTRINAIL
GVLFVIVLATGSVINGAFGLLIIANSAIGIIQELRAKQTLDKLAIVGQAK
PLVRRQSGTSALAPSEVVLDDVIELGPGDQIVVDGVVLEEVSLEVDESLL
TGEADPIAKDAGDQVMSGSFVVAGSGAYRAAKVGREAYAAKLAEEASKFT
LVKSELRNGINKILQFITYLLVPAGALIIYTQLFTTGADWRESVLRMVGA
LVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVNELPAIEGLARVDVVCADK
TGTLTENGMRVAELKPLTAADVGNVLAQLAADDPHPNASMAAIAEAYKMP
PGWQASATAPFKSATKWSGTSYGDHGNWVIGAPDVLLDAESPAAEEAERI
GAQGLRVLLLGSSDLPVDHPDAPGTVTPVALVVLEQRVRPDARDTLDYFA
AQKVAVKVISGDNAVSVGAVAGSLGLDGETMDARHLPDRTDALADTLEHC
TTFGRVRPDQKRAMVHALQSRGHTVAMTGDGVNDVLALKDADIGVAMGSG
SSASRAVAQIVLLDNRFATLPYVVGEGRRVIGNIERVSNLFLTKTVYSVL
LAVLVGVAGLSAKIFDTDPLPFPFQPIHVTIAAWFTIGIPAFILSLAPNK
ERAHSGFVRRVMTSALPSGLAVGLATFASYLLAYPGRGAGAAEQTQASTA
ALITLLISAIWVLAVVARPYQWWRVALVAVSALAYVVIFSLPPLRKLFLL
DPSNLELSSMALGLGLLGAGVVEVIWWAQGAVLGERRRLWRERER
392418157YP_006454762.1 hypothetical protein Mycch_4373 [Mycobacterium chubuense NBB4]MGFLDKAKDLLSKNADKVDTVIDKAGDVVDKKTQGKYASTVDKVQDAAKK
AVADNANAANPPAQPPVPPQQQPPAAPPTS
392418156YP_006454761.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMAKLSVSVDVPLPPERAWESASDLSRYKEWLSIHRVWRSKLPDTIEKGTT
LDSIVEVKGMPNRVSWTVVHYKPPEAMTLNGDGKGGVKVKLIGKVKPSEL
GSTVTFDVHLGGPALFGPIGMVVAGALKGDIQESLNRFKAVFAPS
392418155YP_006454760.1 NmrA-like family protein [Mycobacterium chubuense NBB4]MRVVIAGGHGKIALITERLLAERGDSVAGFVRNPDHARDLQAAGAEALVV
DLEKATVDEVASHLQGADAVLFAAGAGPGSGAARKETVDRDGAILLADAA
EAAGVGRYVMISSMGADADVSDTSDDAADEVFVAYLRAKGAADDDIRSRA
GLSATIVRPGRLTDDPPTGRVTIAAGTGRGSIPRADVAAVVLAVLDAPQT
AGQTFELIGGDTEITDAVASLP
392418154YP_006454759.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTVPESVETHARNWDLRHEDFNDPDLLYDVYAEMRQSCPIAHTDRPFLAD
TPDGAWVATRYADCYRIAQDWQHFSNNPIPDTVEHVAGDLVVMMDPPRQQ
KLRKVLNPYFSPARMKALRPQIAAETDLLIDEFIESGSGDLAQVAWRQPG
IVLFRYVLGMPTDDVSVCFDLTDTALNGATEQARMTAWGELYAHLHDTVA
ARAGRAPRDDMIDVLLNARIDGEKLPFTDVVSNAMLLVQAGLETTASAMS
FAFHHLATHPADRDRLTAEPELLPRAVEELIRYAGSIHGLHRTVIEDVEL
SGHTFRPGETVVVNFASANRDENVFPDADRCILDRRENRHLGFGAGVHRC
LGSNLARLEFQVAVERVLTRIPDYTLAPGRPATFHGNSITRGYRAIPVVF
TPGPTSGA
392418153YP_006454758.1 hypothetical protein Mycch_4369 [Mycobacterium chubuense NBB4]MTTAETKPEELPPGTTPYYARMHTLIKRGVLVCLVALVIEGAFTLPFMAI
YYGYPTLSLTQICSELLKVRYSDDTLECKVPYPAFGPPEGAEGKDTAQDQ
WGIQPVPKYHRLGFRELVRIHDERIARQAHHAADQRP
392418152YP_006454757.1 hypothetical protein Mycch_4368 [Mycobacterium chubuense NBB4]MTLPQTAVALEGHHEESRLAQRRADKWMIVGAALMGMWAPGLIGFPVFMR
GVWLQRQALRAGLSVRPMIVTLIGYLVLIDGMLNSLGWALDLVANHTLIN
RVLMIGWGNMFDAGYFWHYNELWIGGSAGPGEKAYVAGLIFTVFSMRVAA
AIGFLQMRRWGHQWMIVTCWMGVVIWSAYVFNMTMFADVRYAGVVFPVIG
WWLYDIFYITPFLAIPYLHTVNREIFTD
392418151YP_006454756.1 hypothetical protein Mycch_4367 [Mycobacterium chubuense NBB4]MDQKEKNRKKALIVLQIVIYGYLLAMFGIQLYMSFARGWWDL
392418150YP_006454755.1 ATPase family protein associated with various cellular activities (MTGSFQPTDTYLANGNEVQLFEQAYRRQLPVMLTGPTGCGKTRLVEHMGL
LLERPVVTISCHDDLTSSDLVGRFIVTGGDVVWTDGPLTRAVKAGALCYL
DEVVEARHDSLAVLHSLTDHRRALYLDRAGEVVHAPDTFMLVCSYNPAYR
SSLKELKPSFRQRFVTLAMHYLPPDREAEVILAEADVALPTAQRLVRCAT
AIRSADEAFHFEPPSTRVLVTAAQLIAAGAGEFEAAQACVLAPLSSDGAL
THGLREVAAATFTDADSPT
392418149YP_006454754.1 hypothetical protein Mycch_4365 [Mycobacterium chubuense NBB4]MSDLPEAHALAIERSCALTAVALSGRRRTGVRLVTGARRCFGLSSRLDVV
HVPYPAQPAWSPRTLTCGVALQCSPSKERLTGYRLNELSTRELCALTLIE
SGVALGWIADTWPGLLRELHRSLPALRAAAADMEAEEMLDRAVALARTSQ
PLPLDPLLGALPRAYTEAQSAADKLRRTFGRMPWTSTQKRLPRPYSVPVG
GDGGVRNPNLPPPSRPHDNDLDITPEHRPGIPYPEWNCWTQRFMADHVAV
LERAHAGRDAGPGAVAVDVRQWFERNTHRTMTNRLEDGSDLDVEQYVRHF
IDLTTGEGHEPRIFRELLPASRDVTTALLLDGSSSLGVHGGRIFRLELAC
ADALSRAMASARERHGIFVFTGNTRHRVEVTCLKDFPDRRFVPPGNSGLS
TGGYTRLGAPLRHLTSRLLDQPSERRLLIVIGDGLISDEGYEGRYAWADA
AHAVEEADDAGVCVYYVGVGPARVDPLPEVFGPRRSQRIRRVEELPRVLA
HVHRELVAA
392418148YP_006454753.1 hypothetical protein Mycch_4364 [Mycobacterium chubuense NBB4]MGWIWEILRYVAAWGGTGLIIWFWYWMFSNLGTF
392418147YP_006454752.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTPHVRPSSRALRRMQTRERILGAAIAEFRIAGMAGADVNAIVTAAGVAH
GTFFFHFPSKEHVLLELESREEARMAAEFTRFLDVRHDLTTVLTEVVGLV
TRLEERFGPVLFKEILALHFSPTRPNRDEWTDHPLIVLLVREIERARGDG
AGDHPEVDAFYSAAFFLLGIYGVLTTTTNSKTRDTMLAQHVASVRRGLTM
KEN
392418146YP_006454751.1 hypothetical protein Mycch_4362 [Mycobacterium chubuense NBB4]MDLPAVKLGRGDRRDVTPRPSAGGLDEHMAASQQAQRRADKWLISGSLLI
GTAALGIFGLPLFLRGVWLLRTAQRDGLTVRPMLVTLLGYLVIIDAAINT
VGWALDLVANHTILARVLLNGWGNMFDAGYFWHYNELWLGGAAGPGEKAL
EVGLILTVFTMRIAAAIGFLQMKRWGHQWMVITCWMGIVIWCTYVFNMTM
FADVRFAGVVLPVVGWWLYDIFYITPFLAIPYLHSVNREIFSD
392418145YP_006454750.1 hypothetical protein Mycch_4361 [Mycobacterium chubuense NBB4]MLNEPVRRVVQFATGNVGRHSLRAIIGRPDLELVGVHAAGPDKIGRDAAE
LCGLAQPTGVIATDDIDALIALKPECVVYTALGETRPAAAVEEMSRFLCA
GINVVGTSMVWLVTPRYADDWLRVPLEQACAAGSASLYVNGIDPGYSGDT
AVHAALSLVSRAESVTVQEIFDYGSYDDYEYTGTAMGFGSTAADDLPMAF
QPGVITSLFGGLVRSVAGHLDTELDEIRERYQPWYAEKRIECTMTTVEPG
QLAAVRFAVEGVRAGVPVITVEHVNRLTTAAAPEWEFPPDGRSGVHKVVV
EGEPRVELSTQLSHPVLDVTDAGCLSTAARAVNAIDWVCRAPAGLVSIED
IPPVAMIRGLMW
392418144YP_006454749.1 Kef-type K+ transport system- membrane component [Mycobacterium chuMPAAVAVHFFLELAVILAACRVVGWLAQRLGQPQVVGEMIAGVLLGPSLL
GRIAPDVQHALFPSGAANTVLYTLAQIGLVLYMFLIGLNFDVDLIKHRAG
TAVAVSAAGIATPLALGAVVAVPLLDGGTFFEDSVTPVMAMMFLGASIAT
TAFPMLARIIYEKRLSGTPLGTLALACGATDDVLSWCILATVLAMHRGSP
VTAVVAIGGGILYALVVLTVGRRSLQVLGPMSERRNTVSAPVLSTVLGLL
MVCAWFTDTIGIYAIFGAFILGVAMPSGFFAEHVTGRLEPLVTTLLLPLF
FVYSGLNTEIGLVDSPALWAVTLGILLVSIAGKGVACTVAARLRRVPVRE
SVALGSLMNARGLIELILLNIGLEAGIITPTLFTILVIVAIVTTLMTSPI
FEFVYGRHRKPTPAPVHRPEDVTNR
392418143YP_006454748.1 Lycopene cyclase protein [Mycobacterium chubuense NBB4]MNAKTQLSQLNSQERAALAQKIRTRLSAAAAAPVDTPAPDHDVCIIGGGV
AALTLALELRRARPVTRILIVEPNTHPVPEITHTVGESTVEVSAQYLRDR
LGLADHLQSAQIRKMGLRMFFSHNGNTDIAERVELGSSSFVPQVTYQIDR
GRLENELYRRCAAEGVAFTGGRVRSVDFGAAGSPHTVSVQSGQAVTETTA
RWVVDASGRNRTLPRRLDLRRDNGHACNAAWFRVATEIDVGTWSDDPAWH
GRLLEGDRALSTNHLMGEGYWVWLIRLASGATSVGIVADPAFHPFDGFNT
WDKARQWLGEREPQCAAVLAEHEHLVKDFKVMKHYSHSVAKVFDGRDRWC
LTGDAGIFLDPLYSSGLDLVAIGNGLVTDLVTRDLDGDDVVARSAISDSL
FRSLTDMWLAIYRDQYTLMGSPTVMSAKIIWDIAFYWGFVGLLYSNDRFV
RVADQPDVVPHLQGMIDLSNRMQAFFREWAGVESGDCPVKFVDLYARLNF
METLHIAMMGEAESFSEQFGANATLLRQVAGQLVEAVLLEHSGRFADDDV
MAQVQAWQRDSLLAELRSVYRDEQSTNPISEDWLLGTARVP
392418142YP_006454747.1 polyketide synthase family protein [Mycobacterium chubuense NBB4]MPVDQHREQDREPLAIVGIGCRFPGDVASPADYWNVLRHGTDATRTVPDA
RWNAGRYHDPNPAKAGKMVTRRGGFLDRIDQFDAQFFGITPREANLIDPQ
QRLLLQTTWEALEDGGIPAETLTGTDVGVFIGGFTLDYQLLQNQGRTSRF
RFKPHSATGMMMTMLANRISYTFDFRGPSMTIDTACSGSLVAVHLAAQSL
WNGECHLALAGGVNIMVGPNTAVAESKSGFLSPDGRCKAFDESADGYARG
EGGAVVVVKPLARALRDGDHVYAQILGTAVSQDGHTEGITVPSEDAQRIA
ITTALARAGVDPGEVGYVEAHGTGTPVGDPVEMRALAGALASARKAGDPL
LIGSVKTNIGHLEAGAGVAGLIKAALVLEHGHIPANLHLENPSSRIPFGE
LNIDVPRVGRPFPAGNRRVAGVNSFGFGGTNAHVVLAEPPAPLPAVDRMP
PWQPPLALLPISARSEEALAATAQGLAEHLGSGPDLTLADLGYTLSRRRS
HLTHREVLIVDSLEDARSQLESLAADTRVPAGRTSAPATKLAFVCTGMGP
QWWRMCRGLLDAYPVFADSIARSDEALSRYTDWSLIDELRRDENDSRMGE
TEVAQPANFAIQVALAEQLRHFGVTADAVIGHSAGEVAAHHLAGLLTFEQ
SIRVTHHRSRLQQRTSGLGRMLAVGLGADSLATVLDRRAFDEIGRRVSIA
AINSPFAVTIGGDPEILDDIARQLGEAQIFHRYLAGTVPYHTHFMDTVRD
DLHHALEGLSSGPASIPLYSTVTGERLSGYSAGAAYWWQNTRSTVLFESA
IRRMLDDGYTHFVELGPHPVLTASILEIAGSQRTVALPAQRRNDDDSRTL
MHCVGALYSHGYEIDWEALHPAQSARLVKLPSYPWQNKRFWNETPEAAED
LHYRPVHPLLGQPVRAVHPTWEVELSCTALPFLGDHQVQGSVVVPAAVFV
EMALAAATETYGSRHSVEDLVLHRALILDDRCDPTVRTTLDQDKGTIEFA
ALTATGDGDFTWAVTATAELNTAPQPPRRDEAPPEADGVVSMRGDDFYAR
TRDLGFGYGEAFRSVDSITAGDRWAVAEIVVPDKIADDLGAYRFHPALMD
GAFHTLFGTTFARDGGGTETHVPTRIRRGVVYGPPEDKMTVRVRVVSATE
EEIESDITVANRLGEPLAVYSGFTVRSLGASSAVSTERIDKGLYEIQWVP
QADDAGAGEFGARSWLVFADTTGFAASLVRHLRGRGQRVRTVSHGPVDAL
TENGDGFVTNPSLPEQVQELLETHVEREGELAGVVDCWPLDMAWGADEHN
QRIGVLTALHLVKALSERGAPALHVVTGNAQPALGGDLRAVDQAALWGLG
RVIGHQEFPGQWGGLIDIDDSDDCDATAARVCAHILSESTEDQVAIRGRS
TFVPRLRPCTDLTTPFPLKLTAHATYVVTGGLGALGLGMAAHLAERGARH
IVCFSRRTLPPRARWSQLTEADADFAVIEAVRRIERHGAEVSCAGVDVTD
AEQVHRWLSDHLGDGGRPVRGIVHAAGSVDDRLLVTMTEEQFASVMAPKV
TGTRVLDEAFDGHDLEFFVMFGSAGSVIAAPGQGNYAAANAFLDAFAHHR
RARGLPALTIGWGPWSVGMVEKLALERIYAQRGIELITPAAGVRIFDRLI
NQQVPTVVAISADWSRARQAGFGGSVPPMFSELQASEVVGAEGESDAPIL
DVLAATADSERLDVVVERLRLIVAAVFDCAVTDVEPDETLDDLGLDSMMA
MEFRVRINTMFSIDLPVLEILKGVSVNALAARVLAELHVCSPERQPSDVI
DSERAATEDVEELIGQLSDDDLRQLLAELEGGVGDQPDGERP
392418141YP_006454746.1 ABC-type multidrug transport system- ATPase component [MycobacteriuMTSAVSVRRLSKSYGRLRAVQNLDLDVGFGEVFAILGPNGAGKSTTIEIL
EGHRNRDSGDVRVLGEDPATAGRSWRAKIGIVLQEATDFGMLTVSESMQM
FARCYGKVRTVEDALELVGLGSVRSAKVRTLSGGQRRRLDVALGIVGMPE
LLFLDEPTTGFDPEARRQFWDLIKLLARDGTTIMLTTHYLEEAAALADRV
AVIADGRVVAVDSPARLTAYVDSAATVRWVQGGEIHVERTDQPTELIRQR
SAGGVELAELTVTRPTLEDAYLHLIGLS
392418140YP_006454745.1 ABC-type multidrug transport system- permease component [MycobacterMAINHAENAVRTGRRADASEPALPSPLRIGVSRIVPELKMFYRQPAQMVL
TFSMPAVICILLGSIFSAKLPGSDTSTGAVIAASMLAYGILSTSFINLGI
SIAADRDTGALRRLRGTPATALSYFVGKVMLVCIASVAEAVLLLSVGIVV
FGLRLPTDLFGWFTLAWVFVLGVLSCSLLGLFISNLASNAVSAAVITNGP
AVGLQFLSGTYVPIMVLPAWMLTIGSLFPVKWMAQGFRSVLLPQQMAAFE
PAGSWEHWRTFLVLAAWSVGGLIACLSVFRWSDKE
392418139YP_006454744.1 hypothetical protein Mycch_4355 [Mycobacterium chubuense NBB4]MSRRLFAAAAAALVAAACPFAAEAHAAGADQVVQVQGGTVRCLLSADYQG
RGRARAICGHSDGSPFGSSPMSTEKYPEKLNLVVVQEGGEQWWEAGTIPG
APEQDVVVPVGQTYSANGWTVTDQELRAVVENDLSKHGLIVNFVNPRLF
392418138YP_006454743.1 asparagine synthase- glutamine-hydrolyzing [Mycobacterium chubuenseMCGITGWVAFDRDLTRDREVVEAMTETMSCRGPDAAGVWFDRHAALGHRR
LAVIDIPGGAQPMSVSTPNGDVAMVYSGEAYNFTELRDELIAKGETFTTS
SDTEVVLRGYLVWGEALADRLNGMYAFAIWDSRVRKLVMIRDRMGIKPFY
FSPTRDGVLFGSEPKAILANPLAGRTVDADGLREMFASVKTPRHAVWKGM
REVEPGTIVTVDERGVRERTYWRLESKLHTDDQDTTVGRVRDLLDDIVRR
QLVADVPECVLLSGGLDSSAITALSARELREPVRTFAVDFVEQAENFKPN
ELRPTMDTPYVHDVAQHVGSDHTDIVLDHTQLADLDIRRKVVAARDLPMG
IGDMDASLYLLFKAIREQSTVALSGESADEIFGGYRQFHDQAVQKTDAFP
WLAMVNSPLEGSDLVLAPELRTKLDLDTYLEDRYGEAVAEVERLDAEDEF
THRMRVMSYLHLTRFVRILLDRKDRMSMAVGLEVRVPFCDHRLVEYVYNT
PWSLKTYDGREKSLLRGATRDVLPESVVQRVKSPYPSTSDPRYGAALQAH
ARDILAADNDALFALVDRNVLSQIATLEADRVEAVQRSQLERTLDLSVWL
DMYKPDIAI
392418137YP_006454742.1 hypothetical protein Mycch_4353 [Mycobacterium chubuense NBB4]MSFARAVAKAAIVASLGAGASGLAAGLAHADPHGWPPPPGPGVNIGGPGH
PHPPGHDGFPPPGHRGWHPPPPPRWGPPPPPPWAPWAPVIWDGPSQRWGV
VLNGVFIGI
392418136YP_006454741.1 hypothetical protein Mycch_4352 [Mycobacterium chubuense NBB4]MKKFGLVGIVAGALSAAVIGFAGPAQADGNGFGFGGYGYGHNGYGYGYGP
DHSYPWINQLFPHVNVPHVDTTAHQ
392418135YP_006454740.1 poly(3-hydroxybutyrate) depolymerase [Mycobacterium chubuense NBB4]MSILAPVHTTSRVAAVIVALLGIAVCPPAAVSAAPDVTQGALAFGGVQRT
FTVHVPPGGLNGLVVNLHGAGSTGADQAAVTNYDAVADQHGFVVAYPDGI
DFSWADGRGASVPDRQGVDDVGFLSALITSLTQQYGIPAGRVFVTGMSAG
GFMAQRLACDRADLVAAVAPVAGTLGSAVPCAPSRPVSVLAVHGSADPVV
PFNGGAMVGRGGPSDIVAAPAMAGRWRGLNGCPPPVEEPVTGVGDGTAVA
RSVSKGCAGGTEVDFVTITGGGHTWPAGRFSLPAVSVGPTTQAYDASVAS
ADFFAAHGR
392418134YP_006454739.1 hypothetical protein Mycch_4350 [Mycobacterium chubuense NBB4]MSQHARGTVRRVGAAFALGLCTLASAASLMTVGVGTASADDLVPDPSKAG
DGREPQGNVRESATQGDVRSSGIGEALAPAGGDVRGSSRAKPGTTAWVFP
GAAGDLSACVYSGPWCANWMKIPFDLNNP
392418133YP_006454738.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMNLFSLLDQSAARHGDRGAVYHGEQQVHTWLSLRDRALRLAGSLNGLPPG
ARVAVASENCPQIVELMFGIWAAECVFVPINYKLHPREMEQIVADSGAAL
VFASPKIGRDLAPLVSAPVELIGSSDYENRCAADLSPVPRNTDPAALAWL
FYTSGTTGRSKGAMLSHRNLMAMTLSHLADFDSPDENSSLVHGAPMSHGS
GLYVPPYVLRGARQVVPASGAFDPDEFLDLCERHPGCSAFLAPTMVARLV
QTGRSRPANLTTIVYGGGPMYVDSLKKAMAAFGPIFVQLYGQGEAPMTIT
GLRRADHVDAPDAVLGSVGYARSGVDVAVVRPDGRPAGIDEIGEIVCRGD
VVMSGYWQNPSATESTLQDGWLHTGDMGSFDAAGYLTLRDRSKDVVISGG
SNIYPREVEEVLLEHPAVVEAGVVGAPDEEWGEVVVAFIVGRVSADDLDA
HLLQRIARFKRPKRYEFVDELPKNSYGKVLKRELRSRLI
392418132YP_006454737.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMQVAIVTGASSGIGFGCATTLAEQGMAVLGTGRDRDRLAELEKAVGSDRI
ATLAVDLTDDDAPSRIVDAALQRWGRIDYLVNNAGIGSPKPLHETDDETL
DRFLGIMLRAPFRLARDVIVHMQPGSAIINITSTFAVVGGLRGGAYSAAK
GGLTALTTHIACQYGPLGIRCNAVAPGVTVTPMVAKRLEDERFRKINTEM
TPHQRLGRVEDIAATVAFLCSEGGSFINGQTIVVDGGWSSTKYLSDYALN
AEWVPRR
392418131YP_006454736.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMTATLAEALRAAARETPDRTLLQDDDISLDCASLLERATTLAHALLRRMP
VGSVVSFSVPNWHEAAVIYLGSTLAGMIVNPILPSLRDHELSFILADSQS
RMIFIPQSFGNHDYAAMLDRVVADLASPPEVVVVRGDAGRHTAFVSLLSE
PADGPLPQLDPAATRMILYTSGTTGRPKGVLHSHRSLHALIAQLGRYWHI
DPGDTFLVPSPIAHIGGSIYAFECPLLLGTRAVLMQRWDPDAAVALMLEH
RCTHMAGATPFLDGLLGAAQRAGTRLPDLKVFICGGASVPPSLIRRAADC
FENARVSRVYGSTEVPVTTVGSLDDLDRAADTDGRPGIADVTLVDGEIRA
RGPQMLSGYLHPEDNAGSFDDAGYFRTGDLGRWTDDGCLVVTGRAKDLII
RNGENISPKEVEDILVLHPQITEIAIVGVPDDRTGERACAAIVGRGPQIP
DAAELCDFLVSRGVAKFKAPEQVVVVDALPKNDAGKVLKHRIKAALGKES
392418130YP_006454735.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTTTAGDHRYLQVARALRKEIVDGVYPVGSQLPTEHELCERFAVSRYTIR
EALRRLRDDNLVASRPRAGTLVVPRPSTNSYAQDVMSIDDLLAFAQGARF
AIETNAMTTVDDALAERTGLSPGTEWLAASGFRRVDDDTAPVCRTEYYIN
RNFAAVGRLLQRHSGPIFPLIEDLFGVSVSEVHQEISAVVLPPDLAQRLQ
VQAGTAALQMQRTYTTSDGEIAQVTVNTHPSARFRHAMTLRRVRE
392418129YP_006454734.1 gluconolactonase [Mycobacterium chubuense NBB4]MTARYVAPSPTAADGWRLERVTAPSRLFGANGLRTGPDGRIYVAQVTGSQ
ISALDLATGMVEAVSPKGGDIVAPDDVAFGDDGTLYATEVMDGRVSAREP
TGRTRVLRDDLPCANGITVHQGRLFVGECRDGGRLMELPLDGGEPRILLD
NLPSPNAMEVGPDGMLYFPLMTANEIWRIDPSGGEAQRVAGDLGVPDAVK
FDADGFLVSTQVASGQVLRIDPRTGDKTVLAQLNPGLDNLTFVGERLFAS
NFTGEITEILSGGRTSTVLPGGLNWPLDLTVADGRLYVADGTYFYAAGTG
GALETVGMLFSPGYPGFLRGVTAVGAGEFVVTTSGGQVARYRPESGETDY
LATDFDQLYGVAVDAAGAIVFAELGTGRVHRLHNGDVETLVSGLREPIGV
AFDPDGAPLVSESGAGRVVRIGARGADTVVDGLQRPQGILVRDGRLYIVD
AAAKELVEVDLNTRGRTTIASGLPVGPPPGVEPKPLKGMPPFSGPQGPFA
GITAHDGTLYVSADGDGSVLAVRRA
392418128YP_006454733.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSGVPLGMEGRIVVVSGAGGGGIGTTVTRMAAEAGATVVAVSRSQENLDE
HVGPLARQGLPVVAVAADASTEDGVATVLDQVRECDGDLYGLVNVAGGAA
PATWMPATRVSREDWHALFAANLETAFFMSQAVSRELLARGLTGSIVSVS
SISGMNTAPFHIAYGTAKAAVVAMTRTMAVELAPHGIRVNAVAPGVTETA
ASGTYVDEDPERDRKAIAMGRRGTPEEQAGAILFLLSDLSSYITGQTLLV
DGGLNLKWTHLGADNTSLFLADESFRDAMRRM
392418127YP_006454732.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MTDLDANNEVAEELSKPMTIGTEAYTSGEYARAERDRLWRKVWQQVGRVE
ELPEVGSYLTYEILDDSIIVVRTGSGSTPDNFTAHHNVCMHRGRRLIDTP
DGAKNAVGRARKSFVCGFHGWTYGLDGACTHIREKDDWKGKLTERNTHLA
PVRVDTWGGWLFVNMDPDCEPLADYLFPAAKILDPFGLENMRYKWRKWLS
FDCNWKVALEAFNETYHVFTTHPEFNKFGEFKGWAKAQGRHSNIGYDAPK
GMDETKSKIRLGTGDPRVSTAEMQIYTMEETNATTTQTLVNAAKRLVDEL
PEGTPADKVLEHWLSSARRDDEARGVIWPTIPADILGQSGTAWQLFPNFQ
IGQGLTSALCYSARPDPSYNPDKCIFEVAVFELYPKGQEPETEWVYTPKD
SPNWLSVLPQDFSNMAAVQQGMKSAGFPGTLPNPYRERSTVNLHYQLSKY
MGTGAPEELP
392418126YP_006454731.1 putative flavoprotein involved in K+ transport [Mycobacterium chubuMTTAENTCGPTDTPSDIDISALREKYAQERAKRLRPEGSKQYVELADDFA
GYYETDPYTPVAPRDPIAEDIDVVVLGGGFGGLLSAAYLKKAGVEDVRII
ELGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELDFMPSKKFADGPEIYQ
HCRNIGKHFGLYDNAIFSTQVRGLSWDEGLERWRVSTNRDDDIRARFVVL
ASGPFHRPKLPGIPGMKDFKGHSFHSSRWDYDYTGGDFTGGMDKLADKRI
AIIGTGATSIQCVPFLARDAQHLYVFQRTPSSVDVRDNAPTDPEWVKTLT
PGWQKERQRNFHAWTFEGMALGQPDLVCDFWTELGRNTAARVMALDDPAS
LTPEQFMGIREEEDYKIMERLRRRIASTVSDPDTAEILKPYYRFLCKRPL
SNDEYLPTFNRPNVTLVDVSDCKGVERITEKGLIVGGREYEVDCIIYASG
FEITTEISRRYSIESIQGRGGLSLYDYWHDGYKTLHGMTSRGFPNQFFTG
FTQVGISANIAANYELQGEHIAYIIAEALDRGATVVEPTAQAQEQWCATI
RENAVDNSAFDASCTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFGDLLA
EWRATGSLEGLELHG
392418125YP_006454730.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGEDLRFDGRVAVVTGGGRGLGRSYATLLAAHGAKVVVNDPGGSLDGAGV
DDSAAHQVVREIAEAGGHAVASTESVATPEGGRAVIDTALGHFGGIDILV
HNAGIVRRAPLSEMTYDDFEAVLDVHLRGAFHVVRPAFPLMCEAGYGRIV
LTSSIGGLYGNDEVANYAAAKAGVVGLSNVAAREGAAHNVTSNVIVPAAV
TRMAEGIDTSAYPPMGPELVAPVVGYLAHESCSVTGEMFIALAGRVAMAA
VTESPGVYRPSWSMAEVGDELDEIRDRTHPVTFPVVPDGHGDHIRYSFAM
ARQAGQVHA
392418124YP_006454729.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MPDTGPLAGIRVVDLTAMVMGPYCTQIMADMGADVIKVEPPQGDNTRYIS
VGPASGMSGVFVNVNRGKRSIVLDLRSEDGRAALRALVERADVFIHSMRS
KAIAKLGFGYADVAAMNPRIVYTNCYGYGRRGPERDRPAYDDTIQAECGL
PAVQKQLTGEADYVGTIMADKVAGLTALYATTMALFHRERTGEGQEVEVA
MFETMASFMLVEHANGAMFDPPLGPAVYPRTVAPNRRPYRTKDGYIAALI
YNDKHWNAFVTAVEPPWASDVYATLESRAHQIDTVYGLVAQTMAERTTDE
WLALFRDLEIPAAPLNTPDALFDDPHLNAVGLFETVDTPHGPVRFPGVPT
WFSRTPGKVRGPAPELGADTAAVLEELGLAAPDAVGSG
392418123YP_006454728.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFDMGKRADDLRRELRDLVKQHVPDQFLGAFTDDPADLATAQQFCRTLA
EKNLLCLAWPQEFGGGGASVWEQTVVREEMWAHHEPRGAQYMGVNWVGPI
IMRHGTTEQQRKHLPPIAAGEVIWCQGFSEPEAGSDLASLRTTARPDAEG
WLVSGQKIWTSYATMAQWCFLLARTSKVGEGAIQKKQQGLTIFLVPMDDP
AITVRPIRTMLGPHHLNEVFFDELRVTEADVLGTVDQGWSVVQDVMAFER
VGIARYARCERLLAAAPEVLGERWEELPAELRGRWVRMLTHCRRARLLAY
RVVALQGSGRVTPGDAAAYRIAVTKLDQDSAEVLMDIAAEVPHDAARAAW
FLAEADDHWRYSQASTVSSGSIEMQRILLSRVLLAGAR
392418122YP_006454727.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MILDLGDDAQEYGRQARQAFAAGGGDRLVQQAETAPSTRESLVGPLLAEL
GAWELDPRTDADGLEAAAALCRSAGYWALPYPLAERLAQPADLDVDGLIV
VGGARPAGAVVGLECRWAAVTVDGRRALVTGQREPGPGFVAELDLEPVDD
TGARDVALGLALPCWTLLGMLDRALELTLAHVSLRKQFGQTLSSFQGVQF
QLTDAEVERNGLDILAKHALWSIATGRPDATEDAMALRMSALEAADIVFR
VCHQLHGAVGFCDETTLSWLSRYSQPLRRLPFGLSATRDHLTRTAGRRGL
TGLFT
392418121YP_006454726.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTTLDDFRADVRSWCREHIPADWRQRQTGVDDEEFVRFQKAWFAELHGAG
YAVPHWPADWGGGMPVEQQVVLYQELAAHDAPRLVLAFVGIHHAASTLLV
AGTDEQRRRHLPAILDGEIWVQGFSEPEAGSDLASLRTTARRDGDAFVVN
GQKLWASGGMHADWCLLLARTDPDAPQRHGISYFLLDMSSPGVEVRPIRN
AVGDSHFCEIFLDDVRIPAAGLIGAENAGWQVAQATLGAERGMTMLELAE
RLGNAGFRWLVDSAPVDDPVVADRLARFETEITGLRGLCRRIVEHGAEGP
ADASIVKLYYSELLQRLTDFGTEIGGPQAHTVVAKPLSSGWESRSWVLDF
VGSWEWTIPGGASEIQRTIIAERGLGLPREPSVAR
392418120YP_006454725.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTDFAEFHDELRTVAGDLLAKDRETGWPVLVDAGWVGLEVPDELGGAGAT
FRETAVILDQIGRAAGANSYLGSAVLSVGVLKGLAPNAFRDQLLRSTAAG
DGRTAVVIGDFALAGGELTGRAEFVPDAVGADWLLVLVDGGVAVVRATDC
DITVQPVVDETRSLAAVVADAAAVEAVLAGPTEAVDSRAAVAIACDSLGL
AEQMLSATVDYVKVRHQFGRPIGSFQAVKHACADMLVRIEVSRQLIDEAV
EAVATGSDAAIAAAMAKSYTCSAAVDVAGKAMQLHGGIGYTWESGIHTYL
KRAALNRSLFGSPAAQRKQIAQRYRSQRKGI
392418119YP_006454724.1 thiamine pyrophosphate-dependent enzyme- possible carboligase or deMTMGVPVYKRILDLFEAEGVNTLFGIPDPNFVHMFAEAEARGWSVVAPHH
ELAGGFMAEAVSRMTGGPGLCIGTLGPGMANIAGAIQCAKVENSPVIFLG
GQRARITERRVRRGRIQFVRQEPLFAPSVKYSASIEYADQTDEIIREAIR
RAMSGTPGPSYVEYPAHVLLAELDVPDPLPPKRYRLVNQGAGATEVAEAA
KLIREAKSPILLVGHGVHTSRTQAPVKELADLMACPVIQTSGGTSFIPGL
EDRTFAYGFSPAAVEAVVKSDLCVALGTELGEPVHYGKTRHWAEYEANRK
WVLVEQDPVAIGVNRPIDVPLVGDLRGVVPQLVGALRESPRQPSADLDRW
IEEDAEELAQLAENAPTGRTPVHPARFVVEATRAFPEDGILVRDGGATVI
FQWTYSQAKPRDVIWNQNFGHIGTGLPYAIGASVAEGRTRPVMLLTSDSS
FLFHIAELETALRAGVPLVCVVGVDHQWGLEVGVYKRTFEQPSPQPGVHW
SKDVRFDKVAEGFGCHGEFVEKEDEIGPAIERSLASGRPAVVHVCIDPKA
NSEEMPKYDEFRTWYAEGTQ
392418118YP_006454723.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MREYLKHYIDGQWVEPLRPNTLEVDNPTTEEVSGKIALGSSADVDLAVQA
ARRAFETWSQTTREQRLDVLQAILAEYQKRAGDLAAAVSEEMGAPASLAA
GPQVNLGLGHLSTAIDVLKNFEFEEQHGSTLVVKEPIGVCGLITPWNWPI
NQIACKVFPALATGCTMVLKPSEVAPYSAQIFTEILDAAGVPAGVYNLVY
GDGPGVGAPMASHPDIDMVSFTGSTRAGIEVARNAAPTVKRVTQELGGKS
PNIVLDDDDFAKSVAAGTSVMMMNSGQSCNAPSRMLVPNSRMEEAAAIAR
ETASAVKVGDPGDKTAIGPVASRAQFEKIQGLIQKGIDEGATVVVGGPGR
PDGLEKGYYVRPTVFANVTNDMTIAREEIFGPVLCILGYDDLDQAVAIAN
DTEYGLAGYVSGADLDKARSVARRIRAGSVAINHGFDMNAPFGGYKRSGN
GREWGQFAFDEYLEVKAALGYAPA
392418117YP_006454722.1 Protein of unknown function (DUF2945) [Mycobacterium chubuense NBB4MSQQEFTKGDKVTWQSHGSTAEGTVEEKITSDTEAAGRTVRASEDEPQYR
VRSDKSGNDAVHKPDALTAANLARKSTP
392418116YP_006454721.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MVEKTAKPPEVGTNMEPHFEEVQAHYDLSDDFFGLFQDPSRTYSAAYYVR
DDMTLEEAQMAKIDLALGKLHLEPGMTLLDIGCGWGSVLKRAVEKHDVNV
VGLTLSRNQRKFAQELLDGLDTNRTRRILLRGWEQFDEPVDRIISIEAIE
AFPQERYGPFFKMCSSVLPDGGRMLLQAILGHPLKKWPELGIPITMTDLK
FMRFIAKEIFPGGSVPGEENIIELSAEAGLTLEHKQYLTDDYVRTLDTWA
QALEAHHDAAVEATSEEVYQRYMKYLVGCSDFFKRRVSELGQFTLVKV
392418115YP_006454720.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MSNTSTGQPGATAQSKWLSKSASDTRGSDKKEVQFHYDISNDFFKLWQDP
NQVYSCAYFEKDDYNLEQAQMAKIDLSLGKLGLQPGMTLLDIGCGWGATI
MRAVEKYDVNVIGLTLSENQKEHIENHWFANSTSKRNMEVRLQPWEEFEG
RVDRIVSIGAFEHFGFNKYDDYFKKTYSWMPDDGVMMLHSIIIPEDEEIK
AKGLPLTMSNVRFIKFIMDYIYPGGRLPLASMVRDHATKAGYTVTREQHL
QPHYVKTLDAWASNLENKKDEAIAVTSEEIYERFLKYLQGCADLFRDGYT
DVCQFTCEKKPLTSV
392418114YP_006454719.1 hypothetical protein Mycch_4330 [Mycobacterium chubuense NBB4]MIDLPEWARRLDLSPHPEGGYFRETWRSDLTVPQSVLPPDYTGCRNAGTA
ILFLLLPGQQSAWHTVRSAEIWLYHRGGPLHLEVGAGQETAETHVLGADL
DAGETPQFVVPPGHWQRARPVGGDACLVSCIVVPGFDFADFALGAPTD
392418113YP_006454718.1 hypothetical protein Mycch_4329 [Mycobacterium chubuense NBB4]MSRARPGWLVALCALVVAVSAWLPWLRSSAAGGGRANAIGGVAGAMPVPP
PGFGIGQLIFLLSATLLVAGAMAARGISARLASTAALANSVVIVVLAVWY
YRLYVYPPVSAGYGLYVAGAVAAAAALLSVWTMLSAYRSGLP
392418112YP_006454717.1 acetyltransferase- ribosomal protein N-acetylase [Mycobacterium chuMTGFVAPVKLTGQRWVALEPLSREHLPEIEVLAADGELGRLWFTGAPKAG
AAGDWVDMRLAVQTPQTGLTFMARTLDGALIGSSSYLNVDPANRRLEIGN
TWYAASARRSGANTEAKLLMLSHAFNELNCVAVEFRTHFFNSTSRAAIER
LGAKLDGVLRSHQLMPDGSRRDTVVYSILDIEWPAVRSNLRFRLDRNG
392418111YP_006454716.1 molecular chaperone (small heat shock protein) [Mycobacterium chubuMLRFDPFSDLDALTRGLLTSQTGSSRAPRFMPMDLCKIGDHYVLTADLPG
VDPGSVDVNVDNGTLTISAHRTARSEDSAQWLANERFFGSYRRQLSLGEG
IDTGAITATYENGVLTVTIPVAEKAKPRKIEISHAASQKSIEPTTVDAD
392418110YP_006454715.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAPAPNAVAQMLGLLGDEWTLLILQRAMLGARRYGDFHDELPVSNSVLSA
RLASLTHDELLVRREYQTRPPRSEYLLTPRSRSLWPMLTSIWAWEQRFVD
DHPQPLPAMQHRMCGAVFAPQVECRACDTPVSDKDVLAHWGPSGGWDRCI
PATTTRRRSGARRTPAAELFPQTMSVVGDRWGFALLVAAFVGLSRFTDFQ
NQLSAPPGTIADRLTLFTGEGILLNSEGRYRLTEKGRALFGVLVCALTWA
QRWFPAPDGPAAILTHTGCGQRFLPALTCDQCRNRLRGAQILAV
392418109YP_006454714.1 lignostilbene-alpha-beta-dioxygenase-like enzyme [Mycobacterium chuMSIKIHPEIVGKFLSTLPEDDDHPYRTGPWRPQTCEWNADDLTVVEGRVP
DDLDGVYLRNTENPLHPALKNYHPFDGDGMLHIVGFRDGKAFYRNRFVRT
DGFLEENAAGGPLWPGIAEPVELARRDYGWGARTLMKDASSTDVVVHRGV
ALTSHYQCGDLYRIDPCTGDALGKEDWHGAFPSDWGVSAHPKVDDRTGEL
LFFSYSKQAPYLRYGVVGDTGDIVHGVDVELPGPRLPHDMAYTENYVILN
DFPLFWDPALLEHNIHLPRFHRETPSRFAIVPRRGDASQIMWFEADPTYV
LHFPNAYEDGDEIVVDGFFQGDPEPADNGMGNKWQRAFRFLALDRMQARL
HRWRFNVVTGEVREEQLTDSISEFGMINPAHAGLPYRYTYAATGKPGWFL
FDGLVRHDLQTGGEERFAFDDGVYGSETAMAPRVGSTAEDDGYLVTLTTD
MTADASYCLVFDAARVADGPVCKLALPERISSGTHSTWAPGSDLPRWRDT
DTAAQAIGL
392418108YP_006454713.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MGAVWILGGYQSDFARNLDREGHDFSDLTAEVVTATLDAAGLDAADVGVV
HVANAFGELFARQGHLGAMPATVHDGLWDTPATRHEAACASGSVATLAAI
ADLRSGAYETALVVGVELEKTVPGDTATSILGTAAWTGHEGADAKYMWPH
MFDAVATEYDRRYGIDDEHLRAIAALNLANARANPNAQTRAWTVPQPLTG
DDIQNPVVEGRLRRFDCSQITDGGAGVVLVTDAWLRGHPRARPLGRIDGW
GHRTVGLGLRQKLEHSRDDPYVLPHVRGAVLDAFSRAHVTLDDLDGFEVH
DCFTPSEYLAIDHIGVTGPGESWKAVENGEIEIGGRLPINPSGGLIGGGH
PVGASGIRMLLDAARQVSGTAGDYQVDGAVTFGTLNFGGSTSTTVSFVVG
SHQ
392418107YP_006454712.1 response regulator with putative antiterminator output domain [MycoMTGSPNHELAVRMAELARTVSTPRRVEDVLSDVTSAVMELIPSTDAAGIL
LLGKAENFQTVAGTSDLPRQLDELQVRTRQGPCLDAAVDELIVRADDFRT
EERWPLYSAGAVERGVLSGLSFKLYTSSQSAGALNLFAREPHAFDGQAET
IGTVLAAHAAAAILASRQSEQLQSALSTRDQIGQAKGIIMERYGLDDVAA
FDMLRRLSQDSNTKLVEVAQRVIDTRGT
392418106YP_006454711.1 hypothetical protein Mycch_4322 [Mycobacterium chubuense NBB4]MLTASVTAIVPSGGGDSPAPLAGGHVAGVAAAPSRGTGGNAAGAALSALD
TDAKPLQHMLFGSTARSSAGTQASPLFTRSANVSGGGRPTHSVSNSVVAL
APGSHQIMIGPGGWLIGNAVEPGQNGGLLIGNGADGGPGQDGGNGGLLFG
NGGNGGDPVVYGADGTKGGNAGLFGNGGAGGLGSRWGAGGAGGRGGWIAG
NGGAGGQGGIDLIHSRTATGGVGGAGGRAGLFGNGGAGGAGGAATAWSAG
FDSYGGAGGAGGAGGLIVGRGGDGGIAGDSTSMKANAFGATGGAGGRAGL
FGAGGNGGAAGLGKGILSAAAEDGGRGGDGGLIGGSGGNGGNGGALDGIG
TNPDAVAVAGRGGDGGRAGLLGRGGNGGSGGAGQLAAGIGAGGDGGDGGN
GGLIRGSGGVGGDGGSYDGVHSVQSEQGGNGGKGGNAGLTGKGGDGGSGG
AGVEYDHGVGGAGGDGGHAVTGTAGKGGKGGDGYTLSTLKGLGSAGGDGG
NGGNAPVGRGGNGGNGGNGLSPEGATGTGGAGGRGGHGLSRGTDGSRGSG
DGSAAGGA
392418105YP_006454710.1 hypothetical protein Mycch_4321 [Mycobacterium chubuense NBB4]MRRIIIGIGAVVAGLLLAGLLFGGIAQVLGKVQHEPPIQATGPCGGAVIL
GNGGSQCDGPIQPDGSFTRCTSVYVLGFGGWSCYTVYPPR
392418104YP_006454709.1 hypothetical protein Mycch_4320 [Mycobacterium chubuense NBB4]MEKSRLIDIAPFVGAIAVQILTTPIQLTVACNLRRQHDNVKTTGSSPESL
PASIYDQFIVDSDCISSVAAGTTFVASAVVTLLAKTTFDPFALTSYILLG
IVAVFLSALIYLHYRRAPEIYVQRSPWKNRIAPLAMVVYGVNALGVIGFL
SLSP
392418103YP_006454708.1 ribosomal protein L30/L7E [Mycobacterium chubuense NBB4]MSPIATESAWDLYRIVVAEDTHSPNFRGRLGTLPLPRTAAFERVAGRAGN
AIVIQVKSGIGMRDHREQSLASLGLRGIDSAALVDINLGSTRGNIAVVHD
AVRVITLKEPAWKQTRRSLQTRGGRVMVEHIKYGSSRQPGDLLRTDRKQY
WYAELSRRAVSMAWSTSNSASDTITSILESLGPDDSGTGRIIRKTQDGEE
IGEGSIAEVIDSLQESDGVTVEYVQVCLAGLSISWKQPFKRFVDSREDLG
EIAVSVPRNEALRSHGVLTRLIASTATSEIKAIDPLAHLKGSRSVGYGAR
YRKD
392418102YP_006454707.1 hypothetical protein Mycch_4318 [Mycobacterium chubuense NBB4]MGSTPNSARWASIRRLFLVVAVELRPEEIRRLFQDLIGALEFSVLLLRLF
EPLRVGGRHPGHHAFVDVGLAHPSADRLDAGWPRAVPCPGWCPARCAGPA
PSAPRRPSPWSCSDASWASPQTVPSAYLHPRFQGQEPPTFPGRFKPPTPT
VWDQPKRDRQNRHRPIADSGLLVCHYHYRKSPYGLLRRRTQAWKRRPRLP
NANSVGPGVLLANRDRRFTAHLAQHPSQNIAPQITTLPYRAWCEKPKSSG
VRNEANPHVYSKRALLYVYTRGGTRLICGQLNGLSHWNTQ
392418101YP_006454706.1 transposase [Mycobacterium chubuense NBB4]MTLPVRHEASDRLVRCRATERYPLGRRARLELDEIAVYRNEKVTLSFTCG
IDWAESHHDVALIDERGVVLAHRRIDTGTAGFAALLTLIGEHGGGVDDTV
IAVETDKNLIVVALVEAGFTVYPINPRAVARYRERFGQAGGKSDPGDAAV
LAHILRTDRHLHRRMPANTNQAGAVKVLARQHQEAIWALHQTVSRLRSVL
LEFYPQALQAFPNLKHYAATTVLAAAPTPGDAQKLTKTRVTSLLRRSGRG
NHPVLAERILTALRTPALRQPTCVEMAYGHVVQGLVGSVVAMRAAVDELE
KALMCEFDQHPQSTLLRSVPGLGPVLAARILAEVGDDPARFSNPQSLRAY
AGTAPVTIASGRSHYVKARKVRNKRLADACHWWAFTILTKSVGAREHYDR
RRAAGDHHNAALRNLANKLLGRLWWCLTNHQPWTEDGAWPNASPPEEATA
A
392418100YP_006454705.1 transposase [Mycobacterium chubuense NBB4]MSLTWDVYYDTKTRPPSTRAVRDAELGPALRKLWEDNYRVYGVRKLWKAA
RRAGHGIGRDQVGRLMRRLGIEGVRRGNRVKTTAADTAAARHPDLVNRRF
SASAPNQLWVTDLTYVPTWSGVAYVCFIVDAFSRTIVGWRVASNMRTTMV
LDAVEMARWSRGNTLPGLRCHSDAGSQFTSIRYGERLAEIGALPSIGSVG
DSFDNALAETVNGYYKAELIYGPARTEPWKTVEDVELATLSWVYWHNTAR
LHSYLDDVAPTEFEAAFYDAQRIDQPLVEIQ
392418099YP_006454704.1 DNA replication protein [Mycobacterium chubuense NBB4]MTETPSVTATELVAPPSVPPLPADLDAGLRRLKLAAVRRTAPEVLITAKT
QRWTPEEVLRTLVETELAARDASNVVNRLKAAAFPVPKTLESFNVAASSI
PAKTFDYLSNLEWIHTQQNLAIIGPAGTGKSHTLIGLGTAAIHAGLKVRY
FTAADLVETLYRGLAGNTVGKIIESLLRTDLIILDELGFAPLDDTGTQLL
FRLVAGAYERRSLAIGSHWPFEQWGRFLPEQTTAVSILDRLLHHATVVIT
DGDSYRMKDAKHRKEQSKPT
392418098YP_006454703.1 transposase [Mycobacterium chubuense NBB4]MDIISAYQQLGSYRAAAEQCGTTHKTVRRVVAKFEADQAGVVPAPRVERG
HNYDAVTDLVAERVEKSKGRISAKRLLPIARAAGYQGSARNFRRLVADAK
ALWRSANHRGRRPAVWEPGQYLVIDWAEAAPGLFLFCAVLAFSRWRFVRF
ATDQKASTTLALIAEALAAIGGVPARVLADRMACLKGGVVANVVVPTPDY
IRLAGHYGFAPDFCHAADPQSKGIVEHLCGYAQDDLAVPLLTEAAVAGTP
VTLREANAAALSWCAEVNAAIHSEICAVPDERLGVECELLQPLPSLRLQI
GAPSVLRKVDRLSCVRYGSARYSVPTRLIGSTVAVVVDHGAIVLLEPATG
VIVAEHELLAPGGTSILDEHYDGPRPAPSRGPRPKTTVERQFCDLGADAQ
AFLVGAAAIGNTRLGAELEILLALGAAHGEAALVAALHRAVAFRRFRAAD
VRSILAAGTGTPQPRPAGDALILDLPVAPTRSLDAYKVSTMVDGEVIP
392418097YP_006454702.1 hypothetical protein Mycch_4312 [Mycobacterium chubuense NBB4]MPSRTPHSPTTAWCSPPAWPAEKSDATASKPNCTATESTKSTPPNHPTTC
GKVERSHQALKNGSPANPAPTPSPRSKPNSTPSPPNTTTAAPTAPCSTAP
PQRSSTPAAPKPTQQRASTPTTASAPTASTRPERVTLRVNGRLHHIGIGR
HHHRTRVLILAQDPDGLRVTPLAAVKNKVCFLSAHLIVCRRALRYATVKL
VQRSGQSFGPRVQGARVCWS
392418096YP_006454701.1 hypothetical protein Mycch_4311 [Mycobacterium chubuense NBB4]MTDQWPLLVADPLEGEQLVSSQLRPRAGAVAIDRSDYPSACNRVRDLCGT
WGGAGIPLIPVTPSENVDPRWSRILNESNIDGIEGSDLLGDDAVSEYTDA
EGPASAQLIRVLVDLERRPTVQTVRGMSTDDPWHLAYLTVAGDLSSQPHP
QNTWNDLRRDLTFDDVLTIRGVSENGSAAGLLALVRDFSAATAVELSRSK
LPSGLQGGYNRGFPSSSRFAWSDDETSQRFGPNIVVVFEPGSSEDLALVW
NLRARFLHPLRFPLAVPLTSTVEDDIRHLIQSGADHHFGFDHNLALTSIS
VASDRVATLAKSVGFKAVDPWELLRPIGGYCSVSTDIVRFNGGKARVASF
TPSDFQAIGGSYLGSHQGTWMKRKTVVVDAPLPPSRTMRRQIYHGDSHYL
EGPITTGGRSDGFTLIRVPSGLEVVSALSVDHGLQLTESAPGKAAEHLIR
AAGRNLSMFGSAGVVETLTELTRGRSVSIVKRRLNQYLAEPQTDESSDRY
QTLLDRLNRGLGSPDAEELGYPTFDRMRQLLRMRRDAAQQWVSWAMAGGL
ILRGVEANCTRCGHKQWRPLSEAVPSLVCHACGQTIDSPHGYNQINFRYR
ASEVLLRAMSHDVLSHVLAMRYVCGKLGGRPLVFGGYPGVEFRPLDSERV
TAEADVIVVLRNGEIILGECKANARGLSQEELDKLWRSADQLGARATFAA
TLDRAVNCGEEWRVTEGPTGRPHFALTAEHLFDLGGTIGASGEDLFAWRT
DYSSRFSADHQELTGADLARRIDEEFSTYVERTATDYDQHTRAPWTRGPN
D
392418095YP_006454700.1 hypothetical protein Mycch_4310 [Mycobacterium chubuense NBB4]MNTYDFHTLSPIDFELLVRDLLKEHLGVRLKAFGHGPDGGIDLKSSDNGK
ITIAQCKHYRGSSFSALKSAAAAEKSKMDELNPDYYYFVTSQLLSLTQQQ
TLVDILTPHLTDTAQIYSQLDLNDLITEFPNVEINHFKLWMASSTILKEI
VNSGIWNRSKALLEEIQDRVRLYVSTSSYQKATQMLADKQVCVISGAPGV
GKTMLADMLALAQWQDGWKVVELESSAIDKAWDVLDSSEDKKLFFYFDDV
FGQTDIQERLSRDNGKTVARLINAISRRPGKQLVITTRTHVLQEAELRDE
AVSRAGLRARECVVEVTEYTREIRARILYNHLYFSELSRETIRGFVIQRF
YTRIIDHKNFTPRLIELTIAQSSSEGAAEELLKRMLHALDHPMELWGPSF
RESLTETARTLLMHLATFPTTGTAISRVRASAAGASTPLEFERALKQLDG
SWIQIAGSASRNETYTSFANPSCRDFVLSFINSHAEYAIVLAQNVLGPDQ
LAQLLRYARSVDRDRSLKYPLLGSKLRDNSGQIAQAISDTWARTLSTLRT
APSDAPATLESFLGSAAHLNMGIEDWIMDQILSLSRYSTYHSLDGHNCEE
LTQAIRGSGRNLTTDAELESCKILFLIWCDVIGYHDEWHTVFEYRHWLDE
EVGVNWTDDDESILYNCFDQWLRNEFENVLPNAEKESDAEAYIADIRGVA
AQYFDLTSFSSRFDSIERDVYEHFNRSFEPDWDDYREMYAARTVASSQHV
IELDLSDDAYEDDEAPEPVEPRQSPTHEESSIDAMFNHLR
392418094YP_006454699.1 hypothetical protein Mycch_4307 [Mycobacterium chubuense NBB4]MAKVSKLRIVAGSVPGVELTLQRIGAWSGSIMIVLYGASFSGVAQLFPPL
SPASSADEIAAFFVDHKLWIRFGVSGALLSAAVALPFLAAVILRIRRVEG
GWGMLSVTQLMAATVFVPALIFPQFFLAVAAYRPEQRSAELTQALDDVFW
LWFIGIVGTIIVQNLTLAVAAFVDKTDPPTFPRWYGYLNLWVATLSLPGC
VVVVFNDGPLAWNGVFAFYIPGLVLVIWLFATTAVMLRSINAEQAALA
392418093YP_006454698.1 heme/copper-type cytochrome/quinol oxidase- subunit 3 [MycobacteriuMTTTVRRVPGESGTWVFLFGDMAVFGAFFVTFLVERATARDTFDAARRTL
HIGAGVLDTLVLLTSSLFVVLALAALRATERALATRAVAAAMACGVIFVG
LKVFEYTSLATAGHGPGANHFYLYYFILTGLHLFHVCLGLGALAFLLSQT
RRAELSTTRTALVEGAACFWHLVDLLWIFLFALLYLVS
392418092YP_006454697.1 hypothetical protein Mycch_4305 [Mycobacterium chubuense NBB4]MTGLRLLRSRAGASWVFLVAATIVSWAVGAEHGTGSTVAVVVLAIAAIKV
RLVGLDFMELRHAPIPLRAAFECYCAGMWVLLSALYLWL
392418091YP_006454696.1 putative F420-dependent oxidoreductase- MSMEG_2516 family [MycobactMPEPKWIQTSAYDRLVTKGFRFGVGVMRGNSRTKLEDSARRAEALGFDVM
HVPDHLGGPAPFPVMTVIAMATSTLRVGTFVMNSAFYRPALLARDVAALR
DLSGGRLELGLGTGYVEEEFAAAGIPFPSARERVDHLRETTEYIAEHLPD
VPIMIAGNGDRVLRIAARSADIIGLTGGDRPAGADEDPLADRIAFVQQAA
GERFGDLELNIAVTAMPLDGSGMPDLTIPRHFLPGLSDDELLRHPGVLSG
STDEIAERVRGYRDTYGIGYVTVQDRHAEAFGKVIALLK
392418090YP_006454695.1 carboxylate-amine ligase- YbdK family [Mycobacterium chubuense NBB4MTNAPTLGVEEEFLLVDPDSGAPVAKNRQVAEYAAEHGVDLQLELTRCQV
ETATDVAHTTADLRDQLLRLRRVASGAAEQAGARLLAVALPPTLPTEFPV
TDTPRYRDIGERYGMIAHEQGICGCHVHVAVPDRDAAIDVGNRLRPWLPL
LLSLTANSAIYRNADTGHASWRSVLWARWPSAGPPPHFGSADEYDAAVQM
LCRAGVMRDDGMVYWDVRPSADFPTVEIRVADVPATVAETVLFAALVRGC
VMTALDDGRRGEPVQPLAPYVLKAAYWKAARDGLDGDGVDLENHGAAPAL
TLAERLVERVRPALETAGDYEMVSTELARIAGEGNGAMRQQRVWRRRHDV
SDVLAEAAAATLEAPS
392418089YP_006454694.1 hypothetical protein Mycch_4302 [Mycobacterium chubuense NBB4]MTRPDEPADLQSLATPYALHALGDGDVADIDRRLLGASADEAEEFFAEVR
AVRETMAVLAAATAVEPPDHLRGRVLEQITEGSVRALPDRSRRWTRGVLA
AAAAVAIGLGVLGVGLALRPTPQSSTADRVFAASDVRTVSGDIPGGGRAT
LVFSRERDSGVLVMNNVPKPAPGTVYQMWLVGADGPHSAGTMDAGAVAPS
TTAVLPDLGSSRTLAFTVEPPGGSTYPTSPVFAELPLS
392418088YP_006454693.1 RNA polymerase sigma factor- sigma-70 family [Mycobacterium chubuenMRACRLGSRLSVAHSRFPIPHGGDGVILTALALVGARLRLVTADLDALLR
QVARRDVDAFASFYDQTRARVYGLVTRVLRDPGYSEETTQDVYLQVWRSA
ESYDPSAGSPLAWLMTLAHRRAVDRVRSEQAASTRESRYGAANVDPPSDS
VADSVILSDERQQVADCLATLTDTQRECIQLAYYDGLTYVQVSERLSANL
ATIKSRMRDAIRGLRRCLGVA
392418087YP_006454692.1 hypothetical protein Mycch_4300 [Mycobacterium chubuense NBB4]MTTALYRTRITHLRRAPVHHYFEHRSYSWLIDLDDLPRVPWWLRPFAKFL
AVDHLWGSGDDTLRSRVDAFLAGKGIDLPGGKVTALMQPRVLGYVFNPLS
LYWCHDAAGVLRYVIAEVHNTYGQRHAYLLPPSADRPAMVSKKFYVSPFN
DMEGHYLVRAPHPADDVDVQISFHRDHQPAFVATLRGKRKPAGIRQILAL
QLVAPMAPLMNTLSIRVQGITLWLRRVPIVPRPTVERVTVQQL
392418086YP_006454691.1 phage-related replication protein [Mycobacterium chubuense NBB4]MASRHSYFAYGSNLSVRQMAQRCPDAADPRRATLADHDWLINERGVATVE
PFAGGEVHGVVWQVSDRDLATLDSAEGVPVRYRRDRLEVRTDTGRDTAWV
YIDHRVEPGAPRPGYLERILDGARHHGLPGRWIEFLERWDPVHWPQHRNG
SDSAAPQSFSQLLADPAIIEHSVLRSRFGFMAIHGGGLERMTDVIAERAA
DAAHASVYVVRHPDEYPHHLPSASYDPAESARLAEFLDHVDVAVSLHGYG
RLGRSAQLLAGGRNRVLARHLVTHLSIPGHQVITDLDAIPRELRGLHADN
PVNRVRGGGTQLELSARVRGISPRSGLPGDDGLAPATSALVQGLARAARS
WPAD
392418085YP_006454690.1 natural resistance-associated macrophage protein metal ion transporMVAQDVHARARPGWLLLGPAFVAAIAYVDPGNVAANVSAGAQFGFLLVWV
IVAANIMACLVQYLSAKLGVVTGTSLPEAVATRMGRSTRLTYWVQAELVA
MATDLAEVVGGAIALHLLFDLPMIVGGVITGAVSLALLVIKDRRGQTVFE
RVITGLLMVIAIGFLTSLFAATPPFAAAAAGLVPRFDGAESILLAAAMLG
ATVMPHAVYLHSGLARDRHGHRAPGPARRTLLRITRWDVGIAMLIAGAVN
LAMLLVAATNLQGMPNTDSIEGAYDAVQSTLGHTIALLFAIGLLASGLAS
SSVGAYAGAMIMQGLLRRSIPLLARRLITLLPALAVLAAGVDPSRALVLS
QVVLSFGIPFALIPLVRLTGDARVMGADVNRRVTTALGWVVAALISVLNV
ALVYLTVTG
392418084YP_006454689.1 hypothetical protein Mycch_4297 [Mycobacterium chubuense NBB4]MSTLGRGIAVVIAAAGLALSGAAVAGATPKCSDVGKTVTYCETNGSTQLT
STPPPFRWGGWQGGGYYPFGGFGYFP
392418083YP_006454688.1 hypothetical protein Mycch_4296 [Mycobacterium chubuense NBB4]MKARLSTLAALLVAGGASVAIAAAPAALAQPDCVQTGEGGGIQGGANTDC
QSPGNAQIDSTPGVYSEPWEGGYPWGYGPFVL
392418082YP_006454687.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMRLASVSPVILDRFRLDDQVAVVTGAGRGLGAAMALAFAEAGADVLIAAR
TQAQLDDVADQVRAAGRRAHVVVADLAHAEDTAALAAQAVDAFGRLDIVV
NNVGGTMPNALLGTSVKEMRDAFAFNVATAHALTTAAVPLMLEHSGGGSI
INITSTMGRLAGRGFAAYGTAKAALAHYTRLSALDLAPRIRVNAIAPGSI
LTSALEIVASNDELREPMEKATPLKRLGDPLDIAAAAVYLASPAGGYLTG
KTLEVDGGITYPNLELPIPDL
392418081YP_006454686.1 Ku protein [Mycobacterium chubuense NBB4]MRSIWKGSIAFGLVNVPVKVYSATQDHDIKFHQVHAKDNGRIRYKRVCEI
DGEEVEYRDIARAYDSDDGQTVIITDDDISTLPEERSREIEVLEFVPASD
LDPMMYDKSYFLEPDGKSSKSYVLLAKTLMETDRVAIVNFALRNKTRLAA
LRVKDFSKRDVMMIHTLLWPDEIRDPDFPILDKEVEVKPAELKMASQVVD
SMTDDFNPDRYHDDYQDHLHELIQAKLEGGEAFATEEQPQELDESEDVSD
LLAKLEASVKARKEQSGSKEPAKKAPAKKAAKKAPAKKSAAKKAAKKAPA
KKS
392418080YP_006454685.1 sugar kinase- ribokinase [Mycobacterium chubuense NBB4]MKALVIGEALIDIVTRDGRVIGEYVGGSPLNVAVGLSRLGRPVEFLTHIG
DDTHGRRIREHLESAGVQLVSGSQSAPRTPTARATLDPSGSATYAFDIEW
QLSGTPEVAPPVVVHTGSIAAVLEPGCRATAALVDTYHLSATFTFDPNVR
PALIDDPDAARARIDRLLERADVVKASEEDLHWIDPTRAPEQIAASWLAL
GPSIVVVTKGAAGAVAMCAGGTVRIPAGQVEVVDTLGAGDAFMAGLIDAL
WSLDLLGARRRAALARIGPDALTTALRAAALSAALTVSRPGADLPDRAAL
DWAASSDILG
392418079YP_006454684.1 DNA ligase D/DNA polymerase LigD [Mycobacterium chubuense NBB4]MKLTNADKVLYPATGTTKGDVFEYYVRVAEAMLPHIAGRPVTRKRWPNGV
EEGSFFEKQLASSAPEWLDRGTIVHKSGTTTYPVIDTAEGLAWIAQQASL
EVHVPQWRFDDTGSVGPATRIVFDLDPGEGVSMRQLCEVAHEVRDLITDI
GLQTFPLTSGSKGLHLYVPLQDPISSRGASVLAKRVAQQLEQTMPKRVTA
TMTRSLRDGKVFLDWSQNNGNKTTIAPYSLRGREHPTVAAPRTWEEIEDP
KLRHLTYDEVLDRLERDGDLLAELDDPLPVPDRLTTYRSMRDTARTPEPV
PKQSPEVGNNDKFVIQEHHARRLHYDFRLERDGVLVSWAVPKNLPETPSV
NHLAVHTEDHPMEYLTFAGEIPKGEYGGGQVYVWDTGTYETEKFRDNPPD
GPAKGGEVIVTLHGEKVEGRYALIQTDGKNWLAHRMKDQKHPTFADLVPM
LTTEGSVERLSKGQWAFEGKWDGYRILVEADHGKLTVRSRRGRDVTAEYP
QFQAIAADLADHHVILDGEAVALDESGVPSFREMQNRARSTRVEFWAFDI
LYLDGRSLMRAKYTDRRRVLETLAEGGGLIVPAAIEGDGPQALAYAEKKR
WEGVVAKKKDSTYQAGRRSSSWIKDKLWNTQEVVIGGWRQGNGGRTSGIG
ALMLGIPGEGGLQFVGRVGTGFTEKELASLKETLTPLRSDESPFSARLPT
QDAKGVTFVRPELVGEVRYSERTGDGRLRQPSWRGLRPDKGPGEVRWE
392418078YP_006454683.1 protein of unknown function DUF222 [Mycobacterium chubuense NBB4]MYVRSMVVGDLQGAVTALLGAFDEVADCGIDLATSAELVGVLDELETLWC
RLPAVRHRLLARLQTETTPQQLGAKSWKDVLALRWRISTSEAHRRLTDTA
LLAPRQAVTGPSLPPVLPATAAAQAQGLINGEHVEVIRKAVHRLPGFVDT
ATREQFEVDLVRTAVGVGPKELHDTAERTLFLLDQDGPEPDDTERARTRA
VVKHKQRRDAMTDLTATLNPQAWAVWEAIFAKYAAPGMCNPDDPHPCTTG
TPTQAQIDNDHRSLAQRQHDALLAAGRIALMSGQLGRLNGLPASVIIRTT
LKDLESRAGIGVTGGGSVIPIADVIRMAGHANHYLAVFDHATGSALNLFR
AKRIATPAQRIMLIARDGGCTKPCCTVGAYGSQVHHVTTDWAAGGNTNLD
DLGLACPPDNRSVTPDGWTTHMNNHCEVEWTPPPHLDTGQTRLNYHHRPE
KLLHPPEDPETRGPNTAAPVESTGGDDINDAQSCTPSTTDNTDHPGGPAP
PDNQAA
392418077YP_006454682.1 ribonuclease HI [Mycobacterium chubuense NBB4]MTELADVVIIHTDGGCRPNPGPGGWGAVLRQHHHVREMCGGEAGQTSNNR
MELMAPIMALEALTRPVLVHLHTDSTYVRNGITKWVLGWERNGWMTAAKQ
PVKNVDLWQRLQAACARHRVEWFWVKGHSGVADNELADVLATRGLQEALA
TSALAT
392418076YP_006454681.1 hypothetical protein Mycch_4288 [Mycobacterium chubuense NBB4]MTVSIDALEVADPPDAWDRAGFTVDSDAVCRVGGVRIHLIGGVSGTGIVG
WSLRGVPPHEPLDDLDGIPTTRSDAGPAATATHTNGVTSIDHVVLLSPDL
NRTVESLRALGVHRRRERDGELGGHPIRQIFFRLGEVILEVVGSPGTPGD
GPSSLWGITYTVADIDATAAFLGDRTAPVKDAVQPGRRITTLRHHDFGMS
VRTALISPPILSA
392418075YP_006454680.1 hypothetical protein Mycch_4287 [Mycobacterium chubuense NBB4]MERAEELPVAQIVPTPELVEQVVREKLPCWAWAVFASVVFHRWAAVEERK
IRQILGSPVRAEGRLSTGSDVARFAREQLRAVDDVVAEVEAYLSAPAFAA
SFGAPGDEREADAVRIVRAAHHLGDCYERLLALTETFRSHSVPAQYAALL
SDCTRFVNQSLQDFCGFVNDVLERLEDLQRAVVKRHRPVRFEPIRLDTTT
DDQLLWSIADRLQAIC
392418074YP_006454679.1 hypothetical protein Mycch_4286 [Mycobacterium chubuense NBB4]MAFKLTYSDGQESQHGDDTVWELDDGVLKLGREKGKWSVLLSPSHWAVLE
IGGANDGDSKGDSDDDSDNKDKKDSGDSKDDDKDDDDKDD
392418073YP_006454678.1 arabinose efflux permease family protein [Mycobacterium chubuense NMTATVDRPSGTASVVAPDPVVRWLAVVALALGGFGIGTTEFVSMGLLPDI
AGTLGISEPTAGHVISAYALGVVVGAPLIAALTARMARRTLLLALMTVFT
LGNLASMLAPSYGTLIIARFLAGLPHGAFFGVAALVAAHLMGPQNRAKAV
AHVLTGLTVATVLGVPVASWLGQALGWRAAFGLVVAVGVITVTALYFWLP
DRLRTMPVTSPLTELGALRRVQVWLALLVGMIGFGGMFAVYTYIATTMTD
VTGLPRALVPLALMVFGAGMFVGNLVGGRLADRSVIRALYLSIGTLSLML
AVFVLASHNPWTALVVLFGIGAAGSSVGPALQTRLMDVAHDAQTLAAALN
HSALNIGNATGAWVGGLVISAGLGYTAPAAAGAGLALAGLAVLTVSVLLQ
RRRG
392418072YP_006454677.1 2-keto-3-deoxy-6-phosphogluconate aldolase [Mycobacterium chubuenseMKEPRSLLDVAPVLPTVSVRDTGAATAVQVARAIARTGLTLIQVSLDAPA
ALDAIERIATEAPEVIVGAAEVNHVDQPALARAAGAEFLTATAPGGELRA
ALRDTELPHLPGVTSTQDAMELLDDGYCDMYLHPAAAAGGLRHLKALAAF
VPAARFCAAGGIGAADLSGYLAAPNVGCVSADWLAPSDAVARRDWERIRR
LADVALTLSKPTVTAVRAL
392418071YP_006454676.1 transcriptional regulator/sugar kinase [Mycobacterium chubuense NBBMSLFRSSSAAAAGDLYALIRQKRHITRAEIGQLTGMSRTAISARVRELTV
RGLVVERDQAASTGGRPATLLSFNADAGIVLTAAIGGSRARLAVCDLAGD
VRAAADIDQEPGFGPEDLMPDVVKRLDMLLDESGHRDAHIFGVGVSLPGT
VDARQGWSIDSPVLTGWDRVPLMPYFSELTDAPVVLGNDANAFALAEWRA
GAGRGFDDVIVIKASTGLGAGIVAGGALQRGAMGAAGEFGHDKTPAANER
PCRCGDVGCLETVAGGWSLVRVLGQEGRSVRHLRDVVELAHSGDALARRL
IRDSGRHVGEVLAGAVNLLNPAALVVAGDVAGAYDIFVAGLRETLYRNAT
ALATRTLQIVPSQLGERAGVVGTAMMVLDEVLAPQVIDAPAGPSSP
392418070YP_006454675.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTTGSGPATSGDAYDVPDAFDAGADSYDSLVGANPGYHKHLRLSAERMRL
PDGGRGLRLLDIGCGTGASTAALLHAAPHAEIVAADGSAGMLAQARAKRW
PSSVTFVHSRVETLADAGVTGPFDGILAAYLIRNVDEPDAVLQSLRASLR
PGGVLAAHEYSVRDSRAATAIWKLVSSTVIIPAGRLRTGDAALYRYLQRS
VLEFDGVSGFRNRLRRNGFTDVSSMSMPGWQRNVVHTFTGRAPR
392418069YP_006454674.1 glycosyl transferase- UDP-glucuronosyltransferase [Mycobacterium chMAHYLLAVSPLPGHLMPMLTIGLGLQSLGHRITVLTGAQLCDTVAASGLD
PVALPVDVRIEPPAAAPAPLRRLPTPVRRFWLGRAELRAVYAEPLGEQAD
ALRAILRTQPVDAILADVTFTGALPLLLDDSARPPVLCCGVSPLTLTSAD
TPPFGLAWQPRPGRDYRRMNAVAHRVIMRGSQRAFDRALRRAGAGRSPVF
ISDWPRLADGLLQLTVRDFEYPRGDLPPTVEYVGPVLPTAPSTFEPPHWW
DDVCATAGVVLVTQGTHDNVDLDQLINPTLEALGDRRDLLVVATTGRRAG
QRLPRRLADNARVADWVPYSALMPYVDVMITNGGYGGVQFALSHGVPLIV
AGETSDKAEVAARVAYSGVGVDLATATPSPATIRAAVADVREDGAYRGAA
QRFRSEIEDATPIDSIANALKRCCGT
392418068YP_006454673.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMRFTFAEAMTDPTFYIPLAKAAEAAGYHAMTIPDSVAYPFESDSTYPYTP
DGSREFLDGKAFIESFVLTAALCAVTTTLRFNHFVLKLPIRPPALVAKQA
GSLAALFDNRLGLGVGTSPWPEDYELMNVPFARRGKRMDECIDIIRGLTS
GDYFEYHGEFYDIPKTKMTPAPSKPVPILIGGHADAALRRAARNDGWMHG
GGDPEELDALIKKLDTFRAEQGRSGDPFEIHVISVDAYTPDGIKRLEDKG
VTDVIVGFRVPYIIGQDTEPLDAKIRNLEKFAEHVIAKV
392418067YP_006454672.1 hypothetical protein Mycch_4279 [Mycobacterium chubuense NBB4]MTDIETVAQIDAPVDAEFDEATHTWSIGDRRARVLIARDGALPATFRATE
RLEPYLGVAVHGLPNYFVITGPDVSAQKAYIAKCLAHLNRTDSTRIEVRA
TTQRLYHQRFRGRMHRSGRYWRRVGRRIGSAFDTQAVGPDENAAHDGPAT
VRIAGRRHRARVRLTGQVDPIDGHYHWQGTLFGIDTEVRLPQPVTIEIDD
RSAEGRMIERTPQSTYTVVGTGTPPFALPETQIVVRPVSPHSPTSD
392418066YP_006454671.1 P-aminobenzoate N-oxygenase AurF [Mycobacterium chubuense NBB4]MTAPTRGEFAERLLKGSVKKSYAPVVDIDWDAPLDPDKFFLPPKIVSLYG
TPLWDTMSRAQQIELSRQELVNTLSAGIWFENILNQSLLRKMMHQDPTAR
ATHYELTELGDETRHMVMFGKAITRVGAKPVRPRRYQRVIINALPFVFQG
SALWVAALIGEEIFDSLQRQMMDDPELQPIVQRLMRIHVTEEARHIQFAR
DGLRKRAPAMRRGPKLLLANINGLGGVFFQHLFTHPVQYQRAGLDPREAR
RVARASAHRHEVQILGFAPLASFLQKVGLLGPIARRQWKRSHFL
392418065YP_006454670.1 putative membrane protein [Mycobacterium chubuense NBB4]MTSFLLRAALTGFALWVVTLIVPGIGFVGGDTTAARVGIIFVVAVIFGLV
NAIIRPIVAIISIPLYILTLGLFHIVVNALMLWITSRITEHTTHWGLVID
HFWWTAIWAAIVLSVVSWLLSLVVRAD
392418064YP_006454669.1 formamidopyrimidine-DNA glycosylase [Mycobacterium chubuense NBB4]MPELPEIEALADHLRRHAVGLTVGRVDVAALSVLKTFDPPVSALHGLTVT
GAERWGKYLGMRAGDLHLITHLSRAGWLRWSDKLAAAPLRPGKGPIALRV
HLGTPGEAAGFDLTEAGTQKRLAVWLVADPMSVPQIASLGPDALSLSLDG
LAEVLGTQSGRIKTVITDQKVIAGIGNAYSDEILHVAKLSPFATANKLTE
AQLADLHDAMISVLTDAVTRSVGQQAAMLKGEKRSGLRVHARTGMPCPVC
GDTVRQVSFADKSFQYCPTCQTGGKVLADRRMSRLLK
392418063YP_006454668.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMTRQKILITGASSGLGAGMAREFAAKGRDLALCARRAERLDELKAELLER
HPGITVAVAALDVNDHDQVPKVFGELSDELGGIDCVIVNAGIGKGYPLGG
GKLWANKATIETNLVAALVQIETALEMFKAAGKGHLVLVSSVLGNVGVPG
VKAAYAASKAGVTSLGESLRAEYPSGPIKITVLEPGYIESEMTAKSNSTM
LMVDNETGVKAMVDAIEKEKGRAVVPGWPWWPLVELMKLLPPKYTKRFA
392418062YP_006454667.1 beta-glucanase/beta-glucan synthetase [Mycobacterium chubuense NBB4MANIDGHLNRRSMMVMAGLGMLGAALPATARATPYTGPPPAAPPPNGKYL
FEDHFDGPAGSAPDRSKWEIATERESMQDPTFWERPENVGQYRDDRRNVY
VDGKSNLVFHAAKDGNTYYSGKVFGTFRGGIGHNWEARIKLNCLTPGCWP
AWYLANNSTVNGGEVDIMEWYGNGNWAAGTAVHAKLNGGEHVSQNITLDS
AWHTWRVQWDDAGMRFWRDYTDGAQPYFNVPAGSLPDWQFNTPGYQLFPV
LDLAVAGSGGGDPRGGTYPADMLIDYVRVW
392418061YP_006454666.1 glucose-6-phosphate isomerase [Mycobacterium chubuense NBB4]MAAQTPDIPDITATPAWEALSRHHDEIRGEQLRELFSQDPARGTEMALTV
GDLYIDYSKHRITRDTVTLLLDLARAAGLPQRRDAMFSGAHINTSEDRAV
LHTALRLPRDAELTVDGQDVVADVHEVLDRMGDFTDRLRSGDWRGATGER
ITTVVNIGIGGSDLGPVMVDQALRHYADAGVSARFVSNVDPADLVAKLSG
LDPATTLFIVASKTFSTLETLTNATAARRWLIDALGEDAVSKHFVAVSTN
AKLVEDFGIDTDNMFGFWDWVGGRYSVDSAIGLSVMAVIGRERFAEFLAG
FHLVDEHFRTAPLEANAPVLLGLIGLWYSNFFGAETRAVLPYSNDLSRFA
AYLQQLTMESNGKSVRANGTPVTTGTGEIFWGEPGTNGQHAFYQLLHQGT
RLIPADFIGFSEPTDDLPTADGTGSMHDLLMSNFFAQTQVLAFGKTADEI
AAEGTAAEVVPHKVMPGNRPSTSILATRLTPSVVGQLIALYEHQVFTEGV
VWGIDSFDQWGVELGKTQAKALLPVITADAAPAEQSDSSTDALVRRYREE
RGRSV
392418060YP_006454665.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MDTSALLKSVPTGLWIGGEERQGTSTFNVLDPSDDEVLTAVADATAEDAR
AALDAACAVQGEWAATAPRKRGEILRSVFETITERADDIAALMTLEMGKV
VAESKGEVTYGAEFFRWFAEEAVRIDGRYTPSPAGTGRILVTKQAVGPCY
AVTPWNFPLAMGTRKMGPAFAAGCTMIVKPAQETPLTMLLLAKLMDEAGL
PKGVLSVLPTSNPGGVTEALINDGRLRKLTFTGSTGVGKSLVKQSADKLL
RTSMELGGNAPFIVFDDADIDAAVDGAILAKMRNGGEACTAANRFHVANA
VREEFTEKLVKRMSEFTLGKGLDESSTLGPLINAKQVATVTELVSDAVSR
GATVAVGGVAPGGPGNFYPATVLTDVPADARILKEEVFGPVAPIAGFDTE
EEGIAAANDTEYGLAAYIYTQSLDRALRVAEGIESGMVGVNRGVISDAAA
PFGGIKESGFGREGGSEGIEEYLETKYIALTK
392418059YP_006454664.1 putative acyltransferase [Mycobacterium chubuense NBB4]MADGRAVEYSADGRAVESGTAVSAAPIRVGPRRYVSPGQGIPALDGIRAI
AVALVLADHGGIPGLSGGFLGVDVFFVLSGFLITSLLLDEIGRTRRVGLK
SFWIRRARRLLPALVVMVLTVVAARDLFAPESTASLRDDAVATFFWMSNW
MFVHQQTDYFSQGAPPSPLQHTWSLGVEEQYYLLWPLILAAVVAGLAALA
YRRGVALSIRTVRVVVFVVAAAGAVASAVAAAMMTADGALNRVYFGTDTR
VQALLVGAAAAALVVRDWRGLSAGLVILRSRWSRWLAWSLPVVGLVVVVM
AAHAATGQADEFRHGLLFVVAVAAVLVIAPVALEQSGPVARMLSMAPLVG
LGAISYGVYLWHWPIFLVLNGERTGNSGWQLFALRCAATVAVATVSWWLI
EQPVRQWRPAFVPMLPLAAATAATAAVVTMTVLPAGIALQQPKPGPLVDS
AALIAPEVPVAVSAPARPRAPGDVRVAVFGDSIAWTMMRYLPPTPGVDFA
DFTTIGCGIARGGPYEYVGQELVQKPECDAWPSRWTQRIGYERPDVVLLT
IGRWEVVDRMNEGRWTHVGEPGYDGYLRGELNRALDILGSTGARIVVTTE
PYNRRAEKADGSLYPEDQPKRVDNWNALLRSVTAARKNVTVLDLNRKLSP
NGYYQTKVDGIRMRSDGVHPTPEAVEWLTPWLVDALKTR
392418058YP_006454663.1 monofunctional chorismate mutase [Mycobacterium chubuense NBB4]MTTTEAAQLPDIDDLRLEIDRLDAAILEAVKRRTEVSQMIGKARMASGGT
RLVHSREMKVIERYSELGPEGKNLAMLLLRLGRGRLGH
392418057YP_006454662.1 ATP-dependent DNA helicase PcrA [Mycobacterium chubuense NBB4]MSISTTAETDELLEGLNPQQRQAVLHEGTPLLIVAGAGSGKTAVLTRRIA
YLLAARDVGVGQVLAITFTNKAAAEMRERVVALVGPRARSMWVSTFHSTC
VRILRNQASLLPGLNSNFSIYDADDSRRLLLMIGKDLGLDTKKYSPRLLA
NGISNLKNELIGAEQAAAEASEAADDLARIIAEVYGEYQRRLRAANALDF
DDLIGETVAVLQAFPQIAQYYRRRFRHILVDEYQDTNHAQYVLVRELVGV
GAADTDTVPPAELCVVGDADQSIYAFRGATIRNIEDFERDFPNATTILLE
QNYRSTQNILNAANSVIARNVGRRDKRLWTDAGEGELIVGYVADNEHDEA
RFVAQEIDALADADSSFSYNDVAVFYRTNNSSRAIEEVFIRAGIPYKVVG
GVRFYERREIRDVVAYLRVLDNPGDSVSMRRILNTPRRGIGDRAEACVAV
YAENTGSSFNDALLAAAEGKVPMLNTRAEKAIAGFVALLDELRAGLDGEL
GELVESVLDRSGYRAELESSSDPQDLARLDNLNELVSVAHEFSIDLANAR
ALADEEAVDEDVPDTGVLASFLERVSLVADADDIPEHGAGVVTMMTLHTA
KGLEFPVVFVTGWEDGMFPHMRALGDPVELSEERRLAYVGITRARQRLYL
SRAKVRSSWGQPMLNPESRFLREIPQELIDWRRTEQAAPSRSAPVSGAGR
FGTPRPSPTRGPAGKRPLLVLEPGDRVTHDKYGLGRVEEVSGAGESAMSL
IDFGSAGRVKLMHNHAPVSKL
392418056YP_006454661.1 putative flavoprotein involved in K+ transport [Mycobacterium chubuMFDFTESIVIAAPPEQVWEVMREIDRWWPPSNPEHISLEHLDDRPVTEVG
ARLRIREKVAGIPAVAVGTITDVTAGSAVTWEAEAIYRWFGVSVPVGEGV
TWRLTPGIGGSTVVSAHVWATFPAGVIGRLARFAFVRLLDGIAKDREHAR
CELRYLKRTIESRSGIREAVVIGAGAAGLAAARCLQSAGVDVCVLESAPR
VAASWWGRYQGLRLNTVRWLSDLPFRRMAAHFGRWPDRAEWAGYLTEYAQ
ELDDIRTGVTVTLLERTGQAWSVRTDCGTISAQYVVVATGHDRVPVLPSW
PGAAEFTGQLVHSAQLSDVGQVTGRSVLVVGTGNSGIELATMLAADESNS
VSISMRSVPLMLKRELGPIPITALAEVTRLLPDRLIDWIGRALHRRLWSG
LSRYGMSETDKRLSMMRHTYYSPPLDEGFAAALKRGAIEIVPAVTGFDGH
RVTLQKTEPRAYDLVVAATGFRPGLENLVGHLGVLTDDGEPLAKGGKQHP
RAPGLFFAGFNFGLFALLPYLEGDAEAITREITGMANTGRTLRRPFKFGP
LRP
392418055YP_006454660.1 hypothetical protein Mycch_4267 [Mycobacterium chubuense NBB4]MASDDTTPAPNDGPSDTDDSENTRIIRRAPLNTGSQPLSAAADPHTTIIR
RHPTGSLPVAPEPATGYLPRATPVAVGPARPPRVDAKPAIATAVASIVSG
WATGVIATDLITGWWGTDLLFCVAMGFLTAVAAGASISGVIALLLRRRTA
RLLIVVGAVISLLIFASLFVAGAKLPALVFAMPVLPLASIALAALPATAR
WSRSG
392418054YP_006454659.1 metalloendopeptidase-like membrane protein [Mycobacterium chubuenseMPQHRATRFSKAVSAPDSTEVTQIIPFNEFGDLNDSPDLDGPEFLSHAAF
DREARVIHAPELDDLHDTDDLAPLHLVVPTEFRAEPQDRPRASSRAYRDS
NTDVSDGTAATDIIDMRGRKGQHRKTEVPIKGRLMVAAMAVGATAAGAYT
MTNSAQKAPAETVLASDQTALGGSGVITGSVDGMQVVSVAPAVNSSVHAE
EITKAAAFAQERADREARLTRPQYVFPTHGVWTSGFGYRWGVLHAGIDIA
NSIGTPIYAVADGVVTDAGPTAGYGAWVKIRHADGTVTLYGHVNTWLVKP
GERVMAGDQIATIGNRGQSTGPHCHFSVLLNGTDYIDPVPWLAKRGLSPG
SYVG
392418053YP_006454658.1 succinyl-CoA synthetase- beta subunit [Mycobacterium chubuense NBB4MDLFEYQAKELFAKHNVPTTPGRVTDSAEDAKAIAEEIGRPVMVKAQVKT
GGRGKAGGVKYAATPDDAFSHAQNILGLDIKGHVVKKLLVAEASDIAEEY
YISFLLDRANRTYLAMCSVEGGVEIEEVAATKPDRLARIPVDATTGVDET
FAREIAEKGHLPAEVLDAAAVTIAKLWEVFVAEDATLVEVNPLVRTPDDQ
ILALDGKVTLDANADFRHPEHAEFEDRDATDPLELKAKENDLNYVKLDGA
VGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDG
NNVEEGRRILAEANHPLVIQADTMDSGADKAAELANK
392418052YP_006454657.1 succinyl-CoA synthetase- alpha subunit [Mycobacterium chubuense NBBMSIFLNKDSKVIVQGITGGEGTKHTKLMLKAGTQVVGGVNARKAGTTVKH
ENSDGQEVELPVFASVAEAMKETGADTSIAFVPPAFSKDAIIEAIDAEIP
LLVVITEGIPVQDTAYAWAYNVHKGEKTRIIGPNCPGIITPGESLVGITP
NNITGKGPIGLVSKSGTLTYQMMYELRDLGFSTAIGIGGDPVIGTTHIDA
IEAFEKDPDTKVIVMIGEIGGDAEERAADYIKANVSKPVVGYVAGFTAPE
GKTMGHAGAIVSGSSGTAAAKKEALEAAGVKVGKTPSETATLAREIFESL
392418051YP_006454656.1 transposase- IS30 family [Mycobacterium chubuense NBB4]MGCRGPGRARLPESVRERFWAAVAAGLSPTAAATVAGVHGATGRHWAQQA
GYRGESKHFGIRYTAQQRAVFWTAVRSAVPPAQAAVVAGVSEAAARRWLQ
QADHVPRTPFPAEADLVAESELTSRVRAPLRFVERCRLEQLLEHGYPPAQ
AAALMGRHKDTINREIARGQTRSVYRASMGQDVADAARKRPKVRKLEANP
GLRAEVLQRLETRNSPEQIAGRLRQDFPDDPEMWVSHETIYQAVYVQPRG
ELAKELKSALRTGRIKRKPQGRNEIADRNRFKAGMVGISERPAEADDRAI
PGHWEGDLIMGAGNTSAIGTLVERTTGFVMLLHLPGDHTATTVAAAMTAK
VPEIPAILRRSLTWDQGTEMAMHTNITEATGLPIYFCDPHSPWQRGTNEN
TNGLLRQYFPKGTDLAFWGPGFLDQVAAELNARPRKRHNWRTPAEELDRL
LSDPSTYVAATA
392418050YP_006454655.1 hypothetical protein Mycch_4262 [Mycobacterium chubuense NBB4]MARGAHPQRTVFYGACLLAAAFLSCWVAARVHIVWVSALIYVAAAVATCV
GLVMTLRDYG
392418049YP_006454654.1 hypothetical protein Mycch_4261 [Mycobacterium chubuense NBB4]MRIDPRTPVVVGVGQFTERIDDPDYRGMSAVDLATAAAQAALADTGADAT
AVAGAVDTVYGLRQFEISGPMPATLGKSNNYPRSVMRRLGGDPRRVVLEP
VGGQGPQKLVTEAGDAIVAGNADVVMIMGSEPGSTAKYFANRDDKPDFTE
HVDGQLEDRGHQIYSYIDEYTVQHGLTGAPVQYGLLENARRARLGLGVAQ
YRQAMAELFAPMSKVAAKNPFSSSPVERSVEEIETVTDENRMICDPYPRL
LVARDTVNQGAAIVLTSVESARKLGVPEEKWVFLHGHSDLVEQPLLDRVD
LGASPAAAHAAHEALRVAGLGVADIATFDLYSCFPFPVFVICEALGLSGD
DPRGHTLTGGLPYFGGPGNSYSVHGIAETVAQMRDRPGRFGFVGANGGIM
SKYSVGIYSTEPAQWRTSRSAELTARVAELPTVRVTKTPEGAGSVETYSV
RYDWPVRTGIIVGRLDADGSRFMATTDDADLVGLMSDGDPLGAKISVTPT
ENGNRAVLR
392418048YP_006454653.1 hypothetical protein Mycch_4260 [Mycobacterium chubuense NBB4]MRNGRIRRRAGTTIMLISLLSACSPAVEQAAASPPTPDFPDLSGYTPVDT
QEYMQSYPYFRGFDLVTPDGQQCNHNAMNSLGDPSRMTLTCDGPRPDQGP
GTWEVRVATDQAATIEQTEPLDPSYPADPSMRPKQLPAMHKITYQSIECG
ADATGMTACRVGDHGFVLTPTSTHLF
392418047YP_006454652.1 hypothetical protein Mycch_4259 [Mycobacterium chubuense NBB4]MQPRRSFRILAGAMLTATAMTACSTSKEAAPQDASTSPTTPATGAPLSVA
PAGGEFPDMSGYTEGDHRTFFSGGQRYFGIAFRSPDGQKCVSNSYRSVDD
TSLRCWGPRPDKGPGTWEVKTEAGTATTIRQLQDPTPTTPPGADPTPILP
ARHVLTYPEAHLVCGVDEQGATACLLGDHGFVLAPTSTELF
392418046YP_006454651.1 hypothetical protein Mycch_4258 [Mycobacterium chubuense NBB4]MSISMIRAQNPQGVVDAGTELSGKAAALDGLIGEQVRAVNRLRQSWFGRA
ANAAVARAYRDIQRQHLQHELIQARADALSAGGAGMVAGRSVVLAWVAIA
RSMFDVSDAGVVTPRPPNDTAPWVAIAACYTTIIQQLIQTFLHLDGQLAG
TLAAIARGDIPGNDPAPAGGFGPGIDPDGFNNGQLTFHQQMAGFGDAETG
AGGVGVPNTDLSIMGMTPDGRMFTIQGDTGVGMNPDTNGGPGARPPDGGN
NSILYWKMDEHGKWVVDEVVKNPFPSQLGPGGKADISTIPTSTFNVGDTM
YASVMNVDHWNGPPGQRPPGESGWVSRSSELWKSSDNGRTWARTSAVWRN
DVDAPNNPFQVQSFAPADDGYVYMYGTADGRTNDGLHMARVPAQYVGDTS
QYEYWNGTAFDHNQAQNSSPAVVQTPSGVSGIGEPNVHFYDNKVLLTFND
ENGGVYTSSSTDGGVSWTDPTRVVSRGGVYGVFQSPFSGGDSIGATLSLW
NPYGTALYEIENQDTRNLGAY
392418045YP_006454650.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMDFGLVLFTSDRGIAPAAAAKLADEHGFTTFYVPEHTHIPIKRQAAHPTT
GDETLPDDRYMRTLDPWVSLGGAAAVTARVRLSTAVALPVEHDPITLAKS
IATLDHLSGGRVSLGVGFGWNTDELADHNVPPGRRRTMLREYLEAMRALW
TQEEAEYDGEFVKFGPSWAWPKPVQSHIPVLVGAAGTEKNFKWIAKSADG
WITTPRDFDIDAPVKLLQDTWAAAGRDGAPQIVALDFKPDPDKLARWREL
GVTEVLFGLPDKSEADVAAYVERLAGKLNALV
392418044YP_006454649.1 hypothetical protein Mycch_4256 [Mycobacterium chubuense NBB4]MVTAISRRAKLREWVRRYLPCEIAGTAGEFGAAAVAYVVTESLAVAAVTA
TVGASVGYYAAAYISALRWSYRDQRWRPVPARLAVANLLALRSVAVEFGP
AELIDSVAVRPVSFYLGPALFGDVLAGWAVGKVVSDAAFYSCAIVSYERF
TTLLAHRPLEKGEDRGHPTTVSAA
392418043YP_006454648.1 diaminopimelate decarboxylase [Mycobacterium chubuense NBB4]MDTRRRSQLRDELRVRAGRLSDLAATHGTPLLVLEPHLVARRLRRLHDAL
RGFELHYAVKALPHPLVLSTVAICGGGFDVATRGEVDLLQRLGLPISRCI
HTHPIKKPADLDHAYAAGVRTFVVENAAEAQKFCGRPSDVEVLVRLAFRN
PAAKSDLSSKFGVAPAEAELMVKHVLAAGVQFAGFTFHVGSQSSSVEPYR
RALQQTLDLITQIDHALGVRTRVIDIGGGFPVSYRDPEPPVEEVGAIVDE
VLGQDRDEFTLLAEPGRFLAADCMTLLTSVVGTALRDGRVWHYLDDGVYG
SYSNVMTEDVHPPILALSELEGRDVALEPVTLAGPTCDSADVVARDYPMP
VLRLGDLVVSPMMGAYTSVTASSFNGIAPTPIVMA
392418042YP_006454647.1 hypothetical protein Mycch_4253 [Mycobacterium chubuense NBB4]MSYPQGPTGGPGYPPGQQPTTQFNAPTQQFGKVGESEPAAEGPSKLPGYL
SAAVAVLGLLAYLAFFAPQFTVNSSDFPGLGELSGSSTGLELAVVSAVVA
ALFAGIGLLPKQRSYTAVAAVFSVVAFLIVIAEVINKPSATTVDWGLYLL
IAFTLLQAAVAVVVLLFDSGIITAPVPRPKYDQSHQYGQYPGAYYGQHPG
QAQGQHNAPGHQQGPQQQRPGYPTPYTGSGGYPSTGPSTGGFPPVAPSGP
PTPPTGFPTYGQPPSSSNAPTTQVPTQHQQQSPSSQSDQSSS
392418041YP_006454646.1 hypothetical protein Mycch_4252 [Mycobacterium chubuense NBB4]MNSPSRARGAPRGAGGTRQARELLRVAFGPSVVALVLVAAVVLLQLLIAN
SDMTGALGAIASMWLGVHQVPVSIAGSALGVMPLLPVLAMVYGTSRTTAA
ATTSTSWFVTRWVVASALGGPILIAALCLAVVHDAASVITQLQTPDALRA
FGGVFVVHAIGAAVGVGSRVGRRVLYASPLPNWLPDAVRAAAAGVLALMG
LSGAVVAGSLIVHWSTMHELYSITDSVFGQLSLTVLSVLYVPNVMVGAAA
VAVGSSAHVGLATFSPFTVFGGDVPALPVLAAVPTPPLGPVWVALMIVAA
VSAVALGQQCARRRLPLLSALAKVVVAALLAAATMALLGFAGGGPLGNFG
DVGVDQATFAPAAFLWFAGIGGLTVVMSGGVAPRVRRPVAEPEPEPEDED
GDEPVTVDFDTAQAGADPEPGPVAAPSAERGAPASELDPEEHFVVDEPTS
SSVVDEEVRGGRQGSTD
392418040YP_006454645.1 phosphoribosylglycinamide formyltransferase- formyltetrahydrofolateMQPAVRVPPSAPARLVVLASGTGSLLASLLDSAVGDYPARVVAVGTDRVC
AALDIAAAASVPTYTVPLREYPDRSAWDAAITEATAIHNPDLVVSAGFMK
ILGPEFLSRFPGRVVNTHPALLPAFPGAHAVADALAYGVRVTGCTVHLVD
AGTDTGPIIAQQAVSVLDDDDEATLHERIKVIERQLLVDVLAALATRGVT
WTGRKATMG
392418039YP_006454644.1 phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cycloMSDNEGRRRIRRALISVYDKTGLVPLAEGLHAAGVAIVSTGSTAKTIAAA
GVPVTPVEDVTGFPEVLDGRVKTLHPRVHAGLLADQRKPEHVSALEELGV
EAFELVVVNLYPFTQTVNSGAGVDECVEQIDIGGPSMVRAAAKNHPSVAV
VVDPLGYDGVLAAVRAGGFTLTERKTLASLAFRHTAEYDVAVASWMGSVL
APEGEAASAALPPWFGATFRRAAVLRYGENPHQQAALYSDEGAWPGLAQA
EQLHGKEMSYNNYTDADAAWRAAFDHEDICVAIIKHANPCGIAVSSVSVA
DAHRKAHECDPLSAFGGVIAANTEVSVEMAQTVAGIFTEVIIAPAYEPGA
VEVLTGKKNIRVLVASEPQPGGTEFRQVSGGLLIQQRDALDAAGDDPVNW
TLATGSPADPAMLADLVFAWRTCRAVKSNAIVIARDGATVGVGMGQVNRV
DAARLAVERAGDRTRGAVAASDAFFPFPDGLETLIASGVRAVVHPGGSVR
DDEVTAAATAAGITLYLTGARHFAH
392418038YP_006454643.1 Mg-chelatase subunit ChlI [Mycobacterium chubuense NBB4]MVTSPNDLPRTVGELRASGHRERSVKAEIRENLLAALSSGADAEQVWPGI
LGFEDTVIPQLERALIAGHDIVLLGERGQGKTRLLRALSGLLDEWTPVIA
GSELGEHPYSPITPESIRRAADSGDDLPVAWKHRSERYTEKLATPDTSVA
DLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDLAERIQV
AMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPIKDRFG
AEIRTHYPLELDAEVGVITQEAHLAAEVPGYLLAILARFARSLRESSSID
QRSGVSARFAIAAAETVAASARHRSAILGEQEPVARVVDLATVIDVLRGK
LEFESGEEGREQAVLEHLLRRATAETAQRLLGGIDVGPIVTAVENGSPVT
TGERVSAREVLAALPEVPAVAEIQRRLGASSEGQRAAAIELALEALYLAK
RIDKVSGEGETVYG
392418037YP_006454642.1 uncharacterized protein with a von Willebrand factor type A (vWA) dMAKHSHFSRYSRYTGGPDPLAPPVDLREALEAIGQDVMEGTSPRRALSEL
LRRGSKNMPGADKLAAEANRRRRELLQRNNLDGTLADIKKLLDEAVLAER
KELARALDDDARFGELQLDSLSPSPAKAVQELSEYDWRSQEAREKYDQIK
DLLGREMLDQRFAGMKQALENATDEDRQRVSEMLDDLNDLLDKHAKGEDT
QQDFQNFMDKHGEFFPENPQNIDELLDSLAQRAAAAQRFRNSLSEQQRAE
LDSLAQQAFGSPSLMNALNRLDAHLQAARPGEDWTGSQRFSGNDPLGMGE
GAQALADIAELEQLAEQLSQSYAGASMDDVDLDMLARQLGDEAAVNARTL
SELERALMNQGFLDRGADGQWRLSPKAMRQLGQAALRDVAEQLSGRRGER
DTRRAGAAGELTGATRPWQFGDTEPWNVTRTLTNAVLREAGTGERAGAIG
ITVDDVEISETETRTQAAVALLVDTSFSMVMENRWLPMKRTALALNHLVS
TRFRSDALQIVAFGRYARTVTAAELTGLEGVYEQGTNLHHALALAGRHLR
RHPNAQPVVLVVTDGEPTAHLEDFDRNGSPAVFFDYPPHPRTIAHTVRGF
DEIARLGAQVTIFRLGSDPGLARFIDQVARRVSGRVVVPDLDGLGAAVVG
DYLNSKRRR
392418036YP_006454641.1 protein of unknown function (DUF1707) [Mycobacterium chubuense NBB4MPKLSMSTPASRNGSMRAADTDRIQTAQLLTDAAASGKLGVNEYEDRLTR
AYAAQTYEELDRLSADLPGAVTRGRSGPCRPAPSSLLLAILSGFERRGRW
NVPKRLTTFALWGGGVVDMRYADFTAHDVEIRSYSIMGGQTILVPPEVNV
DLHGKGVMGSFDHTVDGEGSPGAPCVRISGFSLWGSVGVKRKKRKGS
392418035YP_006454640.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMDPLVRYEADGPVARLTLDSPHNRNALSTALVEQLHDGLTQASAERDIRV
VVLGHTGGTFCAGADLAEAAGRDPSELALERARDMTRLLRRILESRLPVI
AAIDGHVRAGGLGLVGACDMAVAGATSTFALTEARIGVAPSIISLTLLPK
MTARAAGRYFLTGEKFGADTAAEVGLITVAADDVASTVAELASAVAQGSP
QGLAASKALTTASIIDDFDRRAEKLTQESAALFVSEEAREGMLAFLQKRP
PSWRS
392418034YP_006454639.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTTNGFIETTEQQALRKAVAAMAANYGQDYYLEKARAGRHTDELWAEAGR
LGFIGVNLPEEYGGGGAGMYELSLVMEEMAAAGSALLMMVVSPAINGTII
SKYGTEDQKKRWIPGIADGTITMAFAITEPDAGSNSHKITTTARRDGSDW
VLTGQKVYISGVDQAQAALVVGRTEDHRTGNLKPALFVVPTDTPGFTYTK
IPMEIVSPEFQFQVFLDEVRLPADALVGSEDAAIAQLFAGLNPERIMGAA
SAVGMGRFALTKATEYVKTRQVWKTPIGAHQGISHPLAQNHIEIELAKLM
MQKAASLYDAGDDAGAAEAANMAKYAAGEASVRAVDQAVQSLGGNGLTKE
YGIASVLTASRLARIAPVSREMILNFVAQTSLGLPRSY
392418033YP_006454638.1 acetyl/propionyl-CoA carboxylase- alpha subunit [Mycobacterium chubMITRVLVANRGEIARRVFATCRRLGVGTVAVYTDPDADAPHVAEADARVR
LEGTRGYLDAAQLIAAATAAGADAIHPGYGFLSENADFAAAVQEAGLTWI
GPPVAAVAAMGSKIEAKKIMAAAGVPVLDELDPDTVTADMLPVLIKASAG
GGGRGMRVVRDVSELPAQVEAARREAQSAFGDPTVFCERYLDAGHHVEVQ
VMADAHGTVWAVGERECSIQRRHQKIIEEAPSPLVERVAGMRDKLFEAAR
LAATAIGYTGAGTVEFMADDSGAFFFLEMNTRLQVEHPVTELTSGLDLVE
LQLAVADGAPLDPAPPGSRGVSIEARLYAEDPAKNWQPQAGPVHHFDVPT
AVTRFGPMDRSGVRLDAGVGDGSVISVFYDPMIAKVISYAPTRRQAAAML
ADALTRTRLHGVRTNRDLLVNVLRHPAFLAGDTDTAFFDTHGLPQLATAV
VDADAAALSAVAAALADAAHNRTTATVFRAAPSGWRNLASGFQTKCYDDA
DGRRHEVRYRFTRAGVTIEGRDDVALVSATPDRVVLTVGAQRREGPRVDR
PYDVTRYGDAVFVDSPSGAVHLTALPRFPDPDSALAHGSLVAPMPGSVLR
VGAAVGDAVSAGQPLIWLEAMKMEHTIAAPADGLVAELNVTAGQQVEVGA
VLARVDSGEGE
392418032YP_006454637.1 acetyl-CoA carboxylase- carboxyltransferase component (subunits alpMTLKSLLDTRSPAYLEAAETMAAKLAELDTEHAKALAGGGEKYVSRHHAR
GKMTARERVEALLDPDSPFLELSPLAAWGTDFTVGASVVVGIGAVSGVEC
LLVANDPTVKGGTSNPWTLRKILRANQIALQNRLPVISLVESGGADLPTQ
KEIFIPGGQMFRDLTRLSAAGIPTIALVFGNSTAGGAYIPGMSDHVVMIK
DRSKVFLAGPPLVKMATGEESDDESLGGAEMHARTSGLADYFAVDELDAL
RIGRRIVARLNWCKQGQSPKPFTEPLFDEGELIGIVPPDLRIPFDPREVI
ARVVDGSEFDEFKPLYGGSLVTGWATLHGYPLGILANARGVLFSEESQKA
TQFIQLANRSDTPLLFLHNTTGYMVGKDYEEGGMIKHGSMMINAVSNSTV
PHISLLIGASYGAGHYGMCGRAYDPRFLFAWPSAKSAVMGGTQLAGVLSI
LGRAAAEARGQQVDEAADAALRAAVEAQIEAESLPMFLSGRLYDDGVIDP
RDTRTVLGMCLSAIANGPIKGTSNFGVFRM
392418031YP_006454636.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MSIWTTPEREALRKTVRAFAEREVLPHVDEWEHVGELPRDLHRKAAQAGL
LGAGFPESVGGDGGDGADAVVICEEMHQAGAPGGVFASLFTSGIAVPHMI
ASGDERLIDTYVRPTLRGEKIGSLAITEPGGGSDVGHLSTRAEFVSDGDG
PYFVLNGAKTYITSGVRADYVVTAARTGGPGAGGVSLIVVEKGTPGFEVS
RKLDKMGWRSSDTAELSYTDVRVPVANLVGAENTGFLQIAAAFVSERVGL
AAQAYSSAHRCLDLTVEWCRNRETFGKPLIARQSVQNTLAEMARRIDVAR
VYTRALVERQLSGDANLITEVCFAKNTAVEAGEWVANQAVQLFGGMGYMA
ESEVERQYRDMRILGIGGGTTEILTSLAAKTLGFQA
392418030YP_006454635.1 Protein of unknown function (DUF1446) [Mycobacterium chubuense NBB4MTQDRDHDVPVRIGNCSGFYGDRLSAMREMLTGGELDVLTGDYLAELTML
ILGRDRMKHPDRGYARTFLRQLEDCLGLAVDRGVRIVANAGGLNPAGLAD
AVRALADKLGIAVTVAHVEGDDLLPRCEQLGLGTPLTANAYLGAWGIVDC
LESGADVVVTGRVTDASVIVGPAAAHFGWQRTDYDRIAGAVAAGHVIECG
TQATGGNYSFFTRDFPDLTALTHPGFPIAEIHADGSSVITKHPGTGGAVT
VGTVTAQLLYEIGGARYANPDATLRVDSLELSGDGVDRVRIAGGRGEPPP
PTLKVSLNSLGGFRNEMTFVLTGLDIDAKAELVRHQLESSLAVRPAELEW
SLARTDHPDADTEQTASALLRCVVRDADAATVGRQFSSAAVELALASYPG
FTSTAPPGDGQVYGVFTAGYVAAEEVPHVAVHADGTRVDIPPPSTTSELR
PVTEAELPEPGSFGPTRRVPLGVIAGARSGDKGGSANVGVWVGTQGQWTW
LAHTLTVDKLRELLPETAELPVSRHVLPNLRALNFVIDGILGKGVAYQAR
FDPQAKGLGEWLRSRHVDIPEELL
392418029YP_006454634.1 LSU ribosomal protein L32P [Mycobacterium chubuense NBB4]MAVPKRRMSRANTRSRRAQWKATRTDLVGVTVAGQQHKVPRRLLKAARLG
LIDLDRR
392418028YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix MRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVL
DVMMPRVDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLP
KPFALEELLARMRALLRRTVPDDGAESAAMTFSDLSLDPVTREVTRGNRP
ISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYL
RRKTEAEGEPRLIHTVRGVGYVLRETPP
392418027YP_006454632.1 signal transduction histidine kinase [Mycobacterium chubuense NBB4]MTNRHDMRWPVPIAPPTSSVSLRWRVMLLAMSMVVMAVVLMALAVYAVVS
RALYDEIDNQLHSRARLLIESGSLTVDPGKAIEGTAYTDVNAMFYIPGRL
TFKTNQQDQAIPIGGPEKEVMEGKLLMSLRTVSNQRVLALHLSDGSSLLL
SKSLGPTGEVIKRLATVLLIVGGIGVAVAAIAGGMVASAGLRPVARLTQA
AERVARTDDLRPIPVFGNDELARLTEAFNMMLRALAESRERQGRLVADAG
HELRTPLTSLRTNVELLMASMKPGAPRLPEGEMADLQADVIAQIEEMSTL
VGDLVDLTREDAGGVVHETVEMGEVIERSLERVRRRRNDIDFDVAVTPWQ
VYGDASGLARAVLNLLDNAAKWSPPGGRVGVRLTQIDPLHAEFVVSDSGP
GIPPQERGLVFERFYRSTQARAMPGSGLGLAIVKQVVLKHGGTLAVAETA
PGGQPPGTSMHVVLPGRPSPAEAATRAG
392418026YP_006454631.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMTNHPRYSPPPQPGHQPGTHGHMPQGQPAPQRSGSFEQQAYDWRYATEQQ
RQAFRSPYDPYQGAPMPGGPGQYPQPGMPAPQAPRKRSRAGALTAGAVAV
AIVSGGIGGGVAMLVHPDHGAPGFSASGAAPSVPAASLPAGSVEQVAAKV
VPSVVKLEVDEGRQSEEGSGVILSTDGLILTNNHVVASAASNAPAGPGGP
QTKVTFADGRTTSFSIIGTDPGSDIAVVRAKNVSGLTPIAVGSSAGLRVG
QDVVAVGSPLGLEGTVTTGIISALNRPVAAGGDAQNQNTVLDAIQTDAAI
NPGNSGGALVNMKGELIGINSAIATMGADSGAAQGGSIGLGFAIPVDQAK
RIADELIQSGSASRASLGVQVGNNSGGDGAQIVEVTPGGAAAAAGLPNGV
VVTKLDDRVIDSADALVAAVRSKAPGDKVTLTFLDPSGKSQSVDVTLGKA
TQ
392418025YP_006454630.1 molybdenum cofactor synthesis domain protein [Mycobacterium chubuenMRVSEGMTGPRLRVAASMSGPGYTVVPMEQPHALVGRALVVVVDDRTAHG
DEEDHSGPLVTELLAEAGFVVDGVVVVSSDEVEIRNALNTAVIGGVDLVV
SVGGTGVTPRDVTPEATRDLLDRELLGISEALRASGLSAGNIEAGVSRGL
AGISGSTLVVNLAGSRAAVRDGMAMLGPLAAQIIAQLSSLEI
392418024YP_006454629.1 MspA protein [Mycobacterium chubuense NBB4]MRRPAGVPFTEARENMKAISRVLVAMVAAIAALFVSTGTSHAGLDNELSL
VDGQGRTLNIQQWDTFLNGVFPLDRNRLTREWFHSGKAMYNVTGDGADDF
EGTLELGYQIGFPWSLGVGINFSYTTPNVALDAQDVVTTTGIDLFPPIST
PPLFPGVSISADLGNGPGIQEVATFSVDVKGPHGAVAVSNAHGTVTGAAG
GVLLRPFARLISSSGDSVTTYGEPWNMN
392418023YP_006454628.1 MspA protein [Mycobacterium chubuense NBB4]MKAISRVLVAMVAAIAALFVSTGTSHAGLDNELSLVDGQGRTLNIQQWDT
FLNGVYPLDRNRLTREWFHSGKAVYNVTGDGAKDFAGTLELGYQIGFPWS
LGVGINFSYTTPNVALDAQDVIGTAVGPIDFFPPISTPPLLPGVSISADL
GNGPGIQEVATFSVDVKGPHGAVAVSNAHGTVTGAAGGVLLRPFARLISS
SGDSVTTYGEPWNMN
392418022YP_006454627.1 MspA protein [Mycobacterium chubuense NBB4]MRILIRVMATLTLGVAALFGSSAVSHAGLDNQLSLVDGQGRTLNIQQWDT
FLNGVYPLDRNRLTREWFHSGKAVYNVTGDGAKDFAGTLELGYQIGFPWS
LGVGINFSYTTPNVALDAQDVIGTARGPIDLFPPISTPPLFPGVSISADL
GNGPGIQEVATFSVDVKGDHGAVAVSNAHGTVTGAAGGVLLRPFARLISS
SGDSVTTYGDPWNMN
392418021YP_006454626.1 hypothetical protein Mycch_4232 [Mycobacterium chubuense NBB4]MAEHAPSTARRLAVSFGMGVSALAAAASLMTFGVGTASADDLVPDPSVAG
NGREPDGAVRESATQGDVRSAGMGEAVSPAGSGDVRGSNKAAPGTKAWVF
PGASGDISACVYSGPWCANWMAIPFDLNNP
392418020YP_006454625.1 large conductance mechanosensitive channel protein [Mycobacterium cMLKGFKEFLARGNVIDLSVAVVIGTAFTALVKSFTDSVIQPLIDRIGASP
GKEYGFLKIPLGADKFVDFNAVLSALINFLIVAAVVYFIIVLPYKKLRER
GEVEQAQDTELSLLTEIRNLLAETNGEASGKHVSGPGTGPSPDTATHTSA
TRE
392418019YP_006454624.1 hypothetical protein Mycch_4230 [Mycobacterium chubuense NBB4]MKKFTLSTVAAAALTAAVLGLAAPALAAPTAGNAADTISALEAGGNRVVV
TRQSAAPLDEASVVSITRGPIMRQAIPHATSNGDHTLSVSGQTIYVTVK
392418018YP_006454623.1 flagellar basal body P-ring biosynthesis protein [Mycobacterium chuMGESLDPSPWSRLTRALRPDWSRTVAARRILAGALVVLAAAAALRDDPRD
AQSDVVVAVRDLAPGVELTADDIGVQTRAAPTIPEGAATQLDAVVGRTLA
GATRRGEVLTDVRLLGPRLAGSAAGPDARIVALPLADAALLDLVRPGDVV
DIVAAPQSADDEAQTRVIATNAVVVLVSQKDSGIASRGGNRVVLVALPAA
AAKTVAGAALVQAVTLTLH
392418017YP_006454622.1 putative regulatory protein- FmdB family [Mycobacterium chubuense NMPTYSYACTECDNKFDVVQAFTDDSLTECPQCRGRLRKVFGKVGVVFKGS
GFYRTDSRESGKTSSSSGSSSSSESSSSTAEKSSSSDKTSTSSSSSSSSS
APAAAASS
392418016YP_006454621.1 5-10-methenyltetrahydrofolate synthetase [Mycobacterium chubuense NMQRTKSQVRTEILASRRTLTAERHDAEAAALARHLSASILDGQTVCAYVP
VGSEPGSVEMLDALLLRGAAVLLPIAREDPGGAPLPLRWARYRPGGLVAA
PFGLREPPPPWSPAERLAEAAVVLVPALAVDRHGVRLGRGAGFYDRTLPL
ADPAARLVAVVRDEELVDRLPSEPHDVRMTHALTPRAGLLALGAGAGE
392418015YP_006454620.1 UDP-glucose pyrophosphorylase [Mycobacterium chubuense NBB4]MNRPDVPTPHTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEA
AEAGAERLIIITSEGKDGVVAHFVEDLVLEGTLEARGKNAMLEKVRRAPA
LIKVESVVQAEPLGLGHAVSCVESSLSPDEDAIAVLLPDDLVLPTGVLET
MSKVRAKRGGSVLCAIEVDKADISAYGVFDVEPVPDAANPNVLKVKGMVE
KPKAEDAPSPYAAAGRYVLDRAIFDALKRIPRGAGGELQLTDAIALLIEE
GHPVHVVVHRGSRHDLGNPGGYLKAAVDFALERDDYGPELRRWLVERLGL
APATTEN
392418014YP_006454619.1 molybdenum cofactor synthesis domain protein [Mycobacterium chubuenMRSVEEQQARVAAAAVAPRPVRVAIAEAQGLMCAEEVVTERPLPGFDQAA
IDGYAVRSVDVLGIGGGGDADEGPDDGADEREELRHRDISLPVMGLIEAG
ARTPSRLQPRQAARVQTGAPMPTLADAVLPLRWTDGGESRVRVLRGVRSG
AYVRRTGDDVQPGDVAVRAGTIIGAAQVGLLAAVGRERVLVHPRPRLSVM
SVGGELVDISRTPGNGQVYDVNSYALAAAGRDAGAEVNRVGIVPSDPKQL
REVVEGQLNRAEVVVIAGAVGGVAAEGVRAVLGQLGDMEVTRIAMHPGSV
QGFGQLGADGVPVFLLPANPVSALVVFEVMVRPLIRLSLGKRQPMRRVVR
ARALSPISSVPGRKGYLRGQLMRDQDTGEYLVQALGGAPGASSHLLATLA
EANCLVIVPGEAEQIRTGEVVDVAFLAQRG
392418013YP_006454618.1 acetyltransferase- ribosomal protein N-acetylase [Mycobacterium chuMNLLSSRSQHPGWPSPVGPLRVPAGLVRLRPVRLRDAATWSRIRLADRAH
LEPWEPSTELDWEVRHAVSSWPSVCSGLRSEARKGRMLPYAIELDGQFAG
QLTIGNVTHGALRSAWIGYWVASASTGGGVATAALALGLDHCFGPVLLHR
VEATVRPENAASRAVLAKAGFREEGLLKRYLDVDGAWRDHLLVAITIEEL
KGSVSSALVRAGHASWA
392418012YP_006454617.1 hypothetical protein Mycch_4223 [Mycobacterium chubuense NBB4]MPSIPQSLLWISLVVLWLFVLVPMLISKRDAVRRTSDVALATRVLNSGAG
ARLRRRGGPAAGHRSDPDWQPSGDDLDADLDEREDETPGRSVVMVAADPA
EAGDEPDYLDVDVVEDSGALPLAAAQEEPVAAETADPTPDHSEADADEHD
DAEETAPAAEADQATDDDYEYVDDSSGLEAPSDTDLRIADSITESRRRRR
ESVTAAAVSARKYRFRARTLTVMGVLILSSAVAAFTWSSSMWWVCGSIGV
VTALYLAYLRRQTRIEEQLRRRRAQRIARSRLGVENTSDQEFDVTPSRLR
RPGAAVLEIDDEDPEFEHLDYVAFARHYDLPRAAGQ
392418011YP_006454616.1 putative NTPase (NACHT family) [Mycobacterium chubuense NBB4]MEPTVVGAAAYGAVRVFSACSRGVQDANNSVAFAKRKYRLAGTYDVAWLD
SDFAPSASEDGFTAEQIGDVGKFLTSDGVRPYLSLLAVACLTDEPDTSLI
IQVKNGLSNEARKWNGARKKSWLKFADRIWDRLLELHQEVLPTVGPGAAY
ADDITYFEDFINTPLQRQASAPGGHTARFVKHLVNIGSDVERLRTAFDAT
TSVASHMSATALDPIITHTDTGKGTSADFELLYVDRSFVNYDDGRPLDSS
LIAAGNTPFRLMVTGAPGAGKTTYLQHFRHRYCAEQARPVFVVRCREYAA
INWDRTSLVDFALDRYNSEYSDDMEPSTIRDILALGRGALVLDGLDEVID
PLRRIDLSKRINALASLFPLASILITSREVGYDRAPVDARIFARVELKEF
ELDQALIYVKKWFKLVDKPQLTDAFIHDSEQVADIRLNPLMLSLLCLLYR
ESGSIPSRRLDIYEECARLLFKRWDSHRRIMVDGAIPDFSDLLMQEIARW
YYTSPSAQGGLDETVIRGMLKHILVDQSGFPGNRAEEAAADFLEFCAGRA
WLLGVTGSNDRGERLFSFTHKTFSEYFAAESFAINARDDADICTRIINTF
TNDSSSVLPELLIQSYGKHSSQGAVRVLRKLVEDGAPTLLLLRLVEGTKL
PAWAREQVFTQLQATWIFGAPNKAEFLALLQLNALAREQWVTGDLTENRQ
LREIFLSGWADVVLSGTSDRYASRWAESIQQLTAMTDIRELAGRDSSIWT
WQVLEGDSVLPATETSHMFSCEGSFGVSPGLIWYGVERRLRYGKPPLNEK
FVLECIRDAVTQIERRQGVESSLLRLVYALLLRGSSQTDWTVRWSGDLND
SPEFALFTYIALGLYEWAPEGRVKDRVSSLWDGALRELVQVRSAHLAGKK
PSPEILAQAVRVLRALPERAALWTVGRQDLVVWDTPDWEDELLFPRRS
392418010YP_006454615.1 putative esterase of the alpha/beta hydrolase fold protein [MycobacMRARLTILAAVVTALVGTSPATAHAEVDDGAGTGARVAVLAGAFDKPERT
MQQLHGSLCAPPNVCEPLNYMNLGNLGPTIGGASLDDGDAKLDQWVRSTP
GKKVVFGHSLGSSVIFKWLREHSFDPSAPPPSDLSFVTTGAPERRGTGYV
WTDPEGKNRWRAGQGFGIPANTPYKVVDICRKWDGFCYFIPGDQRSIDGQ
MSKRHTDYSQIDVNDPANQVNVEGNVTEVLVPTPGLG
392418009YP_006454614.1 hypothetical protein Mycch_4218 [Mycobacterium chubuense NBB4]MSTTKPNLWQYITYAYGRRLPDSMQRWVAEDLAGQGAVRRHMIRCAIPPL
FVLAPFWLIPVSLYMHMEMTAPIYIWAVLMALALNKPWRRHRLAQHGLDP
NLVDVIKRKKQARMHEDYVRRFGPRPEDAKSQSNSSPF
392418008YP_006454613.1 transcriptional regulator [Mycobacterium chubuense NBB4]MAAPVRDVDPLALEQQVCFALAVTNRAVLAVYRPLLEPLGLTHPQYLVML
ALWDHLKASDGVASPLSVKQIAASLQLESATLSPMLKRLAALGLITRSRN
ATDERSTDVSLTDKGIALRERALEIPPAVVARLGVDLVELEQLHQVLTRV
NAAALAAGALQS
392418007YP_006454612.1 cyanate permease [Mycobacterium chubuense NBB4]MTPPVQVEQRRRRDIALLLIGILAVSVNQRPALVAVGPLTDQLRRDLNLG
ASAASLLTTLPLLCFGVFALAAPALGRRTGMDRAVVAAGIVLIVGIAIRT
APPVPALFVGSAVAGAGIAVMNVLVPAVIKRDFPARLGLVTALYTVMLNG
GAALAAGATAPLGHLLHLGWRPTLALWGVLAVAAALLWAPQARRAPAVEP
TVTAAHPIRLWRNGLAWAVSMFMGLQSLLFYSLIAWVPTILHDDGLTEAQ
AGFWLAVLTGAGIVASFAVPLIAARQAMQRPLVIATAALFLTGLAGLIVS
PTGLVWLWMLCLGVAQGAGISLAMMMFVHRARDSETSAELSGMAQAVGYL
VAAAGPLAAGALRDVTGGWALALALLAACAAALLVTGWIAMADRTVDA
392418006YP_006454611.1 hypothetical protein Mycch_4215 [Mycobacterium chubuense NBB4]MIQGRKCQKGSPDVRTLITGVDAQGKSCVVSHDDVALDQLAPGFAMGIPF
ATTTSPPPARPGGAAPLIDQGIAPGLVRWMVVDLGPDSETPTHHTDTLDL
QTVMSGSVELILDDGAHRLHQGDLVVLTGVDHAWRAGPQGCRLSAILVGT
PPPGL
392418005YP_006454610.1 acetyltransferase (GNAT) family protein-cyclic nucleotide-binding pMSGLTAVGAAELAALDVFAGVAVEALVPLAEQLRPLSASAGQVLMQQGEL
AVSFLLIGSGTAEVTHAGIDGHDTVAALTPGLIVGEIALLRDAPRTATVV
ATEPLSGWVGGREAFATMLEVPGMMDRLVRTARQRLAALITPIPVEMRGG
IELYLRPVLPGDNERTANGPVEFSSETLYRRFQSVRGPTKALMSYLFEVD
YLDHFVFVLTDGPDGPVVADARFVRDGKNPEVAEIAFIVGDAYQGRGIGT
FLMAAISVAAGYDGVKRFTARVLSDNHSMRAILNHFGASWDRDDLGVVTT
EIDVPAPSELPIDAELVAQIRAVARQVIRAVG
392418004YP_006454609.1 shikimate 5-dehydrogenase [Mycobacterium chubuense NBB4]MTRPPLNKDTRVCISLAGRPSNIGTRFHNHLYEALGLDFLYKAFTTTDIA
GAITGVRALGIRGCSVSMPFKQDVLALVDEVEPSAQAIRSVNTIVNDLSV
AGGHLTASNTDYLAVQRLVDDNGLDPAQSVVIRGSGGMANAVAAAFAGRG
FATGAVVARNHEAGTALAQRLGYEYVADPGGPCSRGADILVNVTPIGMAG
GPDAHDVAFDDTAIRRARTVFDVVALPSETPLIAAARAAGVGVITGAQVI
ALQAAEQFERYTGVRPSPEQIAEASAVSRA
392418003YP_006454608.1 putative lipoprotein LpqN [Mycobacterium chubuense NBB4]MTILMRAGVIPIAVVALGLGVSACGSDGKPADAGTATTSAASIASAAPTG
QGPAASSQAPAPAKTLQDYIKENNIVETPVKKGDPGSPTIDLPAPNGWED
MGSATPDGAYSAISFTADPAMAQNPPTIITKVVKLTGNVDPKKVLEAAPG
EVRNLPGFQGPQTGQANTLSGFDATVIGGIYPKDGATRMVAQKTVVIPGQ
DGLYVLQMNADGTEDQASPLMDATATIDKQAKITP
392418002YP_006454607.1 hypothetical protein Mycch_4211 [Mycobacterium chubuense NBB4]MRLLAVGAVAVVCAACGTPPAPAPTTATSAPVSLTINPARIDRARSGLPQ
GYEVAGYTGTPTPMSLWGLRDAAASNPPQCAALAAPGVAAATARGWSASG
PGGIVYAVVAETASPPPDATLLGGCGRWTVTAGHTTAAVADRPGPEIVSA
DTVGMTATTSTVVEGGTQTHSHADTFIAYLGEYLCFVTLVTDPGSPQPAL
RAGFAADLLTETVSALRG
392418001YP_006454606.1 hypothetical protein Mycch_4210 [Mycobacterium chubuense NBB4]MSNPKLTLVVACTAVVAVVAACSSGQPADYSRADIAKVAELKSDFGPPFR
VSTVGPAAIDPRLLGPQTLPAGLTFDPADCGTSASQETLPKGVKGNMAAT
TAEGDGVRYIVIAVETSEPVPVNTPTDQCKKVSFTGPGVRGLVEVVDAPQ
MSDVHTVGTHRVLQTTTAGAARTGELYNYVANFGDFIVIVTANPLVVPDK
PVAHVDTQRARDLVSRAVDLVKG
392418000YP_006454605.1 alkylated DNA repair protein [Mycobacterium chubuense NBB4]MEQALQSSLFDHADRRELGDGAWLEIRSGWLCQDDAADDSLFAELRDAIP
WRAERRQMYDRVLDVPRLVSFHNLVTEPAPHPRLKHLRRRLNDTYAGELG
EPFTTAGLCLYRDGNDSVAWHGDNVGRSRTDDTMVAIVGLGATRVFALRP
RGGGPSLRLRHNHGDLLVMGGSCQRTWEHAIPKTTRPTGPRISIQFRPHD
VR
392417999YP_006454604.1 redox-sensitive transcriptional activator SoxR [Mycobacterium chubuMVQVMDRPPELTPGELSARSGVAVSALHFYEREGLITSRRTSGNQRRYPR
ETLRRVAFIRMSQRLGIPLARIREALATLPSDRVPTSKDWARLSAGWRAD
LDQRIGHLERLRDNLAGCIGCGCLSLKVCALANPGDVLAAEGPGAARL
392417998YP_006454603.1 arginine deiminase [Mycobacterium chubuense NBB4]MTDAVLGCNSEVGTLRTVILHRPGPELQRLTPRNNDTLLFDGLPWVARAQ
QEHDAFAALLRSRGVEVLLLGDLLTEALAHSGAARMHGISAAVDSRRLGV
PLAQELSAYLRTLDAAPLARVLMAGMTFDELPFGENELSLVRRMHHGGDF
VIDPLPNLLFTRDSSFWIGPRVAITSLAMRARVRETSLTDLIYAHHPRFL
GVRRAYESRSAPVEGGDVLLLAPGVVAVGVGERTTPAGAEALARSLFDDD
LAHTVLAVPIAQERAQMHLDTVCTMVDTDALVMYPNIQDSLTAFTIRRES
GGVKIDRAAPFVAAAADAMGIGKLRVIDTGLDPVTAEREQWDDGNNTLAV
APGVVVAYERNTETNARLTDSGIEVLPIAASELGTGRGGPRCMSCPAGRD
PL
392417997YP_006454602.1 hypothetical protein Mycch_4206 [Mycobacterium chubuense NBB4]MASVILGSQAIKRNELTRGQLRWRYESIYPDVYVPRGAPRTLYTRTVGAW
VWSRERGVITGRAAAAIHGAEWIADDTPIELLWKSYDTPPGIIARDDHFG
YDDVVEIDDMAVATIQRSAYDLGRHLPHRTALIHLDALARATGLTAEHVT
PLIERYRGARGVRRLRKALDLMDGGAQSPKETLLRLLVIDNGFPRPQTQI
PVADERGRPFAYLDMGWEDVKIALEYDGDQHRTDRTRYVWDERRLRRLRE
LDWLHIRVIAEDRPFDIIERVRRAWAQREPGPMAV
392417996YP_006454601.1 dolichyl-phosphate-mannose--protein O-mannosyl transferase [MycobacMISPAPLVPVADFGPLDRLQGWAMTAVITALAAVTRFLNLGSPTDAGTPI
FDEKHYAPQAWQMLHNNGVEDNPGYGLVVHPPVGKQMIALGEALFGYNGL
GWRFSGAVCGVVMVLLVVRITRRISRSTLVGGMAGLLLIADGVSFVIART
ALLDIFLVFFVVAAFGCLIVDRDQMRERMHVAFLEGRTNETPWGPRLGVR
WWRFGAGVLLGLACATKWSGLYFVVFFSVMTLAFDVAARRQYRVARPWLG
TLRRDLGPSLYVFWMIPFGVYLASYAMWFASETAVDRYEVGRSIGPDSVL
PLPDAVRSLWHYTYGVYRFHAGLTNAEGNFHPWESKPWTWPMSLRPVLYA
IDNQNVPGCGAQSCVKAVMLVGTPAMWFVAVPVLAWALWRAFVKRDWRYA
VLLVGYSAGFLPWFADIDRQMYFFYAATMAPFLVMMIAMILGDILYKPGQ
NAEGRTLGLLVACCYIALVITNFAWMYPILTGLPISQQTWNMQIWLPSWR
392417995YP_006454600.1 putative S-adenosylmethionine-dependent methyltransferase- YraL famMTAGRLLIGATPLGQPSDASTRLKRALAEAEVIAAEDTRRVRTLANALEI
RPTGKIVSLYDQNEASRVPALLDDIRGGATVLLVSDAGMPLISDPGYRLV
TACVEGGLTVQCLPGPSAVTTALAVAGLPSERFCFEGFAPRKHAARAAWL
QSLAGELRTCVFFESPRRLADCLRDAVDVLGSERRAVVCRELTKTHEEIV
RGTLGELAEWAADGVLGEITVVLAGATPTADPDLLVVEVNRLVESGMRVK
DACARVVAANPGAPSRRELYDAVLRARD
392417994YP_006454599.1 aminodeoxychorismate synthase- component I [Mycobacterium chubuenseMRIDRLGRLGDAPAVLRALAAATSRLGLAPPSALIGEWFGSRAVIAPSVP
IRPVDPRQAFDAPVGDRSGAVGGGWFGYLSYPDRAADGRGPRIPEAAGGW
SDTVLRCDRDDTWWHESLCGAPVSDWVIEALQRSPDPWEASVRWGQADRA
AHRRGVRACLDAIAAGEVYQACVCTQFTGTLHGHPCDYFAGAVARTAPAR
AAYVAGDWGAVASLSPELFLRRCGESVTSSPIKGTLPAHADPAGLRTSVK
DVAENIMIVDLVRNDLGRVARTGSVTVPELLAIRPAPGVWHLVSTVAAAV
PVEVPMATVLDATFPPASVTGTPKGRARALLTEWEPVRRGIYCGTVGLAS
PVAGVELNVAIRTVEFCSDGTAVLGVGGGITADSDPEREWEECLHKAAPI
IGYRPQSRARSTAS
392417993YP_006454598.1 RNA polymerase sigma-70 factor- TIGR02957 family [Mycobacterium chuMIGSPGDVGVPSARGGHAERFTHLRPLLFTIAYEILGSTTESDDVLQDSY
LRWAEVDLTTVADTKAYLAQLVTRQSLNALRAQSRRREEYVGPWLPEPLL
TEPDPAADVVLAESVSMAMLVVLETLSPDERAVFVLREVFGFGHDEIAAT
IGKSPAAVRQMAHRAREHVQSRRKRFEPVDPAVSTEITLRFFTAAATGDL
DGLMEMLAPDVVWTADSDGRVSAARRPVAGAEKVARLVLGLVRLGGEGGR
VEPAIYNSAPALVLYLGDNLEGVITVEVLDGKITNFYAMRNPEKLATVTV
PRRIGR
392417992YP_006454597.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium chubuenseMTPNHSTVLVIGGGYAGVMAANRLKTRNDLTVKLINPRPEFVERIRLHQL
AVADESTSRVALADYGTVLNAGVQLVVDSVERIDAAAHRVTLASGATLDY
DYLVYAVGSTGAVPDAVPGAAEFAYPLSEFEQATRLRERLADLAAPAPIV
VVGAGLTGIEAASEFAGAGRHVTLVSRVIGPSLSRAGRRSVLRQLAKVGV
TLVDGDAATVTAVGPDHVVLADGRRLLSAVTVWTAGFGVPGLAAASGLTT
DDMGRLVTDETFTSVDDDRIAAAGDSASPSRVPYRMSCQASLPMGALAAD
TVLARMAGETAAAVSVPMSAQCISIGRRGGTLQFQRRDDSPTGIHIGGRA
GALIKEQVCRFTLKWLSGEAAEPGSYKSLKGPDRSALAATPSAVPVR
392417991YP_006454596.1 methionyl-tRNA synthetase [Mycobacterium chubuense NBB4]MSEPYYITTAIAYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTD
VHGLKMAETAAKEGIPTAELARRNSDVFQRLQEKLNISFDRFIRTSDADH
YEASKAIWTRMVDAGDVYLDAYSGWYSVRDERFFAENETTVAEDGVRVSI
ETGTPVTWTEEQTYFFRLSAYADRLLAHYAEHPEFIEPEVRRNEVVSFVS
GGLRDLSISRTTFDWGVPVPGHPDHVMYVWVDALTNYLTGVGYPDTESEV
FRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPKKVFAHGFLFNRGE
KMSKSVGNVVDPNDLVDTFGLDQVRYFLLREVPFGQDGSYSEDGIIARVN
ADLANEFGNLAQRSLSMVAKNLDGVVPAPGDLTVEDTELLAAADALLDRV
RGHYAATAMHLALEAIWSVLGAANRYFSAQEPWVLRKTDPERFGTVLYTT
LEVVRIAALLCQPVMPESSAKLLDLLGQPGDRRDLTAVAARLTPGITLPA
PSGVFPRYQAD
392417990YP_006454595.1 hydrolase- TatD family [Mycobacterium chubuense NBB4]MWAVSSSAQRREPPPLPEPLSPLIDAHTHLDACGADDADDVRVILDRAEG
VGVRAVVTIADDLDSARWAVDAAGWDDRVYAAVALHPTRADALTGEARAE
IERLAEHPRVVAIGETGLDLYWPGRLEGCADPARQREAFAWHIDLAKRTG
KPLMIHNRDADADVLDVLRAEGAPENVIFHCFSSDASMARTCVDAGWVLS
LSGTVSFKNARALREAARLIPAEQLLVETDAPFLTPHPYRGAPNEPYCLP
YTVRALADVVGRPAEAIAEESSATAVRMYGLAGCWS
392417989YP_006454594.1 hypothetical protein Mycch_4198 [Mycobacterium chubuense NBB4]MTKLHQTRSPILRALVAAMLLVLVFAGATAVAVHKTVTLTVDGASMTVPT
MKSRVIDVIKENGFDVTDRDDVYPAPDTPVHQSDTIVLRRSRPLEISTDG
GGSQQVWTTASTVQEALAQLRMTDKAPVAASRGSRVPLGGMALPVVSPKT
VRLDDGGAVRTVHLAAPNVAALLDAAGAPLQQSDTVVPAPSAPVFDGMQV
NVTRVRIQKVTQRLPLVPNNQRIEDPTLNMSRQIVEDPGMPGTQDVTFSV
ATVNGAETGRLPVANVVITPARPGVLRVGAKPGTEVPPISNGSTWDALAR
CEAGGNWAINTGNGFFGGVQFDQNTWERNGGLRYAQRADLATREEQIAIA
EVTRARQGWGAWPVCSGRIGAS
392417988YP_006454593.1 dimethyladenosine transferase [Mycobacterium chubuense NBB4]MTIRLLGRTEIRHLAKSIDFRPRKSFGQNFVHDANTVRRIVSASGVNRSD
HVLEVGPGLGSLTLALLDRGARVTAVEIDPVLARQLPTTIADHSHSEINR
LTVLNRDILTFQRSELTEEPTALVANLPYNVAVPALLHLLAEFPSIRTVM
VMVQAEVAERLAAEPGGKDYGVPSVKVRFFGNVRRYGMVSPTVFWPIPRV
YSGLVRIDRYETSPWPTDTEFRQQVFELIDVAFAQRRKTARNAFAEWAGS
GNESASRLLAASIDPSRRGETLGVADFVRLLQRSEDWHVVPKATPAETAE
PVTDTHDEVPSR
392417987YP_006454592.1 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Mycobacterium chMSPRDGNTATEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAV
SLLDEVTVRTSDMLTVEVSGEGADSVPTDERNLAWRAAELMAEHVGRAPD
VAISIDKTIPVAGGMAGGSADAAAVLVAMNTLWELGVPRRDLHALAAELG
SDVPFALHGGTALGTGRGEELATVLARNTFHWVLAFSRGELSTRRVFAEI
DRLRASGDRTLPPRLESPEPLLAALASGDPAQLAPLLGNDLQPAALSLDS
SLRRTLRAGVEAGALAGIVSGSGPTCAFLCASAGAAVDIGTELAGAGVCR
TVRVASGPVQGARVVPSPSTAG
392417986YP_006454591.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMSRFTEKMYSNARSTDRGMVTGEPHEPVRHTWGEVHERARRIAGGLAEAG
VGLGDAVGVLAGFPVEIAPTAQGLWMRGASLTMLHQPTPRTDLAMWAEDT
MNVIGMIEAKAVIVSEPFLVAAPVLEEKGITVLTVGDLLASEPIDPIEVG
EDDLALMQLTSGSTGSPKAVQITHRNIHSNAEAMFLGAEYDVDTDVMVSW
LPCFHDMGMVGFLTIPMYFGAELVKVTPMDFLRDTLLWAKLIDKYKGTMT
AAPNFAYALLAKRLRRQAKPGEFDLSTLRFALSGAEPVEPADVEDLLDAG
RPFGLRPDAILPAYGMAETTLAVSFSPCGAGLVVDEVDADLLAALRRAVP
ATKGNTKRLATLGPLLKDLEARVIDDHGNVMPPRGVGVIELRGESLTPGY
LTMGGFIPAQDEHGWYDTGDLGYLTEEGHVVVCGRVKDVIIMAGRNIYPT
DIERAAGRVEGVRAGCAVAVRLDAGHSRETFAVAVESNAWQDPAEVRRIE
HQVAHEVVAEVDVRPRNVVVLGPGSIPKTPSGKLRRSNSVSLITG
392417985YP_006454590.1 Protein of unknown function (DUF1222) [Mycobacterium chubuense NBB4MDAQWLAAPEYGLAREILQRGVAAIYLIAFVAAARQFRALIGEHGMLPVP
RFVERVPFRVAPSLFHLRYSDRLFAAIAWSGAVLSAAILSGAANLVPLWA
AMVAWLVLWVLYLSIVNVGQRWYGFGWESLLLEAGFLAMLLGNDDTAPPV
LILWLVRWLVFRVEFGAGLIKMRGDPCWRDLTCLHYHHETQPMPGPLSWF
FHHLPKPLHRVEVAGNHVAQLLVPFALFAPQPVASAAAGIVIVTQLWLVM
SGNFAWLNWVTIVLAFGAIDRSAYSAVLPVSSAPALPTPPLWYAAIVIAA
TALSAFLSYWPVRNMLGRRQHMNASFNPFHLVNTYGAFGSIGRTRYELVI
EGTDESTLTDRTVWKEYGFKGKPGDPRRLPRQWAPYHLRLDWLMWFAALS
PTYAKDWFGPFIARLLRNDAPTLRLLQHNPFPDAPPQHVRAALYEYRFTT
WRELRHERAWWHRSLVGQYLPAIALGELSAR
392417984YP_006454589.1 daunorubicin resistance ABC transporter ATP-binding subunit [MycobaMSGCDDTVGVMPPAPAIEAIDLVKRYGHETAVDGVSFSVPPGTVLGLLGP
NGAGKTTTVRMMTTLTEPTSGTARVAGFDVRRQPEQVRRHMGLTGQVATV
DELLTGRENIRMIGGLYGIRRKDLEKLGSQLLEQFSLTDAGDRVVKSYSG
GMRRRLDLAVSLLASPPVLFLDEPTTGLDPRSRSELWDVLRGLVAQGTTL
LLTTQYLEEADQLADNIVVIDRGRIIAEGSPLELKRQAGRASLVVTVSDA
RDLGSARSLLERSGAEVFADAGARRLTASADGLDDMISVAGWLRDSGIGV
DDIGLSRPSLDDVFLTLTGHRTDDTEEVTA
392417983YP_006454588.1 ABC-type multidrug transport system- permease component [MycobacterMTALETKAQAPVTLQQVATRPTGLARQSWIMVKRNMIHTKRMPEMLSDVT
AQPIMFVLLFAFVFGASITNTGGASYREFLLPGIQAQTIVFSAFVVASGI
TADVEKGIIDRFRSLPISRSSVLIGRSIASLIHSSLGVVVMAVTGLAIGW
RIRNGIAEAVLAFALLLVFGFGMIWFGILIGSLMRTVEAVNGVMFTALFP
VTFLANTFVPTEPMPHWLRVIAEWNPVSSLAQAMRELWGNGGPAPASAQL
PLHHPVLSTFLWSLALTAVFAPFALAAYRRRTSG
392417982YP_006454587.1 hypothetical protein Mycch_4191 [Mycobacterium chubuense NBB4]MFDGDRTWGSLTIRPDRLGMICYRLVVYPPGISTVERRRLRVARGWPAWG
PLLWIACEILLPGAIGPWAALALSTVVAAGAGVLARRCAGRTLTGVRCLT
AVVLAGYADPESTAARDRVLAWAETLLGADDDLARGDISIAAHEMAWWRV
YDDVTEALASRQPDVRRR
392417981YP_006454586.1 putative Fe-S protein [Mycobacterium chubuense NBB4]MADNLPHRLAEHPTVRAVRSRPSRPPGTIDAGWLRQVCLDAGADDVDFAR
VADPALASELPHAEAALPGARSYISLVVKMNRDNVRSTARSVANQEFHRS
GEIMNDAAHRITRVLQDAGHRVINPSATFPMEMDRYPGRIWVVAHKPVAV
AAGLGAMGIHRNVIHPRFGNFILLGTVLVAAEISSYGAPLDYSPCLECKL
CVAACPVGAIKKNGDFDFVACSVHNYREFMGGFTDWVQTIADSADADEFR
SRVSDSENASMWQSLSFKANYKAAYCLAVCPAGEEVIEPYLDDRKGFMEL
VLKPLQEKRETLYVLAGSDAEDHATKRFPHKPVKRVGSGIRGA
392417980YP_006454585.1 hypothetical protein Mycch_4189 [Mycobacterium chubuense NBB4]MAVVRQASVLLMSAAAVIGVSMSMVSSPPARAGGPGGVAETGVLSRAVGS
GVRDGMLVGFSATGPTNDAAAAAVIAVCQGAGAAQCSSDEVTNDVFCVVS
VGADDSSGIVSGGAGATIEAARDDAFRHVGSANLTLDPGARVLASSCP
392417979YP_006454584.1 hypothetical protein Mycch_4188 [Mycobacterium chubuense NBB4]MTSRWTITTTALTASAIVASLLAAPTAAAQATCQEAGSIVRCETNGSVSI
KAVPGTRAPNVVESIPRNNRTGIVLSW
392417978YP_006454583.1 peptidyl-tRNA hydrolase [Mycobacterium chubuense NBB4]MAEPVLVVGLGNPGPQYATTRHNLGFLVADVLADRIGAAFKVHKKSGAEV
VTGRLGGKSVVLAKPRTYMNESGRQVGPLAKFYSVAPADIIVIHDELDID
FGRIRLKSGGGVAGHNGLRSVGSALGSNDFQRVRIGIGRPPGRQSGASFV
LENFNSRERPELGTIVEQAADATELLIAHGIEPAQNTVHAWA
392417977YP_006454582.1 ribosomal protein L25- Ctc-form [Mycobacterium chubuense NBB4]MAQNPTNNLTAQVRTATGKGASRRARREGRVPVVLYGHGTDPQHLEIDGH
DFAAVLRHAGTNAVLTLDIDGKEQLALTKALEIHPIRRNIQHADLLVVRR
GEKVTVEVTVIVEGEATPGTLVTQEANTVEIEADALSIPQQLTTSVEGAE
EGTQILAGQLALPAGVTLITDPETLVVNVVAAPTEEELESEGGGASVEEQ
AAEAEAEAGEAGEGGEEAASESE
392417976YP_006454581.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSDWTAADLPSFAGRTVVVTGANSGLGLVTAHELARVGATTILAVRNLDK
GNAAVAEMAGDVQVRRLDLQDLSSVREFAEGTGTVDVLINNAGIMAVPYA
LTVDGFESQIGTNHLGHFALTNLLLPKITDRVVTVSSFMHLFGYLSLNDL
NWKSRPYLAWPAYGQSKLANLMFTTELQRRLESARSPLRAVAAHPGYSAT
NLQGHSGGRLGSRIMDAGNRFFATDADFGARQTLFAASQDVAGDSFIGPR
FAMRGRTGDAWRSPLARDGDKAAALWTLSEQLTGTEFPL
392417975YP_006454580.1 putative lipoprotein LpqN [Mycobacterium chubuense NBB4]MTASRAAVAAAVVLACAGCGTETPDYQAVWSTTSATSSSAAPTTSEKPVP
IAAYLEQSGVSGKPVAPDKLTDITISMPMPPGWHPYQNTNLAPGTRTIAK
GDTYPTAMLMVFELDGDFNIADALKHANVDAQISQNFRSLNSSNAPFDGF
PSSMIEGSYDLNGARMHSYNRIVIATGAPPKNQRYLIQFTVTGFADKAAE
EAPDIEAAIKGFSVTVPKAPPR
392417974YP_006454579.1 glutaredoxin-dependent arsenate reductase [Mycobacterium chubuense MAQAETRIYHNPKCSTSRKTLELLRDNGIDPEVVLYLKNPPTRDELATMI
ADAGIDVRTAVRKRESLYEELGLASASDDELLDAMAEHPILIERPFVVTP
RGTRLARPLDSVREIL
392417973YP_006454578.1 ribose-phosphate pyrophosphokinase [Mycobacterium chubuense NBB4]MSHDWTDNRKNLMLFSGRAHPELAEQVAKELDVPVTAQTARDFANGEIFV
RFDESVRGSDAFVLQSHPAPLNTWLMEQLIMIDALKRGSAKRITAILPFY
PYARQDKKHRGREPISARLVADLYKTAGADRIVTVDLHTDQIQGFFDGPV
DHMRAQKLLTGYIAENYADHDMVVVSPDSGRVRVAEKWADSLGGVPLAFI
HKTRDPLVPNQVKSNRVVGDVRGKTCILTDDMIDTGGTIAGAVNLLREDG
ASDVIIAATHGVLSDPAPERLANCGAREVIVTNTLPIGDDKMFPQLTVLS
IAPLLANTIRAVFENGSVTGLFDGSA
392417972YP_006454577.1 glucosamine-1-phosphate N-acetyltransferase- UDP-N-acetylglucosaminMREAAVLVLAAGAGTRMKSDTPKVLHTLAGRSMLAHALHSVAKVQPRHLV
VVVGNDRERVAPAAQQIGQELGRAVEIAVQEEQRGTGHAAGCGLAALPDD
FAGVVVVTSGDVPLLDADTLAALISTHVAESAVATVLTTTLAEPTGYGRI
LRSPEGEGGDLLGIVEQADASPAQRAITEVNAGVYAFDAGALRSALSRLR
ADNAQHELYLTDVISIVRGDGHVVRAEHVDDTALVAGVNDRVQLAALGAE
LNRRIVAGHQRNGVTIVDPASTWIDVDVTIGRDTVVRPGTQLLGATSVGG
RCEIGPDTTLTDVTVGDGAEVVRTHGTSSVIGAGADVGPFTYLRPGTVLG
DAGKLGAFVEAKNATIGTGTKVPHLTYIGDADIGEHSNIGASSVFVNYNG
ETKSRTTIGSHVRTGSDTMFVAPVTVGDGAYTGAGTVIREDVPPGALAVS
AGPQRNIEGWVQRKRPGSAAARAAEQAKAAEGAGEATGE
392417971YP_006454576.1 transcription elongation factor [Mycobacterium chubuense NBB4]MHTDDRIWMTPRARENLEAELACLLAVPTRAEADRSDQIVDAWLARKERI
RQIHELLSKADTAVSPPDDGIAEPGMVLTVRYEDSGDAETFLLGTRGISD
TELEVYTVNSPLGSALLGAKAGERRSYALPNGGIQHVTVLSAKPFGAHLL
ADAESRELAKR
392417970YP_006454575.1 glycine/D-amino acid oxidase- deaminating [Mycobacterium chubuense MSGRSGMDASPRSVIVVGAGIVGLSTAWFLQEHGVEVTVLDRAGVAAGAS
WGNAGWVSPALTAPLNSPSMLREGVRALANPAAPLHIPLRADARLAQFLL
RFAANCRSTAWQRAVRANAVLNDEAIETFDVLVTNGVDAPVTDTSVAVAF
RDSAHAHGFLTELSHLSASGQHVHAEILTGTTLHEQVPLASPRVTTVVDV
SGQRFVDPGRFTHALATAVTERGAALRTGEVCRTSKSGDGVVVGLRAGEP
LHADAVVLATGAWLPALTGRRVRVRLQAGRGYSFTVPVDRPLPGPIYLPE
VRVACTPYRGGLRVAGTMEFRHPAEPLDSRRIEAIVASAAPLLDGVRWSD
RTDLWVGPRPVTDDGMPLIGRLAAGVYVAGGHGMWGLAHGPATGRLLAEQ
IVTGKQPEAVRPFDPLRGRATGSEPLTLPL
392417969YP_006454574.1 hypothetical protein Mycch_4177 [Mycobacterium chubuense NBB4]MGPAGPGVASTSVITLDRLINVLGGYGARLLAGSAARSTELRSVVLPEVV
DGRTVAGDVLLAVGAASPAEAVAWARAARAVVVLTRDGTPETVPPGGPAV
VVVDSAMPWSDFAAIVYGLVLEGRETESGRGPTDLFALADSLSEAVGGAV
VIEDRLSQVLAFSRGQQDADPARAATILGRQAPADLRATFDAHGVFTHLA
GSDDPMFVPGDARVGLTGRMVVAARAGRELLGSVWVACADPLTGAQRRAL
ADGAHTVALHLLRSRASADLERQVESELVIRLLESPADAATVASRLGLPP
ASLRVVALRAAQGGRRHAALLQAFEHATAGFGWSRPSRSALADTTVYTVL
AAERAAVARDWVDALVATLPDEVTVQAGISAPAAATELAVARAEADECLA
LQEGTGSVTPPAYDESWDDLVLRRLRTAARSGRTPHRGVVAELRAHDSAH
GTAYVATLRAWLQERGDPGRTAAHLGVHENTVRYRMRRMSELTDLRLDDA
HKRFAMMIELAVID
392417968YP_006454573.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTGSERRQQLIEIAKSLFAERGFDGTSIEEIALRANVSKPVVYEHFGGKE
GLYAVVVDREMSALLDGITSSLTNNRSRVRVERVALALLTYVEEHTDGFR
ILIRDSPASITSGTYSTLLNDAVSQVASILAGDFSRRGLDPDLAPLYAQA
LVGSVSMSAQWWLDTREPKKEVVAAHLVNLMWNGLTHLEADPHLQDE
392417967YP_006454572.1 transcription-repair coupling factor Mfd [Mycobacterium chubuense NMTVSGTLHVHTPIAGLVELALRDPSLQEVARRAAERPADLDFVGPASARV
FVASALAQSGALLVVTATGREADDLTAELQGVFGDAVAMFPSWETLPHER
LSPGVDTVGARMMLLRRLTHPDDERLGPPLRIVVTTARSLLQPMAPDIAS
IEPVTLTVGAEPDVAPGAAAVAAFDATVARLVDLAYTRVDMVGKRGEFAV
RGGILDLFPPTAEHPVRVEFWGDEVSEMRMFSVADQRSIPEIDIDTVIAV
PCREVLLTADVRRRAAALSAEHPVLENSVPGSVPDMLAKLAEGIPVDGME
ALLPLLRPTELVTLPALLPAGTPLLVCDPEKVRTRAADLIKTGREFLEAS
WSTAAVGGDVPIDIEALGASGFVGFDDGREAARAGGHPWWTLSQLTAESG
VTLDIRPAPSARGQQHNLDEIFAMLRAHVATGGYGIVVTPGTGTCMRVVE
QLGEADTPATILEPGAAPRDGVVGVVKGPLHDGVVIPGANLVVITETDLT
GNRAAATEGRKLAAKRRNVVDPLALTAGDLVVHDQHGIGRFVEMTERVIG
GARREYLVLEYASAKRGGGTDKLYVPMDSLDQLSRYVGGEAPTLSRLGGS
DWANTKTKARRAVREIAAELVALYAKRQASAGHAFGPDSPWQTEMEDAFG
FTETVDQLTAITEVKSDMEKPVPMDRVICGDVGYGKTEIAVRAAFKAVQD
GKQVAVLVPTTLLADQHLQTFTARMAGFPVTVKGLSRFTSPSESRAVLDG
MKDGSVDIVIGTHRLLQTGVTWKDLGLVIVDEEQRFGVEHKEHIKSMRTH
VDVLTMSATPIPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPHDDKQV
AAALRREMLRDGQAFYIHNRVRTIDQAAARVRQLVPEARVVVAHGQMPEE
QLEKTVEGFWNREFDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQ
LRGRVGRSRERGYAYFLYPPEVPLTETAYDRLATIAQNNELGAGMAVAMK
DLEIRGAGNVLGAEQSGHVAGVGFDLYVRLVGEAVEAYRAAADGKTVAAP
EEPKDVRIDLPVDAHLPPDYIGSDRLRLEAYRRLAAAQEDAAVDSVIEEL
VDRYGPLPEPAQRLVAVARLRLLARAHGVTEIGAASASTVRISPLTLPDS
AQLRLKRLYAGATYRATTSTVQVPIPRSGGGVGAPRIRDLELVAFVAGLL
LAIDGKPQEEVDITKFGGGA
392417966YP_006454571.1 protein with tetrapyrrole methyltransferase and pyrophosphatase domMTVVLVDPRRPSLIPVEAIELLSGDVQYTEEMPIKVPWSLPSARPAYEGE
PAATLLSSDRDHPSVATRIAAGERVICAPEPQPGERLVDAVALMDTLRTA
GPWESQQTHDSLRRYLLEETYELFDAVHGGDLAELRDELGDVLLQVLFHA
RIAEDAPEGAFDIDDVADALVRKLGHRVPAVLAGESISLEEQLAQWEQRK
ALETSARESSMDGIPTGQPALALAQKVLARAENAGVPAELVPAALTTVTV
SAEFDAENGLRTAILEFMADVRAAERSVAAARRRAEVAEELDDTPVGVIT
PDEWHAHWPDTGEPEAVEYEVPDEEAVADEPEAPDEEAPDEFDEPEATEQ
EPEPAEQ
392417965YP_006454570.1 Tat-translocated enzyme [Mycobacterium chubuense NBB4]MSSPPNNAVGEPRSGLSRRKLFGAAGVGAAVVGAASAGALAGRASAAQTS
DHLQTAVPFRGAHQAGIVTEAQDRMHFATFDITTNSRDDVVKMLADWTEM
AERMTRGEEAFAGGATGQNPYSPPTDTGEALGLPASQLTLTIGFGPSFFV
KDGVDRFGIADKKPAELVDLPKFGNEKIDPARSGGDIVVQACANDPQVAV
HAIRNLARTGFGTVAVRYSQLGFGRTSSTTRNQSTPRNLFGFKDGTANLR
SDETEKLNNFVWVGDGDGPAWLTGGTYLVARRIRMRIEQWDRTTLLEQER
VVGRQKGSGAPMGRGDEFDALDFDAQDDRHEPLIDERAHVRLVAPEHNNG
IEILRRGYNFTDGSDGFGHLDAGLFFIAFVRNPLTQFVPLQTQMSRNDAM
NEYIAPMSSAVFACPPGIPEGDTSTFWGSTLFD
392417964YP_006454569.1 putative periplasmic lipoprotein involved in iron transport [MycobaMKVQTSAAALAAVLAGFALTSCQAKEESSGTAADGRQAAGDITVDASDTS
CTLSGTEGKTGANTFVITNNGSKVTEFYVYGEGERVMGEVENISPGLQRK
LIVQLSQPGTYKTACKPGMVGDGIRGDFTVTGDAVQVDTEGKFAEAADSY
KRYVNSQTDALVAATADFVAAVKAGDIAKAKALYPTARTYYERIEPVAES
FPNDLDPRIDLREADLEPGQKWTGFHRLEKDLWVQGLQPDTNAVADQLTA
DVKELNDGVKAPDWTIDSTQIAGGAQGLLDEIASSKISGEEDIFSHTDLW
DFKANVEGSQTAVASVRPILDERNADLGKRVDQRFTEVEALLEKYRQGDG
FVSYDTVTEPERQELSRAIDALSKEVSQVQGVIAPQ
392417963YP_006454568.1 high-affinity Fe2+/Pb2+ permease [Mycobacterium chubuense NBB4]MMNAGTDLPATALAAAPNVTSQLFGSGLIGLREGLEAAIVVSILVAFLVK
SERRDALRWVWLGVGAAVAMTVIVFSTIQFGENTISGLAAEAIAGVASLI
AVAIVTTMVLWMRKAAASMSGELRSDMARALETGPLAVLALAFFAVGREG
VETALFMVGYAEATTSWPLIGLVAGVVVAGLIAYGMYRGALSIDLRRFFT
YTGVFLILVAAGILSYGIGALQTVGWLPGLSAKAFDITAWFNWSAWYGEV
VQGVFNVTPTPTVLQLAGWSAYLAVVLALFLRPTAAPARPTNPSPQPHPS
PERSIT
392417962YP_006454567.1 membrane-bound lytic murein transglycosylase B [Mycobacterium chubuMTRVRWLRAVAVIGATALLLAASCSWQLGQFIPDGVPPPAGDVVPQIDTH
ARGRPADQLHEWAAERAPRLGIPATALEAYAYAARVADVENPGCHLKWTT
LAGIGQVESHHGTYRGARVATNGDVAPPIRGVLLDGSGGNLQILDQDSVS
HDPAVENKGDQSFARAMGPMQFIPETWRLYGVDANNDGKISADNIDDAAL
SAAGYLCWSGKDLQTPRGWMEALRAYNHSDAYARTVRDWATAYAAGHPL
392417961YP_006454566.1 transposase IS116/IS110/IS902 family [Mycobacterium chubuense NBB4]MIFVGDDWAEDHHDVYLMDEAGQRLAARRLPEGLSGIRALHELIAVHADQ
PDQVLVGIETDRGLWVSALAAAGYQVWAINPMAAARYRDRHHVAGAKSDA
ADAKLLADLVRTDRHNHRQIAGDSPDAEAIKVLARSHQSLIWARTRHANM
LRSALREYYPAALEAFDALTDGDALAILGRAPTPEQGAQLSLAKIGSALK
AAGRQRNIEARAAEIQAVLRRKHLTAPPAVAAAFGATTTAAVHVIAALNT
QIADLETALADHFETHPDADIYRSLPGLGVVLGARVLGEFGDDPNRFTTA
KCRKNYAGTSPLTIASGRKRAVLARHVRNKRLYDAIDQWAFCALLRSPGA
RTYYDEHRAAGDTHHQALRALGNRLVGVLHGCLRHHTRYEEHKAWAHRQT
AAA
392417960YP_006454565.1 enolase [Mycobacterium chubuense NBB4]MPIIEQVGAREILDSRGNPTVEVEVGLLDGTVARAAVPSGASTGEHEAVE
LRDGGSRYLGKGVQKAVEAVLDEIAPAVIGIGADEQRLVDQALVDLDGTP
DKSRLGANAILGVSLAVAKAAAQSAELPLFRYVGGPNAHILPVPMMNIIN
GGAHADTGVDVQEFMIAPIGAPSFKEALRWGAEVYHSLKSVLKKQGLGTG
LGDEGGFAPDLPGTKAALDLISSAIEAAGLTVGSDVALALDVAATEFYTA
GTGYAFEKQTRTAEQMASFYEELMGGYPLVSIEDPLSEDDWDGWVALTTA
IGDRVQIVGDDLFVTNPERLEDGIEKGAANALLVKVNQIGTLTETLDAVS
LAHNAGYKTMMSHRSGETEDTTIADLAVAVGSGQIKTGAPARSERVAKYN
QLLRIEEELGDAARYAGDLAFPRFALADESPARGADGGVK
392417959YP_006454564.1 septum formation initiator [Mycobacterium chubuense NBB4]MPEGKRPDPRRRSGADARSRKAPASRPARPGKSGDSGRAKPRGTSSRREP
RGTEAQGKELARVSEDTGPGVDGGADAVAESKTLSLRQTIAASAEQAAEQ
RFGSTARRAAILAAVVCVLTLTIAGPVRTYFGQRTEMKQLQASEAHLREQ
IADLEAQKAKLADPVFIAAQARERLGFVMPGEIPYQVQLPPGAAEAATPA
GQPSEVKSGDPWYTSLWHTIADAPHGLSPTAPPPPLPAPPPGAPAAPPPG
G
392417958YP_006454563.1 hypothetical protein Mycch_4166 [Mycobacterium chubuense NBB4]MVEPSDLEAVARQLGREPRGVLEIAYRCPNGEPAVVKTAPKLPDGTPFPT
LYYLTHPALTAAASRLESSGLMREMTGRLGRDPELAAAYRRAHEAYLAER
DAIEPLGTTFSGGGMPDRVKCLHVVMAHSLAKGPGVNPFGDEALAILALE
PAMVGILDPEVWA
392417957YP_006454562.1 exopolyphosphatase [Mycobacterium chubuense NBB4]MRVAAVDCGTNSIRLLIADVADDRVQDVHREMRIVRLGQGVDATGQFAPD
ALARTRAALAGYAELMRSYDVEAVRMVATSAARDVGNRDEFFAMTSEVLG
AVVAGAVAEVITGDEEAELSFRGAVGELDSDAAPFVVVDLGGGSTEVVLG
SREVVAGYSADIGCVRLTERCLHSDPPTEDEIAAARAVVRDALADALRVV
PVEQARTWVGVAGTMTTLAALAHKMTTYDSEAIHLSRVRFDDLLTVCADL
LAMTRRQRAALGPMHEGRVDVIGGGAIVVQELAAVLGERAGINELVVSEH
DILDGIALSIA
392417956YP_006454561.1 hypothetical protein Mycch_4164 [Mycobacterium chubuense NBB4]MSREMEMPAAPKYMAVQVAAAIVAAVLVVLGVLGFIPGVTTHLGQLSWAG
QRSHTFLFGTFAVSAVQNIVHLVVGAAGALMARTYAGARAYLLAGGVVYL
GLWLYGLLVTRGSDADLLPLNQADNWLHLGLGGVMVLLAVTLAGQHDPTK
RRTGLRRHVPSH
392417955YP_006454560.1 acyl-CoA synthetase/AMP-acid ligase [Mycobacterium chubuense NBB4]MPGYRDLYDASIDDPAAFWADAATAVTWTKAPDRILDDSNPPFYRWYPGA
ELNTCANALDRHVDGGRAEQAALIYDSAVTDTKRTYSYAELLDQTARFAG
VLRGLGVGKGDRVVIYMPMIPQAVIAMLACARLGAVHSVVFGGFAPHELA
VRIDDVKPTVIVSASCGIEPNRAVEYKPMLDAAIGMVRHPPRYCVVVQRD
RHRCGLVDGRDLDWDVVMTTATPADPVPVAATDPLYVLYTSGTTGKPKGI
VRDNGGHAVALLWSMKHIYDIAPGDVFWAASDVGWVVGHSYIVYAPLLLG
ATTVLYEGKPVGTPDPGAFWRVASEHGVKALFTAPTAIRAIRKEDPDAEY
LHGPAADYDLSRMKYLFLAGERLDPDTYHWASEQLGIPVVDHWWQTETGW
AIAANPMGTQPLPIKAGSPTVPMPGYDVRILHDDGYWCPPGQEGAICIRL
PLPPGTLPTLWNADDRYETSYLSEHPGYYLTGDGGRFDEDGYLFVMGRID
DVINVAGHRLSTGAIEEVLATHPAVAECAVIGVPDEIKGQAPRGLVVVKS
GAPTDGLADELVKLVRDEIGAVASFKLVDIVPALPKTRSGKILRKTMRGL
AAGRDEPVPSTIEDPGVLDALSTILRS
392417954YP_006454559.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMTNQPPPIEGVRRSFVTARGVRFHVTESGPEDGRPVLALHGWPQHHWAYR
NLLADPPPGLRIIAPDLPGYGWSGPAPHRWAKEDVVTDLVALMDAMGLER
VLLVGHDWGGYIGHLLALRVPERIEGYLVLNIPHPWVTAKALAPHLWRFL
LYQPFVASIGVLLQRYTPYLERVIFGVAAPKVDRATARVYAEAFRDPVVA
RTARDTYRTFLLREVRESARNPERRWSTVPTRALFAKDDTAIHASLAAAE
TAHADDYTLEIVDGGHFILDEQPEAVRAKLIALAEEVPAR
392417953YP_006454558.1 response regulator with CheY-like receiver domain and winged-helix MTPVKTRVLVIDDEPQILRALRINLSVRGYEVDTAATGAAALHTAAEHRP
DVVILDLGLPDMSGIDVLAGLRGWLTAPVIVLSARTDSSDKVEALDAGAD
DYVTKPFGMDEFLARLRAAVRRGASAADTDEPIVETSSFTVDLAAKRVTK
NGAEVHLTPTEWGMLEMLVRNRGKLVGREELLKEVWGPAYAKETHYLRVY
LAQLRRKLEDDPSHPVHLLTEAGMGYRFQQ
392417952YP_006454557.1 osmosensitive K+ channel histidine kinase [Mycobacterium chubuense MRSGHAVDDDPVSSSDHRGKRGELRIYLGAAPGVGKTYAMLGEAHRRLER
GTDLVAAVVETHGRQKTADLLRGIEMVPPKMISYRGRSFGELDVEAVVRR
HPQVVLVDELAHTNTPGSKNPKRWQDVEELLDAGITVITTVNVQHLESLN
DVVTQITGIEQQEKVPDEVVRAADQIELVDITPEALRRRLAHGNVYAPER
IDAALSNYFRRGNLTALREMALLWLADQVDAALEKYRADNNITATWEARE
RVVVAVTGGPESETLVRRASRIASKSSAELMVVHVVRGDGLSGVSAPQMG
TVRELAASLGATLHTVVGDDVPAALLDFAREMNATQLVLGTSRRSRWARV
FDQGIGVTVVQRSGKIDVHMVTHEHAGGESLWARITPRERHVAAWLAALV
VPVAICAVTVLLLDPFLGIGGESALFFIGVLVVAMLGGVAPAALSAVLSG
LLLNYFLVEPRHTFTISEPDSAITIVVLLMVAVAVSVLVDGAANRAREAR
RAAQEAELLALFAGSVLRGADLDTLLERVREAYSQRSVTLVRGEAHGGQV
VGCAGADPCVTVDAADTAIEVGSEDAPEEFWLLLAGRRLAARDRRVLSAV
ANQAAGLARQKELTAEAGKAEAIARADELRRSLLSAVSHDLRTPLAAAKA
AVSSLRSPDVGFSPEDTAELLATIEESVDQLTALVGNLLDSSRLAAGVVR
PELRPVYLEEAVPRALLGISKGSRDIGLDRVKVEVGDTVVMADSGLLERV
LANVLDNALRYGDDSPVRVTAGRVGDRVLIAVADEGPGLARGAEDRLFAP
FQRLGDRDTTIGVGLGLSVARGFVEAMGGTIASTDTPGGGLTIEIELAAA
392417951YP_006454556.1 hypothetical protein Mycch_4159 [Mycobacterium chubuense NBB4]MASTINARQGTGDGSRDTRLLGCAAMLALSASLAVMLLATPGSVPAPAYW
FASSVALAVALAVLVLGERSWDRMVASAQAAGLVGR
392417950YP_006454555.1 hypothetical protein Mycch_4158 [Mycobacterium chubuense NBB4]MSRISKTLYTPLSVVMGVGGGLLAGQIFGQIWKRIGENDPEPPDPKDLNS
STATVLTAAAIQGLIVGLVRAGLQRAGARGYQAVTNEPPPA
392417949YP_006454554.1 hypothetical protein Mycch_4157 [Mycobacterium chubuense NBB4]MDVDHPEEDQRWNSRERKETETERLDRNWASLLQELRVVQTGVQLLTGFL
LTLPFQQRFDKLDDAMQNVYLATVSAAVLSTALLIAPVGMHRILFRRHRL
AILVSAAHRCAITGLLLLGSAVIGMTVIIFDAVAGLRPALVAGGAALVLF
AGFWLALPLGMRLGSRPTPAP
392417948YP_006454553.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTDDVTPDAVIPYPGHTADMADRPRDEMRDYIGTGLLAGKRALITGGDSG
IGRAVAVAFAKEGADVAIAYLDEQDDATHTLSLIEAAGQRGADFAGDLAD
PEHCRSIVEQTVEVLGGLDILVNNAAFQSPVSDLTEITDEQWRRTFSVNI
DSFFHVTKAALRHLPDGSAIINTGSINGLRGNKSLIDYSATKGAVHALTY
SLAQSLAPRKIRVNCVAPGPVWTPLIPATMGAEKTENFGEQVPMGRAAQP
DEIAPSYVFFAAGRLSSYYSGEVLAPIGGETLPG
392417947YP_006454552.1 hypothetical protein Mycch_4155 [Mycobacterium chubuense NBB4]MTAPNVSSAKDVVDYLTAQHESIKSLFIETLDAADAETREQAFTRLRTML
AVHETAEEMVVHPRVRRKVEGGTQIADDRLAEEHDAKVQLADIEKLPIDS
AEFSKALIHLQAAVLEHAQHEEELEFTALESTLDADELAKLAEAVAVAER
IAPTHPHPGVESAAANFAAGPFASMVDRARDALGGFFK
392417946YP_006454551.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMKAVTWHGKRDVRVDNVADPKIEEPTDAIIEITSTNICGSDLHLYEVLGA
FMKEGDIIGHEPMGIVREVGAQVSDLAVGDRVVIPFQISCGHCFMCDQQL
YTQCETTQVRDHGMGAALFGYSELYGSVPGGQAEYLRVPQAQFTHIKVPD
GPPDSRFVYLSDVLPTAWQAVEYASVPDGGTVTVLGLGPIGDMAARIAQH
HGYQVFAVDLVQERLDRAAARGIQTIDLRDVNGSLGDAVRSLTNGRGSDS
VIDAVGMEAHGSPVAQGMQTAASFLPDFLGKPLMQKAGVDRLGALYSAID
CVRRGGTLSLIGVYGGMADPLPMLTLFDKQLQVRMGQANVKKWVDDIMPL
LTDSDPLGVDTFATHVVPLDEAPHAYEIFQKKQDGAVKVILQP
392417945YP_006454550.1 topoisomerase IB [Mycobacterium chubuense NBB4]MRLTRSKLDTPGIVRKRRGKGFAFYGPDGELLSDPDTAQRIKDLVIPPAW
KNVWISPRPNGHIQAVGTDAAGRRQYLYHERWQQERAEEKFDRVLELSAR
LPEWRTQIAADLAGRGLTRDRVLALALQLLDRGYFRAGGEQSAEEHEHYG
LATLLCEHVTLKKNAVEFDYPAKSGVQRTVEVDDPEVVRAVRSLMRRNER
TERLLVCRSNSGSWVDVRADDLNTRFKELVGDEFSVKDLRTWHGTVLAAA
AFADAKEPTSKTAVKRAASAVMKEVSQELGNTPAVARASYVDPRVVVGYE
RGVTIAAATRRAAKMKNPDDAQAIVEKATRNLIRRIASK
392417944YP_006454549.1 Rho termination factor [Mycobacterium chubuense NBB4]MPNSSIKSEKMYEDLRREGNSKEKAARISNAAAARGKSSVGRKGGQSGSY
DDWSVGDLKKRAKELGITGYSSLTKDKLITKLRNH
392417943YP_006454548.1 hypothetical protein Mycch_4151 [Mycobacterium chubuense NBB4]MSVTAFQDLPLADRDRDWDGSAAEKRVRQWADATDEPNEKYRNAHVWYDH
DKKDNFTAYKLLIADVIDGKLKAVPRGVMAAAAVMQGSRGGIDLPKDDID
RVKSHLAKYYSKMDDTPPWDS
392417942YP_006454547.1 hypothetical protein Mycch_4150 [Mycobacterium chubuense NBB4]MSEPHSEKAESDVEPDPKVAGSRADDDTDDPSDGPYVGRASSDDDIDTEE
SGAEARSQRG
392417941YP_006454546.1 hypothetical protein Mycch_4148 [Mycobacterium chubuense NBB4]MPDNSHDPVDHARTYRQHAGETVKAGANAPGLILTGLGVLTLAIGLFSFA
NGSRPAGVVGVILAVILIPSGLLWLALRHRKEQKKQLDWHRANPEAPYEP
PTS
392417940YP_006454545.1 cytochrome P450 [Mycobacterium chubuense NBB4]MIEDAISIGGVDLTDPNSYLTGPPLDAFRKLRERAPVAWHPFQEGPGFLA
LTGYDEVVAVSRDSATWSSETDGVYFEAPGPDSPADMRGVMMLTMDPPRH
TALRKLVNKGFTPRQVARLNERIAEMARDLVDNVIEQGECDFVQQVAGAL
PSYVISEMLGIPLEDGFRLYELTEITNAGQVQDARIAEAGMQIFAYAAEL
AARKRVEPGDDIATSLLNAEINGQGLTDMEFNFFFILLLNAGGDTTRNLV
AGGMLALMENPAELAKLEKDTSMMSTAVEEMLRYISPVMWFLRTATRDTE
VRGMPVEKGGRVAMFYPSANRDETKFPDPDTFDITRTPNPHVAFGGGGTH
FCLGANLARVESSALLSEVLARMKNVELAGPVQRMQSMFINGIHSMPVRF
TPAHRLGRR
392417939YP_006454544.1 hypothetical protein Mycch_4144 [Mycobacterium chubuense NBB4]MVVLGVVLLVLAVLAVLAGLLFFGNARGTVPDRPARDVAATRRGLSRINR
SDLFATMRTSVKGAANPDAEQDQRASSLGGFLVLTGLVLVILAIVAFVVA
MI
392417938YP_006454543.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMKVVICGAGIAGLALAHRVAGTGGEVVVLERATGPREQGYMIDFFGPGFD
AAEKMGLLPAIQEAGYRVDEVCFVDQRGRRRAEVPYGLLRKALGGRLISL
MRPDLERVLRESLPATVDLRYSTTVCSISDGPDEVVVTLDDGSLLAADVL
VGADGLHSTVREQVFGPESMFVRYLGFHTAAYVFDSPEVRDAVAGRFALT
DTKNKQLGLYTLRDGRVALFGVHPSSDPRLPDDTRAAVRKAYRGLGWVVP
EALEKCPPPHELYYDQVAQIEMPRWSTGRVTLLGDSCCAVSLIAGQGASL
AVAGAFVLADKLNTAPSVPAALADYERMWRAQVAEKQKAARDAVRWYMPR
STAAIWLRRVALRLAWLPVVNRLVGRTLAGKAASLTTESVHGTMTSALGR
392417937YP_006454542.1 hypothetical protein Mycch_4142 [Mycobacterium chubuense NBB4]MSSPAALHGQEVRQRLLTAAVELIPERGWTAVSTRTLAERAGVTPSVVHY
HFRSLQALLREAVIGAMEREVAELESLLDAVHTADELVEAIFAEVNRPST
GQDTMSLVFVEAYLVATRDEPLRDAIAGLLQASRLRFARRMAEWDVAAAD
DSALILLAALDGLLLYRGLGVASGGATEVLKRLFAGQAKPIDEPR
392417936YP_006454541.1 hypothetical protein Mycch_4141 [Mycobacterium chubuense NBB4]MSSGRLRALELCTAALALVMVAACSHAEAQPRPIADSFAGPDGLITSEKQ
PSPPDSPWELTSGSLFRSAGTGWTGRPDGGGGAGQNGSAVFRMVSKERDF
TNVDVSLTLQVVGLVQTDRTPAQAYDGVHIWLRYESDKQLYAISVDRRDG
IMLIKKKCQGGNDNGGTYYDLDTPVTGTPIPFGQWQHVSASARDQPDGSV
AIDASRDGIALHAVDRGTGCAPLRGGGGVGVRGDNAEFRMAAVTVDPVQ
392417935YP_006454540.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MTVKRQAAHRKPSRLVAMARTGVLILPFLAVVAAYLGVPAVWQWAHAETL
SNRAHPVIVDQIDTPPQPVDPNLVASLRRAPTSPQSSPLILTYHDIGYNS
ATRYTVTPEAFAAQMRLLHDAGWTTITADQLSGWLRGEPLPAHSVMVSFD
DGARGVWRYADPVLERYGQHAVAYLITGFVGTHAPYYMTWPEIAALHASG
RWDLEAHTHLGHQHVPTDAVGGEGPFLTHLEYLADQKRVETQQEYHSRVF
TDLVECRRQFSAHDLPEPTLFAYPFSAHNDDPNGTGMLKGVVGSLYQAAM
LDVPDKISTTASSDVQDGNIARMDVMSDLGLAKWTEKLVEASPLDPTAAK
PIADPTNWTDSGDRPAPLTLDGDGRAVLDPGPRAQITRQYAPYRTSMWNA
YTVSADLGGFSSAGDGTTTGLSVLTGDPQHEVDIEISSAEYSIRRGYGQE
EAVAAGHLVEAAAHHVEAVVRPENVTVTIDGGSPQVVPLNSAGPRQIGGG
IGLIGDREFDASPTPVVSGLAVY
392417934YP_006454539.1 glycosyl transferase [Mycobacterium chubuense NBB4]MTTFAEPVHREAAVEPLPDRRVRPRPRHRRDQRKKSSGITRAVLILALTA
LVVAIFVFKVATLENLRKDPVWATYSIVVTSFILSRFVLAWLYRPARRFT
RSDYRPSVAIIIPAYNEPDIARTLRACLDVDYPAHLLQVVVVDDKSTDDT
LQRIWTVASERSELVVVPAEVNRGKRHAMATGIAAADEDAEVLVFIDSDS
QVTPDAVTTLVRYFADPRVGAVAGHTDVANASTNMLTRMQSMQYYIAFRI
YKSAEALFGSVMCCSGCFSGYRRDAVAPVLDAWLNQRFLGRPSTFGDDRS
LTNFLLPDWRVLYAPDAQAYTNVPERLRQFLRQQLRWKKSWLRESFRAAA
AVRRKHPLMVVMFSLSIALPLLAPQVVLRAMVVQPHFISQLPYWYFGGVA
MMACIYAIYYRLHGPAKGWYQGIFFTMFYTIILVLQLPYAMATVRDSKWG
TR
392417933YP_006454538.1 nucleotide sugar dehydrogenase [Mycobacterium chubuense NBB4]MPHRSPLCGANPPAAATPRVGAVLAPAPDVQPRQRVAVVGLGYVGLPTAL
SLTAAGSEVVGIDVDENRLAAIKDERVELFHGDASRLATALNDQLLKLTT
EPATMKEADAVVICVPTPVDAHTTPDMTALSRACETVVEHAQRGQTIVLT
STTYAGCTRDLLIAPLRQRGFQIGTDVFVAFSPERIDPGVAGHAPESTPR
VLGGFTGRCSERAARLLAHTAAVVHIVSSPEAAEMTKLLENTFRAVNIAL
ANEFADAATELGIDVIEVISAASTKPYGYMPFYPGSGVGGHCIPCDPHYL
LWQMRARRRNSPVVDAAMAAIAARPRAVFGRAVRVLADSGKPLTGARILI
AGVSYKPGISDIRESPALAIIDLLSSQGAHVFFSDPYVDVVRSAVAGTLH
HVANPDQMAWDLVVVHTAHPDHDLGWLAQQPTVLDASYKLADLPNRHLL
392417932YP_006454537.1 Protein of unknown function (DUF3478) [Mycobacterium chubuense NBB4MIEALGGFPANVAAFACHGQVSKADYETVLIPDIEKRLLEHDKVRIYYET
AADFAGVDAGAAWEDAKVGFTHFLRWERFAVVTDVEWIKQAVKLVGFLMP
GHLRTFTPDEAQLARDWVVK
392417931YP_006454536.1 phosphatidylserine decarboxylase [Mycobacterium chubuense NBB4]MPEPDRIVHDLHNLLDREPGLAELLQKSLQKAAERAKDSLNSELYRALDW
PQTLPEYGEYLTSFIRWIPRQTDAPAWKTTAPHERYAKEVNDRLAHFFWL
VDQKVDVDGTAIAENSKAFRGWLTEFARQWGSFLDTGESFDDDILQSFLR
DAPEYTIEESLIDGRPNMPSGWQTFNQFFARELNPGLRPISEPADNRVIT
SPADCSFQHCYDIGPESDIPATTIKGTHRYGNIGQLLEGSRYAGAFSNGT
FVHYMLPPSAYHRFHVPVSGKVEESFVINGQVFMQVDLQDHELQSRDSSQ
SGYEFFQTRGVLTLDTSGSPHGDVGVIAVVPVGMSHVASVNLSTVVGTEV
TKGEEFGYFQFGGSDIIILFQEGVGPEVDTDSAPRRVGSVVARCTQDRRP
QRKGSVDG
392417930YP_006454535.1 peptidase family protein [Mycobacterium chubuense NBB4]MAEERSTLRRELLQELLWAYGPGGQEESVRDICRRELEPCVDETWVDKAG
NLVGFLRGSGSGSQEAKTYDDARGTRVLAHMDELSMIVKRVEPDGTLHVT
PSGVMYPANFGLGPVAILGDNVTLTGVLSLGSEHTTKESLRIWQTKPDKG
DKSLDWVHVFVFTGCTPEELAAAGVHPGTRVCVERSKRTLVDVGDYIGSY
FMDDRASVTALLHAAQVLQSRSQRPSDDVYFVFTTNEEIGGVGASYASRT
LPGDLTIALEVGPTEAEYDTTVGGGPIVAYSDSRCVYDKAVADRLMDIAT
ELDLSPQAAVLGAFESDASHAKASGLSPRAGLLCVQTLSTHGYEVIPSSG
IAALTDVVVEFLLNPA
392417929YP_006454534.1 putative membrane protein [Mycobacterium chubuense NBB4]MASEQDWRDLRSRLARSAAHSRSALKRCGSAHFARLPRPARQGLRLVGHT
VHEALEDRVPGLAAEAALFTLISLPALLLAVIGSLGFVAAELGPAGTEEL
RHLVLGVPRSFLSDPTFSSYERVVQTVLAETHGNVVSLGIVLSIWSGSRA
VNSYLQTMTIAYDIEPRPGWRRRLLALALTLGFLVSAVAVLPPMVLGPRL
LRWLSSGAVEDATLRIVDLFFWPGVILVVFVGLTTVYNVGVPWRTPWRRD
APGALLAMTMWLVASAGLRIYLTISVRQDAVFSQLAVPIAVILWIYVTAF
AVLLGAEFNAEIERMWPHEEHPWRLTPRLSRRTAES
392417928YP_006454533.1 universal stress protein UspA-like protein [Mycobacterium chubuenseMTILAGFSASGHGPAPLHLASQISRCTGEKIVAAAIIERHWPKADPVEDE
YLNFVGTQAKRSLKQMVDQLPEGLDVWEVVHQAASVPEGLTELATEVNAD
IVVVGSSSSGLLGRIALGSVTDRLVHTAAIPVAIAPRGYPAQRGKIERLT
VAYGGQADQVGLVATCAELAERWSARLRIASFTVRPVTMFSGTVEPAAEN
LVIKQWAQRTREGIAAQLEKVRAGVGTLNADVVIGAGPTWRDAVDGLDWE
AGDILVLGSGAAGPAAQVFLGSAAARILRHSPVPTMIVPKREAA
392417927YP_006454532.1 gamma-aminobutyrate permease-like transporter [Mycobacterium chubueMSATPTLKKALSQRQLTMIAIGGVIGAGLFVGSGVVIGATGPGAFLTYGM
AGVLIIMVMRMLAEMAVANPSTGSFADYSRNALGHWAGFSVGWLYWYFWV
IVVGFEAIAGAKIIQYWIDVPLWLSALVFMVLMTSTNLFSVSSYGEFEFW
FAGIKVAAIIAFIALGGAYVFGLWPGKSTDFSNLTSHGGFMPLGFGAITV
GIVTVIFSMVGAEIATIAAAESADPERAVAKAANSVILRILIFYVGAVLL
LVTILPWNDKGVAASPFVAAFTKMGIPYADHVMNVVVLTAVLSCLNSGMY
TASRMLFVLAARREAPPALVKVTRRGVPTNAILASSVVGFLCVIAAAVSP
DTIFAFLLNSSGAIILFVYLLIAISQIVLRYRTPDSELRVKMWLFPVLSA
LTALAIVAILVQMYLDTSLRSQLVLSLLSWAVVIVLFVINKWFVKRRSAE
PAEVSPTGTPHRVLVLANQTVDSRELLDELRRIGAGREAQYMVVVPASPV
DTGAAETHGPRDVTEATQEAATARLDTTLAALRHENLDAQGELGDYRPLR
ALDHAVAKFSPDQIVIATLPAEFSVWHRFDVVDRARAQFNVPVTHVVAQS
AVRNEVPR
392417926YP_006454531.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MRSGGRNHAASTDVGSGVTDQPQLSPTDWVREQTERILEQGTTDGVEIFD
RPIVLFTTTGAKSGQKRYVPLMRVEENGKYAMVASKGGDPRHPLWYHNVK
ANPTVTVQDGDKVATLTARELEGEEREHWWALAVEAYPPYAEYQTKTDRL
IPVFVVE
392417925YP_006454530.1 amino acid ABC transporter substrate-binding protein- PAAT family- MHAGSSVLADPKAAGWRARVGRRLVFLMGALLVVGFGAGVAAAPNAKAQG
QNYVIATDTTFAPFEFQDKNGNFVGIDMDLIRDIAKDQGFTVDIRPLGFD
AALQAVQANQVDGVIAGMSITDERKKVFDFSDPYFESGVQMAVLDTNEDI
KSYADLRGKRVAVKNGTEGAAFAESIKDKYGFSTVYFADSASMFDEVRTG
NSQAVFEDYPVLQYGIAQGNGFKTVTKKEAGASYGFAVNKGRNAELLQKF
NAGLKHLKQSGRYDEILDTYLGKGASTADNSFFGLLKSTFPILMEGLKMT
VILTVVSIAIALVLGTIFGLFRVSRAVWLRAVGTTYVDIFRGTPLLVQAF
FIYFGIPSALGFQMSALTAGIITLSLNAGAYMTEIVRGGIQSVDKGQMEA
ARSLGIGYLPTMRRVILPQAIRTMIPSYINQFVITLKDTSILSVIGIAEL
TQTGRIIIARNFQSFNMWLIIGIIYFIVIMALTKLSDRLERRLVK
392417924YP_006454529.1 amino acid ABC transporter ATP-binding protein- PAAT family [MycobaMNQLVSETATERKGAVKIRIEGLKKSFGDLVVLDGITTTVKEGEVVCVIG
PSGSGKSTFLRCLNKLEDITGGKVTIDEFDLTDKKVDLDKVRQHIGMVFQ
HFNLFPHMTALQNVTLAPLLTKKMGKAEAEKRAMELLGQVGLAEKAHVKP
ANLSGGQKQRVAIARALAMNPSIMLFDEATSALDPEMVGDVLEVLRTLAA
EGMTMVVVTHEMGFAREVASRVIFMADGNIVEDDIPAEVFDHPKHPRLQD
FLSKVL
392417923YP_006454528.1 Cu/Zn superoxide dismutase [Mycobacterium chubuense NBB4]MWKRATAAAALLSAPVVVVAGCNSSQNSSEQTSSSTTSATTTSAAAGAQT
MKAELKTPDGKPVANATIDFTGGYATVTVETVAGGILSPGSHGMHIHSIG
KCEANSVAPTGGPPGNFESAGGHLQVGGRTEHPASGDLTPLFVRADGSGK
VVATTDAFKADDLKGPEGSALIIHAGPDNFANIPQRYTHDGVPGPDAETL
ATGDAGARVACAVLAPASAAGTSTSVATSTSTVTETTAAPGAPATTSPTA
TSPAPATSSPTTTVTTTPVTPTTSVVTTTTSPPLGPPPGPQPGG
392417922YP_006454527.1 hypothetical protein Mycch_4127 [Mycobacterium chubuense NBB4]MTDVRPPFPPFDAQTARQKVQAAEDAWNTRDPHRVSLAYTTDSVWRNRDQ
FLTGRDQIVDFLTAKWQRELDYALRKSLWDFHGNRIAVRFQYECRDSTGR
WWRSYGNELWEFDDHGLMRRREASINDVAIDESERRYFGPRPDDERGHDI
PLH
392417921YP_006454526.1 flavodoxin reductase family protein [Mycobacterium chubuense NBB4]MATLVSVNVGMPRDVAWNGRTVRTGAWKSPVAGPRWIRRLNVDGDGQGDL
GGHGGENRAVLVYQLASYRYWASTLGREDLAPGAFGENLTVDGLPDDEVC
IGDRYRIGEVVLEVTQPRVTCYRVGMRLGEPRMAALLVAHQRPGFYCRVL
AEGQVEAGAGIAKIGSGPERVTVAEVDALLYLPGHPRDALARALRIPALS
PGWKAALQSLLEQDTARPGASGNSGLTGAPAPPAAWRGFRQLEVAAVQDE
SRDVRSVLLRDPEGTPLPKWSAGQSIVVRVERGGRSLVRNYSLSNQPGAG
EYRIGVKREPSGTVSGYFHDCVAVGVLVDVAAPRGTFVLDDGPSPVILIS
AGVGATPVLSMLYAVADTPARLVWWVHGARDGSQHAFAREARRVLNQLPH
SRSDIFYSSPAAGDRLGVDYDHAGRLSAEALQRLGLPVAAHVFVCGPQSF
MDNVTAGLVVCGFPPERVHTERFGARTAITPGVIAVGSRPPHPPEGLPGT
GPSVQFARSGLTAPWRPSDTSLLDFAEACDVPTRWSCRTGVCHTCETALV
SGQVRYTAEPLEPPADGNVLLCITTPADDVVIDL
392417920YP_006454525.1 uncharacterized protein containing a NRPS condensation (elongation)MNEFMRSTDAFTWSMESDPRLRSTVVTVILLDHSPNWDEVRDRIERLTRS
FPMFRQRVVPSPLQAPPRWEDCTDFDLDFHMRRLAVPEGGSFDDVLELAR
LAQMEDFDRARPLWKITLIEGLPDGQAAVLCTFHHALSDGVGGVQIAMAL
FGLSEFPSTEITEPEVSPQPLLGDYRDAARYGAGLMEEAATGVLSTIPRL
LLDGARNPVRTLSSAAEMATSVYRTVRPVNKTGSPLMKKRTLIRRLDVLD
VPMPQLREAAHRSGGALNDAFVAGVAGGLRLYHEKHDIGVGDLHLTMPVS
LRAKDDAVGGNRITLMRFDIPVGVADPAQRIRQIHECTERVRHEKSLPYT
QLIAGFLNRVPRWYIGSILRHVDFLASDVPGIPVPVSLCGAKVLTQYAFG
PTIGSAVNVTLLTYVDTCALGIDVDTGAIPDAELFSECLKAGFDEVLALA
AE
392417919YP_006454524.1 hypothetical protein Mycch_4124 [Mycobacterium chubuense NBB4]MTSTPSQHHTSLARTLGIASVGLGASELIAPDGVARVAGVRPSPRTRRVI
RALGARECGHGAAVLMGSPRLVWTRTVGDVLDVALLVKGLAGSGANRRRG
ALALGILTVIGAADVYAAVDQLR
392417918YP_006454523.1 PE-PPE domain-containing protein [Mycobacterium chubuense NBB4]MSPASDAMALDGSGRAQMRLVLKTAVLLFTALSAAAALIATPVVTLAVTL
AATALIMGGTSHPLSVPEDTPEFIAGYVHNAAGDYIAPSGLCGAGCPLVA
VHTPEEIKFVTGWKDMTFDQSVALGRQNLNDCVQGRPCTVTLAPYTQTGP
PRTVSDSAYVVYSYSESSTVATDEKRYLIAHPAPADVSFLMLANPNRPNG
GILERFAGVHIPILGVTFNGATPTDSPRSAPLTTVDIARQYDGWADFPTN
PLNLLSDLNALVGTVLVHGNYFGVGTPELQGQYQDTTYYLVPTPVVPLLM
PLTWIPLGGRALAIALDPALRVLVETGYDRTTNPGAPTPARYFYVPNLVH
AAVDFAVAVPTGWDNAISYLTHNPTLRPFHTKVPDSPYGVGGPPVYTNAV
DPYGDPTPYAATPSTAEAAPAAVLQRRGREHMPQTAPDSPNDAALQDVPD
VRPEDGTVPPEGTAEAPVTTAADPSPELIDRGIDVGGADDGKDSQGQRPA
PAVRTGPRQTFHQQRHIQHVAHRARPHQPR
392417917YP_006454522.1 hypothetical protein Mycch_4122 [Mycobacterium chubuense NBB4]MSNPSSGPAPDYPQAAAARGRVEPAPRRVRGFLDGDLVFDTTSARYVWEI
PYYPQYYIPLRDVGEGLLRDENHPQRVQFGASRRFAVVAGSRAIEGAARV
FDDGVAAGLVRFEWDALTWFEEDEPIYGHPRNPYARVDALRSHRHVTVAL
DGVMLADTRSPVLLFETGLPTRYYIDRTDVAFLHLEPSATRTLCPYKGVT
SAYWSVRGARGVQADLAWTYNTPLPAVAPIANMVAFYNEKVDITVDGIEL
DRPRTHFS
392417916YP_006454521.1 chloride channel protein EriC [Mycobacterium chubuense NBB4]MTAFPGSDDSAAAVRGTVLVCLTAVFAGAVIGFVGGAFRWCLQQAEALRV
DIAEWAHRLPGPGWLIPIAAAAAAAMLAALIVRWEPLAAGSGIQHVEAVF
RGIAEPPLLRLLVAKFVGGVLAIGSGLVLGREGPTVHMGAAVGAEAARRA
RLPDTDVRMMQSALGGAGLAVAFNAPLAGTLFTAEEVTRSFRLQTVLATL
FASAAAVGCSRLILGNHAAFAVEPVAAPDLAWLPLFVVFGLLTGLLGAFY
NRVVLWFLDHVAALPRVSTVTKAAVIGGIVGLALYVDPLTVGDGDTLTQM
LIGGHSVVLPVVVGYLALRFVSGPLSYSAAVPGGLFAPLLAVGALWGVLF
AGGFDAAWQGDVADLAVPMAVVGMAAFFGATVRAPLTGMTIVIEMTATTS
VAVPMLAATAAAVLAAFLTGSPPIYDSLRDRLLTASAATGGDVPKGL
392417915YP_006454520.1 Protein of unknown function (DUF732) [Mycobacterium chubuense NBB4]MRATIIMTAVLAGSVLATVWAAPAFADDTDDVFIDALDSEGIPFSTTENA
ITLADAVCDYVAAGQARDQVAVEIMGPANWTAEQSGLFVGAATRSYCPS
392417914YP_006454519.1 hypothetical protein Mycch_4119 [Mycobacterium chubuense NBB4]MERNNNPPPTPEDATKATEEQRELQDKLEHQNEDPEAPAATQSYRQIPDE
S
392417913YP_006454518.1 putative membrane protein [Mycobacterium chubuense NBB4]MSAALLLSFAVIFVAELGDKTQLVAMMFALRYRWWVVLTAIAAATTAVHV
LSVAIGHYLGAALPTHLLGVLAGAMFVFFGLWTLRGDSLSDEEASRADKA
TAPAFFVVTSAFILAELGDKTMLATITLAADHNWLGVWIGSTLGMVAADG
LAIIVGAVAGKHLPERFIQLAAAALFLLFGAYLLLENVFPGAPAVVLGAA
AFAIVGLIAVILRMLPERMRPAVMRSDEAPEAEVLEMKSPAREEDSARPT
DAGR
392417912YP_006454517.1 hypothetical protein Mycch_4116 [Mycobacterium chubuense NBB4]MAVTTLLEPSLAELDFEPDILCTCRRFCGPLAHPAQWWVTLSCGCPYPMC
QRALRIANVRLKVRPLTCRHCETDQIAIRSVVRI
392417911YP_006454516.1 transposase IS116/IS110/IS902 family [Mycobacterium chubuense NBB4]MIFVGDDWAEDHHDVYLMDEAGQRLAARRLPEGLSGIRALHELIAVHADQ
PDQVLVGIETDRGLWVSALAAAGYQVWAINPMAAARYRDRHHVAGAKSDA
ADAKLLADLVRTDRHNHRQIAGDSPDAEAIKVLARSHQSLIWARTRHANM
LRSALREYYPAALEAFDALTDGDALAILGRAPTPEQGAQLSLAKIGSALK
AAGRQRNIEARAAEIQAVLRRKHLTAPPAVAAAFGATTTAAVHVIAALNT
QIADLETALADHFETHPDADIYRSLPGLGVVLGARVLGEFGDDPNRFTTA
KCRKNYAGTSPLTIASGRKRAVLARHVRNKRLYDAIDQWAFCALLRSPGA
RTYYDEHRAAGDTHHQALRALGNRLVGVLHGCLRHHTRYEEHKAWAHRQT
AAA
392417910YP_006454515.1 hypothetical protein Mycch_4114 [Mycobacterium chubuense NBB4]MKFTRTLGASVIAGGIALAGLSAGLGTANAQPGPHCGQPNTPACQPAPRS
DWQHRDIDQGRRDHQPFMYNGQQVHPLPAGNGDGWGFWFLGRWIRL
392417909YP_006454514.1 hypothetical protein Mycch_4113 [Mycobacterium chubuense NBB4]MQGVIVMNKFIAAGLLPVAALLALSATAQAEPSPSGSSQGPSATETINQL
KSQGLDVRVNRIGSGPMDKCTVANISRAVTQPPIIPAFDWHDVNVFTRYP
QPVVTVTLNCSR
392417908YP_006454513.1 putative cobalamin binding protein [Mycobacterium chubuense NBB4]MRSLNPTRPGPEAFRAYDSAVARDDAGAATALVERLLDDGVDAVSILTDV
IAAAQRDNGTRWQRGEWTVAREHAATAIAVSATKAVTRYVRRTPPTRGRV
LVACAEREWHALPAMIIDCALRTDGWDSILMGAATSPVRLNQYLQDYGPE
AVAVSCSVLGSLAATRRFIEASTAAGVPIVVGGPAFGADDVRAKALGATG
WAADADGAVTAIARLPAVVPPATPLPAAAAAEQGDLEHDHRRIVAALRSS
WSVTSGSAPPPDIADDVFNQLLHAISAVLLTGDSRPVPETAAWIADLMIT
RGRTIAVVHELADRAAAALSDHPLARDIVETHFADGL
392417907YP_006454512.1 serine phosphatase RsbU- regulator of sigma subunit [Mycobacterium MRRIGGTAVRTRTQLAEEIEIGLAGSLNPRRTAMRLLSLLRPEFADWASL
VLPDSTTDGLRLHGGDAVGFTAIVARSPRTDTRLERLLRTGNTDLIPLGE
KTAAALAEMVPLGRLRDEVAVMGDGQLLAVGLNARGATLGALMLARRSGF
DSDDVAFAARIGLRAAMALDSARLYEERTQIAAVLSGALRPPSLPEVENL
RLAARYRPAAEHLDIGGDFYDIIGSGSDWLLALGDVSGKGVKAAAVTGRT
RQSVRTAAHFDRHPAAVLRALNGALYGLAADQFVTVLCAHVRVAADGGHA
DVELATAGHQGPIVIRADGRVEQLEMYGTACGMLSDVEYHAVRLRLHRND
TMLMFTDGVEEARGPDGLLGVERLVALLPAYAGAAADVVCEAVEQYVIEH
VDGGPHDDIALLAVSCGR
392417906YP_006454511.1 anti-anti-sigma factor [Mycobacterium chubuense NBB4]MQQFNERHVDGVVVVAAVGAIDMLTAPQLQDLISDAAARRPAGLIIDMTD
VDFLGSAGMQVLMTTRKHIGDGTRFAVVADGPATSRPLKITGVSDFVELF
STLDVALTNFATDSAD
392417905YP_006454510.1 CsbD-like protein [Mycobacterium chubuense NBB4]MGDNNSGPEEAVKGAVEGVKGKAKEVVGVVTGRDDLQREGEAQQDKADAQ
REAAQKEAEAESARAAAKTNEERQKAEQA
392417904YP_006454509.1 anti-anti-sigma regulatory factor (antagonist of anti-sigma factor)MTVTSIRSRSADCRRFSVASTALTVVCRTQGRGADKEVTVSVSGEVDAAN
AKHFAHAVREAAGVSASVVLDLTDVNFMAFDGLSALYALSAHLSREDVTW
CVVGSKAVSRVLELCDPEGLIPLATGIPTLRGAEPA
392417903YP_006454508.1 Cytochrome D1 heme domain protein [Mycobacterium chubuense NBB4]MHTIQAEVFREMANFLRSLMPMRQVVRNGKNDSSVIHDARVAVSEGNTAS
QRRLIVGRGPVGDIAVGRAAVVVANPLDDSVSILTNETQALIDTVALDGE
PVAVAVTDDRAYVATASVGRDAVSAIDLESRRIVATYTLSSGVTALAVSP
DGKRVYAGRSEGDRVDLTVIDTTAERIGTIAVGSAPAANIDAVRVDPSGK
RLYVAVTDDIGSQLVVVDAETTRVKRVIPVGSPIRDIAYAGDAVYALTSD
RAVGGAVAAIDLATGAVTDTLTLGGAPTQLAVSPDEARAYVVDYDRVAVV
CTLTLEVIESLPADARPSCVATNGSRLFVADYSGAVDVHAVESTIEKVYS
QFLTTDPIALSVPRDRQPVAV
392417902YP_006454507.1 response regulator of citrate/malate metabolism [Mycobacterium chubMITVLIVEDEPLIAEAHQTYLARLQGFSVAAVVHSARDAMRAASEAAASD
TPIDLVLLDIGLPDANGIALASALSGLRPAPDIITITSERDLEMVRAAIG
HGALAYLLKPFTFAAFRDRLERYQRYREALPAGTDAASQAEVDRALAELR
VGPNRAAAPKGAAPATNDEIARVVRDSGDDGVTADEVAKQVGVSRVTAWR
YLERLADEGTVGRHTDYGKAGRPKTRYQWR
392417901YP_006454506.1 signal transduction histidine kinase regulating citrate/malate metaMARIRAAWPRSLAGQAIVLQILVIAVVVAAGSALALLDARRDGDSAARQQ
VLGIATSLADAPSTAQAIEAGRATEILQPVTEAVRTHTGIAFITIMAPDR
TRFTHTDPSQIGGAYIGTIGPALRGETFTESYTGTLGPSVRAVAPVRDSS
GRIVGLVAAGILQKSLADRWRAQWPIIAAVGVGALAISLIGVWGIRRRLL
RQTRGLRPEELRVMYDHHDAILHSVSEGLIVLEDAGVALVNDEARRLLSL
PAGPVERADLPEFLREHDPGVRDEIHVTDDRVLVVSRSKVGHPGGRATDG
SEVVTIRDRTELQGALGELNSLKVLTDSLRSQAHEAANTLHTIVTMVEMG
RADDAVTFATAELELSQHLVDRLSAAVSEPALVALLLGKSAQAGERGIEL
TITEDTALPADTDELLLSGQEMVTVLGNLIDNAMDACDRSDPWVEVTVNQ
DDERLLIRVADSGEGMDAKLFEKAMRRGYSTKRGTGADQHGLGLALVAQV
VNRHHGSLRADVTYGSVVTVTVTAR
392417900YP_006454505.1 Na+/H+ dicarboxylate symporter [Mycobacterium chubuense NBB4]MTTTMDRPAGEPTPPGAPKRRDRTHWLYLAVIVAVVAGVGVGILAPEVGK
SVGVLGTMFVALIKMMIAPVIFCTIVLGIGSVRRAATVGKVGGLAFVYFL
AMSTFALAIGLVVGNLLHPGSGLHLSASAAGKGAELADKAHEAGGLLDFV
QGIIPTSLFSSLTEGSVLQALFVALLVGFAVQGLGSRGEPILRGVEHLQK
LVFKVLAMILWLAPIGAFGAIANVVGQTGWAAVGQLLTLMLGFYLTCTIF
VFGVLGAMLRLVSGVSIFKLVRYLAREYLLIVSTSSSESALPRLIAKMEH
LGVDRSTVGVVVPTGYSFNLDGTAIYLTMASLFIAGALGDPLSLGEQIGL
LVFMIVASKGAAGVTGAGLATLAGGLQAHRPELLDGVGLIVGIDRFMSEA
RALTNFSGNAVATLLVGSWTHTIDKVKVHAVLAGDDPFDELTMLDDEDGS
RAQEPAPERIPAPV
392417899YP_006454504.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MKRVFVVGVGMTKFEKPGGRAACGADHENRREGWDYPQMAKESGTKALED
AGVDYSEIEQGFVGYVAGDSTCGQRALYELGMTGIPIVNVNNNCSTGSTA
LYLGAQAIRGGLADCVLALGFEKMQPGSLGGGADDRESPMKRHILALNEI
DAMQFPVAPWMFGAAGREHMRKYGTTAEHFAKIGYKNHKHSVNNPYAQFQ
DEYSLDDILAAKMISDPLTKLQCSPTSDGSAAVVLAGEDYVSRHDLAGQA
VEIVGQAMTTDFASTFDGSAANIIGHDMNVKAAQQVYQQSGLGPDDFQVI
ELHDCFSANELLLYEALGLCGAGEAPKLIDDDDTTYGGRWVVNPSGGLIS
KGHPLGATGLAQCSELTWQLRGTADKRQVEGVTAALQHNIGLGGAAVVTA
YQRAER
392417898YP_006454503.1 hypothetical protein Mycch_4102 [Mycobacterium chubuense NBB4]MALRVVQWATGGVGVAAIRGVLEHPELELAGCWVHSAAKAGRDAGEIAGT
GPLGITATSSVDEILALQADAVIYTPLMGDSDEVAALLRSGKNVVTPVGW
LYPSERSGAPLRAAALEGNATLHGTGIAPGGISEKFPLMLSAMSTGVTFV
RAEEYSDLRTYEAPDVLRHVMGFGETPDKALTGPMQKLLDAGFIQAVRMC
VDQLGFAADPKVRASQEIAVATAPIDSPMGPIEPGQVAARKFGWEALVDG
EPVVRVTVNWLMGEENLDPAWSFGPDGQRYEMEVRGHPDFTVSVKGFQSE
VGGQGPEYGVVGTAAHCVNSVPAVCAAAPGIATYLDLPLISGKAAPDKSR
GVGADG
392417897YP_006454502.1 dienelactone hydrolase-like enzyme [Mycobacterium chubuense NBB4]MDQSRPTPVDVDVATPTGPIRAALAVPAGAGPWPGVVVVHDAFGLSDDIR
RNTRRFADNGYLAIAPDLFSRGYVRCVRSVMRSMAQRSGQAVDDLTAARS
VLADRSDCTGKVGIAGFCMGGGFALVMGTMGFDASAPFYPSLMRDYGFLC
DGSCPVVASYGRKDPLNLGNGPRLRKSLDDNGTPNDVKVYPGAGHSFANE
HSGQPVLRIAGFGYDADATDDAYRRVFDFFGTHLVAGR
392417896YP_006454501.1 putative esterase of the alpha-beta hydrolase superfamily [MycobactMTGDQRALVLAGGGLAGIAWETGVLLGVCDEEPEAGRALLEADVLLGTSA
GSAVAAQLGSGVSLEDLFDRQLSSRYGSYEIHPGVSVDAITELFLSAMLT
PGATKEQKLQKIGAVATSTDTVPESVRREVIEHRLPSHQWPQRSLRITAI
DTATGELVVFDNASGVGLVDAVAASCAVPGVWPPVTIGARRFMDGGVGST
VNMSAVHDCGAAVAFVPSASDSPSPWSTPAAAEIDAFPGATLAVFADPES
IAAFGPNPLDPACREPSARAGRAQGRREARRVAEFLDLVL
392417895YP_006454500.1 putative esterase of the alpha-beta hydrolase superfamily [MycobactMRVALALGSGGARGYAHIGVINELRERGHEIVGIAGSSMGALVGGLEAAG
KLDEYALWASSLTQRAVLRLLDPSITSAGVLRAEKILDAVREILGEVTIE
ELPIPYTSVATDLITGKSVWMQRGPVDDAIRASIAIPGLITPHLLDGRLL
ADGGILDPIPMAPIAAAVADVTIAVSLGGDDPEAHRAGSADARPTADWLN
RMWRSTASLLDTKAARSLLDTPTGRAVMGRFVAGDDEPVEEMTAPAAPKL
GSFEVMNRVIDIAQGALARHHLAAYPPDLLIEVPRTVCRSLDFHRANEVI
DIGQELASTGLDTLENRLSEH
392417894YP_006454499.1 hypothetical protein Mycch_4098 [Mycobacterium chubuense NBB4]MVLSGCSSNTGPAPSTTSAAPTTSSAQAAAPTPPLLPGGVEVSPGGVTTA
VGAPAESTEDGYFRACQAARTWIQQQGGDPKSQIEPFLKMVQTGGPVGPA
TFDKPWAQLSQGQQSAVIVAVQAAADDLCG
392417893YP_006454498.1 Cysteine dioxygenase type I [Mycobacterium chubuense NBB4]MVLAPTRLRPADLLHVTDRFADDVLGGRHDHLLPTAGPPAAERWFTRLHG
TDELDVWLISWVPDRSTELHDHGGSLGALTVVSGALCETRWDGRALRRRL
LNSGDQAAFPLGWVHDVVWARESVTVRDGAMASTPTLSVHAYSPPLTAMS
YYDVTERNTLRRKRTELTDQPEGK
392417892YP_006454497.1 Rhodanese-related sulfurtransferase [Mycobacterium chubuense NBB4]MGSRIDVVLENARTRLARLSAEDVPAAIRRGAVLVDIRPAAQRAIEGEVP
TALIIERNVLEWRCDPTSEVRVPQAVDDDVEWVVLCSEGYTSSLAAAALQ
DLGLHRATDVVGGYHALKGVLVY
392417891YP_006454496.1 putative membrane protein [Mycobacterium chubuense NBB4]MTDTGEAPAVAPDEAPPQQETPAPDTRPKRKAWWVRHYTFTGTAVGLIFL
WFSLTPSLLPRGPLFQGLVSGGAGAFGYGIGVFAVWLVRYMRSKDSSPPA
PRWAWLILVVIGVIGMVGMIIWFHHWQDRVRDLMGVPRLGFWDHPLAAVL
SIVTLFVLVEIGQLIGRLVRFLKHQLERVAPPRVSGVVVVVLLLALTIAL
LNGVVVRFAMHTINTTFAAANDETDPENAAPDSPLRSGGPRSLVSWESLG
HQGRVFVSGGPSVEQLTAFNGQPATEPIRAYAGLNSADGIKATAALAALE
LQRTGGLDRAVVAVATTTGTGWINEAEASALEYMYNGNTAIVSMQYSFLP
SWLSFLVDKENARQAGQALFEAVDELVRKMPENKRPKLVVFGESLGSFGG
EAPFLALNNLIARTDGALFSGPTFNNTIWNELTRNRDPGSPEWLPIYDDG
YNARFVARPSNLQRPPAPWGKPRVVYLQHASDPIAWWSPDLLFAKPDWLS
EKRGYDVSPDMEWIPIVTFLQVSADMAVAVDVPDGHGHVYVKNVADAWAE
IMSPPGWTQEKTERLRPLLHSDESA
392417890YP_006454495.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMTSYETILVAREDRVATITLNRPKALNALNSQVMAEVTTAAAELDADPGV
GAIVVTGNEKAFAAGADIKEMASLSFADVFAADFFAAWGKFAAVRTPTIA
AVAGYALGGGCELAMMCDILIAADTAKFGQPEIKLGVLPGMGGSQRLTRA
IGKAKAMDLILTGRNMGAEEAERAGLVSRVVPADTLLDEARDVARTIAGM
SLSASRMAKEAVNRAFETTLAEGLLYERRLFHSAFATDDQTEGMNAFTEK
RSPNFTHR
392417889YP_006454494.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMHSVDENEDVLVNVSGGIGYLTLNRPKAINSLTHHMVGALEKALTAWEKD
DAVSAVVVSGAGDRGLCAGGDVVAIYHSAKAGGAEARQFWHDEYLLNAYI
GRYPKPYVAVMNGITMGGGVGISAHGSVRVVTETTKMAMPEVGIGFIPDV
GGTFILSRAPGLLGLHAALTGAPFSGADAIAMGFADHFVPHDSLAAFTET
IETHGVEAALAAHAQEPPPSNLLQQREWIDRCYAGETVADIVAALREHGT
GTAAAEAADLIASRSPIALSVTLAAVRRAVSLQSLEDVLRQEFRTSCASL
RSHDLIEGIRAQLIDKDRNPMWSPSSMDAVTAADVDAYFAPADPDLEFDQ
H
392417888YP_006454493.1 putative membrane protein [Mycobacterium chubuense NBB4]MRESSNPVFRTLPKGQQGGYAQFGTGAAGYGAQAVHADPYATQYPQQRQT
GVSRPLTIDDVVTKTGITLAVVTAVAAVSYFLTQASPALMFPMFMIGGIG
GLVLVLVATFGRKQDNPAIVVSYAAFEGLFLGAASYMFANLVSNGGPAMI
FQAVVGTLGVFFGMLVVYKTGAIRVTPKFTRMIVAGLFGVLALALVNILF
AIFTGNAPLTNGGPLAIGFSLLCIALAAFSFLIDFDAADQMIRAGAPEKA
AWGIALGLTVTLVWLYIEILRLLSYFNDN
392417887YP_006454492.1 hypothetical protein Mycch_4091 [Mycobacterium chubuense NBB4]MPSCVPSSPLPAWPFLGSEAVASGRLKKHHLRARFCAIFPDVYVPAGVEP
SLLQRAVGAWLWSRRRGVIAGAAAASVHGARWIPDDEPIEMVWSNARPPA
GIVTRRDALCEDEVVRVAGLPVTTPERTAFDIGRLTRGDKGVARLDALGN
ATRFGADSVLRLATRHAGSPGVPRLRAALELHDRGAESPRETWLRLLLIR
NGYPRPRTQIPVVDDYGRPRYYLDMGWEGAMVAVEYDGDHHRERAAFGND
IIRAEFIERRRWRRVRVVAGHRPAEILDRVARAWAAGVRSDRRIG
392417886YP_006454491.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MPEAVIVATARSPIGRANKGSLVSMRPDDLAAQMVKAALEKVPSLDPRDI
DDLMMGCGQPGGEAGFNIGRAVAVQLGYDFLPGTTVNRYCSSSLQTTRMA
FHAIKAGEGDAFISAGVETVSRFGKGTADGWPDSKNPLYADAMARTEQAA
AGATEWHDPREDGALPDVYIAMGQTAENVAAFTGISREDQDHWGVRSQNR
AEEAIKSGFFEREISPVTLPDGTTVSTDDGPRAGTTYEKISQLKPVFRPN
GTITAGNACPLNDGAAAVVIMSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKKALANAKMSIGDIDLYEINEAFAVQVLGSARELGMDEEKLN
VSGGAIALGHPFGMTGARITATLLNNLATRDKTFGIETMCVGGGQGMAMV
VERLS
392417885YP_006454490.1 lysophospholipase L1-like esterase [Mycobacterium chubuense NBB4]MRTPRRSTLALAAAATLASTGSAYVGARNLLSGQADQARQIIPKSWDIPP
RADGVYTPGGGPVERWFRGVPFDLHLMVFGDSTATGYGCTTADEVPGVLL
ARGLADRSGKRIRLSTKAIVGATSRGLSGQIDAMFVAGPPPDAAAILIGA
NDITKPNGIGPSARRLGRAVRRLRDSGAVVVVGTCPDFGVIKAIPQPLRW
VARSRGLRLARAQAVAVRAAGGVPVPFSDLLAPHFYKAPEVLFSPDMFHP
SAAGYELAAKQLLPALCNSLGEFIPGLPEDEALESRSADGASLLSRVGGL
SRFWRRSTGVPAPIVVPAG
392417884YP_006454489.1 esterase/lipase [Mycobacterium chubuense NBB4]MTAPSKVPGPAALGIRPGRAHKVRRFPVSDGAPVEVVEDGPSIAGRLMGL
AAMLTVKPTLTVGSYAPNLPWPWGIVDFAARILRPAPGTVRATIGLPHCN
AQLVRAAGVLPADGRRTVVLYLHGGAFLTCGVNTHGRLVTALSKCADAPV
LVVNYRMIPKHSVGTALDDCYDAYKWLRDTGYEPDQIVLAGDSAGGYLAL
ALAERLQAEGTNGFVGETPAAVVTMSPLFEIDNETRADHPNARTDAMFPP
KAFHALVELIEAAAAKHVVDGVPEEVYEPLDHIEPGLPRTLIHVSGSEVL
LSDARKAARLLAAAGVPVEVRIWPGQMHVFQLGAPAVPEASRSIKQIGEY
IREATW
392417883YP_006454488.1 cystathionine beta-synthase [Mycobacterium chubuense NBB4]MRIARHISELIGNTPLVQLNSVVPPGAGMVAAKVEYLNPGGSSKDRIAVK
MIDAAEASGELKPGGTIVEPTSGNTGVGLALVAQQRGYKCIFVCPDKVSE
DKQNVLRAYGADVVVCPTAVAPDDPDSYYSVSNRLVGEIDGAWKPDQYSN
PMGPESHYETTGPEIWADTDGKVTHFVAGVGTGGTITGAGRYLKEVSGGR
VKVVGVDPEGSVYSGGTGRPYLVEGVGEDFWPSAYDPSVPDEIIAVSDAD
SFDMTRRLAREEALLVGGSCGMAAYAAIQVAEREGPDALVVVLLPDGGRG
YLSKIFNDGWMSSYGFLRSRLDGSVEEHTVGDVLRGKSGELPDLVHTHPS
ETVRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRA
KLADAVSQHMSPALPLIGAGELVSTAAKTLRECDAVMVVEEGKPVGVLTR
HDLLGYLSEGSGRR
392417882YP_006454487.1 hypothetical protein Mycch_4086 [Mycobacterium chubuense NBB4]MADHPPPTGNSPPPPPPPGGYPPPPSAAGGFPRAQSAFDYPPAPGPVAPL
PKESYTPWLTRVLAWIIDYIPVAIVEGIAWGIVLGTQETDCVTDTSDYGM
GGFCSSTTSTTGQSAMVLAGALIVAYVVWNLGYRQGTTGSSIGKSIMKFQ
VVSEKTWQPIGFGLSVLRQIAHIIDGAICYIGYLFPLWDAKRQTIADKIM
ITVCVPVHNTTKQEIR
392417881YP_006454486.1 hypothetical protein Mycch_4085 [Mycobacterium chubuense NBB4]MTDNPGGYPPAGGYPPPPPGSQPTPQGGYAPPPPPGGYPPPPHGNYPPPG
AFPPPQGGGYPNAPAPVLPKEAYTPWFTRVLAWFIDNIPVFIIVGIAQGI
AILTGDNNCVDYNGGLSCTSSYSVVGSIVTFLGSVLSLAYVVWNYGYRQG
TTGSSIGKSVMKFKVVSEKTWQPIGFGLSVVRQIAHIVDAIICYIGYLFP
LWDRKRQTIADKIMTTVCVPITPQGSMPGAGPQHY
392417880YP_006454485.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MSTAGATTIESLLDLDSLLSEEDRDLRTMVRQFGEQRLRPHIAEWYEAGE
VPVRELAPEIGKLGLLGMHLTGYGCSGSSATAYGLVCQELEAVDSGLRSL
VSVQGSLAMFAIHRWGSEEQREQWLPGMAAGELIGCFGLTEPDFGSNPGG
MRTTARRDGSDWILNGSKMWITNASVADVAIVWARSQDDDRRVVGFAVPT
STPGFSAREMTHKLSLRASVTSEFSLDDVRVPDDARLPEAQGLSGPLSCL
SEARFGIVFGAVGAARDCLEATLDYVGSRQVFDKPLAGYQLTQAKIADMA
VELAKAQLLALHLGRLKDEGRIRPEQVSVGKLNNVREAITIARQCRTLLG
ANGITLEYPVMRHAGNLESVLTYEGTSEVHQLVIGEALTGVSAFR
392417879YP_006454484.1 cystathionine beta-lyase/cystathionine gamma-synthase [MycobacteriuMSEQRSAADHYRAFGIATKAIHAGYRPDPATGVVNPPIYASSTFAQDGVG
GLRGGYEYSRTGNPTRSALEAALAAVEVASYARAFSSGMAASDCALRALL
RPGDHVVIPDDAYGGTFRLIDKVFTRWGVDYTAVALSDVDAVRSAVTDRT
KLIWVETPTNPLLTIADVGAIASLAAEKKVKVLVDNTFASPALQQPLTLG
ADIVLHSTTKYIGGHSDVVGGALLTNDEALDDAFGFLQNGAGAVPGPFDA
YLTIRGLKTLPLRMQRHSENAALIAEFLDSHPAVGTVLYPGLPTHPQHDV
AARQMSRFGGMVSVRLRGGPQAARDFCARTEIFILAESLGGVESLIEYPG
AMTHASTAGSQLEVPDDLVRLSVGIEDAADLLGDVEQALSSLA
392417878YP_006454483.1 hypothetical protein Mycch_4082 [Mycobacterium chubuense NBB4]MTQIAEDLLLLLLDNASAQPALDSPRRDRALAAAVLLDLAHQCRIHPAVS
GEPAAGRLVALDVAGAAEPPHPVAVPALRLLQTRPLRPATAIKKLGRHTE
GRLLQHLEQRGQIRRVMFSPKLFHRSYRFPLTDRDRVGSARAALLNALFD
CRPPTASTAGIVTVLHAVDGLGALLSLNDRGWRWVHARAGEIASGSWVDE
SPTGLPEVNLAVTASAVRQALAQMA
392417877YP_006454482.1 transcription elongation factor GreA [Mycobacterium chubuense NBB4]MTDTQVTWLTEEAYDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGY
HAAREEQGQQEARIRQLQELLNNAKVGEAPKQSGVALPGSVVKVYYDDDE
KDTETFLIATRQEGITDGKLEVYSPKSPLGEALIDAKVGETRTYTVPNGN
TVKVTLVSAEPYHG
392417876YP_006454481.1 hypothetical protein Mycch_4080 [Mycobacterium chubuense NBB4]MIERPAARYGRQRLSRRSRRWLVIALTALVLIIGVAIAAVAFTRFNSSDV
KGELAGYRVVDAQTVEVTVSVTRDDPSRPVACIVRARSYDGDETGRRELL
VTPSTDKTVQVKTLVKTSKPAVVGDVYGCGSDVPSYLVGS
392417875YP_006454480.1 mycothiol conjugate amidase Mca [Mycobacterium chubuense NBB4]MWLHCGVKFNASVHAGEQLRGNRLSELRLMAVHAHPDDESSKGAATMARY
VDEGVRVLVVTLTGGERGDILNPAMDLPEVHGRMSEIRRDEMARAAQILG
VEHHWLGFVDSGLPEGDPLPPLPEGCLALEPLERPVEALVRVVRDFKPHV
MTTYDENGGYPHPDHIRCHQVSVAAYEAAADYRLYPEAGEPWSTHKLYYN
HGFLRQRMQVLQDEFAKHGQEGPFAKWLEKWDAGEDLLAKRVTTRIECAK
YFPQRDEALLAHATQIDPNSFFFTTPMDWQQRLWPTEEFELARSRVPVSL
PETDLFVGIEDLT
392417874YP_006454479.1 hypothetical protein Mycch_4078 [Mycobacterium chubuense NBB4]MNPAVATMMTRVLAENGPQNTGPDFGKASPFGLIVIVLLLIAVFGLVWSM
NRHLRRLPKSFDREAPGPGQTAGAGAPDADPDLSTDNPATGPKREPD
392417873YP_006454478.1 thioredoxin domain protein [Mycobacterium chubuense NBB4]MSPTNTLASATSPYLRQHADNPVHWQQWGPDALAMAAERDVPILLSVGYA
ACHWCHVMAHESFADGEVAAAMNADFVCIKVDREERPDIDAVYMNATVAL
TGQGGWPMTCFLTPDGRPFFCGTYYPKPQFLQLLAAVSETWRTRRADVEQ
AGERIAGELRSMSTGLPRGGPAVQAETCDNAVAALLADEDRANGGFGRAP
KFPPSALLEALLRNHERTGTPTPLATVTRACDAMARGGLYDQLAGGFARY
SVDSAWVVPHFEKMLYDNALLLRVYAHWARRTADPLARRVAGETAHFLLE
ELRRDAMLVSSLDADAAGREGLTYVWTPGQLREVLGEGDGRWAAELFDVT
DTGTFEGGTSVLQLRADPDDTARFDAVRTVLRAARQTRPQPGRDDKVVTA
WNGLAITALAEAAFALGQPELLSAAIECARAITSLHVVDGRLRRASLGGV
VGESAAILEDHAALATGLLTLHQATGERAWLDAATALLDVALDHFADPDQ
PGRWFDVADDAEQLMLRPADPLDGATPSGASLMAEALQLAAHLASGERAR
RYAAAAESTLSSAAVLLTRAPRSAGHWLAVAESAVRGPIQIAVACEAPDS
ELLAAARALAPGGAIVVGGPADSAEFLLDRPRVDGRDAAYVCRGRTCDLP
VTSVEDLAAALGPSV
392417872YP_006454477.1 ketosteroid isomerase-like protein [Mycobacterium chubuense NBB4]MSFEPDVLQGFVQRYLDTVANGSADDVAALYAEDATLEDPVGGGEVHIGR
QAIAGFYKGMDGDTDIKTELLTFRAGGHEAAFVFAITVGGAMRIEPIEVM
TFGEDGKITSMKAYWGPQNITPL
392417871YP_006454476.1 channel protein- hemolysin III family [Mycobacterium chubuense NBB4MPTSLEPWYTADAPREPEDLPEAVAEGVAQILGKPRLRGWIHVYSAVVAV
ICGATLVAVSWSVESTRAGIATLIYTLTIVAMFTVSGTYHRVNWTSARAR
KWMKRADHSMIFVFIAGSYTPFAMLALPERSGEVLLWIVWSGALAGVLLK
LFWPSAPRWVGTPLYILLGWVAAWFIGPIMQGAGIAAVVLLIVGGALYSI
GGVLYALKWPNPWPTTFGHHEFFHACTAVAAICHYIAMWFAVF
392417870YP_006454475.1 undecaprenyl diphosphate synthase [Mycobacterium chubuense NBB4]MDLIPRRLKEPAYRLYEMRLRQGLSRQRNELPRHIAVLCDGNRRWARELG
HDDVAYGYRAGARKIAEMLRWCAEAGIEMATVYLLSTENLQRDPEELSSL
IEIITDVVEEICAPANQWSVRTVGDLELIGEEPARRLRDAVQSTDGNGGT
FHVNVAVGYGGRQEIVDAVRALLSKELANGATGEQLIEAVTAEAISENLY
TSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAYWPEFRRVDFLRA
LRDYSARHRRYGR
392417869YP_006454474.1 hypothetical protein Mycch_4073 [Mycobacterium chubuense NBB4]MIAPSAVVFALSWWLGLYLLARDPRKLVLVLSAIGLTTFAAVVALDAVRL
VGASEHLGRVEIYLVAVPGIAWFAVLLELSQPRDTWRSRAGEAALVAVVA
VVAFTGAAMAGDVEGPLRLGHWVLFAAVSVSSLGAMIYAVVRRSQPGPVV
GFIVVATLFFALGNAILVIPLGLVPSWLALASTGFDVAMLGVAVAIVDAF
DEGHAVRRDMLRSVVATTLVAVLFGGQVLIGLAVAGPSTTLAVLLFTSLA
IAIAINVLADPLASLLDKLAFAQSPDLRADRAALRSTEAALPLRSGHPLE
GMDEETFVRVTRRALGHYGDLSKLVASPLTALPAIDERLARRGAADTPLE
RANELKALLAERIAALKPRDGADFGITEQWRHYNSLYFPYVAGVRAYAQN
ATAAGLDPLARQAWQWFVTEVPQRSLHNWQNAAARVIATDLRSDLVTAR
392417868YP_006454473.1 hypothetical protein Mycch_4072 [Mycobacterium chubuense NBB4]MTTLGVMTAITTRHAPPVTPSEAQLLRLALRADATLCAGLGLFVAMAADP
LARLSGLTATANWIAGAALVAYGVLVYSAARVPSIRGVGLAVLAGNIAFV
ATVAVMLAAGWLPLTRWGEAAAVGFTVVTVVLAALQYLGVRRLA
392417867YP_006454472.1 hypothetical protein Mycch_4071 [Mycobacterium chubuense NBB4]MTAAISTRLNESTDSLLRFAMRADAVISGLAGVVMLIFGPKVAELSGTTA
ALEYTVGALFVVFALAVLAFASRPAVRTPGLVIAVGNLLFSVASVVVVVA
GVWPLTTTGVVLVLGTGVYTLVMAELQYQGVRRIGRS
392417866YP_006454471.1 pantothenate kinase [Mycobacterium chubuense NBB4]MARLSEPSPYVEFDRTQWRALRMSTPLKLTEDELVKLRGLGEKIDLLEVE
EVYLPLARLIHLQVAARQALFATTAHFLADSDGEPHQNPDRPVPFVIGVA
GSVAVGKSTTARVLQALLARWEHHPRVDLVTTDGFLYPNAELARRNLMHR
KGFPESYDRRALMRFVTAVKSGSDAACAPVYSHLLYDIVRGEKQIIRHPD
ILILEGLNVLQTGPALMVSDLFDFSVYVDARIEDIEEWYISRFLSMRAGA
FADPASHFHHYSTLTDEQAVFAARDIWHSINRPNLIENILPTRPRATLVL
RKDADHSINRLRLRKL
392417865YP_006454470.1 hypothetical protein Mycch_4069 [Mycobacterium chubuense NBB4]MNSAALIREYLLLGLRFDRVEQGYVDSFTGDPALRRAVEAEPQPDPAELA
RQARRLLAELPGGLDDDRAAFVGAHLRALDCAGRKFAGEEVGFVDEVEAY
FDVRITKGDPARYQEAHDRLDDALGGTGSLAERMQTHRASEEIPPARLEE
AIHAFSSALRDRVRATFPLPANETITYEVVTDKPWSGFNYYLGDYRSTVA
VNADLKQQMSNLPRLVAHESYPGHHTEHCRKEAGLVEGKGHAEQTLFLVN
TPQCLMAEGLADLALYAAVGPGAAGEGQGWGSWAADIYADLGLRFDGERA
EILADAGLLLADVRQDAALMLHDEHRDVDDVVDFLERWLLVDDKRARQML
RFLSSPLWRAYTSTYVEGYRLLRGWLDARPDGVTLTERFGTLLDEPLIPS
SLRAA
392417864YP_006454469.1 glycine/serine hydroxymethyltransferase [Mycobacterium chubuense NBMTADVTAGQGAEYADTASEAYRAALRVIESVEPRIAEATRKELDDQRNSL
KLIASENYASPAVLLTMGTWFSDKYAEGTVGHRFYAACQNVDTVEALAAE
HARELFGAPYAYAQPHSGIDANLVAYWAILATRIEAPGLAELGAKHINDL
SEADWEGLRNKLGNQRLMGMSLDTGGHLTHGFRPNISGKMFHQRQYGTNP
ETGFIDYDAVAAQVREFKPLVLVAGYSAYPRRVNFAKMREIADEVGATFM
VDMAHFAGLVAGKVFTGDEDPVPHAHVVTTTTHKSLRGPRGGLVLATEEY
APAVDKGCPMVLGGPLSHVMAAKAVALAEARRPEFRTYAQAVADNAQSLA
DGFVKRDAGLVTGGTDNHLVLLDVTSFGLTGRQAESALLDSGIVTNRNAI
PADPNGAWYTSGIRFGTPALTTRGFGADDFDRVAELVVEVLQNTQPAAGP
NGPSKAKYTMADGTADRVRAAAAELLDANPLYPGLTL
392417863YP_006454468.1 Fatty acid desaturase [Mycobacterium chubuense NBB4]MAQKPVADALTLELEPVVEKELRRHLDTEDAWFAHDYVPFDQGENFAFLG
GRDWDPSQVSLPKPITDALEILLITKDNLAGYHREFVEHFILEDKWGRWL
GRWTAEEHLHAIALRNYLVVTREVDPTANEDVRVAHVMKGYRADTYSQIE
TLAFMAMWERSHAVFCRNLAAQITEPALAALVGKIAGDEERHTEFFTNLV
AYCLGYAREETIDAIAKRAEALGVVGGDIDAYGDKVAVVAEVGIFDEEKR
RRVVSDSVNAWGLADEPRLAQFISS
392417862YP_006454467.1 PhoH family protein [Mycobacterium chubuense NBB4]MTESLARTYVLDTSVLLSDPWAFTRFAEHEVVVPLVVISELEAKRHHHEL
GWFARQALRMFDDLRLEHGRLDQPIPVGAQGGTLHVELNHSDPSVLPAGF
RNDSNDARILTVAANLAAEGKDVTLVSKDIPLRVKAGAVGLRADEYHAQD
VVTSGWTGMAELEVAGEDVDGLFADGEIDLESARDLPCHTGIRLLGSSSH
ALGRVNADKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGK
AGTGKSALALCAGLEAVLERRTQRKVVVFRPLYAVGGQDLGYLPGSESDK
MGPWAQAVFDTLEGLASPAVLEEVLSRGMLEVLPLTHIRGRSLHDSFVIV
DEAQSLERNVLLTVLSRLGSGSRVVLTHDVAQRDNLRVGRHDGVAAVIEK
LKGHPLFAHITLLRSERSPIAALVTEMLEEISPGALP
392417861YP_006454466.1 putative xylanase/chitin deacetylase [Mycobacterium chubuense NBB4]MRTRPDSLAWRYTRTVLGVAAAVAVLVIGGLTGHVRPAKAGNVDCAQVKC
VALTFDDGPSPFTDRLLQVLRDNNAQATFFLIGNKVAANPAGAKRIADAG
MQIGTHTWEHPNMTSIPPEDIAAQFSKGIDAIQAATGQRPTLSRTAGGLV
DDAVLAEAGRQGLADINWDVIPFDWANDSNTAATRALLMSQIKPNSVVLM
HDTYSSTVDLVYQFIPVLKANGYHLVTVSQMLGLRAPGSVYGSRENGPPV
NDLVDIPPDQIPSLPATPSPAPMPNFPITDIAGQNSGGPNNGA
392417860YP_006454465.1 hypothetical protein Mycch_4064 [Mycobacterium chubuense NBB4]MLAHHDTVASELVTTAPSQPPLKTGFVMLGLASLLNLSKVRHGWGADRML
AASGAAAAGWYLTEELRRR
392417859YP_006454464.1 fumarase [Mycobacterium chubuense NBB4]MTADNVVDDTEYRIEHDTMGEVRVPKDALWRAQTQRAVENFPISFRPLER
TQIRALGLLKGACAQVNKDLGLLAADKADAIIAAAAEIADGQHDDQFPID
VFQTGSGTSSNMNTNEVIASIAARNGVTVHPNDDVNMSQSSNDTFPTATH
IAATEAAVRLLIPALEVLHESLDAKARQWRTVVKSGRTHLMDAVPVTLGQ
EFGGYARQIQAGIERVRGCLPRLGELAIGGTAVGTGLNAPDGFGDKVVEV
LRDQTGIAELRSAVDHFEAQAARDGLVEASGALKTIAVSLTKIANDIRWM
GSGPLTGLGELQLPDLQPGSSIMPGKVNPVIPEAVTQVAAQVIGNDAAVT
IGGASGAFELNVYIPMMARNVLESFTLLTNVSKIFAAKCIDGLVANEEHL
RDQAESSPSIVTPLNSAIGYEEAAKVAKEALKERKTIRQTVVDRGLIGDK
LSEEELDKRLDVLAMAKVADERLREE
392417858YP_006454463.1 fructose-1-6-bisphosphatase- class II [Mycobacterium chubuense NBB4MTSPEALRPSGSSQPRREAPDRNLALELVRVTEAGAMAAGRWVGRGDKEG
GDGAAVDAMRELVNTVSMRGVVVIGEGEKDNAPMLYNGEEVGNGDGPECD
FAVDPVDGTTLMSKGMPNAISVLAVAERGAMFDPSAVFYMNKIAVGPDAV
DVIDITAPIGENIRRVAKAKKVTVPDLTVCILDRPRHKQLMADVRAAGAR
IRLISDGDVAGAISACRPNSGTDMLAGIGGTPEGIITAAAIRCMGGAIQA
QLAPTDDAERQKALDRGHDLDRVLSTEDLVSGENVFFSATGVTDGDLLKG
VQYYGGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAVDFTGDKTAAY
PLP
392417857YP_006454462.1 hypothetical protein Mycch_4061 [Mycobacterium chubuense NBB4]MTTTPEPGQNLATPRDGGPNGAHRPDAGAVGYTVPIARPAKSRLLQDGRD
MFWSLAPLVLACVVLAGLLGMCSFAPTGPGRGPAPDYDAPAALQADADAL
KIPIRVPKLPDGWQANSGSRRGIEAGRADPVTGQPVRAVASTVGYLTPSG
MYLSLTQSNADEDKLIASLGPDRVPTGTQDVDGVRWIVYEGGESGGKPVE
PVWTARLKGPTGPAQLALTGAAGTAEYRTLAAATQSQSPLAAK
392417856YP_006454461.1 dienelactone hydrolase-like enzyme [Mycobacterium chubuense NBB4]MTALESDLSGWVATPFTAEGYTHDVYRKGDGPGVVLIPEMPGLHPGVLAL
GNHLVDNGFTVAAPSLFGTPGASALGPGALPVLVKGCVSKEFAALATNAD
RPVARYLRALARDLNASTPGTGVGVIGQCFTGGFALAAAVDDSVLAPVMS
QPSVPLPLTLKHRRDPGVSEAEMQVIEKRAADEGLCVMGLRFSEDAMAPR
DRFTTLKNRLGDAFEVIEINSKRGNEHGIGRMAHSVLTDQVREVDGHPAY
EARKRVVEFLKSRLT
392417855YP_006454460.1 putative permease [Mycobacterium chubuense NBB4]MTDEFTDTQKRALAVVTVIALGFGAYFLREYVLLLAIAAVLAYLFRPLYV
RLRKRMNVGLSATATLLAAILTVAVPLAGVGVLAFLQISQMVTAVGHWAE
QTDFTALAQRLLDSVNQVLHRIPFVDVTLTQESVRDAAAKLGQNAGQIAL
GVARNSVGGITAAVAGLVLFLYVFIALITSGDKVVALFRDLNPLGERVSD
IYLAKMGAMVSATVKGQFIIAVCQGVAGAISVYIGGIHDGFFMFVIFLTA
LSFIPLGGGIVTIPLGIGMAVFGNVAGGLFVVAFHLLVVTNIDNALRPFL
VPRSAHLHPALMLLAVFAGLRMFGFWGIVLGPVLMIVIVTTISVYLAVYK
GAPMESIAGTRAEPFDDAAERQTPWWRRLLPGTSKPASEPASGPVKSDET
392417854YP_006454459.1 short-chain alcohol dehydrogenase [Mycobacterium chubuense NBB4]MSFAGKHAIVTGAGSGIGAALCRALDQAGAHVLCTDVDEAAAEATRAALS
SRAGAARLDVTDAAAVQAAVDAVVDRAGRLDLMFNNAGIVWGGDTELLTL
DQWNAIIDVDLRGVVHGVAAAYPQMLRQGHGHIVNTASMAGLTAAGQVTS
YVATKHAVVGLSMALRSEAVPRGVGVLVVCPAAVETPILDKGAVGGFVGR
DYFLQNQGKAYDADQLARDTLRAIERNKAILVKPAVAHAQWWFARLAPVL
MNRMAMRFVAGQRTRQGDRSQSAAPGSG
392417853YP_006454458.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSNGSERIAVIVGGASGIGWATAQALAADGCRVTIADLNGEGARERAAEL
GGPHAAAQVDVTDEPSVQRVFDGLGPLDIAVNCAGFSNLGLITDMPVDDF
RAVIDVCLTGAFIVAKHAGRTLRDGGSLVQVSSLNGRQPAAGMSAYCAAK
AGLSMLTQVAALEMGPRGIRVNAVAPGFVHTPLTAAAASVPGVVEDYIDN
TVLGRAGTPADIANAVVYLCSPGSSWLTGEVLDINGGAHLKRYPDLMGHV
MKLVEQS
392417852YP_006454457.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMTELKRSESISVAVPPDELYAMVSDVTRMGEWSPVCKACWWDDGDGPRVG
AWFTGRNVTPERTWEARCQVVAADPGRTFAWEVNNGWVYWGYEFEPDGDG
TRLTESWEFLPAGIAGFRERLGDGADSEIGRRSEAARTGIPATLAAIKQA
AEKG
392417851YP_006454456.1 hypothetical protein Mycch_4055 [Mycobacterium chubuense NBB4]MSERLVHVPAQTAVLGSDEHYPEEGPQRAVEVAEFWIQATPVTNAQFAEF
VSATGYVTVAERPLDAAEHPGAPKENLQPGSMVFTRTAGPVDLRHLSQWW
TWTPGACWRHPVGPLSSIEKRADHPVVHVAYEDAEAYASWAGLGLPTEAQ
WETAARGGLTAATYTWGDEPEPPGRPLANYWHGDFPWRPDRGYGRTTPVG
SFPPNAYGLFDTAGNVWEWTTDWYADRRDARDCCASASRDPRQPQFPVPR
RVIKGGSFLCADSYCRRYRPAARRPQPVDTGMSHIGFRCVQR
392417850YP_006454455.1 hypothetical protein Mycch_4054 [Mycobacterium chubuense NBB4]MSVAELGFWTDGAAKSAILRFVDRAVADVAPEERVAVFDNDGTLWCEKPA
YIQLDFLIRRLAQMAREDSALTAKPAFRAALEENLAWFGDAVTRHYQGDD
SQLEELAGAVLSANAAISVDEHATRVKAFFEQTTHPTLGRPYTACGYAPM
IELLRYLEAHGFTNYIASGGGRDFMRPVTGAMYGIPPERVIGSSVGLVYR
DGTLVTTAQPEFFDDGPVKPVRIWGRTGRRPIFAAGNSNGDIEMLQFTDS
GPQPSLSLLVRHDDADREFDYTAGAEKALGLADTSGWTVASMRNDWAQVF
CE
392417849YP_006454454.1 arylsulfatase A family protein [Mycobacterium chubuense NBB4]MPDGKPNILVIWGDDIGISNLSCYSRGLMGYFTPNIDRIADEGMLFTDSY
GEQSCTAGRSSFITGQSVYRTGMSKVGMPGVDVGLQKEDPTIAELLKPLG
YATGQFGKNHLGDLNKYLPTAHGFDEFFGNLYHLNAEEEPEHEDYPTADE
APLLRTALLPRGVIHSWATDEDSGETDERYGPVGRQRIEDTGPLTKKRME
TIDDETTSACADFIRRQHTADTPFFVWMNMTHMHFRTHTKPESRGQAGRW
QSPYHDTMIDHDRNVGTLLDLVDELGIAEDTIVIYSTDNGPHANSWPDGA
TTPFRSEKATNWEGAFRIPEMIRWPGKIKPRSVSNEIVQHHDWLPTFLAA
AGEPDIVDKLKAGHTIGEMTYKVCIDGYNLLPYLTGEVDKSPRRGMIYFS
DDGDVLGIRAENWKIVFMEQRCPGTLQVWFEPFTPLRAPKLFNLRTDPFE
HADVTSNTYWDWLIDRLYLMFYGSAIVNRFLETFKEFPPRQEPATFTINH
AVAELENFLATRGG
392417848YP_006454453.1 hypothetical protein Mycch_4052 [Mycobacterium chubuense NBB4]MALAVCLLFDRRSDRAVRSLWDRLESVGVPSLRSHTHGRHLPHVSYAVLR
QWDDGAVRAALAGIDDGDPVELDFDGMGVFRRGRVWLAAGVSADFVARQQ
RVVAAVATAGADLHKHYRPGVWLPHCSLAPRATLSQLPDVAAAVMDVLPL
HTRLDRAALINSGTGDVHPLPAMP
392417847YP_006454452.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMAHFRFTDSGDARIRFLDSGGDDLGAPVIFVPGFTDIADDYTEAVTALGR
RTAVVELRGHGRSSAPPEGYDSDTLAADVAAVVDALTDGPVHLMTFSRGT
PYAVVWALANPGRVLSLSIGDYVPEEITLPDDVIVGLLDGRWRGTPVHER
VDRNAGLATVRAARAQSFWEPLARWQPPLCVVRSPNSPLISAADWSRYRQ
LFPEARLEEFADSPHDIFRPDRGRYPALVREHIGAVESG
392417846YP_006454451.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMGDASLTTDLGRVLVTGGSGFVGANLVTELLDQGLEVRSFDRAPSPLPAH
PRLETVQGDITDTDDVARAVGSGTAAVDTIFHTAAIIDLMGGGSVTEEYR
RRSFAVNVTGTENLVHAAQKAGVKRFVYTASNSVVMGGQRISGGDETLPY
TQRFNDLYTETKVAAEKFVLSQNGVSGMLTCSIRPSGIWGRGDQTMFRKV
FESVLAGHVKVLVGGKNVKLDNSYVHNLVHGFILAGQHLVPGGTAPGQAY
FINDGEPINMFEFSRPVVEACGQPWPRFRVPGRLVWFAMTVWQLLHFRFG
LPKPLLEPLAVERLYLDNYFSIAKAQLDLGYQPLYTTEQALEHCLPYYVD
LFHRMKSESHAPMAHAAAPVPPEG
392417845YP_006454450.1 Exodeoxyribonuclease VII small subunit [Mycobacterium chubuense NBBMKPISEMGYEEARDELIEVVQTLEHGGLDLDASLKLWERGEQLAKCCEEH
LAGARQRIEQALTAGDDDEG
392417844YP_006454449.1 Exodeoxyribonuclease VII large subunit [Mycobacterium chubuense NBBMGNDSPGRSPENPFPVRGVAIRVAGWIDKLGAVWVEGQIAQLTLRPNSNT
AFITLRDPAADMSLSLTCPRDLVTDAPVKMTDGTQVIVYGKPSFYTGRGT
FSLRVSEIRAVGIGELLARIERLRRLLDAEGLFDPRLKRPIPFLPGTIGL
ITGRASAAEHDIVAVASGRWPAVRFAVRNTVVQGPNAVPQIVEALRALDS
NPDVDVIVLARGGGSVEDLLPFSDETLCREIARCTTPVVSAIGHEPDNPL
CDLVADLRAATPTDAAKRIVPDTAAEQALVADLRRRSARALRNWVNREQH
VVSQLRSRPVLARPLEAIEARSGEIDRARTAARRDIKRLVAAESDRIGHL
SARLTTLGPAATLARGYAVVQSVPPSGPARVLRSVADAPAGARLRVRVSD
GAVTAISEGVDEAY
392417843YP_006454448.1 hypothetical protein Mycch_4047 [Mycobacterium chubuense NBB4]MATAPYGVRLLVGAAVTAIEETRKLPQTILMYPMTLASHIAQLVMKVQQD
VAVLVIKGDETLETIFPPRDEQPEWATFDEDLGGGPGGGDVVELPVRDGE
RMTEGRFALFSGEPDTATVSSARDTDANSGSGTSDAPEIVAEIDYESLTL
AQLRARLTSLRVSDLEALLAYEESNKGRAPFQTLLANRITRASAK
392417842YP_006454447.1 (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase [MycobactMPTTVNMGIPGASHTALGSVAGGVSGKRVLLAEPRGYCAGVDRAVETVER
ALEKHGAPVYVRHEIVHNRHVVETLAKAGAVFVDETDEVPEGAIVVFSAH
GVAPTVHETAAARDLQVIDATCPLVTKVHNEAKRFARDDYDILLIGHEGH
EEVVGTAGEAPDHVQVVDNPDAVDDVVVRDPDKVIWLSQTTLSVDETMET
VRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSN
SVRLVEVALGAGSDAAHLVDYADDIDPAWLDGVTTVGVTSGASVPEILVR
GVLERLAEHGFDTVQPVTTANETLVFALPREIRPSRT
392417841YP_006454446.1 cell division protein FtsI/penicillin-binding protein 2 [MycobacterMVFAVMLVLAGCSNAEDRLNSTVHAFADALSRGDAPAAAALTSDEAAASG
TLNKLYESLGKDVHVEVDKTQKQDDAATFTLKTTWKFGPQKRTEWSYTSD
GQAKADGDTWKIRWTPATVAPGLDEGPLSYSTLVPQPAARVLDRTGAELL
TQHIVTLVDVAPGADVNAVAALLNPVAPTITAQSLAADLAAAGGKPVTAV
TLREDDLTPIQPQLSTLANVTLRPQTRLLATDRALTSPTLSGLSDLWQQR
MDAADGWAVTAQTDAGTKRVGGQDAKPVGDIASTLDIGMQRAAEHALAPL
PTPAALVAIQPSTGNLLAVAQNTPADQQGAIALTGLYPPGSTFKTVTVSA
ALQAGQVTPDSVVACPGTENIEGRQIPNDNNFDLGQVPLHTAFAKSCNTT
MGRLAVDLPADGLTKAAAQLGLGIDYTAPGMTTVTGSVPVADTSALRVEE
GIGQGKVTASPFGMALVAATLARGTVPAPAIVEGRPGKPDRAPEPLPPGV
DEQVKSMMRETITGGTATQLQDIPGMLGKTGTAEYIDDQHAHGWFVGIDG
DLALAVFVSDAGSSTPAVNAAGDFLRSAG
392417840YP_006454445.1 hypothetical protein Mycch_4044 [Mycobacterium chubuense NBB4]MPWWGAVLIAVVASVLGFAFDAGSGGGQLTGAFSALYVIGCVAAVLAVRQ
ANVFTAVIQPPLLLFVAVPGAYFLMHSSDIHGIKDILINCGYPLIERFPL
MLFTAAVVLLLGIGRWFLGRSAAQNAAADAPAPARGSRLAAKISSLIGGA
DEATPAEDAPRRRHSAERRRNAKPAPGRAARTGARSAKRAASSAEKPSRS
HHTRPADTEIIEPVVDRPRRRRPRPAEAPASETRRRTRSASDRERRSSLP
PTERRASYDRPERAERERPQRSARPRPPRPSRYDGYEPLEPHGGGPLSGG
THHPVSRVRYRGEGDTDDQPEYRTRRRAPRDFDADRWEYDI
392417839YP_006454444.1 GTP-binding protein YchF [Mycobacterium chubuense NBB4]MDPVGLNLGIVGLPNVGKSTLFNALTRNNVLAANYPFATIEPNEGVVALP
DPRLDELAKMFGSEKVVPATVTFVDIAGIVKGASEGAGLGNKFLANIRES
DAICQVVRVFSDDDVVHVDGRVDPKSDIEIIETELILADMQTLERALPRL
EKEARTHKERRPVHEAAVAAQQVLDSGKTLYSAGVDTSLLRELNLLTTKP
FLYVFNADESVLTDPARVAQLRELVAPADAVFLDAKIEAELQELDDESAA
ELLESIGQTERGLDALARAGFHTLKLQTYLTAGPKEARAWTIHQGDTAPK
AAGVIHSDFEKGFIKAEIVSYDDLMAAGSMAAAKAAGKVRMEGKDYVMAD
GDVVEFRFNV
392417838YP_006454443.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMIAMPLGERALAALARQLGEPTGFAGRVVGRLLNRGNRSIVVAAVAAAGC
GPGADVADIGFGGGVGLERLLDCDGTVVHGVEMSETMLTEANRRFSDPIA
RGRLRLHSGRMERLPLEDSALDAIISTNTIYFVPDLAAALRELVRVLRPG
GRLVLGVGDPDQMSKMPFTRHGFRLRPIDELVPMIREAGFGQIEDKRVGD
GHGAFHLLVCELPG
392417837YP_006454442.1 hypothetical protein Mycch_4041 [Mycobacterium chubuense NBB4]MKFVSTRVITADVLQLVTFYEMVTGATANWGNELFAEIPTAVGTLAIGSD
KTVPLFGDGSAEPAANRTAIIEFIVDDVDAEWERLRGHVSEVVTEPTTMP
WGNRALLFRDPDGNLVNLFTPVTEEARAKFGV
392417836YP_006454441.1 arsenite-activated ATPase ArsA [Mycobacterium chubuense NBB4]MTKPQFLTDPPRFLFFTGKGGVGKTSIACATAIEMAHDNKAVLLVSTDPA
SNIGQVFGMTIGNTITEIPQIPGLSALEIDPEQAAQAYRDRIIEPLRTSL
PQAEIASVTEQLSGSCTTEIAAFDEFTSLLTDNSGRLATFNHVLFDTAPT
GHTIRLLQLPGSWSSFLQNGQGDASCLGPLAGLEKQKATYAAAVAALADP
TRSRLLLVARPSRSALAEIDRTHRELAALGLTRQHVVINGVLPEPADSSD
PLATAIHRREQAALAAMSTELKRLPLDVIELKATNMVGVSALTTLFDISP
TQADNATLIAEEPIPDVAVHPLKDLVDDIEKGGPCLVMCMGKGGVGKTTI
AAAIAVALAERGHDVRLSTTDPAAHLNETLCDSVEKLAVSRIDPVAARDA
YKQRVMETKGAALDEHGRADLAEDLRSPCTQEVAVFQAFSRVIQESRRKF
VVLDTAPTGHTLLLLDATGSYHRDIMRNAAPGVHYVTPLMRLQDRAATKV
LLITLAETTPVLEAAELQADLLRAGIHPWAWIINNSVAAAEPTSPLLRRR
AALEVAQIEKVRTELADRYAVIPLLATEPVGIPALEALLAPAQPLAVE
392417835YP_006454440.1 protein-tyrosine-phosphatase [Mycobacterium chubuense NBB4]MLFVCARNSGKSPMAAGLMRAIADTKIAVYSAGTNPGTSLDDLSVQALLD
VGVDITGEKPIDPQLLSDVDLIVTLAREVRIEPIDGVVMENWNTAEPSER
GIDGIERMELIREDIAGRVTGLATRLLDTPTSESRQPPDNGSPSED
392417834YP_006454439.1 protein-tyrosine-phosphatase [Mycobacterium chubuense NBB4]MTDSPVFSKRHVRPDLSIDQQHALLTAATRLRRDFDDTFGMGSIERFLHS
SYDQFASRAAIPNFLPLLAERFARQRLNALARVEGKVVDAKPTVLFLCTH
NAGRSQMALGFFSHLAGGNAVAWSGGSEPADEINPAAIQAMAEVGIDITG
EYPKPWTDEIVQAADAVITMGCGDACPIIPGKRYENWDLPDPAGQGVDAV
RPIRDQIEQRVRRLLTDLGVTAPGPQH
392417833YP_006454438.1 arsenical-resistance protein [Mycobacterium chubuense NBB4]MSATTTDSAVVEKLSLLDRFLPVWIGLAMAAGLLLGRLVPGLNTALDKIE
IDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLVSSLLLNWILGP
ALMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVL
VALNSIFQVVMFAVLGWFYLSVLPGWLGLEQTTISTSPWQIAKSVLIFLG
IPLLAGYLSRRLGERAKGRAWYEQNFLPRVGPWALYGLLFTIVILFALQG
DQITSRPWDVARIALPLLAYFAIMWGGGNLLGAALKLGYERTTTLAFTAA
GNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVALVYVSLALRRRF
TRHTSQHIPSPSRSTQE
392417832YP_006454437.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MSKSALTLRDATECAYAPMVREPLSIEAAAEIAGKLKALADPVRLRLFSL
VASHVGGEACVCDISAGLDVKQPTISHHLKVLKEAGLLASERRSSWVYYS
VVPSTLRTLAAVLDVADDGALA
392417831YP_006454436.1 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily [MyMSRMQLALNVDDLGEAVTFYSKLFNTHPAKLKEGYANFAITEPPLKLVLL
ENPGKGGTINHLGVEVESSATVHAEIARLTGEGLFTDEEIGTTCCFATQD
KVWVTGPGGEKWEVYTVLADSETFGISPKHADGESDAPGVCCGGTAAQSA
ETTDATCC
392417830YP_006454435.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MPKSLPTIDMSTPVCCAPVAAGPMSDDDALHVALRLKALADPARVKIMSH
LLSSDAGEENSGDLAKVLGLTESTVSHHLSQLRGAGLVESNRRGMNVYHR
PHRDALGALCIVLDPNCCT
392417829YP_006454434.1 putative ester cyclase [Mycobacterium chubuense NBB4]MTEGDLLTIYRDYLLCLNERRWDELGRFVADGVVHNGVRLGLSGYRAMLQ
GDTAAIPDLRFVPEILIADDRFVSCRLFFRCTPRGAFLGFEPTGGRVSFA
EHVFYRFENERIVEVWSLIDRDAVREQISQER
392417828YP_006454433.1 dihydrofolate reductase [Mycobacterium chubuense NBB4]MGILTYAATVSLDGYAADADGDFQWSAPGDAVFAVHVDRMADVSVEVLGR
KTYALMTYWESYPDDDEHPLPEREFARRWQGIEKVVASSTLTHDDLVSGR
DRLLPDLSLDELRRIVDGAAGVVEIFGPTVAAAAIRAGLVEEFQFFVVPK
MVGGGLRALPDDVHLDLSLVEYRPFDDGTVQLRYRPRR
392417827YP_006454432.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTFDVSPDAYGRFMGRYAEPLAKVFTSFAAVGAGDKVLDVGCGPGALTAH
LASVGAEVTAIDPSPRFIDAMRARFPDIDVRRGTAEELPYPAATFDAALA
QLVVHFMVDAAAGIRQMARVTRPGGVVATCVWDGPTGALAPFWDAVHVLD
PAAQDEALLSGARRGHLTELFAAAGLRNVDEQAIAVDVVHPTFDEWWEPY
TFGVGPAGDYLARLDDAGRARLQTVARERLGDGPFTVSATAWAARAAV
392417826YP_006454431.1 hypothetical protein Mycch_4029 [Mycobacterium chubuense NBB4]MNPTSLEEDLHEFAIELRKLAYTMPGGCEDPLIRLSERMAQVAEHASAFD
QPRKGPARQVFTG
392417825YP_006454430.1 hypothetical protein Mycch_4028 [Mycobacterium chubuense NBB4]MAEHGARTAQERVGVAVEGERIAEERESIAAEREQIADDRELLADTREAA
STRLLTEASSRVADHELRAEQKVQREQAAVRREQAEVERERAASEREQAR
RKMEVERRRAIQEGGINDH
392417824YP_006454429.1 hypothetical protein Mycch_4027 [Mycobacterium chubuense NBB4]MTTDGRAPQTGDSDHRETELDEREHALDRREAALEDREFRADRRDRIAEE
RDRIANDREIVADERERRADDREGTAALRERERLQRAADSEARYGARADR
EQAEITREMDESERRGQG
392417823YP_006454428.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MPLRYVDPHKKRGRSYARSARFGRSPVGQFIARHIARRTDPYLFRLTGGR
VNMGPVINAPLVSTGAKSGQKRQVQLTYFNDGPDVILIASNFGGAKHPQW
YHNLKAHPECEFGDEPFTAQQVTDPDEYARLFSLAERIYPGYRDYRAKTA
PTGRTIPIFRLVPR
392417822YP_006454427.1 hypothetical protein Mycch_4025 [Mycobacterium chubuense NBB4]MTAVAVLLMVVAAAVIGYHVGRRAAVPSPTWRQRTRRSALGRQAIGLITL
LAVGELERTMQRRLRGRARLRR
392417821YP_006454426.1 hypothetical protein Mycch_4024 [Mycobacterium chubuense NBB4]MPTDHPPGRRVLGKKASAVSIVVASAATLVILFAIMTGSHGSSPQVQSIP
APPTAVSQRTSAPVKPEPVATRPPAATLAMDEHGFVGSDARCDSRQQAVV
IARTERSAIVVCRASDGSYEYEGVRLHDGAFLRLNDVRPIAAGFEARNDT
TTYRLSPTELVVISGETLQSRDPIVEYRTG
392417820YP_006454425.1 hypothetical protein Mycch_4023 [Mycobacterium chubuense NBB4]MTLERALDQTRTGDIWLFRGHSGPDRAIQSMTNSPVNHVGMTVAIDDLPP
LIWHAELGDKLLDLWAGSHHRGVQLNDLRQAVERWIHSYDQRCWLRQLTP
HASREQEDRMLRVIAKMDGTPFPSTARLTGRWLRGRIPVVSDFTRGIPFV
HRKVRESAERRKAVKTGAGLQTAYCAETVAITYEEMGLLTTEKHFNWFDP
GSFWSGDSLPLAQGYRLGAEIAVLA
392417819YP_006454424.1 hypothetical protein Mycch_4022 [Mycobacterium chubuense NBB4]MQRKRRAKWGIYKWVGLAGVAGVVAGGVLVARDQRRRNSYTADDIRARLH
QRLADAEHGGRAT
392417818YP_006454423.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MQIALCVLGVVAVGEAIALAVLTQRMRSAQNEADELRRRLDTRQMLVSGG
TKAVKTVWQTANILRRDGLGAAVRSSIEELADWAEVERPDLARLAPGGRV
AIMFSDIEESTALNERLGDRAYVRLIGKHDKSVRRHVDEHDGYVVKSQGD
GFMVAFSRPEQAVRCSMAIQRGLLKRSNGIRVRIGIHSGKSVLRGDDLFG
RNVAMAARVAAAADGGEILVSEAVRDAVDGSADCGDIAFTDERAVQFKGF
SGSHTVYSVDVIDD
392417817YP_006454422.1 hypothetical protein Mycch_4020 [Mycobacterium chubuense NBB4]MTIPQAPYYESRFIRANDPHADRALWLRETVLVPTGGEPSADVWLMVFDT
DGPRALKHEFPIGTADFRYDEWTARIATTTLDDTAAHGALDDAARWHLTI
SPGDGDPVRVLSDRLYTARFPTAKTLVRQPKARFDGRIEIGGAGIEVDGW
TGSVNHNWGTRHTPAYAYGQVCGFDNAPESTLEIVTARAALGPLLLPGVT
LFVFRHAGQEFAVRTIGGSFQSHARYAPFTWTFGARAGDRMIEGEISTVP
ADVIGLTYGDTHGGVKYCYNSAIAHCRLQVAGKAFERAELVSRRAMFEIL
TDDRLDTVPLLA
392417816YP_006454421.1 4-aminobutyrate aminotransferase family protein [Mycobacterium chubMTPEHHTAGFNFLTQPELPAPRVTEAQARDILSAHYGITARAASLGSQQD
KNFLVTDGDGTVAGVLKVANPAFTAVELQAQDAAAALIAELEPTLRVAVP
LDNTAGEKCTAIDGLVDGTAYVRLLRWLPGGTLLETGYLTPAAVGALGDV
AGRVSRALEDFTHPGLDRILQWDLRFGKDVVDALSSHIADTELRRRVETA
AHEAWARITPLDDALPRQAAHIDLTDANVVVSPDSRAPRPDGIIDFGDLS
YTWAVSELAITASSVLGHPGAELTSVLPAIRAFHAVRPLTDEEAQTLWPM
LVLRTAVLIASGAQQSVLDPDNEYVTNQSDAERQMFDIATSIPMDVMSAV
VTAALRPALPVDPVPVAAPLICADPATTVTLDLSTTSDVYDDAFDAAGVL
SAGVEDESAVAALRAGASAVITRYGEARLSRAPRLSQDSPDVVATGVSVW
TADDTVVAAPWDGDVDVDGGSITLHGKDFELTLSGATASSTGAARAGEPV
ARATGRIELAVRPAGAPVAPAFTRADLAPGWLAHTRDPRPLLGLAPLEIH
PHGDLISRRHASFAAVQEFYYRRPPQIERGRRHHLMSTAGRSYLDMVNNV
TVLGHAHPRIAAVASRQLRRLNTNSRFNYEAVVEFSERLAALLPDPLDTV
FLVNSGSEASDLAIRLATAATGRRDVVAVREAYHGWTYGTDAVSTSTADN
PNALATRPDWVHTVESPNSFRGKHRGAEAHRYAGEAVVQIEAMIAEGRAP
AAFICESVYGNAGGMALPDGYLQQVYTAVRAGGGLAISDEVQVGYGRLGD
WFWGFQQQGAVPDIVSVAKAMGNGYPLGAVITSRAVAEAFSSQGYFFSST
GGSPLSCAIGMTVLDVLTEEHLQDNARRVGGHLKARLTELSDRHPLVGTV
HGFGLYLGVEMIRDADTLEPAPEETAAICDRMLELGVVIQPTGDHLNILK
TKPPLCIDVDGADFYVDTLDRVLTEGW
392417815YP_006454420.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMTSEPNTTTFRGSDDLNLVADEWNNPATTEGFDESRPSVLMLHGGGQNRF
SWKKTGQILASEGFHVVALDSRGHGDSDRSPDATYTVEALCADTLRVLDQ
IGRPTVLIGASMGGLTGILAAREAGPEKVIRLVLVDVVPRYEKDGSARIR
DFMFSHVHGFDSLEQAAEAVAAYLPHRTKPRSPEGLKKNLRHRNGRWYWH
WDPAFLTKPAEDPFLRVELLERAAIELTIPILLIRGKLSDVVSAEAVADF
LDKVPSAEFVELSGAGHTAAGDDNDAFSEVVVQFVSR
392417814YP_006454419.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTLIFSFVQNESGHDAERRNIIEAAYCCLSEPHTAPIPVTTILRRAGVSS
RAFYRHFGSKDDLFLALLRRECDALAARLDRIADEAVGEPADQLAEWVGE
MFTMVTEPHQRTVMAVVDSDEVRAARGYREIRGCAHEHRERSLIAILRRG
RRDGSFPLAEPDADAVAISAVLSRVLSTQAPDDLQAVKQAQGWVLDFALR
AVGAVRPA
392417813YP_006454418.1 ABC-type transport system involved in resistance to organic solventMVAMNAIVKPVRAFGGFYSMALDTFVWMFKPPFAWREFLSQSWFVARVSI
LPTLLLTIPYTVLLTFIETILLTEIGASDFSGTGASLGTVRQIGPIVTVL
VVAGAGATAMCADLGARTIREELDALRVMGINPIQALVVPRVLAATVVSL
ALSATVILVGLSGAYLFVVYIQHVSPGAFVAGLTLIVGATDVVIALVKAA
LFGLSAGLIACYKGISVRGGPAGVGNAVNETVVFTFMALFAINIVATAVA
IKVVQ
392417812YP_006454417.1 ABC-type transport system involved in resistance to organic solventMTVSRPHSQFPWLKSRFRTVADPWNRIGVQTKFYGRTLRSVGYVFTHYSV
ELIRIIAQMGLGAGALIVIGGTVAIVGFLTVTTGALVAVQGYNDFSQLGV
EALTGFVSAYFNVRLIAPATTAIALSATIGAGATAQLGAMRINEEIDALE
VMGIRSIAFLASSRVIAGFLVVIPLYCVGVLMAFWAARFGTTVLYGQSTG
VYDHYFKTFLNPTDLMWSFGQCIALSVIIMLVHTYYGYTARGGPAGVGEA
VGRAVRSSLIVSAFVLVMLSLAVYGRSGNFNLAG
392417811YP_006454416.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MEPHEEGLHPAWWTLILLIVTVAALWLTYSLFVGAFTPHETVTLTSDRSG
LVMETNAKVKLRGVQVGRVGAIQGGSQPVALKLEIDKDKIKFIPANVEGQ
IRATTVFGAKYVDLVYPKDPHGQLQAGQVIQSRNVTVEANTVFENLVDLI
DRIDVAKLNSTLSALAYGVRGQGELIGQATTDANQVLLQLNPRSETIAAD
WKALKNFNDTYSAAAQDILTSLSALSTTSTTITNRATQLDTLLMATIGLS
NSGISLLAPNQANLIKAINVLQPTTDLLYKYNPEYTCLLVGAKTLLDTGG
YEAPGGNGRTLVLDTGLTLGDDPYHYPQNLPVIGAKGGPGGKPGCGSLPD
VAKNWPVRNLVTNTGFGTGIDWRPNPGIGFPAWANYLPVTRAVPEPPSIR
NLFGGPAIGPIPYPGAPAYGARLYAPDGTPLWPGLPPAPPPMAPREPGPT
PGSEPFIVTHPAQMQPTPLPPVPLPREAAPSP
392417810YP_006454415.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MPGLTTRVRHDAWRLAIFLTICLLGVFGLFAVYGQMRFGEKTHTYKAQFS
NVTGLQNGDFVRIAGVEVGQVKKVAIQPDTTAMVEFTASDSVVLTEGSRA
VIRYDDLIGGRYLALQEGAGGTTTLKPGDTIPLARTSPALDLDALIGGFR
PLFRALNPDQVNALSGQLIQALQGQGGTINSFLAQTAALTSTLADRDQLI
GQVITNLNVVLGSLGDQSDQFAKAIDGLSGLVETLKDRRQDITNGLAYTN
AAAGSITDLLVQARPPFSKTIQETDRAAGIVVADHDYFDNLLNTLPDAYQ
ALARQGIYGDFFSFYLCDIVLKLNGKGGQPVYVKVAGQSTGRCAPR
392417809YP_006454414.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MKSFSERNQVVIGVIGLVLTIGIVVGSLNYDRLPFLQGKEYSAYFADAGG
LTTGQGVQVSGFEVGKVQSIELDQSRALIKFTVAKDIRLGDRTEAAIKTK
GLLGTKMLEVTSRGEGQLEGTIPLERTTSPYQLPDALGDLATTISGLNTN
QLSDSLRVLSATFADTPPQLKVAIEGVARFSQTLDERDAQLRSLLGNADK
ATKVLADRSNQVVSLITNSNALLIELESQSAAVDQISGNISSLSDQLLGF
IAENRQTLKPALDKLNGVLTILDNRKERLQKSIHLLQQYSMSLGESVASG
PFFKTYVANLLPGQFLQPFIDAAFSDLGLDPNVLLPSQRTDPQVGQPGTP
ALPVPYPRTGQGGEPHLTVPDAITGNPGEQPCGPPGLPLPGPGCYPYREP
LPAPPPGGPPPGPPAEAPPGLQSTPGPTPAPVLVPAPGEVPPAAPAGAGQ
392417808YP_006454413.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MTRTVRIIVAAALAVILAGGVVVLLRTTTRVNRTHVTAYFENSNGIYPGD
DIRIVGVPVGRIESIEPQPMSVKITFWYDSKYKVPADAKAAILSPTLVTS
RSIQLTPAYTGGPVMKNDAVIPRERTAVPVEWDEVRQQLAKIAGTLQPTE
PGGVSPLGSAINTTADNLRGQGANIRDTVIKLSQAVSALGDHSTNIFSTV
KNLAILVSALQDSTDVMRQLNQNLASVTNLLANDPDEVANAVRDLNKVVG
EVQTFVAENRESLGTTSDKLAGVTQALTDSLDDVKQFLHVAPNTLQNYVN
IWQPAQGAVSSVPMINNFANPISFLCGAVQAASRLGAEESAKLCVQYLAP
IIKNRQYNFLPLAQNVFVGASTRPNELTYSEDWLRPNYIPPQPVPSSAQP
PAGGPPPPAGSPPPLPPSMGPLLPAEASPGQQVPTTPNPADGLQGLMVPQ
GAGQ
392417807YP_006454412.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MRHARAFRVVTVAVLLVGLLSGCAGWRGLNSVPLPGVEGTGPGAFKIQAQ
MPDVDNIEQNSRVRVGDVNVGHVSKIERQGWHALVTMVLNGDVELPANAT
ATLGQTSLLGSLHIELAPPTDVPPEGKLHDGSLIPLSSSKAFPSTEQALA
AVAMLLNGAGLGDIQDITQALSTAFAGRENDLRSLIEQLDKGIGYLDDQK
QDIIAASDSLNNLIGQLAEQKPVVDRALQTIPDALAVLKEQRNNLAEALT
QLGRFSALAADSVNQTKDALVAELKDLGPTVEQLANAGPALTRALSFLPT
FPFPKETLTNWMRGDYANLTLILDLTLSRIDSGFFTGTRWECHLTWLELQ
WGRTIGQFPNPCNAGGPGTAGNPLIAPYRFDQGP
392417806YP_006454411.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MRLTRRILIQMAIFAVIATTALVIMVFTYMRLPEFLGVGQYRVTVKLPET
GGLYPRGNVTYRGVEVGEVKSVSLTDSGVAAVLSLNSDVKIPADVDAEVH
SVSSVGEQFVQLLPRSAGGPVLKDGDVIPVDRTSVPTDINTVLNETNRGL
EAIPRQNLQTVVDEAYVAVGGLGPELRRLVTGSATLAIDARKNLDPLTTL
IDQSKPVLDSQTDTGSSIRAWAANLASITGQLKSQDPALGGILDRGPGAA
EEVRALFDRLRPTLPIVLANLVSVGEVAVTYHPSIEQLLVLLPQGTAVTQ
AVGVHKRNTKQDYMGDALVFNLNLMIPALPAPIPLPPQQLPPPCTTGFLP
AQQQRVPTFEDYPDRPAGNLYCRVPQDAPFNVRGARNLPCVDRPGKRAPT
WQQCDSDQDYVPLNDGYNWKGDPNATLSGQGVPDIPPQVPSSRTAPPPGP
VPPPIATAEYDPANGTYVGPDGRVYTQSNLAPSAAEEHTWQTMLLPPKGK
392417805YP_006454410.1 hypothetical protein Mycch_4008 [Mycobacterium chubuense NBB4]MADDAAAPEGEVTTPTEEAESSAVEPESNAVEGGAGGEDTAAAAAAEDSD
ADDIADGAADDASGAEEVGPPRAPISHVKLALIAGLVAVVALAGLAGWLG
FRTYQSHRAEQERNLFLQVGRQGALNLTTIDWEHADADVQRILDSATGTF
YDDFQQRAQPFMEVVKQAKSKSVGTIAEAGLESYGDNEARVLVAVNVKTS
NAGAPEQQPRAWRMRISVEKIGDEAKVSNVEFVP
392417804YP_006454409.1 hypothetical protein Mycch_4007 [Mycobacterium chubuense NBB4]MSKDVSKDLETDTVNDTVEPGVDDAGVADKGTEATKPTEATEPTEATEST
EATEATEVTETSAVDESTEAVEHPSGTAKRSIRWSRVVAFGLLPALALVL
ALGAGYLKWRDNTVRTSEVAAKTSVQAAKDSTVALLSYTPDKVEQQLGDA
RNLLTGEFRDSYTSLTNDVVIPGAKQKQISAVASVPAAASVSANPSEAVV
LVFVNQTVTVGGTAPTDTASSVRVTLEKVGDRWLISKFDPV
392417803YP_006454408.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMPMLPGVSDTGAALVTGASSGIGEEIARELARRGHRVILVARRADRLHAL
AQSLDRVAHVLPADLSNPADRAALPDQVAALSLTVDVLVNNAGVSNLGPV
ARVSPEAELALVEVDVAAVVDLCSRFVPGMVARGRGAVLNVASVGAFGPV
PWQASYGAAKAFVLSYTEAMREELRGTGVTAAVVCPGPVRTGFGDAAGIP
DEEAEKMLPKFLWEQPDAVARAALDGLDKGRPVIVPGAPNRAAALLYRFA
PHTALLPLLGRSHPGRRK
392417802YP_006454407.1 hypothetical protein Mycch_4005 [Mycobacterium chubuense NBB4]MTVRRLAAVDAQTHWMARAIPSDQFLLYGFDAAATDLDRTLATIADRARR
CPDLRLRVAETSFWTYPVWEPRDVDSDQFGIREPVSWPECLTAVASLADA
QLDATVSTWRLHVFPSVGEMPIAGAGTVVVLQISHALGDGIRASALAAYL
FGRDSSIPAAGSPRGRAHLPRRALAAARAHRRLVRDTDAGLVPPQADSRP
ALRSNARPSGRRYLRTVIRRRMHLPGPTVTVGALTAVSAALAGHLRELGD
DPALLGAEVPMARAGPRRANNHFGNVGVGLYPELDAGARASRIALDLSER
RRRAAHPAMAAEDAAFGAVPAPLLRWGVSHFDPDVRSATVTGNTVVSSVN
RGTADLRFGAAQVVLTAGYPSLSPMMGLTHGVHGVGDTIAVSVHAAESAI
GDIDAYVARLEHELA
392417801YP_006454406.1 putative membrane protein [Mycobacterium chubuense NBB4]MTAYDVGVLILRLVLGLTMAAHGYNKFFGPGGLKGTAGWFDSMGMKPGSF
HARVAATTEMAAGLGLAVGLLTPIPAAGFVALMLVAAWTVHKPNGFFIVK
EGWEYNLVLAGSAVGIATLGAGKISLDHLLFANTGLDDYLHGWWGLLIAA
VVGLAGGIGQLAIFYRPPAKTAG
392417800YP_006454405.1 Transmembrane protein of unknown function (DUF3556) [Mycobacterium MGFLKQDAPVVDYAEWSKGTRAQRIVPMARHWAEVGFGTPVVMHLFYVVK
ILLYALGAWLFALTTTGTGGLAGFTNVASWYHEPIVYQKVVFYTMLFEVV
GLGCGFGPLNNRFFPPMGSILYWLRPKTIRLPPWPGRVPLTRGDTRTPID
VVLYGALLVMLLVALFSDGTGPIPALGSQIGVLPVWQTVSILALLALAGL
RDKVLFLAARGEVYGSLAVCFLFAGADIVIGAKLVCLVIWMGAATSKLNK
HFPFVISTMMSNNPVIRPRWIKRKFFEHFPDDLRPGRASRWLAHFSTAIE
MLVPLVLFFSHGGWATAIAAFVMLCFHFGILSAIPMGVPLEWNVFMMFSV
LALFVGNSGIGLEDLHSPWPLVLFAVVAGTVVTGNLFPRKVSFLPGMRYY
AGNWDTSLWCIKPSADAKITRGIVAIASMPAAQMEKFYGSKETAEMYQYM
GYAFRSFNTHGRAMFTLAHRAMAGQDEVDYVLTDGERVCSTAIGWNFGDG
HMHNEQLIAALQKRCRFEPGEVRVLLLDAQPIHKQRQEYRLVDAATGEFE
RGYVNVADMVTRQPWDDAVPVHVTWQKDGADAT
392417799YP_006454404.1 transcriptional regulator [Mycobacterium chubuense NBB4]MVYSVAELTEPVGEQYWREVVTRSTPLAPMIGATAANAGSAVRSPKTAEL
VAGTLRRMVVDGKLKDGDFLPNEAELMAHFGVSRPTLREAVRVLESERLV
EVRRGSRTGARVRVPGPEIVARPAGLLLELSGATIADVMTARSGIEPMAA
RILAESGDETAFTELETMLEGLIAAGSQSGHLAEATGEFHRRVVELSGNT
TLSIIAGMLHEITVRHNDFLFKERRPVSKSDYDKLMRSYRRLMKLLRSGD
ADAAEAHWRKHLDTARELMLTGLDTVRVRDVMG
392417798YP_006454403.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MAEAVIVEAVRSPVGKRNGGLSGVHPADLSAQVLNGLVERAGVDPALVDD
VIWGCVMQAGEQALDIARTALLTAGWPESVPGVTVDRQCGSSQQSVHFAA
AGVVAGHYDVVVAGGVESMSRTPMGSSLAGGGNPYPAGFKGRYSQTPNQG
IGAEMIAQQWGFDRAALDQFSLDSHEKAAAAQDSGAFNDQIVAIKDQDGN
PVLKDEGIRRGTTLEKMGQLKPAFREDGVIHAGNSSQISDGSAALLFMSA
EKAKELGLKPIAKVHTAVLAGADPVIMLTAPIPATQKALKRSGLSLDQIG
AFEVNEAFAPVPMAWLKDIGADVKKLNPNGGAIALGHPLGGSGARIMTTL
LYHMRDNGIQYGLQTMCEGGGQANATILELL
392417797YP_006454402.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMTEPAAAGSDGPTPPSSSSSAGALVERRGNVMVVTINRPEARNAINSAVS
IGLGDALEEAQDDPDVWAVVVTGSGDKSFCAGADLKALSRGENIGHPDHP
KWGFAGYVRHFIDKPTIAAVNGTALGGGTELALASDLVVAGESAKFGLPE
VKRGLIAAAGGVFRLVDQIPRKVALQMMFTGEPITSAEALKWGLINEVVP
DGAELDAALALAERITVNAPLAVQASKRVAVGADERVVAADEPGWSRTMR
EVVTVFATEDAKEGPLAFAQKRQPVWKAK
392417796YP_006454401.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MKRTIYDAEHEAFRDTVRGYIDSELVPNAEKWEADRMVDRSAYVAAGKHG
LIGFNMPEEYGGGGSDDFRFNAIIDEEIAKAGVPAPALSLHNDVVGPYFK
DLANDEQKKRWLPGIVSGETIIAIAMTEPGAGSDLAGIRTSAVRDGDDWI
VNGSKTFISSGINSDLVVVVARTDPEAGHKGFTLLVVERDMPGFTRGRKL
EKMGLHAQDTSELHFENVRVPSANVLGKEGRGFYHLMQNLPSERLSIAIS
AIAGARETWRQTLQYAKDRKAFGQPIGSFQHNRFLLAEMETELEVTETYI
DRCLQGVVDGELTAVEAAKAKWWATEVAKKVVDQCVQLHGGYGYMMEYRV
ARDYVDGRIQTIFGGTTEIMKEIIGRDLGL
392417795YP_006454400.1 secreted/surface protein with fasciclin-like repeats [MycobacteriumMKTRTSKAIGVAVGAAAIALSVPLAVNAYAEPTTTTNTPVAEIPDPQGPK
CDDFKKAVPNWKSLADVPVGKVLSAIPDISSFNAAVSGQLNPAVNIVPVL
ENGPFVVFAPTNDAFAALPPEQQEMLRTDPAALTKLAYYHVFLGLLGPDD
VKGQRPSQEGTEVEVTGSGGDIKVNETTKVVCGGIQAQNARIYIVDKVLD
PTEAPAPIGRTTASSTATSATSTTQTLPAEAPAAPAPATSPAPAAEAPIG
392417794YP_006454399.1 transcriptional regulator- tetR family [Mycobacterium chubuense NBBMSSTAKVIYLRSYGERDRDDHHVVRRVLDATVEMLRDVPLAELTTRRIAE
RSGVGHADLCVYFRSRDAIVAEVYLGMLRDAPLHVDAAAPARARVAALFE
QLLMLPADEPGLAAACSSALISAEPSVQAIRRRIHAELHRRVRTVLGSGA
WPEVTETLEFGLVGAMVQASAGSAGFRDTADELVQVVAALLPEGC
392417793YP_006454398.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMTTSSAPSAPTALDIVEGVDLSGKTVVITGASSGLGRESARALAATGAQV
ILTARDAAALADAEEWVRRQVRGALLSCVHLDLASLASIATAAAEIGELT
PAVHVLMNNAGVMFTPFGHTVEGFETQFGTNYLGHFEFTRLLFPALVAAD
GARVVNLSSEGHRMSDVDFDDVNWERRGYDKFAAYGASKTANILHAVELD
RRLRDSDVRAYAVHPGIVATSLARYMTREDFARLNERASAARGDGARPPV
DVTRDFATPEAGAATQVWAAVSDDLSGTGGVYLSECAIRSAAPYAVDENR
ALALWALSEQLCTERAPSLGSAR
392417792YP_006454397.1 isoleucine patch superfamily enzyme- carbonic anhydrase/acetyltransMAAMPQPLILSVAGRSPQLHPDSWIAPNATLVGQIVLAENASAWYGVILR
AEAEPIEIGEGTNLQDGVTIHVDPGFPARVGAGVSVGHNAVLHGCTVEDD
CLIGMGAVVLNGATIGTGSLVAAGAVVPQGAVIPPGSMVAGVPAKVRREL
REDEVEGIRHNAQVYQQLVKLHRDADNA
392417791YP_006454396.1 putative nucleoside-diphosphate sugar epimerase [Mycobacterium chubMTGATGYIGSRLVTALLADGHQVVAASRNPDRLAGFGWRDEVSTVALDAH
DEDSARRAFTESGPVDVVYYLVHGIGQPGFRDADNHAAANVAKAAKAAGV
RRIVYLGGFVPDGDDLSEHLTSRAEVAAALKVDGGPDVVWLGAAIVIGAG
STSFEMLRYVGDRFLLLPLPEWSANPIDPISVRDVVYYLVEAADTDTVPA
GAYDIRGPETTTYGDLLRTYARVAGIWRAPVPVYGIDTGLVSKVTGVVLP
VPSGLAADLVESLDYPMMASEDGLAGIVPEPADGLIGVEDAIRRAVTSPP
RRPVDELADPHHLADTDPDWAGGDASRLKHLASTVTPSVVHPVLGLIGLV
PGPVAAAVRTGVDHVLGFLPKVAPA
392417790YP_006454395.1 putative metal-dependent membrane protease [Mycobacterium chubuenseMNSPEHEGFPEEVLRIARTRATPYDESAGVVRRRKIVVGVVLLVGASLLG
YSLSRSPGDTTFIWLTLALAGVWAVGAFASGPLHFGRVQFRGHNKRPVIT
GTAVGLGLGAVFIVGGMVCREIPGVNAYITRVLEFSNAGPLWLITFITVI
NGLAEELFFRGALYTTLLKYRPVLVSTVLYVIATAATTGNPMLGFAAIIL
GTVCALERRATGGVLAPALTHFFWGLVMVLALPPMFGV
392417789YP_006454394.1 hypothetical protein Mycch_3992 [Mycobacterium chubuense NBB4]MDRNPCRTRQHLTRAATVAAAAAAVAALGAPTASASPSGDLWNLANSKHV
SAGCAPYADNPALGNTALDIAKTMVNPPGGILGNGRVPTDSMLADRGYFV
TVWGEADYINSDSAGSPQAAMDFWLANGTRDIFPNCAMKDMATAVWIQNG
KWAAVLLAGSPGGTPPQPPVVH
392417788YP_006454393.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMTTDTYTGIGDLTVGLDDGVLSVTLNRPDSLNSLTAPMLNTFAETLEQAA
GDPQVRVVRIGGAGRGFSSGAGISEEDHANPGAAGTPADVLDAANRCIRA
IVHLPQPAVAVVHGAAAGVGASLALACDVVLASEKAFFMLAFTKIGLMPD
GGASALIAAAVGRIRAMRMALLAERIPAAEAFDWGLVSAVYPAEAFEAEV
NRVVAALVSGPAVALRKTKDAINAATLTELEAALEREKTGQLSLLDSHDF
REGTKAFQQRRAATFTDT
392417787YP_006454392.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MAGPLQGLRVVELAGIGPGPHAAMILGDLGADVVRIERPGKGAGPATTPS
RDYLLRNRRSVAANLKDPDDVKRVLSLIGKADVLIEGFRPGVTERLGLGP
EDCAKVNEGLIYARMTGWGQQGPRAQQAGHDINYISLNGTLHAIGRAGER
PVPPLNLVGDFGGGSMFLLVGVLSALWERQRSGKGQVVDAAMVDGSSVLS
TMMWAFRGMGMWSDERGVNMLDTGAPYYDTYTCADGRYVAVGAIEPQFYA
EMLAGVGLDVAELPDQNDMSRWPELRARLTEAFAAQDRDHWAEVFAGTDA
CVTPVLSFAEVESEPHNTERDTFYRENGYLYPAPAPRFSRTATSAPKPPG
VPGADTEAVVQDWV
392417786YP_006454391.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMEIKDAVAVVTGGASGLGLATTKRLLDRGASVVVIDLKGGDVVKELGPRA
KFVEANVTDPEQVSAALDAAEEMGPLRIDINCAGIGNAIKTLGKEGPFPL
DGFRKVVEVNLIGTFNVIRLAAERIAKTEPVDGERGVIVNTASVAAFEGQ
IGQAAYSASKGGVVGMTLPIARDLSRDLIRVVTIAPGLFKTPLLGSLPED
AQASLGKQVPHPARLGDPDEYGALAVHIVENPMLNGETIRLDGAIRMAPR
392417785YP_006454390.1 2-nitropropane dioxygenase-like enzyme [Mycobacterium chubuense NBBMSIRTKFTETFGVEHPIAQGGMQWVGRAELVAAVANAGALGFITALTQPT
PADLANEIARTRDLTDKPFGVNLTILPAINPPPYDEYRQVIVDAGIKIVE
TAGSNPAPHLPMFHDNGIKVLHKCTSVRHAVKAQSLGVDGISIDGFECAG
HPGEDDIPGLVLIPAAADKIEIPMIASGGFADARGLVAALALGADGINMG
SRFMCTVESCIHQNVKEAIVAGDERGTELIFRSLHNTARVASNTVSREVV
EILKQGGQFDDVKDLVAGVRGRRVFDEGDVDAGIWTVGTAMGLINDIPTV
SELVSRIVGEAEDLITGRLTGMVAPVAQRV
392417784YP_006454389.1 hypothetical protein Mycch_3986 [Mycobacterium chubuense NBB4]MWIDDTSADVIKVDFEALYHGDVLVEGMTSEQLDDESALPTAV
392417783YP_006454388.1 putative membrane protein [Mycobacterium chubuense NBB4]MSENSTQGPHSTVGLAATTGHPEAAPPRSHAAPDAGTSLALLILRLGVGA
AALQAGLIKAFDFSATTGFMAQGGWRLPTFAAFMVTASETLGGIGMLVGA
LTPLAACSVLGAMLCAWAVNVSGAAFWSAPFNVPFLIGIGAAALLFAGAG
AYSVDGRALTRLTWSLRVSAGLLALAFVVAILTWVALYGVNPIHFTAPPG
AAAQ
392417782YP_006454387.1 putative RND superfamily drug exporter [Mycobacterium chubuense NBBMLHRIALLAIAAPRRILAGALLVMVACGVFGVPVAEHLSAGGFQDPTSES
AQATRLLVDKFDQGDMDLLITVSSATGALGPDARAVGTDIATRLAQSPHV
GDVSSAWTAPPSAAPALISEDGKTGLIVAAITGGDSDGQKYAKELTDALV
YDRDGVAVRAGGVASTYVQINAQSEKDLLTMEAIAIPLSFVVLVWIFGGL
LAAALPLAVGAFAILGSMAVLRGLTLITEVSIFALNLTIAMGLALAIDYT
LLIISRYRDELADGGDRHSALLRTMVTAGRTVLFSAMTVALSMVAMVLFP
MYFLKSFAYAGIAVVAFAAVAAIVVAPAAIVLAGDRLDSMDVRKLVRRMR
NRPEPAPKPVEQMFWYRSTKFVMRRSIPIAAAVVAFLVLLGLPFLGAKWG
FPDDRVLPPSATARQVGDDLRANFAIDSARNVPVVLPDADGVTLAALDDY
AAELSRVEDVSSVSAPGGTFVRGVKAGPPSAPAGLADGSAFLTVASTAPL
FTAASETQLDRLHAVPPPAGKHAQLTGLAQINRDSAESITSRLPTVLGII
AAITFVLLFLLTGSVVLPLKALVLNVLSLTAAFGALVWIFQDGHLSGLGT
TPTGTLVANMPVLLFCIAFGLSMDYEVFLLSRIREYWLKSGRTNPEIAPR
VRSDESVALGLARTGRVVTAAALLMSISFAALIAAKVAFMRMFGVGLTLA
IIADATLVRMLLVPAFMHLLGRWNWWAPRPLAWLHARIGISEAPEDTSPV
SPPAQAPVASAEKG
392417781YP_006454386.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSVEPLRRRRAPRGAGDQLRDEILDAATELLLETGDAKAVSIRSVAQRVG
VTPPSIYLHFADKGAMLDAVCVRYFEKLDEEMQALASQAGSPVDVLRAQG
MAYVRFALRTPELYRIATMEPGHPGSDVDMMLNSSAFGHLRAAVEALIAE
DIYPPGDPTTLALELWTAAHGVAALLISRPYLPWGDVEQFADRVMRSVCC
GQVLSAAIGETDPPQETVTWLKEVVDERHR
392417780YP_006454385.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMNDTVDNPFFARLWTVMSSREPEALRRLRAENLAGLTGRVLEVGAGTGTN
FEFYPDTVTEVVAVEPERRLAALARDAAAAAQVPVTVDAGTVEQFTDSAQ
FDAVVCSLVLCSIDDPEAVVRQLLSVLRPGGQLRYLEHVASAGTRARLQR
VADATVWPRLFGNCHTHRHTEQTIVGAGFEVTDARRQWTFPAWVPVPVAE
FAIGVAVKP
392417779YP_006454384.1 NAD-dependent protein deacetylase- SIR2 family [Mycobacterium chubuMTVFSGAGISAESGVPTFRDVETGLWAQVDPYEISSAEGWRAHPDRVWAW
YLWRHHMMRAVAPNDAHRAVAAWEDYADVHVVTQNVDNLHERAGSNQVYH
LHGSLFEFHCDRCGSAYLGEVPAMPEPAESVDPPRCVCGGLIRPDVVWFG
EALPDDAWQKSVDAVVNADLVVVVGTSSVVYPAAGLPELAVASGTPVIEV
NPEPTPLSDSATVTLRERAAIALPNLLQRLPALLG
392417778YP_006454383.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAELGDWVRVDPHAARPLFDQLRTQIIDGIRDGQLPPGTRLPTVRELASQ
INLAVNTVARAYRELEAAGILETRGRFGTFVARSDPADVAMATAASTFVS
TALALGVGKGEALRYVENAFG
392417777YP_006454382.1 O-methyltransferase involved in polyketide biosynthesis [MycobacterMTPTDKHAADVTGVSETALMTLLVRATEARRPDAVLDDPMAIHLVDSIHF
DFAKFGFTRRQDMALRAKLFDKHTRRYLVDHPKATVVALAEGLQTSFYRL
DASGVGDPIDASGLGIGHDFRWLTVDLPPMIELRRKLLPASERVQMCAQS
ALDFSWMDRVDPSHGVFITAEGLLMYLQPEEAMALIAACAARFPGGQMMF
DLPPSGFAALARRGMRTSLRYRVPPMPFSLSVAELADLVNTVPGVRAVHD
LPAEAARGRVLGAVLWAWQRIPLLDPLRPLTTLLEFG
392417776YP_006454381.1 hypothetical protein Mycch_3978 [Mycobacterium chubuense NBB4]MTRYAAFLRGVNVGGVNLKMAAVAQALEAAGFANVKTILASGNVLLDSRA
GTAAVRKKAEKALRDEFGYDAWVLAYPLDTIAEISAAYPFEREVEGHHSY
VTFVSDGDVLRELAALAGQPGPDEKISPGSGVLYWQVPRSATLASAVGKT
MGKKRYKSSTTTRNLRTLDKVLRG
392417775YP_006454380.1 O-methyltransferase involved in polyketide biosynthesis [MycobacterMGAVTPIDGEVLEGVSATTLWTLRNRATEAKRADGVIRDPWAITLLDAIT
YDYGKFGRPSQFHALRALAFDAVTRTFLDDHPNASVVALAEGLQSSFWRL
DRDRHIGASTWYSVDLPPVIELRRRLLPHDDRIVTLPRSALDRGWMDRVD
TSHGVLITAEGLLMYLRPDDALRLIRDCAQRFPGATMMFDSNPHWVSARA
RRGLRLSDRYVTPPLPFALSPREATALAGRLPGIASARDVRLPRGRGLFR
YAGCRAFDREPLQRMRPSTTVLEFGS
392417774YP_006454379.1 PPOX class probable F420-dependent enzyme [Mycobacterium chubuense MTRDVFDDKLLALIAGNSLGVLATLKRDGRPQLSNVSYHFDPRALTISVS
ITEPRAKTRNLRRDPRAAIHVSSDDGWAYAVAEGDAVLTPPAADLQDDTV
EGLIDLYRKIAGEHPDWDDYRRAMVDDRRVLMTLPISHVYGMPPGRR
392417773YP_006454378.1 hypothetical protein Mycch_3975 [Mycobacterium chubuense NBB4]MASDGSAESSKSSGGPEGSEDETKRRFREALERKKAKSAGGSAHRDAGSK
QPRAHGPLENRREFRRKSG
392417772YP_006454377.1 arabinose efflux permease family protein [Mycobacterium chubuense NMNHVRRYSMALLAYAFAAIMVGTTLPTPMYALFGDEMHFRVLTTTVIYAT
YAGGVLFALLAFGRWSDVVGRRPVLLGGIAFAVASAVVFLLADSVPELLV
GRVLSGLSAGIFTGTATAAVIEAAPPAARSRAAAVATVANIGGLGMGPLL
AGILVQYAPRPLDLSFAVHLVLVTLAAVAVLAVPETSSRTGRLGFQRLSI
PPEARQTFVVAALAAFAGFAVTGLFTAVAPSFLAGVLGITNHALAGVIAC
SIFAASAVTQVTARTMDPHRAVAVGCAILIVGMVILAMALHFSSLSALIA
SAVVAGMGQGMSFSRGLAAVSDLTPPDRRAEVSSTYFVVAYVAISLPVIG
EGLAARAWGLQTSGVTFAVAVAVLAAVCLAAIVRRSRRDTDSPSAASHPA
ESPAAQRRP
392417771YP_006454376.1 SSS sodium solute transporter [Mycobacterium chubuense NBB4]MTTVLAQAQTVGNPVANIGIFTLFVVVTMVVVIRASKRNATASEFFTGGR
GFSGPQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVAL
LLVAELLRNTGKFTMADVLSFRLRQRPVRLAAATSTLTVSLFYLLAQMAG
AGGLVALLLDVKSRGGQSIVIAVVGVLMIVYVLVGGMKGTTWVQIIKAVL
LIVGAALMTVMVLGKFGLNFSEILGSAQSAISGATTAGVADRDVLAPGAQ
YGGSLTSQVNFVSLALALVLGTAGLPHVLMRFYTVPTAKEARRSVVWAIA
LIGAFYLFTLVLGYGAAALVGPDRILGAAGGVNSAAPLLAFELGGVILLG
VISAVAFATILAVVAGLTITASASFAHDIYASVMKRHQVTEAEQVRVSRI
TAVVLGVFAIGLGILANGQNVAFLVALAFAVAASANLPTIVYSLYWKRFN
TRGALWSMYGGLISCIVLIVFSPAVSGSKTAMIPGADFAWFPLANPGIVS
IPLAFVLGVVGTLTSPDRGDPKVAAEMEVRSLTGIGAEKAVAH
392417770YP_006454375.1 putative membrane protein [Mycobacterium chubuense NBB4]MSETDLPLRPEAISGDRYLQVQASPEFQELRSRLRRFVFPMTAVFLVWYA
TYVALGAFAHDFMATKVWGDINVGLIIGLGQFASTFLITGLYVRFANREL
DPRAEAIRTELESELR
392417769YP_006454374.1 putative symporter [Mycobacterium chubuense NBB4]MTGSPLVAAALLAAAVATVAIGAYGVRFSRTTSDFLVASRTVGSQWNAAA
ISGEYLSAASFLGVAGLIAKYGADALWYPVGFTAGYLGLLLFVAAPLRRS
GAYTVPDFAEFRLGSARLRKVAMLVVVVVCVFYLVPQYQGAGLAMKTLLG
TPVWLGPVAVGAIVITNVVAGGMRSITFVQAFQYWLKLTAVAIPALALAG
LFLTDHHGELGGPLPPTVHQDTTVAIDTDVVVAVAEPAGITVTGILDGRR
VDGAAIPAAGRHVVGADSTLHLAAGAATPVLAGTPGAGEDWIASGGGLGG
RHPLYQVVSIMVATFLGTMGLPHVLVRFYTNPDGRAARRTALAVIALLSL
FYLFPTLLGVFSRLYVPQLLITGTADAAVLLAPGSVISGVAGQLLAALVA
AGAIAAFLATSSGLLVSFAGALATDVLPGRVRDFRVAAVIGGLIPIPLAL
AASGGMELSRSVGLAFAVAASTLCPLLVLGIWWRGLTALGAACGLVVGGL
LSGVAVTVAVAGGVDDDAAGGWPAVLIGYPAAVSVPLAFATMIVVSRLTR
AAVPADVAQTFARMHVPEHLGMGVERVPGD
392417768YP_006454373.1 Protein of unknown function- DUF485 [Mycobacterium chubuense NBB4]MTSDERPQRQRVVLAHRRGARLVRTRVEVQEQTQVGDALVRGLVRAQLGL
ALRLGAVVVCLVGAIPLLNTLFPGLSAIPVFGIRLNWLVLAGLVYPLLYG
IGWSYVRLAEQGERDFVGVIDAEP
392417767YP_006454372.1 response regulator of the LytR/AlgR family [Mycobacterium chubuenseMTGTAEPPGRRAQALTVLAVDDEAPALDELAYLLNRHPGIGEVFRAGDAT
SALRELNQRQIDAVFLDINMPGLSGIELAGVLANFAQRPAIVFVTAHDDK
AVAAFDVGAVDYLLKPIREGRVDEAVRRVATIRAAPPATEPSRGRDENAR
RATESDVIPAELGGVTHLVPRDSIGWVEAEGDYARLHSASGSHLVRIPLS
TLETRWRDHGFQRVHRSYLVALRLVTGLRTVDGAVLVRLRPNGASPAVEL
PVSRRQARELRDRLVRNPMRSLRPAGSADDQ
392417766YP_006454371.1 putative regulator of cell autolysis [Mycobacterium chubuense NBB4]MSGELAIALTAALIVVAVAAVVLAVRTRQVVATPTERAVHATLHTASLAA
RALRQGLDTGSARTAAPFLRGLTGTDGLALFDGDGRLLARDADDDAVWNG
EVVDACTSAAAESIGGQRRVMTHATAAAVVAQPLLAEAGDLLGVLVVVTT
RSPGPGTLGAVGEVARYAASQIELAELDASRARLDRAEVLALRAQISPHF
IYNALNTIASFVRTDPDRARELILEFADFTRYSFRAAGQYTTLADELRNI
DRYLNLERARFGTALTVRLQVAPEVLNVVVPFLALQPLVENAVRHGFAGR
GSGSIELVARDEGSDCVITVEDDGIGMDPDALRAGPSDALSGGTPAGEGD
SAHVGLTNVDHRLRAAFGNDYGLVVETAIGAGTKVVMRVPKFRSGVRAGG
GAFGVGKQ
392417765YP_006454370.1 Rhodanese-related sulfurtransferase [Mycobacterium chubuense NBB4]MAAVQEVDIATLARAWESGAPVLDVREDHEFAQAHVPRAQWIPLGELPAR
VGEVPADTTVYVICASGNRSKRGAEILEDSGRSAVSVAGGTKGWIRAGHP
AESG
392417764YP_006454369.1 Zn-dependent hydrolase- glyoxylase [Mycobacterium chubuense NBB4]MILEQYYIECLSHASYLIGDEGTGRAVVVDPRRDISEYLADAAKYGLRIE
GVINTHFHADFVSGHLELVDATGAWIGFGEAAQTDYPIRRLAGGEHLSLG
EVDLEILSTPGHTWESISVLVRERPGAEPTAVLTGDSLFIGDVGRPDLVN
IGDSSTSDLARAMYHTIHDKLLRLPDAVTVMPAHGAGSSCGKNLSTDLTS
TIGEQRRTNPSVQPMAEEAFVEMITHGQPAAPAYFSSDAAMNKRVHPLLA
PDRRIPEMTAAQLRSALDAGVRVVDARSVEDFAAGHLRGSVNVGFDGRFA
ETGGMVAEVGEQVALVTYPGEEQEAALRLARIGSDNAVGYLNVGRDGGFP
EELGDLVRTAPRTSARELDRLLDEDAVTLIDIRNPGEREFGVIPAATPIP
LAQLRTRLADVPSGKPIVVHCAGGWRSSVAASLLRAEGFENVSDLAGGYN
AWAEAHAAV
392417763YP_006454368.1 thioredoxin domain-containing protein [Mycobacterium chubuense NBB4MSTVNLSFDDFESTIVGNPIVFVDFWASWCGPCRAFAPVYERSSTAHPDV
VHAKVDTEKELDLATALQIRSIPTVMAFRDGVLVYSQPGAMPPATLEDLI
TRVKELDMESVRATIAARKAATA
392417762YP_006454367.1 hypothetical protein Mycch_3964 [Mycobacterium chubuense NBB4]MCYPVTCRRCGKTTWDGCGQHVADVRQSVPASQWCTCSDRAEAQKPKRNP
LFGR
392417761YP_006454366.1 Rhodanese-like protein [Mycobacterium chubuense NBB4]MPNSPVDFQRRSRTRRQAPASVPQPLEDEDDLVAVDTTWGELQPLQCAPG
VVTVGELELIDSVRGGALLVDTRMPDSKRGVTLPGAVGIPHDQIAQRSDE
LDPSRVNIVFCNGPQCPQSPDAIRRLLDAGFPAGSLAYYRGGLHDWVTLA
MPTAPVA
392417760YP_006454365.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTELSAFQHPRFARMYERISAESERRGTAEHRDHALAGLSGRVIEVGAGN
GLNFAHYPATVTEVVAVEPDHHLRELAARAAESAPVPVRVLAGHAAALPV
EDAGFDAAVASLVLCSVPDQRAALAEIRRVLKPDGRLRFFEHVRSQNSWL
GLLEDAVTPMWSRIGGGCHLNRDTTTAIRAAGFDIDTLDRFAYAPLRYFP
AFAHTLGQARPRTSTPRDATTAEPRD
392417759YP_006454364.1 hypothetical protein Mycch_3960 [Mycobacterium chubuense NBB4]MGHDDDRMLTLADLAQLVDSPLIRVMGGERVDVDTHAALEAIAANEAGLG
LSA
392417758YP_006454363.1 hypothetical protein Mycch_3959 [Mycobacterium chubuense NBB4]MDNPLPTDPCAFIRRDIEITQKLIDEDRVGLQHPEVLTHDDVVRLKVDLE
RRGALLESFLESFRRCRAENPRCRRTHAGRTVSTARHVPPAIASAERGRS
PEMTTHAEQLK
392417757YP_006454362.1 putative HhH-GPD family protein [Mycobacterium chubuense NBB4]MTANLCLTQEPEADHLLSEDPFALLVGMLLDQQIPMEVAFGGPKKIADRM
GGFNAAAIADHDPEKFADLCAQTPAVHRFPGSMAKRVQALAQVIVDEYGG
DATALWSDGADGADVLRRLKALPGFGEQKAKIFLALLGKQYGVTPKGWRA
AAGDYGKAGTHMSVADVKDAGSLQKVRTYKKEAKAAAKAAKA
392417756YP_006454361.1 site-specific recombinase- DNA invertase Pin [Mycobacterium chubuenMTVTLGYATAGGGDLDGQLAELTAAGVDPRRIFTDKSPGSTDKMRAGLLA
LLSYARAGDVVVVVALERLGRSVAEVTQTVADLTTRGITLRCLRDGLDTA
TATGRVVARVLTDLAALDAVRPGEART
392417755YP_006454360.1 nitroreductase [Mycobacterium chubuense NBB4]MMRTTAAVRRFTGDRLPDDVLVRILDNARFAPSGGNRQGVHVIAIRDRKI
REALAELSLPGARRYVAQAGNGEGTWNPLLPMGVSQEQVAATEVPDQMTA
PLLTCAVVLVVCVDLAAVAALDQDLDRIGVVAGASVYPFVWNVLLAARNE
GYGGVLTTMAVAEETRVKDLLGIPAGHAVAAVVPLGKPQHQPKRLTRKPI
AEFVTRERFDGASL
392417754YP_006454359.1 hypothetical protein Mycch_3955 [Mycobacterium chubuense NBB4]MKTHLNCPCGEAITGKDEDDLVEKAQKHLSEAHPGREYDRDAILFMAY
392417753YP_006454358.1 hypothetical protein Mycch_3954 [Mycobacterium chubuense NBB4]MATIRTMLTTAMAVGSSAALLTVGVTGVAHADPPAAPSPIDGLQAPGLPA
VQSIGPVIQQAAADPSNAASMLMAAAAVFAGDAAAPRPSSDIASAVNQFV
QPVAHVPATGAIPGTEAHLPAGVDPAHAVGPAPEATPEVAHAAAAVPPGP
PPAPGPAPLPDPAASPAAAPAAAPVAAPAAAPVAAPAAAPVAAPDPAAAP
AAVVAPNPAPPGAPAPAAAPAPAATPAAVVTPNPAPPGAPAPAAAPAPAA
TPAAVVTPNPAPPSAPAPAAAPGGAPNFGPNAPVTQDFLYPSISNGCLKD
GGNVLATAISVAGPATIPLPGPKAGQTAYVFTAVGTPGPAAEQKLPLNVT
WVNLTTGKSGSATLKPRPDMNANGPTTLTAIADTGSGSIMSTIFGQVTTT
EKQCQFMPTIGSTVVP
392417752YP_006454357.1 hypothetical protein Mycch_3953 [Mycobacterium chubuense NBB4]MLRTRKLFATTMIAAAGAVSAAVALSAAAAAQPPAAPAPAPAPEVPGLPF
LQQLAANPAAATQLVQTFANVLGNAPAATASTTATPAGVAATPGITPAAT
PATMPGATASITLPQPANALPGAATTVPASVTTPAAAPSASPLGGLTSAL
GVPGGLASLLPAGTPLAGLLPTGNSAAPAAAPVAPAPAPAAAPAPLFTPL
SALP
392417751YP_006454356.1 Protein of unknown function (DUF2029) [Mycobacterium chubuense NBB4MARLSAAAPVLLIVSIAARLAWTYLLPNGANFVDLHVYVGGAAALDQPGT
LYDYVYADQTPDFPLPFTYPPFAAVVFYPLHLLPFGLVALAWELGIVAAL
YGVVRLSQRLLADSPGALPGGHRVAMLWTAVGIWTEPLRSTFDYGQINVL
LVLAVLYAVYRTQWWLSGLLVGLAAGVKLTPAVSGLYFLGARRWATAVFS
GVVFLGTVVLSALVVGDQTRYYFTDLLGDARRVGPIGTSFNQSWRGGISR
ILGHDAGYGPLVVAGIAVTAVLALLAWRAIGGSDDRLAAIVVVQLFGLLL
SPISWTHHWVWLIPLMIWLLHGPWRDRTGARILGWGWLALTLIGVPWLLS
FAQPTIWVISRPWYLAWAGLIYIVATLATLAWIATRGSRRYRGPSAGPCP
392417750YP_006454355.1 pterin-4a-carbinolamine dehydratase [Mycobacterium chubuense NBB4]MAVLTDEQVDAALPELDGWERADGALRRSVKFPAFLDGIEAVRRVAEHAE
AKDHHPDIDIRWCTVSFALVTHSEGGITDKDLQMARDIDGILG
392417749YP_006454354.1 ADP-ribose pyrophosphatase [Mycobacterium chubuense NBB4]MPVQIVVAGALTSGATLLVAQRDRPAELAGRWELPGGKVTAGESEREALV
RELDEELGVTVQVGARLGDDVELPGSVVLRAYVVTQVGDGTAQPHDHRCL
RWVTAADLDALDWVPADRAWLPHLRALLADPTAFAAGPIDPARAADEH
392417748YP_006454353.1 nitrate/nitrite transporter [Mycobacterium chubuense NBB4]MSTAVTPDTGARRGLNLALATWVSAINFWAWNMIGPLSTTYAGDMSLSST
EASMLVATPILVGALGRIVTGPLTDRFGGRTMLIAVTVASILPVLGVGAA
GSANSYPLLLVCGFLLGVAGTIFAVGIPFANNWYEPARRGFATGVFGMGM
VGTALSAFFTPRFVKWFGLFTTHVIIAAALVLTAAFCLVVLRNAPYFRPN
RQPVVPKLKAAAKLPVTWEMSFLYAIVFGGFVAFSNYLPTYIKTIYGFSA
VDAGARTAAFALAAVLARPVGGALADRIAPKYVVLGSLLGTAAMAFIAVF
QPPPDVWSAATFIALAIFLGIGTGGVFAWVARRSPAASVGSVTGIVAAAG
GLGGYFPPLVMGATYDAAANEYTVGLLLLVATALAAVGFTALRLHAHEPK
ATEAPA
392417747YP_006454352.1 respiratory nitrate reductase alpha subunit apoprotein [MycobacteriMTNPPRTGGRVEELLERSGRFFTRGEISDDLRTVSHRGGREGDIFYRDRW
SHDKVVRSTHGVNCTGSCSWKVYVKDGIITWETQETDYPSVGPDRPEYEP
RGCPRGAAFSWYTYSPTRVRYPYARGVLVEMYREAKARLGDPVLAWADIQ
GDPQRRRRYQQARGKGGLMRVTWAEAAEMIAAAHVHTIKTYGPDRIAGFS
PIPAMSMVSHAAGARFVSLLGGAMTSFYDWYADLPVASPQVFGDQTDVPE
SGDWWDASYLVMWGSNVPVTRTPDAHWMAEVRYRGTKVVTVSPDYADNTK
FADEWMPCAAGTDGALAMAMGHVILTEGFVRQRVPFFVDYARTYTDLPFL
VKLEERDGIVVPGKMLTAADLDIGHQAMENAAFKPALWDGASESVAVPPG
SLGFRYGDAGAGKWNLDLGELVPALTVARAGEDPGETAMIVLPRFDAVDG
DAGTVRRGVPVRRVAGHRVCTVFDLMLAQYGVGRPGLPGDWPTGYDDPDA
PYTPAWQEPITGVSASQAIRVAREFARNAEESGGRSMIIMGAGICQWFHG
DTTYRAVLALLLLTGSMGRNGGGWAHYVGQEKCRPITGWATMGSATDWSR
PPRQMPGTSYWYVHTDQWRYDGYRADALASPTARGRFTGKHTMDVVTAAA
AMGWMPFYPQFDRSSLDVADEARAAGREIPEFVCEQLASGALRLAVTDPD
DPANWPRVLDVWRANLLGSSSKGNEYFLQHLLGTASNLQATPTAEHLRPD
GVAWTPEIPEGKLDLLMSIDFRMTSTTLLSDVVLPAATWYEKADLSSTDM
HPYVHAFSPAIDPPWETRSDFDAFGAIARAFSALAKNHLGTRTDVVLGAL
LHDTPGAMAYPGGVHRDWRESGEVPVPGKTIGPITVVERDYTAIADKWST
VGPLVDRLGVTTKGVTTRPDHEIDELSRKFGVLDSGAAAGRPAMTTAERM
ADVILALSGTSNGRLAVEGFRELERRVGKPLAHLAEGSEERRITYADTQA
RPVPVITSPEWSGSETGGRRYAPFTVNIEQLKPFHTLTGRMHFFLDHDWL
EELGEQLPVYRPPLDLGRLFGEPAVGDRDGVGLTVRYLTPHSKWSIHSEY
QDNLFMLSLSRGGPTMWMSPSDAAKIGVADNDWVEAVNRNGVLVCRAIVS
HRMPEGVVYVYHAQERVIDVPLTETTGRRGGIHNSLTRLLVKPSHLAGGY
AQTAFAFNYLGPTGNQRDEVTVVRRRSQEVTYR
392417746YP_006454351.1 respiratory nitrate reductase beta subunit [Mycobacterium chubuenseMKVMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRPGTEYVWFNNVETRPGQ
GYPRTYEDQDRWRGGWMRDKRGRLRLRGGGRWHKLAHIFSNPKLPSIEDY
YEPWTYDYENLINAPLGEHMPVAPPRSLISGEPMKVQWSANWDDNLAGSP
EILPGDPVLQKVSEEVRLELEQTFMFYLPRICEHCLNPSCVASCPSGAMY
KRSEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRIE
VGLPTVCSETCVGRLRYLGLVLYDVDRVLAAASVSDDTDLYAAHRQILLD
PNDPEVIAGARAEGISDEWIEAAQNSPVYALINTYQVALPLHPEFRTVPM
VWYIPPLSPVVDAVSRSGHDGEDAGNLFGALEALRIPIEYLAGLFTAGDT
AVVEGVLRKLAAMRSYMRDVNLGRETQPHIPESVGMTEEQIYDMYRLLAL
AKYDERYVIPTAYATDGLPGVEEPGCSLSFEGGTGMYESGPFGEASGGPV
PVAVETFHALRNRQTSEEMAANRTRPSRVNLLNWDGRGAPSGLFPGDGER
R
392417745YP_006454350.1 respiratory nitrate reductase chaperone NarJ [Mycobacterium chubuenMKARLRSRTTLNDRLTWQCASLTLSYPDGDRLDTAAELLTHIDGPAARHL
AGTLDAVRALSPREAAEAYVATFDMRRRCTLYLTFWTAGDTRNRGQAMLE
FARTYREAGVSPPDREAPDYLPVALEFAANVDWDAGRRVLGAHRVAVDVL
HRALCEAGSPYAMTVAAVLSTLPRGSESDELSAQRLVAHGPPAEAVGLQP
FTLTVPPRGRAGRTDAVAGRPGGR
392417744YP_006454349.1 respiratory nitrate reductase- gamma subunit [Mycobacterium chubuenMRWRAALEVADVSGWEIFWDVVPYVTLAIVVVGTWWRYRYDKFGWTTRSS
QLYESRLLRIASPLFHFGILVVIVGHIIGLVIPESWTAAVGLSNHAYHVQ
ALVLGAIAGVCTLVGVSLLVYRRRTSGPVFMATTRNDKLMYLVLVLAIVA
GLACTLIGATPVGGEHDYRQTVSPWFRSIWMLQPRGDLMVQAPLWFHIHV
LIGLTLFCLWPFTRLVHAFSAPVGYLFRPYVVYRSRDVARKGELVGSQPH
RRGW
392417743YP_006454348.1 hypothetical protein Mycch_3944 [Mycobacterium chubuense NBB4]MTVYEVLTVALITALAAATIVAIYWGLANWVGTFYVVRCTECRHLTFNSA
NQPRTSCPHCRHPVLTHPLHALVHPASRTDVRVVGDRLHF
392417742YP_006454347.1 GTP-binding protein TypA/BipA [Mycobacterium chubuense NBB4]MSSRPDFRNVAIVAHVDHGKTTLVDAMLRQSGALSHRGDDAIERLMDSGD
LEKEKGITILAKNTAVHRHHADGGMTVINVIDTPGHADFGGEVERGLSMV
DGVLLLVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVS
DSHDLLLDVASDLDEDAQKAAEDALGLPTLYASGRAGIASTVQPANGENP
QGENLDPLFDVLLEHIPPPHGDPEAPLQALVTNLDASAFLGRLALIRIYK
GRIRKGQQVAWMRDVDGHPVITNAKITELLVTEGVERTPTEEAVAGDIVA
VAGIPEIMIGDTLADPDHAHALPRITVDEPAISVTIGTNTSPLAGKVSGH
KLTARMVKSRLDSELIGNVSIKVVDIGRPDAWEVQGRGELALAVLVEQMR
REGFELTVGKPQVVTRTIDGKLHEPFEAMTIDCPEEFVGAITQLMAARKG
RMEEMANHAAGWVRMDFIVPSRGLIGFRTDFLTLTRGTGIANAVFDGYRP
WAGEIRARHTGSLVSDRSGSITPFAMIQLADRGQFFVEPGQDTYEGQVVG
INPRAEDLDINITREKKLTNMRSSTADVIETLARPLELGLEQAMEFCAED
ECVEVTPEIVRVRKVELTASLRARAKARAKQQANS
392417741YP_006454346.1 ABC-type dipeptide transport system- periplasmic component [MycobacMIDTLSGVPTARRVLTCAVVVMTLLAGCTVSPPPAPQSTDTTKSTPPPPM
KATQIIMAIDSIGPGFNVHLLSDQSPVNAAISSLVLPSSFRPIPDSRTPT
GSRWEMDTSLLQSAEVTSQDPFTVTYKIRPEAQWTDNAPIGADDYWYLWR
QMVSQPGAVDPAGYDLITGVQSVEGGKTAVVTFSQPYPAWRELFNNILPA
HIVKDVPGGFPAGLAQAMPVTGGQFRVESIDPQRDEILLARNDRYWGEPA
TPDLILFRRGGAPAALADSIRNRDTQVAQVHGGSAVFAQLSAIPDVRTAR
IVTPRVMQLTLRAQQPALADAEVRKAVLGLLDVDLLASVGAGDDNTVTLA
QAQVRSPSDPGYVPTAPPALTREGAMTLLADAGYQIDAAPPTTTAGPPAP
GAPDANRGQLTKDGQPLTLVLGVANNDPTSVAVANTAADQLRSVGIVASV
SALDPVALYGDALVNNKVDAVVGWHQAGGDLATALASRYGCPALEATAVP
TTTGPTPAPPSATSQAPSTSNPPAGPPPPSTPPSTATATPPSPAPESGQL
VQAPSNITGICDRSIQPRIDAALRGTADIGEVIDEVEPKLWNMSTVLPIL
QDTTIVAAGPSVQHVSLTGAVPVGIVGDAGKWVKQPQ
392417740YP_006454345.1 chloride channel protein EriC [Mycobacterium chubuense NBB4]MEFGCAILVIGLLAGLAGAATTLVLHGVEHATYHYTLGTLLSGVESSTHL
RRAVGPMLGGALAGCGWWLLHRRYQVPALSETIAGRRPVPRLVMTVDAGL
QVLLVGSGASLGREGAPRQLAAAWGDLGTSRLTLTEQDRRILLACAAGAG
LAAVYSVPLGGALFATRILLGTWHPRAVGTALITSSLAVAVAAPVTHLEH
PLVWPDARLSPLLGFLALALAPLAAAVGLVFDRVSTAARRRAAHSWAVIP
AIAAAGLATGVCSIWLPELPGNGRSVLQVSVNSGLTLTAAAAILLLKPLL
TAVFLRAGAVGGLLTPALATGAAAGSVVALGLDQWAGTQLHVATMSLACA
AGVLAITQRSPLFSTLFVWELARPPLWLLAVFAVCAYASYGLAVLRWRHR
GVTAAA
392417739YP_006454344.1 N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside dMYARAAFCAVPTSGQAVGMETPRLLFVHAHPDDETLTTGATIAHYAARGA
QVQVVTCTLGEEGEVIGDRWALLAADRADQLGGYRIGELTAALAALGVDG
PRFLGGAGRWRDSGMAGTPPRGRERFVDGDLAEQTAALAAVIDDLRPHVV
VTYDPHGGYGHPDHIHTHRVTTAAVDAAGWRVPKVYWTVTSQTAMTEGLA
ALSDVPDGWIQLPADDLPIVGFGDDAIDAALDLTAHGAARVAALRAHETQ
VSVSPDGRTFALSNNIALPVDSTEYYVLAAGAAGERDARGWETDLLAGLE
LD
392417738YP_006454343.1 hypothetical protein Mycch_3939 [Mycobacterium chubuense NBB4]MDQDLDPNLQHWQDRFDNYQWVVGSLVSLLDSIPT
392417737YP_006454342.1 hypothetical protein Mycch_3938 [Mycobacterium chubuense NBB4]MLFVLALDGVLSALMAVFFLPLRVGTVPLPVSGLVSGILNALLVLAAAKW
TTSPRLAALPLWTWLATVVVFTFGGPGDDIVFGGTGIMGFGAVLLIVLGA
APPAWILTRRTTPARGGGSGRRVGAGAGARAE
392417736YP_006454341.1 FO synthase subunit 1- FO synthase subunit 2 [Mycobacterium chubuenMALNPARGADLPSPVIPPKSGAPDPAALRRVLRRARDGVALNADEAAIAM
TARGDDLADLCASAARVRDAGLEAAGRRGATGRLPVSYSRKVFIPVTHLC
RDTCHYCTFVTVPGKLRAQGTGMYMEPDEILDVARRGAELGCKEALFTLG
DRPEERWDEARQWLDERGYDSTLDYVRAMAVRVLEETGLLPHLNPGVMSW
SELSRLKPVAPSMGMMLETTSRRLFETKGLAHYGSPDKDPEVRLRTLADA
GRLSIPFTTGLLVGIGETLTERAETIHAIRRLHKEFGHVQEVIVQNFRAK
DHTAMASVPDAGIDDFLATLAVTRLVMGPKMRVQAPPNLVSRAECLALLG
AGVDDWGGVSPLTPDHVNPERPWPALDELAAVTAEAGYDLVQRLTAQPPY
VQAGAGWIDPRVAGHVSALADPDTGYALDVNPVGRPWQEPDEAAESLGRT
DLHAAIDSQGRLTETRSDLGSAFGDWESIREKVHELAARAPERLDTDVLA
ALRSAERDPAGCSDDEYLALATADGPAMEAVAALADSLRRDTVGDDVTFV
VNRNINFTNICYTGCRFCAFAQRKGDADAYSLSTAEVADRAWEAHVAGAT
EVCMQGGIDPDLPVTGYADLVRAVKARVPSMHVHAFSPMEIANGVTKSGL
SIREWLTSLREAGLDTIPGTAAEILDDEVRWVLTKGKLPTSMWIEVITTA
HEVGLRSSSTMMYGHVDTPRHWVGHLNVLREIQDRTGGFTEFVPLPFVHQ
SSPLYLAGGARPGPTHRDNRAVHALARIMLHGRISNIQTSWVKLGTERTQ
VMLRGGANDLGGTLMEETISRMAGSEFGSYKSVEDLVDIAAGIGRPARQR
TTTYAPLAA
392417735YP_006454340.1 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1-7-dioic acid hydraMKLRRVCADGRLELQILESDGSWSTTQDRSALGGVVFDAEWELATARRHV
DVSGNVLPFQPASFRDFMLYERHAVDAARGLVRRFHPGQSRAATAVEKLT
RKPFPMFKPKALFYRQPIYYMSNHLSFVPSGTPVTIPSYSAALDFELEIG
FVLKSPLFNATPHQALEAIGAFVVVNDFSARDVQRTEMASGLGPQKSKHF
ASSMSVLAVTADEILPQIDDLSGSVTINGGTVATVFSRGMQWSLGDILAH
ASRDEMLYPGELFATGTLPGGSGMETGRWLRPGDRLTLAIDQIGEISHSI
SSVQEPS
392417734YP_006454339.1 hypothetical protein Mycch_3935 [Mycobacterium chubuense NBB4]MTTVAGLPAHALLVHAIVVLVPMITLVGILCALWPAARQRFVWGLVALAV
VNLVLTPLTVSAGEWLYNRQDSHSTILQTHAERGETMIYFSIALLVMAIA
VAVLHVRAGRSGGSHRLATVLVAVLVVVIGVASTVQVVRIGHTGTEAKWG
VVGQ
392417733YP_006454338.1 hypothetical protein Mycch_3934 [Mycobacterium chubuense NBB4]MTTATAQLATGTWAIDPVHSSVGFSVRHLMVSKVRGQFENFSGAITVAED
GTPSVRAEIAVDSVDTRNEQRDAHIKSADFFDVERYPVATFTSTAVRADG
DRYVVDGDFTLKGVTKTISLDLEFNGVNPGMGHGEVAGFEASVVVNRKDF
GIDIDMPLETGGAVVGDKVTITLEIEAVKQV
392417732YP_006454337.1 ferredoxin [Mycobacterium chubuense NBB4]MTYTIAEPCVDVKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVC
PVEAIYYEDDVPDQWSGYTQINADFFAELGSPGGASKVGQTDNDPQAVKD
LPPQGED
392417731YP_006454336.1 succinyldiaminopimelate aminotransferase apoenzyme [Mycobacterium cMSGSLPVFPWDTLADVTATARAHPDGIVDLSVGTPVDDVAPVIRDALAAA
GSAPGYPTTAGTAALREAAVTALQRRYGVTGVTPAAVLPVIGTKELIAWL
PTLLGLDGSDTVVVPELAYPTYEVGALLAHTAVVRADSLTQLGPASPALV
YLNSPSNPTGKVLGVDHLRKVVGWARERGVLIASDECYLGLGWDAAPLSV
LHPDVCDGDHTGLLAVHSLSKTSSLAGYRAGFVAGDPAVVAELLAVRKHA
GMMVPTPVQGAMVAALDDDAHEREQRERYARRRAALLPAIEAAGFTVDHS
EAGLYLWATRGEPCRDTVAWLAERGILVAPGEFYGPRGARHVRVALTATD
ERIAAAVQRLADSAR
392417730YP_006454335.1 hypothetical protein Mycch_3931 [Mycobacterium chubuense NBB4]MAVSAPGVGLGQLLLALDRTMVTLVDAPRGLDMPVSSVALIDSDDVRLGL
AVGPGSADLFFLLGVSDADVAGWLEHHAGRPAAIFVKDPTPAAVARVAAL
GTAVVAVDPRARWEHLYRLVNHAFEHHGDRGDRHTSETDLFGLAQSIADR
TRGMVCIEDADSHMLAYSASDEADELRRLTILGRAGPPEHLEWIGQWGIF
DALRSGPDVVRVAERPELGLRPRRAVGVHLPADDDRRTRPAARFAGTIWL
QQGSAALADDADEILRGGAVLAARIMSRLASAPSQHAVRVAQLLGLAAGD
EDASALAGELGIPAEARAAVVGFHGVTAAVPPDVIALSAGAFRPDAQVTA
HADRVYVLLPKVSATTTVTSWARGVVASLRRELGVEARAVTAAPLAGLAA
AAPARTEVDRVFDSAERHPAAIGQVTSVDEARTTVLLDEIVSHIAEQPRL
VDPRVRELRAREPMLAETLQAYLDGFGDIAVIARHLHVHANTVRYRVRRI
EKLLSTRLDDADDRLVLALALRATEP
392417729YP_006454334.1 delta-1-pyrroline-5-carboxylate dehydrogenase [Mycobacterium chubueMNALTAITDVPLPQNEPIHDYAPGSPERSRLSDALTSLAGDPVELPHVIG
GVHRMGSGDRVDVVQPHRHHSRLGTFTNADHTDAAAAVEAAAAAKPGWEA
MPFDERAAVFLRAADLLAGPWRETLAAATMLGQSKTAYQAEIDTPCELVD
FWRFNVAFAREILAQQPISSPGVWNRTDYRALDGFVYAITPFNFTAIAGN
LPTAPALMGNTVVWKPSPTQTFAAYLTMQLLEAAGLPPGVINLLAGDGKA
VSDVVLADRRLAGIHFTGSTATFQHLWREVGTHIDRYDAYPRLVGETGGK
DFVVAHPSAQPDVLRTALIRGAFDYQGQKCSAASRAYIPRSVWQRMGDDF
LGATEALRYGDVTDLTNFGGALIDARAFAKNVTAIERAKSAARVTVAVGG
EYDDSEGYFVRPTVLLSDDPGDEAFSTEYFGPLLAVHVYPDDDYERILDT
VDGSARYALTGAVIADDRAAVLQAGQRLRHAAGNFYVNDKPTGAVVGQQP
FGGSRASGTNDKAGSALNLLRWTSARSVKENFVPPTRHTYPHMEA
392417728YP_006454333.1 proline dehydrogenase [Mycobacterium chubuense NBB4]MGVFERVARPAILAAARRDGLRRTAERLPVTRAVVHRFVPGESVGDVMGS
IRQLRNSGRLVSIDHLGEDVTDADAAEATVTAYLELIDALTTRTEPPSAV
RPLEVSLKLSALGQALPRDGEKIALENARAICDRAQRAGVWVTVDAEDHT
TTDSTLSIVRELRTDFGWVGTVLQAYLKRTRGDCAEFAASGARIRLCKGA
YDEPASVAFRDRDDVTDSYLQCLRILMAGSGYPMVASHDPEIIAAVPALV
HEYGRSTEHFEYQMLYGIREAEQRRLASDGNHIRVYVPFGTQWYGYFVRR
LAERPANFTFFLRALAERRS
392417727YP_006454332.1 hypothetical protein Mycch_3928 [Mycobacterium chubuense NBB4]MSGLRARAALASATLLAAACVCAESVAQAAPPDWSGRYTVVTFASSKLGT
SIAARQPEPDFSAQYTFSTSCAGTCVATAADGPAPTNPTVPQPSRYTWDG
ARWVFNYNWQWECFRGDDVPREFVPARSLVFYAPTPDGSMFGTWRTEILD
GVCKGTVVMPVAAYPA
392417726YP_006454331.1 NTP pyrophosphohydrolase [Mycobacterium chubuense NBB4]MDSIRAVGTRQVYRNNWLTIREDDIRRPDGSAGIYAVVDKPTYALVIPRD
GERFHLVEQFRYPLGLRRWEFPQGTAPDRAALDPPELAARELREETGLLA
ESMTELGLLDVAPGMSSQRGRVFLATGITEGPHDREHEEQDMRSAWFARS
EVEQMMRDGVITDAQTLAAWALMLLAEAA
392417725YP_006454330.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMLLASLNPAAVAAGADVADAVRIDGVTWSRSDLVGAATSVAERVGGAARV
AVLARPTAATVLGVVGALIAGVPVVPVPADVGVAERRHILSDSGAQAWLG
EVPEYTDGLPHVPVRLHARSWHRYPEPSPDATALVVYTSGTTGLPKGVLI
SRRAIAANIDMLAEAWQWSADDTLVHGLPLYHVHGLVLGLLGSLRIGNRF
VHTGKPTPHAYAHAVTELGGSLLFGVPTVWSRVVEDGDAARALAPARLLV
SGSAPLPVPVFDGLARLSGHQAIERYGSTESLITLSTSAAGERRPGWVGL
PLRGVRTRLVGEDGADVAHDGETIGRLHVTSPTLFDGYLNRPDATAEVLG
ADGWYRTGDVAVVDAGGMHRIVGRESVDLIKSGGFRIGAGEIETVLLGHP
GVREAAVVGAPDEDLGQRIVAFVVGDAVPDALIEHVGQQLSAHKRPREVR
IVDALPRNAMGKVLKKELQQWV
392417724YP_006454329.1 hypothetical protein Mycch_3925 [Mycobacterium chubuense NBB4]MGLRFSDVCIDAHDARTLAAWWSQVLGWPAEDTDDGDVALRAPEGAGPDW
LFLAVPDDKVVKNRIHFDLTPDDQHAEVQRLTALGARHVDIGQGDESWVV
LADPEGNEFCILAAGE
392417723YP_006454328.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium chubuense NBB4]MSGARTLAVIGGALTVTLAAACGQSPEVMLAQTSIVLPPPPEPVTPPAPG
DALAIGPAAVDTTGGWLPDGTMLSPFDSANPILSQIDPALLTAVQDAART
ATAQGVDIRVSSGWRSKGFQQRLFDDAVRNYGSVEKAAQFVAGPEVSHHV
TGQAVDIGPPDADRWLIANGRQFGLCQIYANEIWHFELALDAQGNCPPLR
PNAAG
392417722YP_006454327.1 2-3-4-5-tetrahydropyridine-2-6-dicarboxylate N-succinyltransferase MTSASGASGASGIGLATIAGDGTVLDTWFPQPELGGDGVPGTVRLSVAEV
PAELAELVGRDEDRDVETVVVRTVIESLEDKAADAYDAYLRLHLLSHRLV
APHGLNADGLFGVLTNVVWTNHGPCAIEGFETVRARLRRRGHVTVYGVDK
FPRMVDYVVPSGVRIADADRVRLGAHLASGTTVMHEGFVNFNAGTLGNSM
VEGRISAGVVVDDGSDVGGGASIMGTLSGGGTEVISVGKRCLLGANAGLG
ISLGDDCVIEAGLYVTAGTKVVTADGQTVKARELSGANNLLFRRNSVTGA
VEVVKRDGTGITLNEALHAN
392417721YP_006454326.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTLRQLRYFAVLGQELNYRRAAEKLFITQPALSTAIKQLEHQFGVLLFRR
NTREVALTDLGAAWLPQVQQAISGVDAVVDNLVMLSGTRRGVLRVGYLIG
TGADLLFRLVRHFEAAYPDVTVEPIEFDFSDPTAGLADGTTEVAIIRPPV
DLPEHRMLMLDSESWVACLPRDHRLAGREEVTIAELLDDPIVCAPLTAGM
WRDYWLAMDARGNRPPTIAAVAATYEAETTAIARGLGISFTTSSVARFYD
RPGIVYVPIADRPPSHTALAWHPANVTPQADALVRLVQDQWNSGDPE
392417720YP_006454325.1 amino acid transporter [Mycobacterium chubuense NBB4]MTDAVTRTTHSEQPTPVLNAEDAKLAELGYTQKLDRSVGTLASFAIGFAT
ISATTAVFTGFGAGYFTAGGPFVWTLLLAGAVFALWAFIAADLTAKLPLA
GYSYQWISRINGPDLAWFTGFIALMGWVCGMTGVGFILSGYLGGLFGWTM
SQSAQILVAIGVVFVCVLINIYGVRFATMVNNIGVSFELVITVGATALVA
IIAFASPENHQPISALFTGGQSGDKDSYVLAWLAAALGPFFGLIGVESGA
DVAEETKNARRVVPKTMFYALVTSIVIELLMYIVYVLAIRDAAAVEANSA
APIEEIISQQAGPVVTKIVVAVALTNILACLLANILVATRLTYSMARDNM
LPFSHVWRHVSPKSKAPTYAVLGLGCLSAALLLSALVNEKAFNYIIGIAS
LLFFFVYILQTIGLLVGYRRGTIPAAEPGTFDLGRWRLPLYVTALVVFLG
VAVALLFLPQFTNNKWVFLGIVALAALWWATGLKSRLSRGDAGADYAKTH
ND
392417719YP_006454324.1 branched-chain amino acid aminotransferase/4-amino-4-deoxychorismatMTALDIDSSRKRSSADTGTSNLVAVEPGAIREDTPPGSVIQYSDYELDYS
SPFAGGVAWIEGEFIPAEDARISIFDTGFGHSDLTYTVAHVWHGNIFRLG
DHLDRLLDGARKLRLDAGYGKDELAEITKKCVSLSQLRESFVNLTVTRGY
GRRKGEKDLSKLTHQVYIYAIPYLWAFPPAEQIFGTTAIVPRHVRRAGRN
TVDPTIKNYQWGDLTAASFEAKDRGARTAILMDADNCVAEGPGFNVCIVK
DGKLASPSRNALPGITRKTVFEIADAMGIEATLRDVTSHELYEADEIMAV
TTAGGVTPINTLDGEAIGAGEPGPLTVAIRDRFWALMDEPSPLIEAIEY
392417718YP_006454323.1 succinyldiaminopimelate desuccinylase [Mycobacterium chubuense NBB4MLDLHGDPIALTAALVDIPSESRHEKRIADEIEAALRAQTGGFEVVRSGD
AVLARTNLGKPSRVLLAGHTDTVPAADNLPSRLVDGVLHGCGTSDMKSGD
AVFLHLAATVAEPAHDITLVLYDCEEIEASANGLGRIERELPDWLAADVA
ILGEPSGGYIEAGCQGTLRVVVSATGTRAHSARSWLGDNAIHKLGDVLAR
LEAYRARSVDIDGCVYREGLSAVRIDGGVAGNVIPDAASVTVNFRFAPDR
SAEEAYGHVCDVFSGLDVGIELTDSAAGALPGLTRPAAAALVDAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHRADERVDAGQITAATDMLRR
YLTA
392417717YP_006454322.1 ATPase component of ABC transporters with duplicated ATPase domain MSFTPSVVCSHLSFSWPDDTALFSDLSFTVGPGRTGLVAPNGAGKSALLR
LIAGELIPAAGSVTVDGVIGYLPQTLPLLDDRSVGEVLGVAEVIGALDAL
AAGDAGEEVFAAIGDDWDVEERTRAQLDRLGLGHLALERSLRSLSGGEVV
TLGLARELLRRPDVLLLDEPTNNLDADARHRLYEALDDFGGCLLLVSHDR
VLLDRMDRIAELHRGEITLYGGTFSDYRAALEEGQRAAEGAVRNAEQLLK
REKRQRQQARERADRRANTAKRTLSDAGLPKIVAGAMKRRAQETAGRTDD
VHARRVQEARARLDGAERAVRDDDTLVLDLPHTAVRAGRTVLQINDLRII
RDGRELLAGVDLVVRGPQRIALTGRNGAGKTTLLRAVLGEIEPDAGAVAV
ADGRVAYLSQRLDLLDDDRTVAENLAAFAPGLSVTRRRHLLAQFLFRGDG
VDLPVGVLSGGERLRATLACVLFAEPAPQLLLLDEPTNNLDLVSVGQLEA
ALGAYGGAFIVVSHDDAFLDAIGVERMLRVENAALMSG
392417716YP_006454321.1 Protein of unknown function (DUF2580) [Mycobacterium chubuense NBB4MVEPLSVNTDGVRSLSDIHSTVAAALGALTAAAPGAAGVASTHGTVAAAV
GTALTSALGSRRGTMATTRASGDTIAELLHQAALAYERGDRRGAEAITAE
AQEAAPTRPAAD
392417715YP_006454320.1 hypothetical protein Mycch_3916 [Mycobacterium chubuense NBB4]MPVPVHWVTAPPEPALTQVESGVRTHAGAVLVGPAGVGKSTLARRAVERL
APDFSRVDWVRATASQTRVPFAAFEHLIDVPDTGKTAAVLRAARERLGDG
RLLVVDDAHLLDPLSATLVYQLAVARAVRMVATASLGGPPVPAEISALWR
DGLLARIDLQPAGHDDGRLRAQVGEFVETLPKAAHRVLEYLVVSDPLSLE
DAAVLTSAHAVDEAVQSGAVEIGEDGLRPAHPLFCDAVRGALGGPEVRRL
RTAVVERLSASASKGVVGRLRLAVLALGSDRPQSTADLRTAAQEALRLGD
LELCERLGRAALERGPDLAARLTVAYALAWQGRGREADDVLAEIDSTALT
EDELMAWALPTAANQFWMLSQPERATAFLRTIRGKVSSPAARTTIDALSA
TFAMNAGNLTRATEIAAEVLASPDADDTAIGWAASAAALSAARTGRFADV
DALAERASAGQPGLLRFTSGYGQTTALVMGGEPDRALELAQRLTDFAQRR
QPGRAIGEVLIADALLAKDDPAQAVALLRDAAATLAPTGYSWGPLAWMLL
AQALGRLNQPVEAAKALSRAESRHGLKSMLFAPELALARAWTMAARNDAH
EAVELARGAVKAADRGGQTAVALRAARDGVRLGDPRARDTLTRLCREVDC
AFGRDALAAAGD
392417714YP_006454319.1 TIGR00730 family protein [Mycobacterium chubuense NBB4]MARFEPVSREPDREWAVCVYCASSPQHPDLIDLARRVGTGIADRGWTLVS
GGGNVSAMGAVAGAARSHGGHTIGVIPKALVHREVADTEADELVVTDTMR
ERKQVMEDRADAFIALPGGIGTLEEFFEAWTAGYLGMHSKPIVMLDTLGH
YDGLLAWLRGLVGTGYVAEEALRRLIVVDDVDAALTACAPRLG
392417713YP_006454318.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMSGKSGTRSSVGVLDIASQVPGLLMDTPTILRGVVTGFLARPSAKTSIGK
VFQDRAAQYGDKVFLKFADKELTYGEANETVNRYAAVLAARGVGHGDVVG
IMLRNSPDSVLLMLAAVKCGAIAGMINYHQRGDVLKHSLGLLEATVVVTE
VDLVEPINESGADTTGLLTIDEIQQLAATAPTTNPATTSAVLAKDKAFYI
FTSGTTGMPKASVMTHYRWLRALAGFGGLGMRLNSSDTLYCCLPLYHNNA
LTVALSSVLNSGAALALGKSFSASKFWDDVIRFDATAFVYIGEICTYLLG
QPEKPTDRKHKVRVIAGNGLRPAIWDEFTNRFGIKRVCEFYAASEGNTAF
VNVLNIDKTTGICPTPVAFVEYDHDSGEPKRDENGRLRRVKNGEPGLLLS
KVSNFQPFDGYTDKEATEKKLVRGAFKEGDVWFNTGDLMRAQGFGHAAFT
DRLGDTFRWKGENVATTEVEAAISTDSQVEEATVFGVEVPGAGGRAGMAA
IQLKDGQEFDGKSLAKAAFDKLPGYAVPLFVRVVEELAHTSTFKSQKGDL
RKEGYGKASGDDDDSEDVTIEDPLYVLSGKDEGYVPFYDEYPEEVAAGKK
PK
392417712YP_006454317.1 Dihydropteroate synthase [Mycobacterium chubuense NBB4]MQSTFLGRPVAGGRALIMAIVNRTPDSFYDRGVTFTDEAAKEAAHRVIAD
GADLVDVGGVKAGPGETVGVDEEIARVVPFIEWLRSTYPDQLISVDTWRA
EVAKQACAAGADLINDTWGGADPDLATVAAEFGAGLVCSHTGGAAPRTRP
FRVDYGITERGVVDDVLAEVTAAAERAAALGVRRDGIVIDPTHDFGKNTY
HGLSLLRHVKDLVNTGWPVLMALSNKDFVGETLGVGLTERLEGTLAATAL
AAAEGAAMFRVHEVGPTRRVLEMVASIKGARQPKRTVRGLA
392417711YP_006454316.1 glycosyl transferase [Mycobacterium chubuense NBB4]MTVLSDRVNDLDTYQVAEHRWLSDHSWSRPDWTVAELEAAKCGRTVSVVL
PALNEEETVAGVVETITPLLGGLVDELIVLDSGSTDDTEIRAVAAGARVV
SREVALPEVAPEPGKGEVLWRSLAATTGDIIVFVDSDLIDPDPMFVPKLL
GPLLTTDGVHLVKGFYRRPLKVSGSEDANGGGRVTELVARPLLAALRPEL
MCLYQPLGGEYAGTRELLTSVPFAPGYGVEIGLLVDAYDRLGLDGIAQVN
LGVRTHRNRPLTELASMSRQVIATLLSRCGIPDSGVGLTQFYADGEDYTP
RTSTVSLADRPPMITLRPR
392417710YP_006454315.1 DivIVA domain protein [Mycobacterium chubuense NBB4]MTLVLLYLVVLVLIGVVLFAVGSVLFGRGEVLPPLPRGTTATVLPASGVT
GADVDAVKFTQTARGYKTSEVDWVLDRLGQELDQLRGELAAVRAAQGLDE
PAVERPAEGVHAAHSDDARDGT
392417709YP_006454314.1 DNA-3-methyladenine glycosylase I [Mycobacterium chubuense NBB4]MTAPADDRRIRCGWIDRSRLSSDDFVLYRDYHDTEWGRPVRDSAALFERI
SLEAFQSGLSWLIILRKRDNFRSAFDGFDVERIARYTDRDVERLMADPGI
VRNRLKIEATISNARAAADLADDGVDLGELLWSFAPPDRSTRERPTDLSL
VAAVTPESAAMAKELKRRGFRFVGPTTAYALMQATGMVDDHVANCWVPRA
AS
392417708YP_006454313.1 methyltransferase- putative- TIGR00027 family [Mycobacterium chubueMADQPHDGHVPAPVQRKAVADTGVLVAAIRAHESTRDDRLFTDPYAARLA
GTAGLAMLERMVADVGERSTTQIVVRTRFWDEALLRATGTVRQVVILAAG
LDARAYRLAWPAGTTVFEIDQPAVIAAKAELLAGERPRCVRVAVGVDLAD
AWAGVLTSAGFDPARPTVWLIEGLLQYLDEAAVHALFAQVDALSAAGSVL
LYDIVGKALMEAPFMATLLRSMAEQGSPWLFATDAPGELAAVHGWSSRVT
DVAEPGHAWGRSSAPAAPLDAAGVPRGYFVEAVKPGAEPAIAGSSHTSWP
G
392417707YP_006454312.1 Protein of unknown function (DUF3117) [Mycobacterium chubuense NBB4MAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPEEAAALGDEL
KGVTS
392417706YP_006454311.1 glycogen synthase [Mycobacterium chubuense NBB4]MTREYPPEVYGGAGVHVTELVAQLRHLCEVDVHCMGAPRSGATVAQPDPA
LAGANPALATLSADLNMVNTASQATVVHSHTWYAGMAGHLAALLYGVPHV
LTAHSLEPMRPWKAEQLGGGYRISSWVEKTAVEAADAVIAVSSGMREDVL
STYPTLDPNRVHVVRNGIDTAVWYPAAAEGSGSVLAELGVDPARPIVAFV
GRITRQKGVAHLVAAAHHFAPEVQLVLCAGAPDTPEIAEEVASAVQELSR
ARTGVFWVREMLPTHKIREILSAATVFVCPSVYEPLGIVNLEAMACGTAV
VASDVGGIPEVVADEQTGLLVHYNASDSGAFERELAAAVNALVGEPERAS
RYGSAGRQRCIDEFSWAQIAEQTLEIYRKVAS
392417705YP_006454310.1 glucose-1-phosphate adenylyltransferase [Mycobacterium chubuense NBMREAPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVN
ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSMNLIYDEDPDYIVIFGADHVYRMDPEQMVQQHIESGAGATV
AGIRVPRAEATAFGCIDSDDSGRIRSFIEKPADPPGTPDDPEQTFVSMGN
YIFTTKVLIDAIRADAEDDDSDHDMGGDIIPRLVTDGMAAVYDFNNNEVP
GATERDHGYWRDVGTLDAFYDAHMDLVSVHPIFNLYNKRWPIRGSSENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVIMP
GARIGRGAVVRHAILDKNVVVGPGEMVGVDLDKDRERFSISAGGVVAVGK
GVWV
392417704YP_006454309.1 hypothetical protein Mycch_3905 [Mycobacterium chubuense NBB4]MQTFLPCPGFADSAGVLDTKRLGKQRVETIQVLRALTVAGYGWRHHPAAA
MWAGYEEALVRYGLEVCRLWCSQGRADTCAATLVTDLTEGTGLTVIRTQD
DLAAAGELPPWLGDPALHQSHQSALVRKDPGHYRPLFPDVADDLPYVWPA
SDRARRVPAG
392417703YP_006454308.1 hypothetical protein Mycch_3904 [Mycobacterium chubuense NBB4]MELLTGFGLATAAGLNAYIPLLALGLLARFTDLVALPAGWSWLENGWVMA
IVAVLLVVEIGADKVPALDTVNDTVQTFIRPTAGGIVFGSGTAAQTAAVT
DPGAFAQSGQWIPVVLGIIVALVVSLTKSTVRPAANVATAGMAAPVLSTV
EDVVSVVLVVLAILVPVLVLAALIALGWAAVRLIRRRRRRPVAGSGTR
392417702YP_006454307.1 putative protein-S-isoprenylcysteine methyltransferase [MycobacteriMKLTLQAVSSFVLGLAFFGLVLFLPAGTFDYWQAWVFVAVFSVSTFVPST
YLAIRHPDALSRRMKAGPTAETRPAQRIIITAIFLLGIAVMVVSALDWRF
GWSTVPVWLVIAGEVLVAAGLVGAQLVVIQNNYAGASITVEEGQPLVSTG
LYGIVRHPMYTGSLIMMLGTPLALGSLWGLPVVLAAVPVLAARILDEEKA
LTTELAGYPEYTQRVRYRLIPGVW
392417701YP_006454306.1 putative exporter of polyketide antibiotics [Mycobacterium chubuensMTAVIERPHQPAHQARRNGTGMTGTLGLLRLYARRDRIVLPLWVLLLSVP
LSTVYVGSIETVYPSAADRATLAASIMASPAQRALYGQVFNDSVGAVGIW
KAGMFHVLIAVAVILTVIRHTRADEETGRSELLDSTAVGRYAGLTAAVLL
AGGASVLTGLVGAAGLLTQDIPAAGSLAFGAALACSGLVFTAVAAVSAQL
SSSARFARSVAFGALGVAFTLRAVGDAGAGAQALTWLSPLGWSLQVRPYA
GDRFWVLGLHLALTALLLVLAYTLLSRRDVGAGLLAERRGPARGGRRLRG
VLALAWRLDRGSLIVWTVGLALYGAIIGSIVHGIGDEIGGSQIARDVVTR
LGGTDAMEQAFIAVAFSMLGMVTAAFAISLALRLYQEESSGHAETVLASA
VSRTRWLTGHLVFALGGPAVALLIAGLVTGLAYGAAAGDIPGVLPRVLGT
AAVQLPAVWLLAAVTVALFGVLPRFTPVGWGVLVAFIAVFMLGSLSGAPQ
WLLDLEPFTHVPHVGIGDFTPVPLLWLLTLDAALIALGAIGFRRRDLR
392417700YP_006454305.1 ABC-type multidrug transport system- ATPase component [MycobacteriuMSDPAIEIHELTKNFGAVRALDGLDLNVAEGEVHGFLGPNGAGKSTTIRI
LLGLARAGAGTARLLGGDPWTDAVTLHRQLAYVPGDVTLWPTLTGGETID
LLARMRGGIDQKRRADLIERFELDPTKRARTYSKGNRQKVSLVSAFSSDA
RLLLLDEPSSGLDPLMENVFQQCVGEARDRGVTVLLSSHILAETEALCDR
VTIIRAGRTVESGTLDSMRHLSRTSIKAEMLYDGLDLSCIPGVEDVSIEG
RTVRAQVDSDSLAEVIRALGEAGVRSLVSQPPTLEELFLRHYHTDTPEQV
TA
392417699YP_006454304.1 transcriptional regulator [Mycobacterium chubuense NBB4]MRSADDLTTRARIRDAAIDLFGRDGFGVGVRAIAAAAGVSPALVIHHFGS
KDGLHKACDDYVAETVRESKSQSLQTSDPATWLGQLAEIEEYAPLVAYLV
RSLQSGGELAKSLWRTMIDNGEQYIEEGVRAGTIKPSADPKARARFLALT
GGGALLLYLQMHDDPTNLRAVLRDYSEDMVLPALEVYTLGLLADSTMYDA
FLARREKGIPFTANPEDHDE
392417698YP_006454303.1 putative O-methyltransferase [Mycobacterium chubuense NBB4]MSTTRRDPAFFPEVVPETRMSLDAPSVMRLPSPVLVCQAYEQTEHFLRKS
ATPFSTSENSPPAPGFCVAADGRVGAPALRFSLYAAGMSSTDEPGGGSGD
SGARPSQAEAIVRHAEHSISEDAIVAAARERAVDIGAGAVTPAVGALLCV
LAKLTGAKAVVEVGTGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQA
FTEAGVGPGRTRLISGRAQEVLTRLADESYDLVFIDADPADQPQFVVEGV
RLLRPGGAIVVHRAALGGRAGDASAKDAEVGAVREAARLIAEDERLTPVL
VPLGDGLLVAARD
392417697YP_006454302.1 RNA polymerase- sigma 29 subunit- SigE [Mycobacterium chubuense NBBMAHLEQFTDGEWVEPTDELTGTAVFDATGDMAAMPSWDELVRQHADRVYR
LAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDM
VRRRGRIRMEALPEDYERVPADEPNPEQIYHDSRLGPDLQAALDSLPPEF
RAAVVLCDIEGLSYEEIGATLDVKLGTVRSRIHRGRQALREYLARHSDAG
SLDAARTA
392417696YP_006454301.1 hypothetical protein Mycch_3897 [Mycobacterium chubuense NBB4]MFDPGHAFRRAFSWLPAQLASQSDAPVGPRQFGSTEHLSIEAIAAFVDGE
LRMTAHLRAAHHLSLCSECAMEVDAQRQAREALRDSCPVAMPSSLLGLLS
QIPNRPPAETPEPIDTPQLADGVQRARRKRR
392417695YP_006454300.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMSNLDQTGRERLEPRPVSRPPVDPAAKRAFGRPAGVDGSFLGADKYRDQG
EFTPKDRPPDPVLAEAFGRPYPGGDSLQRHPTDAGALDAERGDDGPDPAD
DPWRNPGAPAGLGTPALAPSAPATSSGPVGKLGVRDVLFGGRVSYVALAV
LAIIALVIGVAGGWVGRKTAEVVEAFTTSKVTLETGNSGEPPEGGFAKVA
AAVADSVVTIEATSDTEGSQGSGIVVDGRGYIVTNNHVISEAATNPSQFK
MSVVFNDGKDVPANLVGRDPKTDLAVLKVDNVDNLTVARMGDSEKLYVGE
YVIAAGAPLGLRSTVTHGIISALHRPVPLSGDGSDTDTVIDGVQTDASIN
HGNSGGPLINMNSEVIGINTAGKSLSDSASGLGFAIPVNEVKQVVETLIQ
NGKIAHPTLGLTARSVSNDVAKGAQIANVTAGGPAERAGILENDVVVKVG
DRSVADADEFVVAVRQLKIGQPAPIEVVRDGRHVTLTVTPGPDNST
392417694YP_006454299.1 twin arginine-targeting protein translocase TatB [Mycobacterium chuMFANVGWGEMLVLVIAGLVILGPERLPGAIRWTAGAVRQARDYISGATSQ
LRQDLGPEFDDLREPLSELQKLRGMSPRAALTKHLLDGDDSIFTGRFDDP
QKPEKPQSGPGPADVTPSTPPAVTPVDPSAPTKFDPDAT
392417693YP_006454298.1 ATPase involved in chromosome partitioning [Mycobacterium chubuenseMSSTPADLHSAVRAALTKVIDPELRRPITDVGMVKNVTVDPDGSVHVEIY
LTTAACPKKNEISELVTRAVSDVPGTGSVKVTLDVMNDEQRAELRKLLRG
DSREPVIPFAQPGSLTRVYAVASGKGGVGKSSVTVNLAAAMAARGLSVGV
LDADIYGHSVPRMMGTTDRPTQVDAMILPPVAHDVRVISIAMFTQGNTPV
VWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVSQLIPGAEI
LVVTTPQLAAAEVAERAGAIALQTRQRIAGVVENMVDGPVLKMFGEGGGR
KVAESLSRAVGADVPLLGQVPLDPELVAAGDSGVPLVLSAPDSPAGKELR
KVADALTSRKRGLAGMSLGLDPAGR
392417692YP_006454297.1 hypothetical protein Mycch_3893 [Mycobacterium chubuense NBB4]MPAFGVAAVLTPLVLAGAVGASSPSDGMPKRDSAIVPLAAVAPSPGSGGA
SVVTVTKTPTPMRIAAATVSAPPPAIVVNSPGTLRIPSMALAAYRNAEAK
MASATPGCGVSWNLLAGIGRIESMHAFGGATDARGTAVRPIYGPALDGTL
PGNEVIVQSRATDRVVYARALGPMQFLPGTWSRYASDGDGDGKADVQNIF
DASLAAARYLCSGGLNLRSQTDVVAAILRYNNSMAYAQNVMAWAAAYATG
VVPVDLPPITGSVPALGDSHLDKPEGLGPGLPLNAAGLPTNDPLALLQFT
QRTDAASLINTNVPGFAPGQSLGPLPGPAPAPAAAPQQAAPPPPAWVPPW
APPAPQQPECAVFCIKDTAPAAPPVAVPGPGAPVAQPGPAAQPVPPAPPA
PAALPPGLGPAPGPAA
392417691YP_006454296.1 putative membrane protein [Mycobacterium chubuense NBB4]MSESSARQRLDTPRVSRSLTPRLDAEAVGRVSESIARFLGTGRYLMIQTI
VVIVWVILNIGAFAWQWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVALEEDRRRAEQTKADTEYLARELAALRLAVGEVATRDYLRRELEEIR
EILADLRPQHGAGGDESSKQDGAERRSRKSG
392417690YP_006454295.1 Mg/Co/Ni transporter MgtE with CBS domain [Mycobacterium chubuense MASVNRVYAARLAGMVVLGPDGESIGRVRDIVIGITIVRQQPRVLGLVIE
LLSRRRIFVPILRVTAIEPGAVTLSTGNVSLRRFSQRPGEVLVLGQVVET
RVRVDDPDLSQLAGIDVVVVDLGIEQTRSRDWMVTKVAVRPQRRLGRRSN
VYTVDWQHVQGLTPSGLAMPDQGVAQLLEQFEGQRPIEVADAIRELPAKR
RYEVFNALDDERLADVLQELPEDEQVTVLRQLKTDRAADVLEAMDPDDAA
DLLGTMTPADAEQFLRRMDPEDSEDVRRLLSHSPNTAGGLMTSEPVVLAP
DTTVAEALARVRDPDLTPALASLVFVVRPPTATPTGRYLGCVHLQRLLRE
PPAALVSGIVDTDLPSLRPEDSLGALTRYFAAYNLVCGPVVDEESHLLGA
VSVDDVLDHLLPDDWREREAEPEIVTAERTT
392417689YP_006454294.1 citrate lyase beta subunit [Mycobacterium chubuense NBB4]MENRYRPRRTCLSVPGSSAKMIAKAKSLPADEVFLDLEDAVAADAKADAR
EQVAVALAEPGWAGQLRGVRVNDWTTPWTHADVIEVVARAGASLDIVVLP
KVADVSHVHALHLLLSQLEATHGLPVGRIGIEAQIEDARGLTNVDAIAAA
PRVQALVLGPADLMASLNMRTLEVGEQPEGYDVGDAYHHVLMRILVAARA
NGINAIDGPYLKVRDVEAFRRVAARSAALGYDGKWVLHPDQIAAGNEIFS
PRQEAYEHAELILEAYEWHTSRAGGARGAVMLGDEMIDEASRKMALVIAG
KGRAAGMQRTGERFQPPA
392417688YP_006454293.1 hypothetical protein Mycch_3889 [Mycobacterium chubuense NBB4]MTSPDKDEGRIESSDSTEHGSEPSSTGYEAAPIEQSQQPAHSPEPQDYTP
PPAYNPPPNYTPPPSGGYEAYPPPPSGYPPPYSDPNFGAPSYPPPPPYGT
APGGYPPPPMGYPGGDYGYGTGYGAPPSPGTNTLAIASLVASIVGVCCGI
GSIIGIVLGIVALNQIKTSRQEGQGLAIAGIAVGAVTLVMSIAWSLYVLN
S
392417687YP_006454292.1 hypothetical protein Mycch_3888 [Mycobacterium chubuense NBB4]MTSPFQPGQNPASGVPASGRGRPVGLPTPPKGWPIGSYPTYAEAQRAVDY
LSDQQFPVEQVTIVGVDLMQVERVTGRLTWPKVLGGGVLTGAWLGLFIGL
ILGFFSPNPWSALITGLVAGVFFGLITSAVPYAMARGTRDFSSTLQLVAG
RYDVLCDPQSAEKGRNLLGRLAI
392417686YP_006454291.1 carbohydrate ABC transporter ATP-binding protein- CUT1 family [MycoMAEIVLDRVTKSYPDGTAAVRGLSLTIADGEFVILVGPSGCGKSTTLNMI
AGLEEITSGTLLIDGERVNERSAKDRDIAMVFQSYALYPHMTVRQNIAFP
LTLAKMAKHEIAQKVEQTAKTLDLTDLLDRKPSQLSGGQRQRVAMGRAIV
RNPRAFLMDEPLSNLDAKLRVQMRSEIARLQKRLGTTAVYVTHDQTEAMT
LGDRVVVMLAGEVQQVGTPDELYRGPVNLFVAGFIGSPAMNFFPAALTEI
GVRLPFGEIPLTGAVHERLRGHPSRDDLIVGVRPEHLQDAAVIDAYARIG
ALRFEVSVELVESLGADKYVHFSVEGAVVRSAQLAVAAAESGVGDNEFVA
RVPAHSGAVAGRALELALEPGKVLIFDPRTGVNLSREADGE
392417685YP_006454290.1 Suppressor of fused protein (SUFU) [Mycobacterium chubuense NBB4]MTDILDLVRTRLREHFAVEPDEASVTFLGTERMNILRFAVVDDVAAHYVS
LGCSRHPMVDPAEFVTDPVVGPRAEVMVTLRGPSPTGLARSLAVVAAAPA
VEGLILEPDALVDLETPLWQGAPFTAFLLGRSDIGDVALPEPMSPVTVLS
AVPITATEAAWVRLKGAAAMREAWGQDGVDPTDPRRRAANPA
392417684YP_006454289.1 magnesium Mg(2+) and cobalt Co(2+) transport protein CorA [MycobactMPSFRALPPSLLRQGARPRGPGEPDAKRIHVPVSQAMVDCGVYCDGTRLP
GRYSHAAALAKVHDIEAEGGRAFVWIGLHEPDEHQMQAVADVFNLHELAV
EDAVHAHQRPKLERYDNTLFLVLKTVKYVEHETVGHAMEIVETGEIMIFV
GADFVVTVRHGDFSGLAGVRKRMDDSPGRVELGPYAVMHAIADHVVDGYL
EVADLVEHDIDAMEEDIFSPRAQTDIEAIYLLKREIVELRRAVGPLTFAL
QRLGSEHNDLVSKEVRRYMRDVLDHNTQAADRILSYDELLSSLVQAALGK
VAMQQNVDMRKISAWVAIAAVPTALAGIYGMNFDNMPELHWVWGYPAVLL
LMAIVCFSLHRTFHRNNWL
392417683YP_006454288.1 malic enzyme [Mycobacterium chubuense NBB4]MKYPDAVAESVVVPSRDPSSAGRTPQVVVEDTEIFEAHEGGKLSIGLNSP
LDTQRALSIAYTPGVAKVSRAIATDRTLAAKYTWAHRLVAVVSDGSAVLG
LGDIGASASLPVMEGKSALFKTFGGLDSIPIVLDTKDPDEIVETLIRLRP
TFGAVNLEDISAPRCFEIERRVIEALDCPVMHDDQHGTAIVVLGALLGAC
KVLDRDMHTLRVVISGAGAAGVACANILLAKGISDITVLDSKGIVHTGRS
DLNSFKAELAERTNPSGRTGGVAEAVDGADMFLGLSAGVVPEEIIATMAP
GGIVFALSNPDPEIHPDAARKYAAVVATGRSDFPNQINNVLAFPGVFRGA
LDAGARRITEKMKVAAAEAIFSVVGDDLAADHIVPSALDPRVGPAVAAAV
AAASEDSVG
392417682YP_006454287.1 periplasmic glycine betaine/choline-binding (lipo)protein of an ABCMLAAGCGAHPTPSSIPVGATGDPESQLIAHLYVAALGFYGSAAHVEVSQD
PLDRLDSGDVTVVPGFTGRLLARFDPGAAARADVQVYRTLLAALPEGVAA
GDYTTSAEDKPTVAVTQRTADAWGGRDVTALVRHCPDVTAGAVKGTRWPS
SIGTCTPRTAREFASDDAMFAALRSGEINAAWTTSAAPDVPSEAVVLSDK
TSLVRAENVVPLYRRNVLSESQVLALNEIAGVLDTGSLADMRRQLAEGTE
PGLVAGKWLDAHPLGVSN
392417681YP_006454286.1 short-chain alcohol dehydrogenase [Mycobacterium chubuense NBB4]MQGFAGKVAVVTGAGSGIGQALAIELGRAGAQVAISDVDTEGLAVTEERL
KAIGAPVKADRLNVVEREAFLLYADSVVEHFGKVNQIYNNAGIAFTGDIE
ITQFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVVNVSSVFGLFSVP
GQAAYNSAKFAVRGFTEALRQEMALAGHPVKVSCVHPGGIKTAIARNGTA
AEGLDAEELAKTFDKKLASTSPEKAAQVILDGVRKNKARILIGNDAKMFE
VVIRLVGAGYQNFFPKAVARLTPKQSH
392417680YP_006454285.1 Protein of unknown function (DUF732) [Mycobacterium chubuense NBB4]MNVKLPAVVMLAASAVFAGTLSAAPAQADTGVDVFLNALQHYRLGDIDPA
TAVRVGQDVCPMLAEPGQNAANVAAKVADELGRPLGPATMFTGLAIQILC
PRAVGALTDGVPFSFFG
392417679YP_006454284.1 2-oxoglutarate dehydrogenase E1 component [Mycobacterium chubuense MYRKFREDPSSVDPSWHEFLVDYSPEPTNDAPSGANGTSATTRSSGPITP
PEPAPAPPPKRTSNGATTPKAPEKPSQKDAEKPAAKTAKSDKPAAKSSAP
QKSEAAPAQEKPKPAAAAKGGSAGSDESQVLRGAAAAVVKNMSASLEVPT
ATSVRAIPAKAMIDNRIVINNHLKRTRGGKISFTHLLGYAIVQAVKKFPN
MNRHFAEIDGKPNAVTPAHTNLGLAIDLQGKDGKRSLVVASIKNCETMRF
GQFIAAYEDIVRRARDGKLTAEDFAGVTISLTNPGTIGTVHSVPRLMQGQ
GAIIGAGAMEYPAEFQGASEERINEVGVGKLMTLTSTYDHRIIQGAESGD
FLRTIHQLLLDDEFYDEIFRELGIPYEPVRWRIDNPDSIEDKNARVIELI
AAYRNRGHLMADIDPLRLDNTRFRSHPDLDVNTHGLTLWDLDREFKVNGF
AGQTHKKLRDILGLLRDAYCRHVGVEYTHILEPEQQQWLQDRIEVKHEKP
TVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAAIDQ
AAEHGLDEVVVGMPHRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSG
DVKYHLGAGGTYIQMFGDNDISVSLVANPSHLEAVDPVLEGLVRAKQDIL
DKGNGPDGFTVVPMMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIIV
NNQIGFTTSPGDSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVAKLAMD
FRQKFKKDVVIDMLCYRRRGHNEGDDPSMTQPNMYDVIDTKRGVRKTYTE
ALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHAVEPSHSVESDQM
VPAGMNTAVEKSLLQRIGDAHLAYGEDFNVHPRVKPVLEKRREMAYEGKV
DWAFAELLALGSFLAEGRTIRMTGQDTRRGTFTQRHSVVIDRKTGKEFTP
LDLLTVDSDGNPTGGKFMVYDSALSEFAAVGFEYGYSVGNPDALVLWEAQ
FGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRME
RFLLLWAEGSMTIAQPSTPANYFHLLRRHGLDGIHRPLIVFTPKSMLRNK
AAVSDLKDFTEAKFRSVLEEPTYEEGTGDRSKVTRVLLTSGKLYYELANR
KNKEKREDVAIVRLEQLAPLPRRRLAETLDRYPNAEERFWVQEEPANQGA
WPTLGLTLPELLPDHFTGIKRISRRAMSAPSSGSSKVHAVEQQEIIDEAF
A
392417678YP_006454283.1 hypothetical protein Mycch_3879 [Mycobacterium chubuense NBB4]MSARSRAKSQSLAVKEEDPGAAAKVLSQIIERGTKVQAPAVTAYVQRLRD
SHPGATPAEIVRLLDKRYMAAVMASGAAVGSAAAFPGIGTLMAMSAVAGE
TVVFLEATAVYVLAVAEVYGVPAGHREQRRALVLAVLVGDDGKRAMADLI
GSRRTSGGWLADGAASLPLPALSQLNSRLLRYFVKRYTLKRGAMAFGKML
PVGVGAVVGGVGNRFMGKKIVENAHTAFGDPPARWPSPLHVVPPAGS
392417677YP_006454282.1 drug resistance transporter- Bcr/CflA subfamily [Mycobacterium chubMLTRVMAVSPDVDRRPVAEAAPPGVSRTKMIVVLGLLVALGPLTIDMYLP
ALPRIADELSVSSSIAQLTLTGTLAGLAVGQLIIGPLSDSLGRRRPLIAG
IVLHMLASLVCLFAPNIEVLGVARGLQGVGAAAGMVVAVAVVGDLFAGSA
AATVMSRLMLVLGVAPVLAPSLGAAVLLHGSWHWVFAALVVVAGALLVMT
VLALPETLPAGHRRPLKAGGIARTYGELLRDLRFVILVVIGALGMSGLFA
YIAGASFVLQGRYGLGQTAFALVFGAGAVALIGATQFNVVLLRRFEPQQI
MVWALAAASVFGGVFVALSAAHVGGVAGFVGPVWAILAAMGLVIPNAPAV
ALTRHPDAAGTAAALLGAVQFGTGAVIAPVVGVLGNDELAMSAVMATGVI
VALLALLLTGAHRATGDDVVGAPAVAEPA
392417676YP_006454281.1 drug resistance transporter- EmrB/QacA subfamily [Mycobacterium chuMTPRSRAANPWPALWALLVGFFMILVDATIVAVANPAVMTHLHVGYDAVI
WVTSAYLLAYAVPLLVAGRLGDRFGPKNLYLLGLAVFTAASLWCGLSGTI
GTLVAARVVQGIGAALLTPQTLSVITRTFPAHRRGVAMSVWGATAGVATL
VGPLAGGVLVDHLGWQWIFFVNVPVGVIGLALAVWLVPDLPTQSHRFDIP
GVILSGIGMFLIVFALQEAQSHDWAPWIWASIAVGIAVMAAFVYWQSVNR
GEPLIPLLIFRDRDFSMSNLGVATIGFVVTGMILPLMFYAQAVCGLSPTR
AALLTAPMAVATGVLAPVVGKIVDRSHPRPVIGFGFSVMAIGLTWLSIEM
TPTTPIWRLVLPLTAMGAAMAFIWSPLAATATRNLPPVLAGAGSGVYNTT
RQVGSVLGSAGMAAFMASRLSAEMPGPAGSAPQSEGSVSQLPGFLHAPFA
SAMSQSMLLPAFIALFGVLAALFLLGSPSIRSDIRSGGVSPALDSDDPRA
IDDDEYEYADDDEYVEYEVQWEDPVPQRFAGDSGEEPVDTDVLERAAEPL
PASGPAPNGAPPAPHTDAPTTRHEWRNILDRLLEDPHPDPLHRGHHRVSD
GFPAGLRVDDDPPSYGRHSRHDD
392417675YP_006454280.1 hypothetical protein Mycch_3876 [Mycobacterium chubuense NBB4]MTSIEADYLVVGAGAMGMAFVDTLLAETDATVVLVDEGHQPGGHWNWVYP
FVRLHQPSAYYGVNSVPLGDEDRIDESGWNEGFFELATGHEVCSYYDRVM
RHQLLPTGRLSYFPMARHLGDNRFRSLDGTEHTVSVRRRVVDATYLLTKV
QSMRAAAPFTVAGDVEVVPPNELPRRAAGRQHFTIVGGGKTGMDSCLWLL
RNGVPAEALRWVMPRDSWLLNRANIQPGAHFAISLRASIASRLKAVTDAT
SLDDLFDRLEAAAEVLRLDPSVRPTMYHCAIVSLGELEQLRTIGDVVRLG
RIERVHADRVDLQQGTVAVPAPSLYVDCTTPGLPRPPSVPVFDGDRITLQ
SVRGCQQVFSSAFIAHVEATYGDDDTRNELCAPIPHPDAPIDWLRILLSD
NKAHMRWLQDPALMQWLASARLNVLRDVFPRFPDKPRVQEKAIGALTVAL
RAANERLTELMGSPAPV
392417674YP_006454279.1 FAD/FMN-dependent dehydrogenase [Mycobacterium chubuense NBB4]MTEPLTERLAAIVGAGHVSTDSDVLTGRSVDYTGRYRGHAAALVRPATAD
EVAEVLRVCRDAGVRVTVQGGRTSLVAGTVPEHDDVLLSTERLREIGEVD
VTERRIHVGAGVTLADVQRAATAAGLVFGVDLAARDSATVGGMASTNAGG
LRTVCYGNMSEQVLGLDVVLPDGAVMHRHSRVRSDNTGYDLASLFVGAEG
TLGVITGLDLRLHPVPRHRVTAVCGFADLDALIATGRVFRDTDGIAALEL
VDARASVLTAEHAGVNAPVEGAWQLLVELAGETDPTERLAEILADAELTG
EPAVGVDTGAQQRLWQGREAIADVLGVYGPPLKFDVSLPLSTIKDFAADA
EALIADHAAEAIPVLFGHVGEGNLHLNIVRCALVGEAEHALYSAMMALIA
RHGGNVSSEHGVGTRKREYVSMSRTDADIAAMKAVKAAFDPDGYLNPAVL
FD
392417673YP_006454278.1 RecB family nuclease- putative- TM0106 family [Mycobacterium chubueMFVADDRVVYSASDLAAAARCEYALLRSFDAKLGWGPAVSGDDELLARTA
DLGDAHEARHLDELRRGADVAIIGRPDYTVAGLTAAADQTLRAIERRAPV
VYQAAMFDGRFAGFADFLILEDGPDGPRYRLRDTKLARSVKVEALLQMAA
YAETLAAAGVPIAPEVDLVLGDGASVSYPVDELTPVYRPRRDALQRLLDG
HVAGGRPVAWKDEHVRACFRCTECEAQVRASDDLLLVAGMRVSQRARLID
AGITTVHALAGHRGPVPELPVRTVAALTEQARLQISDRVDGKPPYQVVDA
QPLMVLPDADRGDLFFDFEGDPLWTADGHEWGLEYLWGVLTVGDDFTPLW
AHDRASERRALVEFLTMVRKRRKRYPNMHVYHYAAYEKSTLLRLAGRYGE
GEREVDELLRDGVLVDLYPLVRKSIRVGTENYSIKSLEPLYMGNELREGE
VTTATASITEYARYCELRHGGHIDDAATVLKEIEEYNRYDCRSTRRLRDW
LTARAIESAVPPRGPQPVTGGTQEPAQDPADAVERRLMKFAGDGVEPRSA
QQTAVAMYAAAKGFHKREDKPFWWGHFDRVNNPVDEWADSSGVFIAHDHE
IVEDWHQPPRARKPQRHVRLFGEIATGELSENMYALYDPPSPRGLSDDPD
RRGFARVTVLGCDNPEAPTEVVVCERQPKGGDVYSQVPFALTPDAPISTK
PLQDSIAATAAAIADALPRLRAGAMTDLLLRRPPRTRSGAPLPRSGAVES
ISGDITAALLDLDSSYLAVHGPPGTGKTSTSAVVIAALVDTHGWRVGVVA
QSHAVVENLFAEILRAGVDGARVGKKVNSVAEGWTALTNPEFADFVARHD
GCVVGGTAWDFANDTKIPAESLDLLVVEEAGQFSLANTIAVSRAARNLLL
LGDPQQLPQVSQGTHPEPVDGSALGWLVDGHHTLPPERGYFLDRSHRMHP
DVCRAVSRLSYDGRLHSNDAVTATRRLDGVVPGVRTLAIDHDGNATESPE
EAAAIVGEIRRLLGTPWTDEKGTRPLAERDVLVVTPYNAQVVLVRRHLDT
AGLTKVRAGTVDKFQGQQAPVVFVSMTASSIDDVPRGIAFLLNRNRLNVA
VSRAKYLAVIVRSAQLTEYLPGTPDRLVELGAFLSLSACDTPAR
392417672YP_006454277.1 hypothetical protein Mycch_3873 [Mycobacterium chubuense NBB4]MRTAGILCTLAGVAVLAAAGCSSGDSTASKTPGPTADSPSASPAGPPPAP
AAPPPPGPTAAQDPCATDLAAPEIARAVSTLPRDPRSDQGWNPEPLAGNY
NPCAQLSAVIVKANTNSQNPNTRALMFHQGKFIPTGVPDTYGFNGLDTSA
STGDTVALQYSSGVAGLDSIVKFRWNGSGVELIGNTTR
392417671YP_006454276.1 DNA/RNA helicase- superfamily II [Mycobacterium chubuense NBB4]MTSSDPAPEHGDLSFADLQIHPSVLQAVRDVGYESPSPIQAATIPAMLAG
SDVVGLAQTGTGKTAAFAIPILSKIDTSSRTTQALVLAPTRELALQVAEA
FSRYGAHLQVNVLPVYGGSSYGPQLAGLKRGAQVVVGTPGRVIDHLEKGT
LDVSHLDYMVLDEADEMLQMGFAEDVERILADTPEYKQVALFSATMPPGI
RKITAKYLHDPVEVTVKSKSQTAENITQRYIQVSHQRKMDALTRLLEVEQ
GDAMIVFVRTKQATEEVAEKLKARGFAAAAINGDIPQAVRERTINQLKDG
SIDILVATDVAARGLDVERISHVVNYDIPHDPESYVHRIGRTGRAGRSGT
ALLFVTPRERHLLNSIERVTRQKLVESELPSVEDVNERRVQKFRDSITEA
LAAPGIDLFRKLIEGYERDHDVPMADIAAALALQSRDGEEFLMTEPPPEK
RRERRERTDDREDRGPRKPRERRSDLATYRIAVGKRHKVAPGAIVGAIAN
EGGLHRSDFGHISIKMDHSLVELPAKLSPKTLKALENTRIQGQLIHLEPD
RGPKPHRGKTKSK
392417670YP_006454275.1 putative acyltransferase [Mycobacterium chubuense NBB4]MSVSDTSDSADTVGGLESVTRGRVASLTGIRAVAALLVVLTHSAYTTGKY
GQGYLGLVYSRMEIGVPIFFVLSGYLLFSPWVSGTASQRPAPSVRRYAWH
RVRRIMPAYAITVVAAYLVYHFRTAGPNPGHTWEGLLRNLTLTQIYTDHY
LYSYLHQGLTQMWSLAVEVAFYVALPFLAYLLLVVLCRRRWRPWLLLAGL
AALSLVTPAWLTLVHTTDWLPDGARLWLPGYLAWFLGGMVLAVLRPLGIR
AYGLACLPPAIVSYLIVSTPLGGEPTTSPAGLGEALAKAGFYTVIATLAV
APLALGDSGFYSRLLASRPMVFLGEISYEIFLIHLITMELVMVEILRYPI
YTGSAWLLFAGTLVVTIPPAWLLHRLTRVRS
392417669YP_006454274.1 transcriptional regulator [Mycobacterium chubuense NBB4]MAGDWLAARRTEVAADRILDAAGDLFTKKEAATVGMHEIASAAGCSRATL
YRYFENRDALYTAYVHRESYRLYREMTEQITSIVDPRERLIEGMLSSLRN
VRHSPALASWFATTQRPIGGEMAEQSEVIKALTEAFVFSLGPDDSHSVEH
RARWLVRVMTSLLVFPGHDEADERSMLEEFVVPIVLPAQATQ
392417668YP_006454273.1 cytochrome P450 [Mycobacterium chubuense NBB4]MSHGSPVRFELADAATWPNPWPMYRALRDHDPVHHVVPDDRPDQDYYVLS
RHADIWTAARDHETFSSAQGLTVNYGELELIGLADNPPMVMQDPPVHTEF
RKLVSRGFTPRQVEAVEPKVRDFVVERLERLRANGGGDIVAELFKPLPSM
VVAHYLGVPEADRGRFDGWTEAIVAANTTDGGVAGALGSLGDALGEMMAY
FTALIERRRAEPLDDTVSHLVAAGVGADGDISGVLAILAFTFTMVTGGND
TTTGMLGGSVQLLHQRPDQRRLLTDDPELIGDAVDEFLRLTSPVQGLART
TTRDVTIGDTTIPEGRRVLLLYGSANRDEREYGDAAAELDVTRRPRNILT
FSHGAHFCLGSAAARMQSRVALSELLARIPQFEVDEDGIVWAGGSYVRRP
LSVPFTVTN
392417667YP_006454272.1 hypothetical protein Mycch_3868 [Mycobacterium chubuense NBB4]MVNGGQVAAYGFRYQYLAAAEHILRYLLDHPADLGAVSLTIEPARLDARR
HGGADPDEVIDYSVNHQGVAVQRTQVKATRQPSPSSPLLPRVATTIFARM
GPGAPGEGQPQILTNRPLSKKLRKQCGAPVSTTAAQSTYGLTTDSGLQGA
IVEDHRSVADVKHSLLGLIGTVRADKALGLGNRSADLLMSALVDHIFDAA
AGMSANTISAHDLLELLGTPDIELAHVLRGYDWGAPLAEVPRLVSVVPRI
DTLMELTAMFNDSTATRTPAVAILRGTTGFGKSTIAADFCHLNRHLYEHI
TWVDSREPALMKARIKDILATMGVTVEPDSDVAALFRTEMGRMAGPFVLV
FDNAASRDQIEPFVPTSGCGLTIVTTPSSATWWVSERRITVEGFTTEEAI
HCFARYASVDAQVHREPIEEIVERLHRVPLAVAMAGLYFHDSDEDVANLS
ATYFDNLAALNVEANIPEGFDHTAFAAVQLAVSRLSEGNAGTDEHRRRSQ
QLIARAAVLAPELIPFNLILQALSGVDYSEPTNPPRPEVAERHSRNIIMQ
TLMTQTIARRRHYVDRTGEQNPASDTLNFHPLVHEILRNLQLQVSFPELI
GPLTDLMACLYGWLEQMRHEGDFFPVDQLLMHSDHLLDFIDALDVTGPPS
AVLDDFRRELTLLKCEAASAFSSRREYDSAVGLVRGALEDIMGVELSPRT
RAIVAKASADAMTDIYQGGLDKDNVLLFAERLVDELQILERSDDPHAGEM
SYLSADLGRRAMQSLGYAPTDPLVEELVRIAGRQNRSPSITGAVQQILAE
IGSRQYRRALERIASASRQPGAQTSESEALLHQLAASALLHLQQFGEAAE
IIETLLANDPYPHLADLYKELYAMLDTGLVFESPRWQSSPARNRLLQAQT
EIRFRIAR
392417666YP_006454271.1 Abi-like protein [Mycobacterium chubuense NBB4]MPERILPLLGTARVGAYEAYRPHYSQAQLGELYAWHSSLASAVHEVLGYC
EVVFRNALDKGLAEWNGSHPTSPGGPHWLLDPAPQLKAIIDPPPPPPPKP
GEEPRKQGRRVVFKARTNVIRSRDRTHRRFKEPITHDDLLAQLTFGELVH
LVPTNSSKRVKGFTPIEMMWLYGVRSAFPNVDKVFPLDTSLKGNTALVDQ
GRRLGDAADRLRILRNRIAHHEQILTAKHAQRHRDALLIVEAVSTDAAAA
LSSISRVLDLIKREP
392417665YP_006454270.1 transcriptional regulator/sugar kinase [Mycobacterium chubuense NBBMRFGRGVVIAGVHVEQRGNIPTSITAVLVGLDSTRELAVGSRDINADDAH
GWQGVAHAIRELVVGLKAQLDARTRDELQASVDAADADFDPVLRERREQE
LAAFTPFELFGVGVEVGAPVFDGRIASIARTGGATRVDFHGFEEELQALF
TDERNAITPVVIENDVNALAVLAIHEEHYAVPDLAVFGVFDEGVGGGLVL
DGRLRRGGSGTAMEVGHLQVVHIPGTSGAIGSNGGAHQPAQGSPRTFSDP
CECGRDGHVDTRATSSRIAGELGVSFEDALTLNTEKARVTFRSAGFALGR
AIAHVSNIVNPTRIIVYLPAGLARPPKDEPTAAAEYCPAASAEVCAAFGN
AGRERAQFLTYRPLTKEQTAPLCARAAAVCLLQGFIEHALRVDGCSFSTN
RKADTAVRHDQYAVSKNP
392417664YP_006454269.1 hypothetical protein Mycch_3865 [Mycobacterium chubuense NBB4]MDAIYAPTDRTASIGRRLASAIATVAVTTVVAASVVACSHDVVVDAGCDL
TAPLIEGIATALGAVAEIGPAAAIAGGIAGVVVSKACKELFAQDTTPQSN
DRFLKEDPLVPNQFRLPSDATVCLPGSGRFASVAAGTTVTTCQFSKNVRQ
AFLQTGIGTVSAYSPVTDVWYDMDCAGDYPVACTGGKNALVYIY
392417663YP_006454268.1 hypothetical protein Mycch_3864 [Mycobacterium chubuense NBB4]MVNRLDITTWAYNKTALNSYRADNNGGKSVRVDWTARADGHEIDGACASS
ARVQGPDTDQAKDSSNCSSSVWFDIHQPGNYTVTVTTHQDSGAEYSQNIT
LAIVP
392417662YP_006454267.1 DNA replication protein [Mycobacterium chubuense NBB4]MTETPSVTATELVAPPSVPPLPADLDAGLRRLKLAAVRRTAPEVLITAKT
QRWTPEEVLRTLVETELAARDASNVVNRLKAAAFPVPKTLESFNVAASSI
PAKTFDYLSNLEWIHTQQNLAIIGPAGTGKSHTLIGLGTAAIHAGLKVRY
FTAADLVETLYRGLADNTVGKIIESLLRTDLIILDELGFAPLDDTGTQLL
FRLVAGAYERRSLAIGSHWPFEQWGRFLPEQTTAVSILDRLLHHATVVIT
DGDSYRMKDAKHRKEQSKPT
392417661YP_006454266.1 transposase [Mycobacterium chubuense NBB4]MDIISAYQQLGSYRAAAEQCGTTHKTVRRVVAKFEADQAGVVPAPRVERG
HNYDAVTDLVAERVEKSKGRISAKRLLPIARAAGYQGSARNFRRLVADAK
ALWRSANHRGRRPAVWEPGQYLVIDWAEAAPGLFLFCAVLAFSRWRFVRF
ATDQKASTTLALIAEALAAIGGVPARVLADRMACLKGGVVANVVVPTPDY
IRLAGHYGFAPDFCHAADPQSKGIVEHLCGYAQDDLAVPLLTEAAVAGTP
VTLREANAAALSWCAEVNAAIHSEICAVPDERLGVECELLQPLPSLRLQI
GAPSVLRKVDRLSCVRYGSARYSVPTRLIGSTVAVVVDHGAIVLLEPATG
VIVAEHELLAPGGTSILDEHYDGPRPAPSRGPRPKTTVERQFCDLGADAQ
AFLVGAAAIGNTRLGAELEILLALGAAHGEAALVAALHRAVAFRRFRAAD
VRSILAAGTGTPQPRPAGDALILDLPVAPTRPLDAYKVSTMVDGEVIP
392417660YP_006454265.1 hypothetical protein Mycch_3861 [Mycobacterium chubuense NBB4]MVDGGHNLQSFLVGAGAAVPKQAPPWFASQEQYETFQKLFATDVGAQCIT
TTSIDVPHLDEDDRKQALSNRSLRSTLQLLCSTYARLDAAALFGREAAFE
KKLVAPLQGDLANKVRGALAGGSRIIPPSALNQLIREAIEWCADGDAADD
LGPISTVEFVHMVLSINGDQEAQDRPDFFTTWPPTQDELIAFNDAMTHDD
DLVLEHVRRHMLVEFARAHTNSTPVPQAILALTYDTWFKAWPDAAPHSLI
GDSPEQAFKNSTNVPLRDVVRMGLHIWGHTKAGAISLDIATLKTFADAAA
LNLLKSTAVLSVKEYRKRLKKERAQGFLAHRRYTFTERPIIQLDDENYIV
LRPAWVLDRFCGSQLYWQTFAQFGFEKTPAGEQFSLAINYVFESTVGYLF
RRAARRARPTITLITEAEMQQAWTKGGITPSVCDWVLVSGNSCALIDATN
VWLDANAAQGLSDPDEYQADLEETFINKKFEQLKSTRQLLIDNGWEGCTF
NDTTIYTPIVVVPNTGIPASVFADIDVKLRTGQLAPNMLAAGVLTYHELE
VFEGITQHRAPQMFVGLLARWRLQCTTPMPMRLQTFLDISGFDRPRSTYM
GTANSLLIKKIGPPIPQL
392417659YP_006454264.1 FAD/FMN-dependent dehydrogenase [Mycobacterium chubuense NBB4]MHAALDQLIAVLPEGTVVTDPDILASYRQDRAADPGAGTPLAVVRPRRTE
EVQAVLRWASTHRVAVVPRGMGTGLSGGATAVDGGIVLSTEKMRDISVDP
VTRTAVVQPGLLNAEVKKAVAEYDLWYPPDPSSYEICSIGGNIATNAGGL
CCVKYGVTTDYVLGLQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGSEGT
LGVVTEVTLKLLPAQHGACTVVATFDSIEAAARAVVTITGKIRPSMLEFM
DAAAINAVEDKLRMGLDRQAAAMMVAASDDRGPSGAEDAEFMAGVFAEHG
ATEVFSTSDPDEGEAFVAARRFAIPAVEAKGSLLLEDVGVPLPALAELVS
GVEKIAANHDLMISVIAHAGDGNTHPLIVFDPADAAMEQRAQQAFGEIMD
LAVSLGGTITGEHGVGRLKRPWLAGQLGPEAMELNRRIKTALDPDGILNP
GAAI
392417658YP_006454263.1 H+ Antiporter protein [Mycobacterium chubuense NBB4]MTPDRAPTSRRGPLLLILFAALMAGAGNGISIVAFPWLVLQRNGSALEAS
IVAMAGTLPLLVATLIAGAAVDFLGRRRVSMISDALSALSVAAVPVLALA
FGASAVNVAVLAGLAALGAFFDPAGMTARETMLPEAANRAGWTLDHANSV
FEAVFNLAYIVGPGIGGLLIATLGGVNTMWVTAAAFVLSIFAIGVLRLEG
AGTPDPAALSGGVWSGIIEGLRFVWRNRVLRTLAFIDLAATGLYMPMESV
LFPKYFTDRNEPAQLGWVLMALSVGGLVGALGFAVLSTYLRRRTVMLTAV
VTLGVAMTVIAFLPPLPVILVLCAVVGFVYGPIAPIYNYVMQTRAPHHLR
GRVVGVMGSLAYAAGPLGLILAGPLADATGLHVTFLALSLPMLALGVAAV
FLPALYELDREP
392417657YP_006454262.1 uracil-DNA glycosylase [Mycobacterium chubuense NBB4]MPHPRTGVLFESPVRAGSGWPGDPATARTAVATTAADVTALAAAARTLRQ
VDAGVSVCRACPRLVQWREEVATTKRKSFAGEPYWGRPAPGFGSAHPRIF
VVGLAPAANGANRTGRVFTGDRSGDFLFASLYRSGLANQQTCTDSADGLE
LNDIRVAAAVRCAPPGNAPTPAERSTCAPWLDAEWRLTAADVRVIVALGG
FAWQVALGLIRRAGGSVPTPAPKFGHGVTATLAAPDGDVVLLGCYHPSQQ
NTFTGRLTPAMMDETFATALSLANSAR
392417656YP_006454261.1 luciferase family oxidoreductase- group 1 [Mycobacterium chubuense MRLSVLDLVPVRSDQSTSDALAATTRLAQTADRLGYTRYWVAEHHNMPSV
AATSPPVLIAHLAAHTSALRLGSGGVMLPNHAPLAVAEQFALLEAAHPRR
IDLGIGRAPGSDPVTSMALRGAAGRDDRDIEAFPDYLDDVVALMSSKGVR
VPLPRDLMRDNYILKATPAAISEPTLWLLGSSMYSARLAAAKGLPYVFAH
HFSGQGTEEALRLYRDTFRPSELAPEPVTFLTVNAVVAETRDEAMRLILP
NLQMMGRLRTGQPLRALDLVEDAETQQVSPHAQAIVDAGLRQAVVGSPAE
AADQLRALAGTFGVDEVMVHPVASAYRGVDPATAPGREQTLELLAKELF
392417655YP_006454260.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MDITGWVERNVGVRLLMLHDTLYKRTNGRVGHRIPLPGVPPSLLLHTVGA
KTGKQRTNTLSYFPDGGHYYVVASKGGDPKAPGWYHNLKAHPDVEINLGP
KKLAVTATPVLADDPDYRRLWDIVNRDNSNRYNGYQKRTSRRIPLVRLTP
KG
392417654YP_006454259.1 HIT family hydrolase- diadenosine tetraphosphate hydrolase [MycobacMSCVFCAIVADEAPAIRIWEDDDYLAVLDIRPFTRGHTLVIPKRHTVDLT
DTPAETVAQMTAIGQRIAKAARTSGLHADGNNIAINDGKAAFQTVFHIHL
HVVPRRDGDKFSFAKGMLLRRDPDREETGRILREALARIDVAEKD
392417653YP_006454258.1 hypothetical protein Mycch_3853 [Mycobacterium chubuense NBB4]MTADFMPPPGYTSLTPFLCVQPAAKAIDFYTSVFGATLIEKMDGPGGTIA
HAELDFGHGRLQLGDPAEAYGIRAPDRGSDTVTCSIALYCPDVDAVVDRA
STAGATVREKPQDFATGDRFASLRDPFGVRWTVMTRVEEVSAGERDRRLG
EWAKENLN
392417652YP_006454257.1 DNA-binding domain-containing protein- AraC-type [Mycobacterium chuMVGRPLAASSYELDRWAPSRDAAAYVEHFWSVTWDLHGREPVDNTVITFP
SMHLTHEWGEDCERHGFPLPNTLVHGVVETVFRTSIRERGAVVGARFRPG
GFTARFGRDASTMTGRVLPVDDDLLGEPVHLDDDVAAAAAEMDRLIACAA
GPDPTYAALTVLIDRIRDDTGLHRVEQVMAHSPWSVRTTQRVVRRYVGVP
VKWVLCRYRLQNAAWEIENRPDVDFADLAVRLGWYDQPHFINDFRAMLGC
TPGEYATAYGHLSR
392417651YP_006454256.1 G:T/U mismatch-specific DNA glycosylase [Mycobacterium chubuense NBMTSPTLHSFPPLVATGARILILGNMPGVVSLRADRYYAHPRNAFWRITGA
LFGFDADAPYDERVAALTEAGVALWDVLKSCRRAGSLDAAVEPNSMVPND
FDAFFAAHPTIAHVCFNGTAAERNYRRLVETRAAMRYSRLPSTSPAHTAS
FESKAAAWRDALID
392417650YP_006454255.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MADDGDLEASGLLDGLEGEARAEREELIRWLLERGVTVEQIQTSSAPILL
ASRRVIGDDGQYVSARAAAEKSGVDLELFERIQRAMGLPRVEDPDAAVFL
RADAEAGMFARDFLDAGIEPDELVQITRLLGDGLARAAEAMRYAALATVI
RPGATELQIAQDTEALVSAVAPLLGPMIQDVLMLQLRHAIETEGVSATER
ADGRHLPGARLVTIAFADLVGFTRLGEAVPPEDLERLSQRLADMTRDVAV
APVRFVKTIGDEVMLVSPEPVPLLEAVLELVDETDEDEDLPRLRVGMATG
KAVSRAGDWFGSPVNLAARVTGAARPGSVLVAESAREAIGDDDRFTWSFA
GARHLKGIKSDVKLFRARRAETPE
392417649YP_006454254.1 copper/silver-translocating P-type ATPase [Mycobacterium chubuense MSTVELAIGGMTCASCAARVEKKLNKLDGVTATVNFATGKARVEFGGAVS
PEQLIAAVESAGYQAALPDPAPEADEAPDPTAALRQRLLICVALSIPVIA
MAMVPALQFTYWQWLSLTLAAPVVVWGAWPFHQAAWTNLRHGAATMDTLI
SVGTLAAFGWSVYALFWGSAGMPGMTHPFELTIARTNGSANIYLEAAAGV
TTFILAGRYFETRAKRRAGAALRALLEMGAKDVAVRRDGVEQRIPVDQLR
TGDEFVVRPGEKVAADGVVIEGCSAVDASMLTGESVPEEVQPGDAVVGAT
VNVDGVLVVRAERVGSDTQLAQMARLVEDAQNGKAQAQRLADRISGVFVP
IVIALSVATLGFWLGAGFSAGAAFTAAVAVLIIACPCALGLATPTALMVG
TGRGAQLGILIKGPEVLESTRRVDTVILDKTGTVTTGTMTLVDVFAADGE
QPDEVLRLAGALEDSSEHPIARAIAAGARDKLGELPAVSGFANLRGLGVE
GTVDGRAVLLGRAQLLADRAYEIDDGVAEAARRAENDGRTAVAVGWDGRA
RGLLMVADAVKLTSAEAISLLKELGLTPIMVTGDNEAVARTVAAQVGIDQ
VIAGVLPQEKVDTVKRLQSEGKVVAMVGDGVNDAAALAQADLGLAMGTGT
DVAIEASDLTLVRDDLRAVPDAIRLSRRTLGTIKGNLFWAFAYNVAALPL
AAAGLLNPMIAGAAMAFSSVFVVSNSLRLRAFTPSR
392417648YP_006454253.1 hypothetical protein Mycch_3848 [Mycobacterium chubuense NBB4]MTAVPKILVFAVVLAAVFALSLWAGHTFGPSPESAAPATTSQHSPPHGGG
392417647YP_006454252.1 copper chaperone [Mycobacterium chubuense NBB4]MSTTTITVAGMSCGGCANSVRAELTHIPGVVDVDVDLSNGTVTIASDAPV
DGETLRAAVEEAGYQLAS
392417646YP_006454251.1 hypothetical protein Mycch_3846 [Mycobacterium chubuense NBB4]MMSKRGVLAGAGAVGATLALLLTGCSSSSNDANSGSAGHQHEPTSQPAEG
ATAHNDADVSFATNMIPHHEQAIVMSDIILGKQGIDQRVVALANQIKAAQ
GPEITTMRQWLTDWGTPASGHEGHDMGGGMHGAMGMMTDQQLQQLRDAQG
VDAARQFLSGMIAHHEGAVTMAQTEVGSGRSAPAVSLAQNVIKTQQREID
EMKQILGSL
392417645YP_006454250.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium chubuense NBB4]MRILVQRVTSARVTVAGKTVGEIAPESQGLLALVGVTHTDDAAKARRMAE
KLWQLRILDDEKSASDVGAPILVVSQFTLYGNTTKGRRPTWNAAAPGSVA
EPLIEAFAAALGGLGAHVQTGVFGADMRVELVNDGPVTVLLEV
392417644YP_006454249.1 hypothetical protein Mycch_3844 [Mycobacterium chubuense NBB4]MTGPGPGSWQPDPEGRFEYRWFDGQRWTDQVSQGGQLMRVPLGLSPSQPA
GPPPGDGFAGITGDLVDGRFSEKEAKPIANQNSKLLRVRLGEPFMARQGS
MVAYQGNVDFAFEGGGASKFLKKAFTGEGLPLMRCTGQGDVFLAERAYDV
HLLNLTNTGLSISGKNVLAFSSSLDWNIERVRGGSVATGGLFNTTLRGTG
WVALTTDGPPVVLNAAEAPTFADTNAVVAWSANLQTQLKTSFKAGALIGR
GSGEALQVSFYGDGFVIVQPSEGVQVAATQ
392417643YP_006454248.1 hypothetical protein Mycch_3843 [Mycobacterium chubuense NBB4]MAKEIDRRRARGALAVLRQHPGMVLFAVSPALVVLALVWWLFGAGWAALL
LVVLLVGGAVAVVRKRD
392417642YP_006454247.1 transcriptional regulator containing an amidase domain and an AraC-MHDGQSRGTATAGDFVINTTDLQEAEKSLSTLFGTIRLSTPRPQHNARTQ
LWRSHIDHLVIDDAEFTFDMGYEMDPPDSVLLCRVHSGILEETPRGQASH
RYGTGSVVAFGAVEGRPLIGRVEQSRYHVLTVPRRCLAEAAGDVDASTSL
TSSRPLSPAANQYLVDVIDHVRHGVLSNPRAAREPLVAAAVTRYVAASML
AAFPNTPAGPSRPAGDDDNHEALRRATAFIEDHAGEDISLADIARAARVS
PPTLGRLFRRHRQITPMQYLQEMRLRSAHRQLVDADPTTDSVAGVAHRWG
FWHLGRFRQLYRSTYGDSPESTLTR
392417641YP_006454246.1 hypothetical protein Mycch_3841 [Mycobacterium chubuense NBB4]MRHHPHSRRSGRSGGWQQADQPDASDAADWIAGRLPDDWFAGDPEVVVDR
EEITVIGRLPEAEGAESEARASGRAARFREQTRGDRMRIADEAEARYGRK
VAWGVEIPAIGDAPAERILFTHMAVPVMTRLRQPERQVLDTLVDAGVARS
RADALAWSVRLVGEHADEWLGKLRDAMREVDDLRAEGPQL
392417640YP_006454245.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMTRTVHTFCRYCLASCGVEVTVEDNRVVRISPDKQNPHSWRDFCAKGRTA
GQLVEHPRRILAPMRRVGDAYVEATWEEAVSDIAARMNAVIDADCPDAVG
VYYGNPAGFSSSNVIFMNGWLDAVGTHSRYSVGSIDQNAMHVVATAMYGS
MLMAPVSDIDNCDYFLLVGTNPAVSAWNWLETVPGGWRRALARQAQGATI
TVVDPLRTESAAKADVHLAVRPAQDWALLLAMVKVILDEGREHAQDCADL
ASGLDGLRALVAEADVDDLARRCDLPRAQIESVARDFASARAAMVVTRTG
VSMHLTGTVAEWLGHVLNVITGRMDRPGGRRFEPGYVDAIRMSGMVTAST
HRNRLSGRAMVAGAHALAELPDEITTAGSGQIRAMVINCGNPVVSGPDGA
KLDAALSQLDLLVAVDFVQRESHRHAHWLLPAVHWLERDDLLAFTSNMHD
EPYVHYGAQAVEPPPHARQEWQIFTDLAIAMNRPLFGARGVNAFIKATRR
AAELTRLPGLAFSPRWIDRLVLATGRKFNGRRLTWRDVVSHPHGWVLGPR
EFGHFRTALRTPDKKVHVAPAQFVARARELLAGPMPHPPADYPMQLANRR
HRHSMNSWLNELPGLHPSGKRSEVVIHPDDAAELGVADGDRVRVSSRVGE
IELTASIDDLPRRGVVVIDHGWGSRVFDPRTGAAPVSHGVNRNLLVDGAA
VDPLSQTPALSSSYVAVARVG
392417639YP_006454244.1 ABC-type multidrug transport system- ATPase and permease component MTGPLARSMRMAEPPVTRSRDFRGSALRLLRRLTPQRGLTVAVMLLGIGG
IAIGVIGPRILGHATDLLFNGVIGRELPAGLTKQQAVDAARARGDTTFAD
LLSGMNVVPGQGVDFSAVGRTLALALTLYLIAGLMVWLQARLLNVAVQRT
MVALRADVEDKVHRLPLRYFDSRQRGEVLSRVTNDVDNLQTALSMSITQL
LTSVLTVFAVLVMMLTISPLLTLLTVVTVPLSLWVTRSIARRSRRLFVAQ
WTNTGRLNAHIEETYSGFTVVKTFGHRAHAQEQFRDLNDDVYHASFGAQF
LSGLVSPATVFIGNLSYVGVAVVGGLQVATGQITLGSIQAFIQYVRQFNQ
PLTQIAGMYNTLQSGIASAERVFDLLDTEEEPPDSPRALPSGDDRRGVRV
GGRVEFDHVWFGYDPGTPVIEDLSLVAEPGTTVAIVGPTGAGKTTLVNLL
MRFYDVDSGRILLDGVDISTVSRQSLRSRIGMVLQDTWLFAGTIHDNIAY
GRPEATDDEVLEAARAAYVDRFVHTLPKGYQTLVNDGGTNISAGEKQLIT
IARAVLARPQLLILDEATSSVDTRTEVLIQHAMAELRRDRTSFIIAHRLS
TIRDADVILVMEAGRIVESGSHSELLARRGEYWTMTQA
392417638YP_006454243.1 ABC-type multidrug transport system- ATPase and permease component MLWELLRRHVRPYRSLLAVVAVLQVISTLATLYLPTVNAAIIDDGVARGD
LHRIVELGAVMLAVTGLQAVCAVGAVYFGSRASMGVGRDLRSAVFHHVTG
FSAEDTARFGAPSLLTRTTNDVQQIQLLVQLTCTMLITAPIMSIGGILMA
VHQDAGLSWLLLISVPLLALANYWIVSHLLPIFRRLQRQIDAINRVMREQ
LTGLRVVRAFAREPFERNRFAEANEALAGTALEAGRWQALMLPVTTLVIN
VSSVALIWFGGLRIDAGQMQVGSLIAFLSYFMQILVAVLMATFILVIIPR
ASVCAERITEVLVTQPAIVTSPDALSPTTIAGEIRFENVTFSYLGADRPV
LEDVSLIARPGTTTAVVGSTGSGKSTLTSLICRLYDVTAGSVSIDGVDVR
DLDIERLWAAIGMVPQRGYLFSGTVADNLRYGKSDATDAEMWAALRVAAA
DGFIAAHPEGLATRVAQGGMNFSGGQRQRLAIARAVIRRPVIYLFDDAFS
ALDVHTDAHVRENLRDVSADATVVIVSQRVSTVATADQIVVVDDGRVVGA
GTHDDLLTRCAAYREFADSQSVKAGEP
392417637YP_006454242.1 Protein of unknown function (DUF3558) [Mycobacterium chubuense NBB4MTSSYRGLGRSGKALAVAAVAVLPVLAACSNDQPSSPSVPSTEAPQQAAK
HGPFFPQCAGVSDDEISKQTQVPGLVNTAATSVGCQWLAGGSILGPHFSF
TWFRGSPIGRERKTEELSRTSVEDVNIEGHSGFIASNDDPTLGTNLCEIG
IQFNDDFIEWSISYAQKPFPAPCDVAKELARQSIVNSK
392417636YP_006454241.1 Protein of unknown function (DUF3558) [Mycobacterium chubuense NBB4MSARRARSAAAAALATVATLTLLTGCTQTVQGTAAKSGSGDVPRNNDSQK
QYPNLLKECDVLTEDILAQTVGADPRDIQSTFVGAVCRWQAANPAGLIDI
TRFWFEQGSLDNERKTAQQLNYQIENRSIAGIASFVMRPNDPNGACGVAS
DAAGVVGWWVNPQAPGIDACGMATKLMELTLATRA
392417635YP_006454240.1 phosphohistidine phosphatase SixA [Mycobacterium chubuense NBB4]MSDRIRTLLLLRHAKSDYPDGVPDHERPLAPRGVREAALAGDWIRANLAA
VDAVLCSTATRTRQTLDRTGITAPVQFVDRIYDSSPGIVIDEINAVPTRF
DAEVATLLVVGHEPVMSSLALGLADDASVDSGAARAISAKFPTSSVAVLR
AAAPWEQWELGGAELAEFHTPR
392417634YP_006454239.1 DNA repair exonuclease [Mycobacterium chubuense NBB4]MRFLHTADWQLGMTRHFLNGEAQPRYSAARRAAVAALGPLAAEAGAEFVV
VAGDVFEHNQLAPRDVSLSLEAMRGIGVPVYLLPGNHDPLDASSVYTSAL
FTAERPDNVVVLDRAGVHEVRPGLQLVAAPWSSKVPTTDLVGEVVDGLPA
DGVTRIVVGHGAVDILVPDKDRASLIRLDTLEQAIVRGAVHYVALGDKHS
RLSVGNTGRIWYSGSPEVTNYDDIEPDPGNVLVVAVDEADPRRPVGVDAH
RVGDWRFMSLRHAVDSSRDVADLDINLDLMPDKERTVIRLGLTGSLTVTD
KAALDVCLDRYARLFAALIPWDKQTDIAVMPTDGEFDDLGIGGFAAAAVD
ELVATARSAGDDAEDARAALALLLRLTEGGAA
392417633YP_006454238.1 hypothetical protein Mycch_3833 [Mycobacterium chubuense NBB4]MKLHRLTLTNYRGITHRDIEFPDHGVVVVSGPNETGKSSMLEALDLLLEA
KDRSGKKEVKQVKPTHADVGAEVTAEISCGVYRFVYRKRYHKKPETELTV
LAPRREQLTGDEAHDRVRAILAQTVDLDLWQAQRVLQSAPTSAVDLSGCD
ALSRALDMVAGEVDATPAQGAGNVETLLIDRIDEEYRRYFTATGRPTGEW
AAATTRLRAADQEVATCAAAIAEVDEAVRRHAALTDELSGLSVESTCATE
RLTQIRAAAQTITTLRGEVEQAGVRAQAANSAHEASLAALTERRRARADI
DDRTATVERLQAAAAEAAEALDTAGEVQVAAEEAAVEARATLEASQVRVD
TARSAVQRLADREEANRIAARLGTIERHQREFDAVRRALTAITLTAEHMA
AIEKASAAHDRAAAAVEHTSAHVELVAEADLELLIGGEPVTLQAGRSWQS
GVSGPTDVAVPGLLSVRVTPGASAAGTQAALDAAATTLAQALERAGVSGL
AEAREVDQRRRDLQAAGREARVALDALTADDSADALRARLCELRENQPDD
DGLFDLATGGPHDPAAQRRELIDATAAHQQAVRDCETHRKVAEEAAKLLA
QRGVHAARAKEKLQAARDELAAAQLRLAAQRDAVGDEQLALKAEADGEAV
AAAQAHLTRLGDELARHEPETVAAALAEAERAAEGVAARRDQAAEALREV
ATALKIFGTEGRKGRLDAAETEREHAEAEYRRVQRRARAAQLLKSVMGRH
RDAMRSRYVDPFRGEVERLGRIVFGESFEVEVDSELRIGHRTLSGRTVPY
ESLSGGAKEQLGIVARLAGAALVATEDSVPVVIDDALGFSDTGRLAKMAE
VFDAVAGDGQVIILTCSPQRYADVQTATHIELSA
392417632YP_006454237.1 choline dehydrogenase-like flavoprotein [Mycobacterium chubuense NBMEADYVIVGTGSAGAVVANRLSADPSVQVIVLEAGKRDRDPFVHIPAGFS
RLMRGPLDWDYLTEPQQGLGGRRIYWPRGKMLGGSSSMNAMMWIPGFAAD
YDEWGERAGQQWDYAHVEPYLRRIEAGPLIISRQRSPRASTAAWLDAAKD
CGHRVEKPNSAEPQGFCETLVTQRRGARWSSADAYLKPKAVRKRRNLTVI
TEATATRVVFAGDRAIGVEFDGKHGRTVATARREVVLCAGAINTPHLLML
SGVGDHDQLTRLGVVPVAHSPEVGANLVDHLVVPLGFDVPYGSLVDAQKP
LELLNYLVRRRGMLTSNVGEAYGFVKSRPDLALPDLELIYAPAPYFDEGI
GDPYRGHAVVMGPILLKPQSKGSVTLHSTDPHDKPLIDPRYLTDPAGADR
EALMAGLRMCAHIAAARPLKDTLGRIARPLDATTLDDETLARALESLSHT
LYHPVGTCRMGTDDASVVDPHLRVRGVRALRVVDASVMPTIIRGHTHAPT
VVIGEKAADLIRSTH
392417631YP_006454236.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMNAKRRRAHDKLAALPGVRPVRRPVVTGGPHRGGEEFDVYYVRTGRKSAN
PLLIIPGGPGAASVALYRAFRRHAAVAGLDVIMVEHRGVGLSRHDDAGAD
LPPEALTVDAVVGDLAAVLDDAQVDKAVVYGASYGTYLAAGLGVRHPDRV
EAMVLDSPLLSADDIEEVRAQTRRVLWDGAAPESAELAAKVRRLVADGVL
RSKDVQLIGDLYGVAGPEVLGRQLDLLLAGHDWLWAAVGVGARNLFESKT
PYQHEPDLVERIAYRELNYGAEPDGGPLDPAIALREMASGDVEFATEPYD
LVSAMPSFTWPTAVVSGGRDLTTPPAVARRITGLIPGSVLVDLPTAGHSM
LDTREHAALQICQAASNGAIDELPSRALELDALPANLTVRLLVRAISVAL
TVESVVPDVVPRAVRQVTAS
392417630YP_006454235.1 ABC-type dipeptide transport system- periplasmic component [MycobacMTYRALLRLLGVALTALLILTGCSGSREPGPSAGGSAELGATADINAQDP
ATLRQGGNLRLALSGFPANFNNLHIDGNLGEIGAMYKATMPRAFFIKPDG
QMTVNNDFFTNVELTGTDPQVVTYTINPKAVWTNGRPITWEDIASQINAT
SGKDKRFLFAAPNGSERVASVTRGVDDRQAVVTFAKHYADWKGMFAGNGM
LFPKEMTATPEAFNTGFRDTPPPSAGPFTITAVDRGAQRITLSRNPKWWG
TPALLDSITYTVLDDAARIPALQNNALDATGLATIDELTIAKRTPGISLR
RAPAPSWYHLTFNGAQGSILADPALRMAIAKGIDRQGIVNVSQRGLTDKP
VPLNNHIYVAGQEGYQDNGIGFDPEGAKRDLDALGWRQAGQFREKDGRTL
TIRDVFYDAKSTRDIGVVAQNNLAQIGVDLQLIPAAGGKLFPDFVTPGNF
DVVQFAWGGDAFPLSSLSQTYASQGESNYGKIGSPEVDAKIEQTLSELDP
AKARTLANELDRMLWQEVFSLPLFQAPGNLAVRSTLANFGPAGIGDLNYS
AIGFMKQ
392417629YP_006454234.1 oligopeptide/dipeptide ABC transporter- ATP-binding protein [MycobaMSLLEVRGLTVSFPTEAEHVTAVRGLDYHLESGEVVALVGESGAGKSAGA
MAVIGLLPEYAEVSGSVRLDGDELLGLSDQQMSRIRGNRIGTVFQDPMSA
LTPVYTVGDQVAEAIRIHRGDVGRRAARARAVELLDLVGIARPEQRARAF
PHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILDVLRTAR
DVTGAGVLIITHDLGVVAEFADRALVMYAGRAVETAPVADLYTGRRMPYT
AGLLGSVPRLDAPQGTRLVPIPGAPPSPAALPSGCPFTPRCPLAVEECSA
AEPELEPVGPDHRVACIRHEHVAGRSAAEIYGVSVEPTAPDVEPAAQPVV
LRVSDLVKTYPLTKGVVLRRRVGEVRAVDGVSFELHEGRTLAIVGESGSG
KSTTLHQVLGLTAPQSGSIEVLGSDVASLTSSARRDVRRELQVVFQDPVA
SLDPRLPVFDVLAEPLRANGFDKTSAEDRIAELLTVVGLRREDADRYPAE
FSGGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIINLLLDLQQRF
GLAYLFVSHDLSVVKHLAHDVAVMHEGVIVEQGASAQVFGTPRDDYTRRL
LAAVPRPGPDRG
392417628YP_006454233.1 ABC-type dipeptide/oligopeptide/nickel transport system- permease cMSDLEAETPAPRQFVTRRTLVLRRFLRNKPAVVSLVVLCLLFIGCYALPP
LLPYSYTDLDYYALQEPPTTAHWFGTNALGQDLLAQTLRGMQKSLLIGVC
VAVISTLVAATVGAVAGYFGGWRDTVLMWFVDLLLVVPGFILIAIVTPST
RGGDTVLWLILLLAAFSWMISSRIVRGMTMSLRDREFVAAARYMGVRSWR
VIVRHIVPNVASILIIDTTLNVGIAILAETGLSFLGFGVQPPDVSLGTLI
AAGTGSVTTFPWVFLFPAGVLVLIVLCANLIGDGLRDALDPGVRPASQRR
RRP
392417627YP_006454232.1 ABC-type dipeptide/oligopeptide/nickel transport system- permease cMTRFLARRLLNYAVLLALASFLAFSLTSLTFHPLDSLLERNPRPPQAVID
AKAAELGLDQPIPLRYARWISGAVRGDFGTTIAGQPVTDELWRRVGVSLR
LVVIGSVLGTIVGVVVGAWGAVRQYRLSDRVITLLSLLILSAPTFVVANL
LILAALKANSILGLQVFQYTGETSPDAAGGGPGQFVDRLQHLVLPTLTLA
LASAAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRQALFKHGLRTALIPM
ATLFAYGISGLVTGAVFVEKIFGWHGMGEWFVQAIAAQDTNIVVAFTVFS
GITILLGGLLSDVIYAALDPRVRAS
392417626YP_006454231.1 hypothetical protein Mycch_3826 [Mycobacterium chubuense NBB4]MSTEQLTSDDRVWGSPEPAPTRWGGRETAVAVGIAAVIAALGGAAIYAAT
GQTAHGAGAFGNHAFGPGGPGFGPGGPGFGPGGPGSPGGPGAVPAGPGGP
ALHGKFVVPDAAGAFTTVLTQTGTVTASSPTSVTVRSRDGFSQAYSTTAD
QTRGLIVNEVVTVRAVQQGDRATATEIVGEAAGPPPPGSPATPR
392417625YP_006454230.1 response regulator with CheY-like receiver domain and winged-helix MRRPDGSPIHVLVVDDEPVLAELVSMALRYEGWEISTAGDGATAITLARE
TPPDVVVLDVMLPDMSGLEVLRKLREQIPGLPLLLLTAKDSVEDRIAGLT
AGGDDYVTKPFSIEEVVLRLRALLRRTGVSTETGGAKIVVGDLVLDEDSH
EVTRAGEVISLTATEFELLRFMMRNAKRVLSKAQILDRVWSYDFGGRSNI
VELYVSYLRKKIDSGREPMIHTLRGAGYVLKPAR
392417624YP_006454229.1 signal transduction histidine kinase [Mycobacterium chubuense NBB4]MVTRSPRGWSLRTRLLVTQVLLLAVVCAAIGFATEFALQRFLMNQLDEQV
VEAGRRSSAIFEFGPPPPPGMDPADRRPPEERSESRRRMMLREDEGPGPA
FLNAPGQAIRTIGAVVSSGKPVDAGVITSDGARAELSTTAADQLATLPAD
EHPRTVRLDGLGRYRVVSFPAHHPGEVVVTGLPTSDVDDTLLWVLVIFCV
VAAVALIGAATASIVIVRRQLDPLARVSAAAQQVADLELDRGEVRLPTPI
VRVDPAAARTEVGQLGAALNRMLDRIAGALAARHASETRIRQFVADASHE
LRTPLAAIRGYTELAQRKQAALPDDVAHAMNRVESETERMTHLVEDMLLL
ARLDTGRPLEREQVDLTRLVVDAVSDAHIAGPGHTWELDLPDEPVTVPGD
EARLHQVLANLLANARTHTPPGTSVTTSLSVGDGGAAVLTVHDDGPGIPA
WLQPEVFERFARGDSSRSRRGGSTGLGLAIVNAVVRAHGGRIALHSVPGD
TEFVVTLPGDTQPSHR
392417623YP_006454228.1 PMT family glycosyltransferase- 4-amino-4-deoxy-L-arabinose transfeMTLVFSAEQTRSSAENPDRARFRVCSPRVALAGLLAVTAVLYLWNLGASR
WANAFYAAAVQAGASDATAMLFGSTDAANSITVDKTPAALWVMTLSARVF
GFNPWSMLVPQALMGVAAVALLYAAVRRVGGPGAGLIAGAVLALTPVAAL
MFRFNNPDALLVLLLVAAAYCTQRACERDAGRWWLLAAGVAVGFGFLAKM
LQALLVLPALSAAYLLAGRPPLGRRVLDTAVAAVAVVVSGGWYVLLAELW
PASARPYIGGSQHNSILELALGYNGFGRLTGDEPGGLGNMNHDVGWGRLL
GFSMGSDIGWLLPAAVICLAAGFVITRRAPRTDASRAALVIWGGWLAVTA
VVFSYMNGIVHPYYTVVLAPAIGAGIGLGATLLWRRRADPRAATTLSGAV
LVTSVLGAVLLSRHGDWMPWLRAVVAVGGVAAAVLLLVAGRLGVVATRVV
AAVAAVSCLAAPAAVSLATASTPHSGSIPSVGPAPGPRAAVMGGPGGGLL
DSPTPRADLARLIATDAGEYTWAAAVVGSNNAAGFQLASGAPVMAVGGFN
GTDPSPTLAQFTRYVDEARIHYFIKGRMMTMGHPGGNSARDSSEIAEWVE
ARYTPVTIDGTAVYDLTQQPRTSQPAHSSGQR
392417622YP_006454227.1 glycosyl transferase [Mycobacterium chubuense NBB4]MDAMTDTALEPEFACAERPFERRPNAALVARAAGAPVLDVVVPVYNEEAA
LAASVYRLHHYLRENVPFRARITIADNASVDDTPRIAAQLADELDDVRVV
RLEQKGRGRALHYVWSHSDATVLVYMDVDMSTDLAAFAPLVAPLISGHSD
LAIGTRLGRGARVQRGPKREIISRCYNLILKSTLSARFSDAQCGFKAIRA
DVAARLLPHVEDNGWFFDTELLVLAERSGLRIHEVPVDWVDDPDSRVDIL
ATAAADLRGIGRLVRGLATGAIPVNTIAAQLGSSRAAAAPNSLLRQVVRF
GAIGVTSTAAYVLLFTLMHSWAGAQLANLIALLLTAIANTAANRRFTFGV
GGRSGLARHHLEGLIVFGIALSITSAALGLLHATAATPHHLVELGVLIAA
NLLATAVRFVLLRGWVFHPRRTRTKGNPR
392417621YP_006454226.1 PMT family glycosyltransferase- 4-amino-4-deoxy-L-arabinose transfeMTLTADAPVRDTAENQSGRSSNMLHRMVFGDGVQPRWARPALLALLTATA
VLYLWGLGTSGWANSYYAAAAQAGTQNWTAWLFGSLDRGNAITVDKPPAA
MWVMGLSGRIFGFTPFTMLLPQALMGVASVAVLSATVRRVCGPGAGLIAG
AALAVTPVAASMFRYNNPDALLVLLLVAAAYLMVRAIETGRTRWMVAVGV
VLGFAFLTKMLQAFLVVPGLALAFLVAAPVAFWPRVARLLAGAAAMVAVA
GSFLALVSLWPADSRPYIGGSTDNSLLQLALGYNGIQRVTGGEGMPGGRP
GGGANLFFGGDPGIGRLFGASFGAEASWLLPAALIGLVAGLWFTRRTART
AAVRASLLLWGGWLLVTGAVFSFMDGTIHPYYTVALAPAIAALVGICVVQ
LWRGRQYRAPRAVLAAMSAATGVWSFILLDRAPDWHPWLRWVVLIGSILV
AAVIGAGAQRLGRLTVVVAAAAILLAGAASLGYAVETAAHAPSGPGVMSG
PVSAHNGFGGFGGPGGPGGPGRPGGSVAGNAALQELVKTADNRWAAASIG
SMTTSNLELETGASVMAIGGFTGGDDAPTLEQFQAYVAQGQVRYFIAGDH
MGPRRDSGSASAITAWVEKNFTPTDVGGTAVYDLQR
392417620YP_006454225.1 transposase [Mycobacterium chubuense NBB4]MEVTPTYAGIDWSWQHHALCIVDAAGRRVEEITVAHSKPGLAKVTTLLHR
HGVERVGIERGDGPVVEHLIRDGLEVVVISARQVKSLRARYGSAGNKDDR
FDAFVLADALRTDPYRWAVVRPDSDATVALRGLVRARQDLVGHRIAVHNQ
LLATLQHHFPGAIGLFHQLDIPISLAFLRRFPCEAKAAWLSPTRLAHWLH
ANGYCGRATAEELFTHLHQAATGHLSGATSEAGELIVLSLVDLLTSIRQR
QSELETRIKEALLAHPDGPIMQSLPRSGVVRAATLLAEIGDCRARFPDAQ
SLAAAAGVAPSTRQSGKHCNVTYRRGCNKQLRAALIDWAQDTPRANTWAH
DTYYRARQRGCRHPHAARIPAQAWTRILWRCWHDHTAYNPELHGRLNTLE
AEAA
392417619YP_006454224.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTASVGRPRNPAKDVAVLQATRELLVEAGYQGTSVMAIARRAGVGAPTIY
RRWPTKESLVEDAAFGHPQPAPLPRPTGELLADLRSWVAVFLDWLADPAI
RAALPGLLTAYHRDEQIYERLVLRAEADVRSLMGELLGSALPDLPRTEIA
ARTDVVFDFLVAATVVRAMTRGLLDRDGFCERTARALRALALATE
392417618YP_006454223.1 hypothetical protein Mycch_3818 [Mycobacterium chubuense NBB4]MLTPHDELLCHQLPTTFDHIAQSDLRWTERIVMYGFDRSGDVNVMTGLAR
YPNRNVTDAYAMITRRTATGQEARVVRMSTELHPETGPLGSYTVGPYTYQ
VEEPLRTVRAVLEPNDQGVSLDLRLRGQFPTYEQTPAFHRSRGRVSEDAR
RFYQNGDLEGWIEIDGERIEIDTRRWWFGRDHSWGIRNGPGGGSLAEGAH
LQPQEIPDGTLYYMGIFQFDDELVHFAQRETSTGERWQFEGEVLHPMATG
RPATSIIDVEHDLKFRQELRVISGGTFTIHRGDRTSSTIEVTPLTDFWPG
LAGYMEVNGYASGHWRGRDFLDGFTVDPTDLDAIRPVSFLSETLCEVRMA
TSEGDKIGHGLVEMVFVGAYPRYGYTGW
392417617YP_006454222.1 putative aminoglycoside phosphotransferase [Mycobacterium chubuenseMSTPARARPAVEALPALLEGIVRQHVPGAERARIENFACSTSGFSTETFL
FDLTGLDGGGSLGLVFRRPPEFQILPDYDLRRQFLVMQRLAASPIPVPTV
RWMDPGPAALGTPYLVMDRIDDVIGVSDVPPYHQTGVFAETDDAGRTLLW
NGCVDTIAAVHRLDPRDYRLEFLAPSGGASPSALASFLRYALEWAYDDHP
LHPTFVRALNWLNTHDYTPERVGLCWGDSRMSNVLYGADLTPVAALDWEI
AYLGDTAADLAWLFMTDWVSSPLPGNAPAPGTPSRDETIARYEDAVGHAV
GNIRYGDVTAPLLLAVALVRLNARFALEGVDLADICARRVEHILDGD
392417616YP_006454221.1 sulfate adenylyltransferase subunit 2 [Mycobacterium chubuense NBB4MTATDELTSNAGRYELSHLRALEAEAIHIIREVAAEFERPVLLFSGGKDS
IVMLHLAIKAFRPGRLPFPVMHVDTGHNFDEVISTRDELVARHGIRLVVA
SVQDDIDAGRVVDNGPSRNPLQTVTLLRGIRENRFDAAFGGARRDEEKAR
AKERVFSFRDEFGQWDPKNQRPELWNLYNGRHRKGEHIRAFPISNWTEFD
IWSYIGAEKITLPSIYYAHTREVFERDGMLLAVHEYLRPRDDEPVMQKSV
RFRTVGDVTCTGCVESTAATVDEVIAETAISRLTERGATRADDRISEAGM
EDRKREGYF
392417615YP_006454220.1 sulfate adenylyltransferase subunit 1- adenylylsulfate kinase [MycoMSASTTLLRIATAGSVDDGKSTLIGRLLFDSKAVMEDQLAAVERTSKERG
HDYTDLALVTDGLRAEREQGITIDVAYRYFATAKRKFIIADTPGHIQYTR
NMVTGTSTAQLAIVLVDARHGLLEQSRRHAFLASLLGIRHIVLAVNKMDL
VGWDRATFETIRDQFHDFAARLDVHDVTAIPLSALKGDNVVSKSEVTPWY
EGPSLLTHLEEVYIAGDRNLVDVRFPVQFVIRPQTHEHADHRSYAGTVAS
GLMRPGDEVVVLPTGKTSRITAIEGPGGPVQEAFPPMAVSVSLADDIDIS
RGDMIARPNNQPRVTQEFDATVCWMADGTSLEPGRDYLIKHTTRTTRVKV
TALDYRLDVNTLHRDKTATALKLNELGRISLRSQVPLLLDEYSRNAATGS
FILIDPNTNGTVAAGMILPYVTARTSSPNTVRHDSLCSAEDRLSKGRTVW
FTGLSGSGKSSVAMLVEQKLLEKGVPAYVLDGDNLRHGLNADLGFSMADR
AENQRRLAHIAAILADSGQVVLVPAISPLEEHRELARRVTCEAGLDFFEV
FMDTPLEDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKDPDLRLTPDR
SIDELADRVIELLESTP
392417614YP_006454219.1 3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [MycobaMTETDHELAARLATEAGALLLDVRAEFAHATVEERKAAGDKRSHDFLLAA
LTAERPADAVLSEEGVDDPVRLSAQRVWIVDPLDGTREFSEVGRTDWAVH
VALWDSGAGVPPARSAGGLVAGAVALPAQGVTLATPTVPAPPAPPVAPRI
VVSRTRPPAIALEVKDALNGTLVEMGSAGAKVASVVQGLSDVYVHAGGQY
EWDSAAPVAVARAAGLHTSRIDGSPLVYNQRDSKLPDLIVCRPELADAVL
AVTARR
392417613YP_006454218.1 nicotinamidase-like amidase [Mycobacterium chubuense NBB4]MAELNTLRALSGLPLTPVGLADSVLVLIDCQNTYTRGVMELDGVAAALDE
VGRLLERARSAGVPVVHIQHDDGPGSLYDIAGESGAIVEQLAPRDGEAVV
VKNYPNSFVGTDLDARLKGLGASHLLLAGFMTHMCVNSTARGAFNLGYAP
TVVGAATATRTLPGPHGESVSAQAMQAASLAAVADLFAVVVPRASDIPD
392417612YP_006454217.1 rrf2 family protein- putative transcriptional regulator [MycobacterMRMSAKAEYGVRAMVQLATVDGGALVTTDDLARAQSIPAQFLVDILSDLR
TDRLVRSHRGREGGYELARPAADISIADVLRCIDGPLASVRDIGLGDLPY
SGPTAALTDVWRALRASMRSVLEQTSLADVAAGALPEHVRSLADDYRDQE
AARGHSVE
392417611YP_006454216.1 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily [MyMAITLNHTIVAARDKTESARFLAELFDLPAPTPFGHFLVVQVGDTSLDYA
DAGAGDEIHPQHYAFLVSEAEFDTIYGRIREREMPHWADPRMARPGEINH
NDGGRGVYFRDPGGHYLEILTRPYGSGG
392417610YP_006454215.1 2-nitropropane dioxygenase-like enzyme [Mycobacterium chubuense NBBMPFDLRDLSAPILAAPMAGGPSTPELAAAATDAGGLGFVAAGYLTAEVFA
QRLEAARRLTSGPLAANLFAPQPSAGTAAAVAAYADTLAGEAQRYDVALG
EPRVDDDGWDAKIDVLLAVRPELVSFTFGLPSADERRRLSDAGIVTAGTV
TTLDEARMAADVGVELLVAQGPSAGGHRGTFDATARPSEQLLDDLLDSIT
SGLDLPVVAAGGLMTAADVRRVRQKGAVAAQLGTAFLLSDEAGSSAVHRS
ALQDPQFTETIVTKAFSGRYARGLRNRFVDEHDDAAPLAYPQVHYLTSPL
RAASVRAGDPHGVNIWAGTGFRRAEAAPAATIISKLADG
392417609YP_006454214.1 transposase- IS30 family [Mycobacterium chubuense NBB4]MGCRGPGRARLPESVRERFWAAVAAGLSPTAAATVAGVHGATGRHWAQQA
GYRGESKHFGIRYTAQQRAVFWTAVRSAVPPAQAAVVAGVSEAAARRWLQ
QADHVPRTPFPAEADLVAESELTSRVRAPLRFVERCRLEQLLEHGYPPAQ
AAALMGRHKDTINREIARGQTRSVYRASMGQDVADAARKRPKVRKLEANP
GLRAEVLQRLETRNSPEQIAGRLRQDFPDDPEMWVSHETIYQAVYVQPRG
ELAKELKSALRTGRIKRKPQGRNEIADRNRFKAGMVGISERPAEADDRAI
PGHWEGDLIMGAGNTSAIGTLVERTTGFVMLLHLPGDHTATTVAAAMTAK
VPEIPGILRRSLTWDQGTEMAMHTNITEATGLPIYFCDPHSPWQRGTNEN
TNGLLRQYFPKGTDLAFWGPGFLDQVAAELNARPRKRHNWRTPAEELDRL
LSDPSTYVAATA
392417608YP_006454213.1 tellurite resistance protein-like permease [Mycobacterium chubuenseMPGGILRTLALAILAAMTADRPSIMSYLGPNWFASVMGTGIVATAGASLP
VHVPGLRAFALAVWVVSAVWLVVLALATGAHWVRNPVVARSHGRNPQMAH
FYGAAPMALLTVASGALLVGHELLGARVAVDLAWVLWVAGTLGGLFTAMS
IPFLMFTQYRVEPDAAFGGWLMPVVPPMVSAATGALLIPHMPGGTGRQTM
LYGCLAMFGLSLVASLIIITMVWSRLAHFGTSGTARVPTLWIVLGPLGQS
ITVAGLLGTDAALAVDRTLADGMRVFAVLYGVPVWGFAVLWIALATALTL
RTLRRGMPFALTWWSLTFPVGTFVTGTTQLAAHTDLPAFRVAAAIGYVGL
LCTWVLVAVRTFRGGVRGALFTPPAAEPIRASKDPAP
392417607YP_006454212.1 transcriptional regulator [Mycobacterium chubuense NBB4]MALRPVDRRSVPEDVFDQIITDVLSGEMRPGEALPSERRLAEVLGVSRPA
VREALKRLAAAGLIDVRQGDATTVRDFRHTAGLDLLPRLLMREGELDLAV
VRSILETRLHNGPKVAELAALRGGRSLSAELNAAVAALETESDPIAAQRF
ALDFWDLIVDGADSIAFRLMFNTLRATYEPALPALATIMAGEVGRASAYR
AVADAVVAGDAAGARDNAHGLLEPATTALLTVLDNLKENR
392417606YP_006454211.1 fatty acid hydroxylase-like protein [Mycobacterium chubuense NBB4]MTTTSTRAVRKSFSLTDARREFGRHPSPWMLGVTLLVALGARIMVGDWQI
TDAVVPAVMLAVFPFFEWLVHVCILHWRPRQLGRLRVDLLLARKHREHHV
DPRDIPLIFIPWQALLWVLPGAVAIALLAFPRSALGLTFLGFAAVLGLCY
EWCHYLIHSDYKPKTAAYRAVWRNHRQHHFKNEHYWFTVTSTGTADRVLG
TYPDSGAVATSPTAKNLHAQTN
392417605YP_006454210.1 flavin-dependent oxidoreductase- F420-dependent methylene-tetrahydrMPVMEPNLDTATLRAWAQLVDRGPFSSLCWGERIAFDNPETLTLLGALAA
WTDRVRLVTTVIIPQLHDPVMLAKALATGDMLSGGRLTVGIGVGGRHEDY
RAVGADPATQTMRQMAERVAVMKRVWAGEKVTDSTLPVGPPPVQSPGPEL
LVGTMGPRTVRSAASWADGLAGTTMDLDVAKQNELFDVARDAWREAGKAA
PHLATSFWFAIGDGDAPREQVHRHLLRYMNWIPAKIVDAMAPTTGWAGTQ
DELRTVLRRFAEIGTDEIHLIPTSSDLDQVRRVAEVAADLV
392417604YP_006454209.1 K+ transport system- NAD-binding component [Mycobacterium chubuenseMVGHTIVSGADALAVRIAEELRGTGTTVTVIDRADELTAAGISTAAAVVC
VGDDDALNLEIALLARQYSPTVRVVARLANGVLREAMAVDNGPGAVLDVA
DLAAPSVVEACLARTTHTIATGGLEFVVSGADAPRTGTLREIYGDLAPVA
VLHGDHSATPGAVVACPGRDVMVDEGDWVAMIGTADELAAEGIAVAARAT
VTAGSHRGPVTRLVNAARAFREDVNPNFYRALSVSLSLLAFSTVLLWFTY
DKPGMSLIDALYFSTETIATVGYGDFSFSDQPTWLRLFSIVLMFAGITTT
AVLMAFIADLLLSRRLAYSAGRRKVRELRDHMIVVGLGSFGIRVAADLKA
AGHDVAVVELNIDNRYLSAAADLDIPVIFGDATLPSTLEAARIDDAVAVA
VLTDNDMVNIETGIVSRERLKARWTNSSRHPRVPVVLRVFDRVLGAAVAQ
RFGFENVRSTVELAAPWYIGAALGLTVFGTFSVGQASFMVGGVQVEPGSE
LDGIRMAELSTQARVIAIVGRTGVRELHPRRGSQLNAGDTAYLVGPYREL
LDTLRKGRSASFRSPAQ
392417603YP_006454208.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFQLSEEQVLLRDTIRDMLSRTYDPESRLKAIDTDLGWSRDVWSQLAEV
GVLGLGFDEDAGGQIEIQTVLTEVGRRLAPEPVLHAALGPGALIAEVGTA
EQRALLDEVAAGERLLAFAHAEPGMRRPTTSVSTTAAQQGDSWTVSGRKN
PVLAGDCADTLVVSAALPDGGTGLFLVDAAAAQRTPYRTFDGQRGAEIDF
DAAPAEPLGEAADASAAIAHGLVRISSALCAEALGAMEEALRLTTEYLTQ
RKQFGVTLSKFQTLTQRAADMYVSLELARSMTLYAAMSIADGNLDPVVAA
RAKLQIGRSGRHISQEAIQLHGGIGVTAEYPVGHYAARLTAIEQTLGSAQ
DQLHLLMARLGDYEVVTV
392417602YP_006454207.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MQLALTSEEAAFRDELRTFYTTEIPADIRARTREGTDVSKDDIVTTQKIL
NEHGLATPGWPVEWGGKDWTPTQHQIWLDEMQLASVPEPLNFNTKMVGPV
IAEFGSQEIKQRFLPPTAALDIWWCQGFSEPEAGSDLASLRTTATRDGDT
YVVNGQKTWTTLGQYADWIFCLVRTDPNAPKKQAGISFLLIDLDTPGITM
RPIKLVDGSVEVNEVFFEDVRVPADHLVGEENQGWTYAKFLLGNERTGIA
QVGRTKLRIAEAKERAKANGLLEDPLFAARLAEAENDILALELTQMRVAS
GSKGGKPNPASSVLKLRGSQLQQLATELLMEVAGPDILPFGASEGIASPE
WAQHSAPRYLNYRKTSIYGGSNEVQRTIISSTILGL
392417601YP_006454206.1 hypothetical protein Mycch_3801 [Mycobacterium chubuense NBB4]MRRIAMTVGATAMIVGSLIGTPTAGAAAVGTDITVNPPAPPRPSVHMLDC
AGTTGWMGCGPGWFWRDGWRGFACYPC
392417600YP_006454205.1 hypothetical protein Mycch_3800 [Mycobacterium chubuense NBB4]MMKISTLSLGTVAAATIIATFGMGAAAAAPDYATLPVDPNVITDSTAYTA
KPAVLDPDGQQGVQQEFDHRDGTRGITTTIRILSSPQDAAGALDAMRADL
APIVIGPASQPVAVGTGGTMMTGKSPDGSQSVGVLLFTQGNAAVEVQFDG
PANDPVPVDLATQYGQDQVSAINRELGA
392417599YP_006454204.1 Protein of unknown function (DUF1460) [Mycobacterium chubuense NBB4MSAGMPRSGRSARETAGLAARLVVAGVIIATSCALSGALAPGALASPQTQ
ISAASEQTLETMLTADQGAARTDPAVRADEISRRFLGTPYGADTLVGSAT
EPEQLVVNLQRVDCFTYADYVEALKRADTREQFLASLIDVRYKDGVVAFQ
NRRHFFTDWAASAPAVATDVTSSVSAHAIPVTKNLNRKDSGGAYLAGLPV
VARTVSYIPSGQVDSDVVGRLRTGDYLGAYAEDGGLDVTHVGIFIATPDG
PVFRNASSRSADDKVVDTPLSGYLRTVPGLVVLRPVV
392417598YP_006454203.1 transglycosylase family protein [Mycobacterium chubuense NBB4]MNSNHLRVAGLTVAAVVLAAGCASTAPSATEATQGVVSRRAVPPPHGTPP
PAPQWAQPRLASDPVRLTGDLVQDERTLRDRGAPEAVLVAAARRQQAAYR
VLGRHPEWDAITRPRVPGPLLDVYDRNIDARRQLEAMSSGRGTPTLPAWR
ITAPAPPAELLSYYRQAEADTGVGWNVLAAINLVETGFGRISGVSNAGAQ
GPMQFLPSTFAAYSRGDIRSPRDSILAAGRFLAAQGFSRNRDQAIFRYNN
SRQYVRAVNQYAAVIGADPAGLAGYYRWDVYYNTASGDVVLPVGYAATAP
IPVEHYLADHPQ
392417597YP_006454202.1 hypothetical protein Mycch_3797 [Mycobacterium chubuense NBB4]MNARTRSQASEASRRIAALGTAMIVAAPLTAMSQPQSPPTVTRTVQLAAA
AVPPGGLVISFLGNQLTYCSIICPLLVDTAVTAAGTTLRTPVTFLTSLKS
GNVWKTIGITAASVTGPTNDVAQATILADGTRVAPRALNAFEVAVVGGLD
ILAAAPDGLPAVAEAIATAREQTFTALHLPIVPNPAPTVMPQGVLQVAVV
GVINVVGAVIFPAFNEILSAVFDTPNAVAQELAATGRPARALAAGVRTAA
GHLAAAGTVIAASAVTAAHDVKTAIEQRRSSRAGMATQRPVSAASGPAAS
SAPKPLSDRPFRRSAKRDDRSDADSTTAHSVGQDSSTASKRPRAHGDSVR
AARRHAVRG
392417596YP_006454201.1 hypothetical protein Mycch_3796 [Mycobacterium chubuense NBB4]MSRLKRMLVLALSIAMVGLFGLVTGGTTASAQPPGVGKKNVVQVQGTGPN
GAKFNGQFVATAAKEVTKAEGAATSDQNGATSSNTGVALTGQLIGKLVTP
GGGQPAGAPGAAQDVNMQNFAMPVNAINFPPSAKPSSSTPGDSHIQFASQ
QASCSVLDLTLGPLDLNLLGLRVQLNQVHLVITAIPADGLLGQLLCSLAG
PNGVLSGAVQNIVNLLNQILGQL
392417595YP_006454200.1 hypothetical protein Mycch_3794 [Mycobacterium chubuense NBB4]MTVTSENAAPAQEVLQRADGVELIGEMAGSGYKIPPALVRRADGQTIQLT
PLLYATLHEIDGARNANAVAAAVAETTGRPVTEDNIRHLVDKQLRPHGLL
VLADGSQPQTKKRNPLLALRFRYAVTEPERTRRLTDPFRFLFRPWMVVPL
LAAFAVVCWWVFFRKGLAHAAYDAFERPGLLILVFVITILSAGFHEFGHA
AAARYGGATPGVMGFGVYLVWPAFYTDVTDTYRLGRRGRVRTDLGGLYFN
AIVAVAIMAVWWWLRYDALLLVVATQILQMLRQLAPMVRFDGYHVLADLT
GVPDLYSRIKPTLLGLLPWRWGDPHARLLKPWARILVTVWVMVVVPMLLS
AVAGAIIGMPRLLGSAWSALGKQQDVLSAAWADGDFIQVTARVLAMIAIV
IPVAGVVYMFVRIARQSGVSLWKGTAGKPLMRALALLLGAVVTCGIAYAW
WPGEGKYQPIQPWERGTVGDIAYALGVKHLAHPTERTAATRPVATTRKLV
NGQRGVMRVVWDNQASLPRSTQPRLAVILVPRTMSGARGGGGGGGGGGGG
ALASAPTPVDQGWVFPFDKPLVPGPGDNQALAVNTTNRTIDYEAAFALVW
QTDEDYAYNINDAEAYASCVRCGAVAVAYQVVFVIDNDETNDNVAAPQNL
AGALSYKCINCLTYALAQQLFVTLDEPLSPAAMAKLDAVWTDVAAYQQKI
EAGQVKLADIQGQLQGYTDQIKAIVEEDQPGTFMTSTAASTTSAPTTSAS
ASPSASATPTATVPTLTSSAPQPSTATASAESTATTEAPSTSTDPTTSAG
STSTVTTSDPSSSTDSTATSGSTSTGTTAGDTSSGGTTSDGTTSDGTTSG
GSAGSP
392417594YP_006454199.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMDIAISGAGVAGTALAYWLRRAGHRPTLIERAPSFRTGGYMIDFWGVGYQ
VTKRMGLEGRVRDGGYDIRSVRSVASDGATRAEVGVDVFRRIAGPDFTSL
PRGDLAAAIYQTVENDVETLFGESIVRIDEHPDCVRLEFEQASPRDFDLL
VGADGLHSNVRRIRFGPEDEFEHYLGCKVAACVVDGYRPRDDLTYVTYAT
TGRQVGRFALRGDRTMFLFVFRADRDGGGRTPRDELHAQFDDAGWECRQI
LAAADDVEDLYFDVVSQIKMASWSDGRVVLVGDAAACISLLGGEGTGLAI
TEAYALAGELTRAKGDHRRAFSAYETLLRGFVDDKQKGAQKMLGFFATET
RFGLWFRNVALRTMNHLPLAGLFARTVRDDIDLPEYEI
392417593YP_006454198.1 arginyl-tRNA synthetase [Mycobacterium chubuense NBB4]MTPADLAELLKSTAAAVLVEHGLDSAALPATVTVERPRNPEHGDYATNLA
LQLGKKVGANPRELAGWLAAALAHQNGIAAADVAGPGFVNLRIEASAQNV
IIDNVITAGPAYGNSAKLAGQRVNLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLSTQGAEVVREYYFNDHGAQIDRFTNSLIAAAKGEPTPEDGYAGTYI
GDIAAQVIAKEPDALNLPDAEMRETFRAIGVNLMFDHIKSSLHEFGTDFD
VFTHEDSMHTSGRVDQAIGKLRETGGIYEKDGAVWLRTTDFGDDKDRVVI
KSDGRPAYIAGDLAYFLDKRQRGFDLCIYMLGADHHGYIARLKAAAAALG
DDPDTVEVLIGQMVNLVRDGQPVRMSKRAGTVITLDDLVEAIGVDAARYA
LIRSSVDTPIDIDLALWSSASNENPVYYVQYAHARLSALARNAADLGIDA
STAHLDLLTHDKEGTLIRNLGEFPRVLDTAAALREPHRVSRYLEDLAGDY
HRFYDSCRVLPQGDEEPGDLHVARLALCEATRRVIANGLAILGVSAPERM
392417592YP_006454197.1 diaminopimelate decarboxylase [Mycobacterium chubuense NBB4]MIAHPAGPRHAEEVHHAGAPDRPDSAADVLRLAPNVWPQNAVRGDDGIVT
IAGVSVRDIAAEFGTPVFVIDEDDFRARCREISAAFGGGDHVRYAAKAFL
CTEIARWIDEEGLSLDVASGGELAVALHAGFPAERIALHGNNKSIAELTA
AVKAGIEHVVVDSTTEIDRLDEVARDAGTVQDVLIRVTVGVEAHTHEFIS
TAHEDQKFGLSLASGAAMDAVRRVFDADHLRLVGLHSHIGSQIFDVAGFE
LAAHRVIGLLRDVVAEFGVEKTSQMSIVDLGGGLGISYLPDDDPPPMADL
AAKLGAIVANECAAVGLPAPKLVVEPGRAIAGPGTITLYEVGTVKDVDVA
ADRNRRYVSVDGGMSDNIRTSLYGAEYDVRLLSRSSDAAPTMSRVVGKHC
ESGDIVVRDAWLPGDVTPGDLLGVAATGAYCYSMSSRYNLIGRPAVVAVR
DGRARLILRRETVDDLLSLEVR
392417591YP_006454196.1 homoserine dehydrogenase [Mycobacterium chubuense NBB4]MTETNGKHDGGHIGVAVLGLGNVGSQVVRIIEEDAADLTARIGAPLVVRG
IGVRNADRDRGVAPELLTDNIEALVSRDDVDIVVEVMGPVDPARKAILTA
LEHGKSVVTANKALMAVSAGELAQAAEHAHVDLYFEAAVAGAIPVIRPLT
QSLAGDTVLRVAGIVNGTTNYILSEMDSTGADYASALADASALGYAEADP
TADVEGYDAAAKAAILASIAFHTRVSADDVYREGITKVTAADFASARSLG
CTIKLLAICERLTDGDGQQRVSARVYPALVPLEHPLAAVNGAFNAVVVEA
EAAGRLMFYGQGAGGAPTASAVLGDLVMAARNRVQGGRGPRESKYAALPV
APIGVIPTRYYVNMNVADRPGVLSAVAAEFAKREVSIAEVRQEGMVDGGG
QRCGARIVVVTHRATDAALSETVAALADLEVVSSINSVLRMEGTSE
392417590YP_006454195.1 threonine synthase [Mycobacterium chubuense NBB4]MSTTAPRAVHQPWPGLIEAYRERLPVEDSWTPITLREGGTPLLPAPRLSE
YTGCTVHLKVEGLNPTGSFKDRGMTMAVTEAVARGQQAVLCASTGNTSAS
AAAYAARAGITCAVLVPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELA
RKLTADFPTVSLVNSVNPFRIEGQKTAAFEIIDALGEAPDIHALPVGNAG
NITAYWKGYTEYHRDGLTGRLPRMLGTQAAGAAPLVLGEPVSDPETIATA
IRIGSPASWTSAVEAQQQSGGRFLAATDEEILAAYHLVARAEGVFVEPAS
AASIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVD
PVAVVAKLGLV
392417589YP_006454194.1 homoserine kinase [Mycobacterium chubuense NBB4]MTRTLPTALTATAVVAASSANLGPGFDSMGLAVSLYDEIIVETTESGLIV
EVEGEGAGQVPLDANHLVVRAIERGLRETAVSAAGLIVRCRNDIPHSRGL
GSSAAAVVGGLAAANGLAAQAGASPMTAERLIQVSSEFEGHPDNAAAAVL
GGAVVSWTEAGAGEARFAAAPIRLHPDINLFTAVPQVRSSTAETRILLPE
WVSHADARFNLSRAALLVVALTERPDLLMAATEDVLHQPQRAAAMPASAE
YLAVLRRCGVPAVLSGAGPAVLALSTRAELPAEALEFGSRNGFATARMAV
GDAVKWTSGVTVRS
392417588YP_006454193.1 transcription termination factor Rho [Mycobacterium chubuense NBB4]MTETDLITAGGSAGSGELPNPVTGDISSPAAPAAPAAPAATAVADDAPAA
PSRRGALSSMVLPELRALAKEIGVEGASGMRKSELIAAIRERRGEKNGSS
AETAAAPAESAPSAAAPEQATSEAQPARQRRERRSASREQGQASEQDQNQ
ARDQAKDNASAADDSKAGGAKPEGAEAPAEASGGGRDRNADRGRQGNRDG
GDTRDQDRAEKTSDNRGDQNQGGRANQNNTGGNGGGRGADNNGGGRGADN
DDDGEGRQGRRGRRFRDRRRRERGDNAGGGDRDTELREDDVVQPVAGILD
VLDNYAFVRTSGYLAGPNDVYVSMNMVRKNGLRRGDAVTGAVRVPRENDG
GDKNPRQKFNPLVRLDTVNGKPVEEAKKRPEFTKLTPLYPNQRLRLETSG
DKLTTRVIDLIMPIGKGQRALIVSPPKAGKTTIMQDIANAITRNNPECHL
MVVLVDERPEEVTDMQRSVKGEVIASTFDRPPSDHTQAAELAIERAKRLV
EQGKDVVVLLDSITRLGRAYNNASPASGRILSGGVDSTALYPPKRFLGAA
RNIEEGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERRV
FPAVDVNPSGTRKDELLLSPDEFAIVHKLRRVMSGLDPHQAIDLLMSQLR
KTKNNYEFLVQVSKNTPGGADVD
392417587YP_006454192.1 transcriptional regulator [Mycobacterium chubuense NBB4]MADEPSTAVLMFIAHRDVESRVMAALARAGVADLTIAQSRVMQRLDPAGS
RLTDLAEQARITKQTAGALVDQLERAGYVTRKPDPTDARARLVTLTERGG
EVCRMAAAEVAQVEIEWRKHLGDNSFDALRGALISLREITDPYR
392417586YP_006454191.1 hypothetical protein Mycch_3784 [Mycobacterium chubuense NBB4]MDADAVWHHTDTQRLEIAGLIGEIEARDPALWDTPSLCAGWTVRNVAAHL
THSTIGMPRMLFEAARSGFRFNAAVDRMARADDRTAAEIAANLRDVVGSR
RRPPGATEREPLIDVLVHAQDICIPLGIDRPMPVDAARAAAERVWDMGFP
FHARKRLAGVRLVASDADFAVGEGKELRAPVRDVLLMLTGRQAAVAAAW
392417585YP_006454190.1 transcriptional regulator [Mycobacterium chubuense NBB4]MGTASKSEASPPVKSVRDRLIDAAEQCLTAKGIRATTVSEVAELAGVSRG
WLYRHFPDKAELLGAAIVRLNDAFWTESRARLDAITELEQKIATGVALAR
RESETPGALVLKLRQEEPEAFTACVGLGVRGLIPEIAAFWEPYVRAAVDR
GEIHPDTDCAEAAEWIARIMMSLATVPGEHCDVDDPESVLRHARRYIVAA
LRCEPA
392417584YP_006454189.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMAETVQQLLRDLCSDDGIAVTYEGRTWTWREHLGAAAAQAAALIGIADPD
RPLHVGVLLGNTPDMLTAMAAAGLGGYVVCGINNTRRGDALVRDIRRADC
QILITNDTHLGLLNGLDLADVRLLVVGSPEWKELTAQAGALTPHREVTAT
DTFMLIFTSGTSGDPKAVKMMHAMVLLAGAALAARYELTSDDVCYLSMPL
FHSNAVLAGWSVALNSGAAMAPAQFTASRFIDDVRRYGVTYMNYVGKPLA
YILAGPERDDDSDNPLRVAFGNEASDRDIAEFARRFGCEVWDGFGSTENA
VTVTREDGCPAGSIGRGFPGVAIYNSETLTECAVAQFDAHGALVNADDAI
GELVNTQGAGMFAGYYNDQGATDERMRHGMFWSGDLAYRDADGWIYLAGR
TADWMRVDGENMTSAPIERILIRQRAVSQVAVYPVPDEHVGDQVMAAIVL
ADEATLTPEEFGEFLAGQPDLSPKAWPRHVWIADALPSTATNKVLKREMI
AMGTNPEGRLLWTRDGRTYRIVSGEE
392417583YP_006454188.1 LSU ribosomal protein L31P [Mycobacterium chubuense NBB4]MKSGIHPDYVETTVLCGCGASFTTRSTKQSGQITVEVCSQCHPFYTGKQK
ILDSGGRVARFEKRYGKRKPAADK
392417582YP_006454187.1 bacterial peptide chain release factor 1 (bRF-1) [Mycobacterium chuMTETAPAIDAILAEHAELEQRLSDPELHADPVAARKAGRRFAQLSPIVAT
YRKLDTARGDLEAARELAADDSSFAEEVDELASTVADLDTHLTDLLAPRD
PHDADDIVLEVKSGEGGEESALFAADLARMYTRYAERHGWTVTMLDETTS
DLGGFKDATLSIRSKGDSADGVWSRLKFEGGVHRVQRVPVTESQGRVHTS
AAGVLVYPEPEEVEQVQIDESDLRIDVYRSSGKGGQGVNTTDSAVRITHL
PTGIVVTCQNERSQLQNKIRAMQVLAARLQALAEEQASAEASADRASQIR
TVDRSERIRTYNFPENRIADHRINFKAHNLDQVLDGDLDALFDALAAADK
QARLQSTS
392417581YP_006454186.1 protein-(glutamine-N5) methyltransferase- release factor-specific [MSVANRPATMRQMIDAATDELAAAGVASPRTDAELLAAHVAGTDRGRVVF
ADPDADFGDRYRQLIARRAERIPLQHLTGTAAFGPVTVHVGPGVFVPRPE
TESLLEWALTRPLPDRPVIVDLCTGSGALALALSTARPNATVLAVDDSDD
ALAYARRNLAGTPVELVRADVTDNGLLGEWDGAVDLLVANPPYIPAATEL
EHEVAQHDPAHALFGGDDGMAVIDRIAPVAGRLLRPGGCCAVEHDDTTAD
RTVEAFTRTGAFVDVTARCDLAGRPRFVTAVRRSDRGGEDRA
392417580YP_006454185.1 translation factor SUA5 [Mycobacterium chubuense NBB4]MSELFDCSDPGQREAGIASAISALKGGRLVVMPTDTVYGIGANAFDNEAV
AALLAAKGRGRDMPVPVLVGSWHTIQGLVYSVPQSAKELIRAFWPGALSL
VVHQAPSLQWDLGDANGTVMLRMPLHPVAIELLREVGPMAVSSANISGRP
ASVTAAQARDQLADLVEVYLDGGPAERQAASTIVDLTGAHPRVLRQGPVS
AEAIAGVLGVDPETLTATP
392417579YP_006454184.1 UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylgluMHPVVSDVQYMAGGLLALSDRGAGVPLRELALVGLTAAIITYLATGWVRV
LAMRWGAVAYPRERDVHSKPTPRMGGLAMYLGVLAAVLLASQLPALTRGF
VYSSGMPAVVVAGGLIMVVGLIDDRWGLDALTKFAGQITAASVLVTMGVA
WSVLYIPIGGVGTIVLDQVASILLTLALTVAIVNAMNFVDGLDGLAAGLG
LITASAICIFSVGLLRDHGGDVLFYPPAVISVVLAGACLGFLPHNFHKAR
IFMGDSGSMLIGLMLAAASTTAAGPISQTAYGVRDVFALLSPFLLVVAVM
FVPALDMLLAIIRRTRAGLSPFSPDKMHLHHRLLEIGHSHRRVVLLIYLW
VGIVALGAASTIFFDPRYTAAVMVGAIVVAVVVTLIPLLRRRDGVVDEVY
DKK
392417578YP_006454183.1 ATP synthase I chain [Mycobacterium chubuense NBB4]MTTPAQDAPLVFPSVAFRPVRLLVLCVALTAVVTAVAALVGYPLFGLFFG
VGMALGLLNALLVRRAVNAITAQDHPLKKKMALNSASRLLAITVVGLTIA
FLFRPMGLGVLFGLALFQVVLVLSTSLPVLKKLRAGDGDQGPAATTDSST
SNDG
392417577YP_006454182.1 F0F1-type ATP synthase- alpha subunit [Mycobacterium chubuense NBB4MTESVLALEVGHHLEQKWFGLTVNVDTVLSTAIAGVIVIALAFFLRAKVT
STGVPGGVQLFFEAITIQMRNQVESAIGMRIAPFVLPLAVALFCFILFAN
WLSVLPVQYTDSHGVTTELIKPPASDINFVLALALFVFLCYHLAGIWRRG
IVGHPIKVAKGHVAFLAPINIVEEIAKPISLSLRLFGNIFAGGIMVGLIA
LFPAWILWLPNAIWKSFDLFIGLIQAFIFALLTILYFGQSMELDHDAEHD
KDHAESSTAEQH
392417576YP_006454181.1 ATP synthase F0 subcomplex C subunit [Mycobacterium chubuense NBB4]MNPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGIARQPEAQGRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
392417575YP_006454180.1 F0F1-type ATP synthase- beta subunit [Mycobacterium chubuense NBB4]MPDPNVVYLAAEGEGGGTSNFLVPNGTFFFVLLIFLIVLGVIWKWVVPPV
SKVLAEREAMLAKTAADNRKAAEQVAAAQADYDETMAGARGEASSIRDEA
RAEGRKAVDEARAEAGGEVSDRLQSANTDLQQKASATSSELESSVDGLSA
TLASRILGVDVNDTSSGRR
392417574YP_006454179.1 ATP synthase- F0 subunit b/ATP synthase- F1 delta subunit [MycobactMSTFIGQLVGFAIIVFIVVKWVVPPVRTLMKNQQDAVRAALEESKSAAEK
LASADKMHEKAVEDAKAEGARLTEEARHDSTRIAEQLREQAASEAERIKS
QGEQQIHLLRQQTIRELRQNLGLESVQKAEEIVRNYVSDPQAQSATVDRF
LDHLDEMAPSPAVLEAGATLNLRAASREALAEVVKKFDSVADGADADTLS
TLADNLAAVAKLLIKQPALNNVLAEASDESDAKVALAERLFQGKVDDATL
DLLKTAVTQRWSSEGNLVDALEHVARLALLVRAERDGQAEEVEEQLFRVG
RVLDSESRLNRLLSDPTVDADKRVGLLDKVLQSGGGVNATTTALLAQTVE
LLRGGLADAAVSDLAELAVTRRGEAVAEVTAATELSDEQRTRLTQVLSRI
YGTEVSVQLNVDPDLLGGLLITVGDEVIDGSISSRLAAARTGLPD
392417573YP_006454178.1 ATP synthase F1 subcomplex alpha subunit [Mycobacterium chubuense NMAELTISASDIEGAIEDYVSSFTADSDREEVGVVIDAGDGIAHVEGLPSV
MTQELLEFPGGVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSV
PVGDAFLGRVINPLGQPIDGQGDIESDTRRALELQAPSVVQRQGVSEPLQ
TGIKAIDSQTPIGRGQRQLIIGDRKTGKTAVCVDTILNQREAWETGDPSK
QVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPASDAAGFKWLAP
YTGSAIGQHWMYDGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD
VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITD
GQCFLESDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLELSQY
RELESFAAFASDLDPASKAQLDRGARLVELLKQPAYTPYPVEDQVIAIFL
GTGGHLDSVPVEDVARFEQELLEHVKGSHSEILENIRESKKFPEEEQEKL
TGIINEFKKGFSASDGSSVAVNEHEAEAMDEEDVEKESVKVRKPAPKK
392417572YP_006454177.1 ATP synthase F1 subcomplex gamma subunit [Mycobacterium chubuense NMAATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYSTEI
TNMLTELASASALDHPLLVARENPRRAAVLVVSSDRGLCGAYNANVLRQA
EELFSLLREEGKDPVLYAVGRKALGFYNFRQRNVIESWTGFSERPTYEQA
REIADTLVAAFMSGADDEGDDAGADGVLGVDELHIVFTEFKSMLSQSAAA
RRIAPMVVEYVEDETPEDGPRTLFSFEPNAETLFDALLPRYVATRVYAAL
LEAAASESAARRRAMKSATDNADDLIKSLTLAANRERQAQITQEISEIVG
GANALADAK
392417571YP_006454176.1 ATP synthase- F1 beta subunit [Mycobacterium chubuense NBB4]MSAPAKDKETTGRVVRITGPVVDVEFPRGAVPELFNALHADISYKELSKT
LTLEVAQHLGDNLVRTISMQPTDGLVRGVEVTDTGDSISVPVGDGVKGHV
FNALGDCLDEPGYGKDFEHWSIHRKPPAFSELEPRTEMLETGLKVVDLLT
PYVRGGKIALFGGAGVGKTVLIQEMINRIARNFGGTSVFAGVGERTREGN
DLWVELEDANVLKDTALVFGQMDEPPGTRMRVALSALTMAEFFRDEQGQD
VLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGELQERITSTR
GKSITSMQAVYVPADDYTDPAPATTFAHLDATTELSRTVFSKGIFPAVDP
LASSSTILDPSVVGDEHYRVAQEVIRILQRYKDLQDIIAILGIDELAEED
KQLVQRARRIERFLSQNMMAAEQFTGQPGSTVPLKETIEAFDKLTKGDFD
HLPEQAFFLIGGLDDLAKKAESLGAKL
392417570YP_006454175.1 ATP synthase- F1 epsilon subunit [Mycobacterium chubuense NBB4]MAEMNVEIVAVERELWKGEATFVFTRTTAGEIGILPRHIPLVAQLVDDAM
VRVEREGEDDLRIAVDGGFLSVTDEAVRILVENAQLESEINADEAKQDSE
SDDERTAAWGRARLRALGQLD
392417569YP_006454174.1 Protein of unknown function (DUF2550) [Mycobacterium chubuense NBB4MSASMLFMVALVGVLLLAVIALSYRLWKLRQVGGTAAILRDVPAVGGHGW
RHGVMRYRGGEAGFYRLSSLRWWPDRTLSRRGLEIVSRRSPRGDEFDIMT
DEIVVLELRDAGPDRGRGYEIALDRGALTAFTSWLESRPSPRARRRTY
392417568YP_006454173.1 ATP:cob(I)alamin adenosyltransferase [Mycobacterium chubuense NBB4]MAVHLTRIYTRTGDDGTTGLSDFSRVSKNDARLAAYADCDETNAAIGVAV
ALGNPDERLLAVLRQIQNDLFDAGADLSTPVVDDPEYPPLRVPQSYIDRL
EKWCDEFNEPLPALNSFILPGGTPLSALLHVARTVARRAERSAWHAVETH
GDSISVLPAKYLNRLSDLLFILSRVANPQGDVLWRPGGQAQ
392417567YP_006454172.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Mycobacterium chMVTGGNRLSGEVAVGGAKNSVLKLMAASLLAEGTSTITNCPDILDVPLMA
EVLRGLGATVELDGDIVRITSPDEPKYDADFAAVRQFRASVCVLGPLVGR
CKRAKVALPGGDAIGSRPLDMHQSGLRQLGARCNIEHGCVVAEADHLHGA
EIQLEFPSVGATENILMAAVLADGVTIIHNAAREPDVVDLCTMLNQMGAQ
VAGAGSSTLIITGVDRLYPTEHRVIGDRIVAATWGIAAAMTRGDISVTGV
DPAHLQLVLHKLHDAGATVTQSDDGFRVVQYERPKAVNVATLPFPGFPTD
LQPMAIGLAAIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVR
GIPQLSSAPVWSSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYPKFVEN
LVGLGAEIERVQ
392417566YP_006454171.1 O-6-methylguanine DNA methyltransferase [Mycobacterium chubuense NBMETTRYRTTDSPIGTLTLAGVDGRLRHLRMDDQTYEPDRGGWEPDDDAFG
DAIVQLEEYFRGVRREFDLELDLVGTPFQRRVWEALLTIPYGETRSYGEI
AEHIGAPGAFRAVGMANGHNPVGIIVPCHRVIGANGSLTGYGGGIDRKKK
LLGLEKSNSFAAVPTLFD
392417565YP_006454170.1 adenosine deaminase [Mycobacterium chubuense NBB4]MHTDFDRCHRAVQAKDARFDGWFVTAVLTTKIYCRPSCPVRPPFARNMRF
YPTAAAAQRAGFRACKRCRPDASPGSPEWNVRGDVVARAMRLIADGTVDR
EGVTGLAARLGYTVRQLERLMQSEVGATPLAVARAQRAQMARVLIETTEM
PFSDAAFAAGFASIRQFNDTVRTVCDLTPTMLRSRAQARRGREGVSGTGV
MSLRLAVRAPFAYDGLFGHLAASAVPGVEEFRDGAYRRTLRLPHGSGIVA
LTPQPDHVRCRVVVDDFRDLSAAIARSRRLLDLDADPEAIVDALSADDDL
AALIAKAPGQRIPRTVDEHELAIRVVLGQQVSTAAARTHAGRLAAAYGGT
VHDAEGALTHVFPSVTELAEIDPVHLAFPRSRQRSLTALISALLDGTVLL
DAGCDWHAARAQLLALPGIGPWSTEMIAMRGLGDPDAFPVTDLGVSLAAR
QLGLPSGPAQLTARGERWRPWRSYATQHLWTALDHAVNQWPPKEK
392417564YP_006454169.1 hypothetical protein Mycch_3759 [Mycobacterium chubuense NBB4]MTNRDSVAGDIPDTGIPGPMAAEMSMAEQYDWHRSYLHRHPVSRRNFLLG
SAALAGVAAAGVSPFGRRAYAQDAPLTVANRRVGFGTEASSQLRLAAQLS
RNPHSRKVFVDHGPTSALGATVEAQVRNLVTQIPDSDGSVLAAEQFYVHA
PLDGLAARAPHFYRWRTDDGFVSDVRSAATAMPAGRSATAPFRFTMMGDQ
GTDTTPLVPPGLAPGDYDDRYYTPDDDPAVSHTDNVLNQIIASHPDFHVL
AGDIAYADPSGMGRPPTFVRSGGHLPSGFDKFNPYVWDVYLASIEASAST
TPWMFATGNHDMEAAYPSHGYGGHLARLDFPGNGPAPCPSVYSFVYGNVA
VLSLDANDVSHEITANTGYSGGAQTSWVERTLATHRSNPDIDFIVCFFHH
CAYSTVETHASDGGVRDAWCALFDRYRVDLVLQGHNHAFERSDPIRAGRP
TTAAADYATVHPDTDGTVYYTVGSGGRPRYRFAAGEAQSYRGHEAADTVV
PNSYVWTSDGHRQPEAVGWSRVRFLDYAFIRVDVRPGALISEMDVTAVDE
YGREFDTLTFRRQVRA
392417563YP_006454168.1 transcriptional regulator [Mycobacterium chubuense NBB4]MDIDFTRLRYFVAVADELHFKRAADKLMITPPPLSKQIKLLENELGGALF
ERGYRDVRLTPLGQRLVGPAREILRQVEDFKVVAARGIRGLAPIRVGATA
YAPSDLLAELESALAGLPGPTEFSVPGSAAEVTAKLIAGHIELGLIHLPA
SDRRLRHRVVASYQGGIAVRFDDPLAARDVVSIEELRDREVAIDFARPNP
MVLAGLTRRLNRRGIHRIVRTTNQRGGEVEMATQVLNRQLVAIVSYAPDS
FIGKIFSPPEFKLIPVDESTWAPADIALAWVPERLRERLADVDRMVEQIA
ERLGPVHRGAQG
392417562YP_006454167.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MPDAAYDPPLRGTRILDLTSGPMTAVGRLFADLGAHVTVLRLDGVTDDEA
AGPCIDGVPIQTAINRHGMATIELDPATEPGRRRFEDLLADTDILIENTP
PGSPGEAALAVRDLRTRHASLVILSISDFGRDTDYRTWQGTGPVFHALSS
ELSRSGIPGREPLIPPAELPYQVAAAQAAVMTLAVYLDRLRTSEGDLIDF
SVLEGAMQTLDPPFGSAGSASAGVAVSAQQRDWNAEQMRYPIIACRDGHV
RICILSKRQWRGMFTWMGSPEEFADPSYDKLGKRFRSPDLIAAINRFCAD
KTRAELEAQGQARGVPTAAVLTLSEALNAEHFAARGFFRDVELAPGVVAP
IPVGVSEIDGCRASALDVSRSDAPRPAAAPLLAGRRRHGQGLPLEGLRVL
DLGVIVVGADSARLFGDLGADVVKIEHSAHPDGLRVGKPTSMTQPFAAGH
RNKRSIGIDMRTDEGRELAHRLVKVSDVVLTNYKPGVAEALGMDYATLRR
INPHIVVVDSSAFGPTGPWADRLGYGPLVRAAVGFTNLWVYPDEPETFCD
TVTVYPDHVAARIGALNALALLVRRERTGAGGSVSISQAEVMLSHLAADI
AADALQRAGHTRSDEAERDGPWGLFPAAGEGAWIAITARDDADRRALREV
MGIAEAAPLDAEAVRAWTLRHSRVGAMDLLQAAGVPAGAVLHADELPRWS
LYEQRRSFRDELHPHGAVPFTIENVQIHCDHVADPPLGQAPLLGEQTAEI
AAELLGLDPAQIDALHERGVLETPESEAAARV
392417561YP_006454166.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTTAALPSADELRTEVREWLRDNWTPLPKATDPWASSPERIAWLEKVLDA
GYAVPTYPTEWFGRGYPNDLAAVIAQEFSAIKAPGSRQDKYNIPANTTLR
LGSDRLKQDLLRDFLIERSRTCLLYSEPGAGSDLAGVRTTAVRHGDRWVV
NGQKVWTSGAQTADYALLLARTDWDVPKHKGLSLFVLPMKQPGIEVRPLV
QITGESHFNEVFISDAEVSDEYLLGGEGNGWRALQTALAYERSIMGDSGR
SSRNKRADDLIALARDHGVLDDAAVRDRLATVLAMRELNRLNNARAKAAT
TQGTSSSIMSLGKLAMSRILHTEAAMKTQIIGAQALLSGPENPEADDVNF
LTLNAFFTSIGGGTDQIQRNIIGERVLGLPKEPEADRDIPFRQARRS
392417560YP_006454165.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTISVAERAELRTAVGALLAEKCSEDDVRRAMASDEGFDRDLWRQLAEQG
VVGMLVGADHGGLGFGALESEAVAEETGAALLPAPFVSSAVLTVALINAA
GSDDDKQRLLPGLADGSAIGTVAVTGPSGSWTPEGVDVRADADGRLTGTA
HYVTWGQVADVVLVVARTASGIAVFEVAPDAPGFQRCAVTVFDPTVRLST
YTFTATPGRRLGTAGWEAVQEALDHAIIASAGEHVGGARRLFDMTVEYLK
TRIQFGRQIGSFQALKHMAADLLLDVESATSAARHAAAEKAAASENAIGA
TALAGFACAEAYQNISMQAIQMHGGIGFTWEHPAHLFLRRARTGMQLFGG
ARLHRERYLVSKGA
392417559YP_006454164.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MTANRTAAQRLGRVLERVTHQSGRVAGTPEYGSWILGRVSESQRRRRVRI
QIILTTFVVVANLIGIGVATLVVTIAFPIPNVFGSSVAWITFIVVPAYLV
AALVVGVFWATRRVMNNVRWAIEERQPTREDQRNTFLAPWRLTRVLLVLW
GLGTVVLTTLYGLRDTDFIPKWLLGVSFPGIVVSASCYLFTEFALRPVAA
QALEAGKPPRRIADGLMGRTMLVWVLGSGVPVVGIFLAAAITLMQRNLTP
TQFTVAVMILALFALVFGAILMFILAWLTVTPVRVVREALNRVEQGDLDT
NLVVFDGTELGQLQRGFNSMVRGLQERERVRDLFGRHVGREVALLAEQAR
PKLGGEERYAAVVFVDIIGSTKLVTSLPAVEVVELLNRFFAVIVEEVDRH
HGLVNKFEGDAVLAVFGAPVSLEHPEDEALAAAREIARRLCDEVPECEAG
IGVAAGTVVAGNVGARERFEYTVIGEPVNEAARLCELAKDEPQRLVASSA
AIGKATETERSRWTLGESVTLRGHDEPTQLATPVDAG
392417558YP_006454163.1 putative nuclease of the RecB family [Mycobacterium chubuense NBB4]MRLVIAQCTVDYVGRLTAHLPSARRLLLIKADGSVSVHADDRAYKPLNWM
SPPCWLNEELDGDAPVWVVENKAGEQLRITVEGVEHDSSHELGLDPGLVK
DGVEAHLQALLAEHVELLGAGYTLVRREYMTPIGPVDLLCRDEQGRSVAV
EIKRRGEIDGVEQLTRYLELLNRDTLLAPVAGVFAAQQIKPQARTLAVDR
GIRCLTLDYDKMRGMDSDEYRLF
392417557YP_006454162.1 hypothetical protein Mycch_3752 [Mycobacterium chubuense NBB4]MPRRRATGRRGRRLPGADPLPASRRVEVGADGYDYEVRPVAAARAAKTYR
CPGCDQEIKPGTAHVVVWPADSDLASGTVDDRRHWHTPCWTHRATRGPTR
RWS
392417556YP_006454161.1 methylmalonyl-CoA epimerase [Mycobacterium chubuense NBB4]MTAEQTDARPVLATALVTAIDHVGIAVPDLDAAIKWYHDHLGMIVLHEEV
NDEQGIREAMLSVRGAPVGSTQIQLMAPIDDSSTIAKFLDKRGPGLQQFA
YRVSDLDTLSARLREQGVRLIYDAPRRGTANSRINFIHPKDGGGVLIELV
EPAEGSGSTH
392417555YP_006454160.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MTTSVIVAGARTPVGKLMGSLKDFSGSDLGAVAIAGALEKANVPASAVEY
VIMGQVLTAGAGQMPARQAAVAAGIGWDVPSLTINKMCLSGIDAIALADQ
LIRAGEFEVVVAGGQESMTKAPHLLMDSRAGYKYGDVTVLDHMAYDGLHD
VFTDQPMGALTEQRNDVDQFTRAEQDEFAAGSHQKAARAWKDGVFADEVV
PVKIPQRKGDPIEFTEDEGIRADTTSESLAGLRPAFRKDGTITAGSASQI
SDGACAVVVMSKAKAEEMGLSWLCEIGAHGVVAGPDSTLQSQPANAIKKA
IAKEGISTDQLDVIEINEAFAAVALASTKELGVDPERVNVNGGAIAVGHP
IGMSGARITLHAALELARRGGGYAVAALCGAGGQGDALILRRP
392417554YP_006454159.1 integral membrane protein [Mycobacterium chubuense NBB4]MAVMASTFDVRSAPAWFRLIAFAEALSWVGLLIGMYFKYLGTPATEIGVK
VFGPVHGAIFIAFVVAAVLTGIRFTWGPVTWLLALLGSIVPLGSVIFLIW
ADRAGRMGSATAAPALGRPGRTVPEKT
392417553YP_006454158.1 thioredoxin domain-containing protein [Mycobacterium chubuense NBB4MTRPRPPIAPAMAGAVDLSALKQRAAAGDSAPAAAPGGVEITEANFEAEV
LVRSNEVPVVVLLWSPRSDSSAQLAEVLSGLAEADGPKWSLAAVNVDAVP
RVAQMFGVQAVPTVVALAAGQPLSSFQGMQPPEQLRRWIDSLLDATAGKL
SGAGDADDQEQVDPQVEQARAHLDRGEFDAALAAYQAILDANPNHVEAKG
AVRQIGFLQRATTHPQDAVDVADATPDDIDAAFAAADVEILQQNVTGAFA
RLTALVKRTAGDDRTRVRTRLIELFDLFDPADPEVIAGRRNLANALY
392417552YP_006454157.1 alpha-1-4-glucan:alpha-1-4-glucan 6-glycosyltransferase [MycobacterMTKASKASKATKASKATKMTDSPHLRPHTADVNRLLAGEHHDPHSVLGAH
EFDDHTVIRAYRPHAVEVAALIGGTRYPFQHIEAGLFAVAVPFTDLVDYR
LEIKYSDDSDFVHTVADAYRFLPTLGEMDLHLFSEGRHERLWEVLGAHPR
SFTTPDGVVEGVSFAVWAPNAKGVSIIGDFNNWGGNEAQLRALGSTGVWE
LFWPSFPVDGLYKFRVHGADGVVTERADPMAFATEVPPHTASRVTHSDYT
WSDDEWMTGRPLRNPVFEPMSTYEVHLGSWRPGLSYTELADELTRYVVEH
GFTHVEMLPVAEHPFGGSWGYQVTSYYAPSSRFGTPDEFRYLVDRLHRAG
IGVLVDWVPAHFPKDAWALGRFDGTPLYEHADPRRGEQLDWGTYVFDFGR
AEVRNFLVANALYWLQEFHIDGLRVDAVASMLYLDYSRPEGGWTPNVYGG
RENLEAVQFLQEMNATVHKINPGIVTIAEESTSWPGVTRPTNLGGLGFSM
KWNMGWMNDTLEFIKRDPIHRSYHHHEITFSMLYAFSENYVLPISHDEVV
HGKGTLWGRMPGSDHMKAAGIRGLLAYQWAHPGKQLLFMGQEFGQRAEWS
EERGVDWYQLEEQGFSDGILRMLTDTNAIYRSRRALWSRDTKPEGYSWID
ANDSANNVLSFLRFGDDGSMMACVFNFSGSEHSRYRLGLPHAGTWREVLN
TDSDSYHGSGIGNYGAVEATDEPWHGRPASAVMVLPPLAALWFEPERP
392417551YP_006454156.1 glycosidase [Mycobacterium chubuense NBB4]MTAGRIEIDDVAPVVSGGRFPAKAVVGEVVPVSATVWREGHDAVAATLVV
RYHGSAYPPLADEPPGRTRPPEPVPIQEVVSPAQRVKPLTLPMEQGRTPD
VFHGQFCPDAVGLWTFRVDGWSDPLATWRHHVIAKLDAGQSEGELSNDLL
IGAKLLERAATGLPRQDRYPLIEAAARLREPGDPFYRAGAALAADVTELI
EQYPLRELVTRGGQYGIWVDRPLARFSAWYEFFPRSTGGWDSAGHPVHGT
FATATKALPRVARMGFDIAYLPPIHPIGKVHRKGPNNSVTAGPHDVGSPW
AIGSDEGGHDAVHPALGTIDDFDDFVAAARDEGLEVALDLALQCAPDHPW
AKEHPEWFTVLPDGTIAYAENPPKKYQDIYPLNFDNDPAGLYEEVLRVVR
HWISHGVKIFRVDNPHTKPPNFWAWLIGEVKNTDPDVLFLSEAFTRPARL
YGLAKLGFTQSYTYFTWRTAKWEITEFGEQIAEHADYCRQSLWPNTPDIL
HEILQHGGPGMFAIRAVLAATLSPTWGMYSGFELYEHRAVREGSEEYLNS
EKYELRPRDFDAAVADGESLEPFITRLNEIRRLHPALQQSRTITFHHVDN
DALLAYSKFDPASGDQVLVVVTLNAFGPEEGTLWLDMSALGMDQQDRFWV
RDEITGDEYQWGQGNYVRLEPARAVAHVINMPQVPADQRMNLLRRE
392417550YP_006454155.1 alpha-glucan phosphorylase [Mycobacterium chubuense NBB4]MKALRRFTVRAHLPERLAALERLSVNLRWSWDKPTQDLFESIDPELWRLV
GSDPVGLLGQVGPARLEDLSRDEAFVSRLDALAADLDNYLTRPLWYQELA
DENGQEAALPNGIAYFSMEFGVAEVLPNYSGGLGILAGDHLKSASDLGLP
LIAVGLYYRSGYFRQSLTADGWQHETYPSLDPQGLPLRLLTDAGGAPVLI
DLALPQNATLHARVWIAQVGRIPLLLLDSDIPENDHDLRGVTDRLYGGDQ
EHRIKQELLAGIGGVRAIRAFTDSEGLPAPEVFHMNEGHAGFLGVERIRE
LIEAGLDFDTALTVVRSSTVFTTHTPVPAGIDRFPVEMVERYFGSDPGGV
GTRLLPGVPLDRIVAFGAEDDPSKFNMAHMGLRLAQRANGVSLLHGQVSR
EMFNDLWPGFDPAEVPIGSITNGVHAPTWAAPQWLELGRELIGSADLSSL
SEPHVWERLQQVDPGHMWWIRSQLREELIEDVRARLRRSWLERGASDAEL
GWIATAFDPGVLTIGFARRVPTYKRLTLMLRDAERLARLLLDDERPIQLI
VAGKSHPADDGGKALIQQVVRFADRPDLRHRIAFLPDYDMSMARKLYHGC
DVWLNNPLRPLEACGTSGMKSALNGGLNLSIRDGWWDEWYDGENGWEIPT
ANGLADEARRDDIEAAALYDLLENAVAPKFYDRDERGVPMRWVEMVRHTL
QVLGPKVLASRMVRDYTQKYYLPAARALRESIEPGTGARYNVPFGAAREL
AEYRQRVEKIWPQIEITDVDSSGLPDTPLLGSQLTLTALVNLAGLRPSEV
SVQAVLGRVDAGDTLLNPMTVPMTHTGTADSGQDVFTAVTPLPVTGSVGY
TVRVLPHHRLLAEDSELGLVALA
392417549YP_006454154.1 putative metalloprotease [Mycobacterium chubuense NBB4]MSPSVRARHVVGGAIAACAMLLTACSTTLQGHAVSVFDDPFSVAGMPATD
GPTGLRPNAEGPARDIQGTDGGEIDELAGGAVSDIEAYWETAFPESFNEG
FTPVKALVSWDANGYGGGQFCDEDTFGLVNAAYCYSDKTIGWDRGGLLPG
LRRAHGDMGVVMVLAHEYGHSVSRQAGLTRQGTPTLVSEQQADCLAGAYM
RWVAENNSKRFTLSTGDGLNNVLAGVVAFRDPLVTEGDPEAGYDEHGSAF
ERVSAFQFGFTDGPAACAGIDMREIGQRRGNLPVLLPEDQTGELPVDEAS
VRSIVDAMGILFSPKNPPVLSFDAAAAGSCADARPSPPASFCPATNTIVV
DLPALQKMGAPPDQTRADTLASGDNVAYSVLVSRYMQAIQHEHGGVALDN
AEAALRTACLTGVATVKLSKEVTTPDGNTIALTAGDVDEAVSGILTNGLA
ASDVNGESVPSGFSRIDAFRVGVLGDAERCYKRFP
392417548YP_006454153.1 DNA helicase- Rad3 [Mycobacterium chubuense NBB4]MSDVADLLATAVAALGGAQRDGQVAMAEAVAQAFDTGEHLAVQAGTGTGK
SLAYLVPAIARALRDDRPVVVSTATIALQRQLVDRDLPRLADSLSSALPR
RPDFALLKGRGNYLCLNKIHNGSAEPDDRPQEELFAPMASSALGRDVARL
TEWSSATQTGDRDELTPGVPDRSWSQVSVSARECIGVSRCPFGTDCFAER
ARDRAAAADVVVTNHALLAIDAIGDANVLPEHDLLIVDEAHELVDRVTSV
ATAELSPTSLGVAQRRAARIIGPELAERLEAAATTFTSAIFDARPGRIDV
LDEEMASYLTVLRDAASTARTAVDTAPSDPKTTSARAEAATSLADVAETA
ARILAAFVPAIPDRTDVVWLEQTEDRSGSRTVLRVAPLSVAGLLRSRLFG
HATSVLTSATLTVGGNFDAMASAWGLAAGGDGPDSEIGWRGLDVGSPFDH
ARSGILYVAAHLPPPGRDGTGSAEQLDEIASLIEAADGRTLGLFSSMRAA
RATAEVMRERLDTPVLCQGEDTTSALVARFADDERTSLFGTLSLWQGVDV
PGPSLSLVLIDRIPFPRPDDPLLTARQRAVAARGGNGFMAVAASHAALLL
AQGAGRLLRRVDDRGVVAVLDSRMATAGYSGFLRASLPPFWATTDGASVR
AALQRLRTPR
392417547YP_006454152.1 putative nicotinate phosphoribosyltransferase [Mycobacterium chubueMTSPSPGLSPALLTDKYELTMLAAALRDGSAHRRTTFEVFARRLPDGRRY
GVTAGAGRFVEALAHFRFDDTAMGSLDFLDDETRAYLADYRFTGDVDGYP
EGELYFPGSPVLSVHGTFAECVVLETLALSVFNHDTAVASAAARMVSAAE
GRPLIEMGSRRTHEQAAVAAARAAYLAGFTGSSNLEAQRRYRVPALGTSA
HAFTLLHTVGTDGPQRHSEWEKAAFRAQIDALGVGTTLLVDTYDITAGVA
NAVEVAGPQLGAVRIDSGDLGVLARQVRDQLDSLGATSTRIVVSGDLDEF
AIAALRAEPVDIYGVGTSVVTGSGAPTASMVYKLVEVDGVPVEKRSSRKE
SHGGRKQALRLAKQSGTIVEEVVFPVGAPPPSPSDLVERTLTVPLVRGGD
VVAHLGLDAARERVKRGLVSLPWDGLSLSRGEPAVPTRMLAHSRSAR
392417546YP_006454151.1 hypothetical protein Mycch_3741 [Mycobacterium chubuense NBB4]MVTPAKARPGTREQRDVAEEVAADAPWVTIVWDDPVNLMTYVTYVFQKLF
GYSEPHATKLMLQVHNEGKAVVSAGTRESMEVDVSKLHAAGLWATLQQDR
392417545YP_006454150.1 protein of unknown function (DUF2017) [Mycobacterium chubuense NBB4MRKWKRVEGGDGPRFRSALAAHEAELLTSLVTSLVGMLEDRESSTPVDEL
AELTGMRTGNSTPPQDDTMKRLLPDFYRPATDHPAGSGPAESLNSALRSL
HEPEIIDAKREAAQRLLDTIPTGGGKFELTENDAQAWASAVNDVRLALGT
MLEIGPEGPDRLPHDHPMAGHLDVYQWLTVLQEYLVVALMARGR
392417544YP_006454149.1 L-aminopeptidase/D-esterase [Mycobacterium chubuense NBB4]MAGAITDVGGIRVGHHHRLDDDVELASGWASGTTVVLTPPGTVGAVDGRG
GAPGTRETDLLDPANSVRHVDAVVLSGGSAFGLAAADGVMTWLEEQGRGV
AMEGGVVPIVPSAVIFDLPVGGWQCRPNAEFGYRAAAAAGADVAIGTVGA
GVGARAGVLKGGVGTASVTLDCGVTVGALVVVNSAGDVVDPATGLPWMAR
HIEEYGLIAPPADQIAGYADRHGELSPLNTTIAVVATDAVLSKQACRRVA
VAAQDGLAHTIRPCHTPLDGDTVFALATGAVDVMPDPTTPASMSPETPLV
TAVGAAAADVLARAVLVGVLAAEAVAGIPTYRGLLPGAFE
392417543YP_006454148.1 putative metal-dependent protease of the PAD1/JAB1 superfamily [MycMLTIRADLVTAMVSHAREDHPDEACGVIAGPEGSDRPERFIAMVNAERSP
TFYRFDSGEQLKVWRGMDEAGEAPVVIYHSHTATEAYPSRTDISYASEPD
AHYVLVSTRDPDEHELRSYRIAEGVVTEEPVTIVEQY
392417542YP_006454147.1 molybdopterin converting factor- small subunit [Mycobacterium chubuMSISVSIPTILRTHTGGEKRVTATGDTLQAVIADLEANYTGISERLLDSA
NPGKLQRFVNIYVNDEDVRFSGGLDTQISDGDSVTILPAVAGG
392417541YP_006454146.1 cysteine synthase [Mycobacterium chubuense NBB4]MARYDSLLEALGGTPLVGLPRLSPRWDDTADGPHVRLWAKLEDRNPTGSI
KDRPALRMIEDAERAGLLHPGATILEPTSGNTGISLAMAALLKGYQMVCV
MPENTSIERRQLLELYGARIIYSPAEGGSNTAVAHAKELAAEHPSWVMLY
QYGNPSNAAAHYDGTGPELLADLPEITHFVAGLGTTGTLMGTGRYLREHV
PGVQIVAAEPRYGEGVYALRNIDEGFIPELYDPEVLTTRFAVGSYDAVRR
TRELVQTEGIFAGISTGAILHAALGMAAKALKAGERADIAFTVCDAGWKY
LSTGAYAGSLDDAEDALEGQLWA
392417540YP_006454145.1 putative membrane protein [Mycobacterium chubuense NBB4]MGVKGTGGNPGMAGLPANSPKRPPWVVGGLTILSFVALLWIVEAFDTVSG
HRLDENGIRPMETDGLVGILFAPLLHANWEHLIANTGPALVLGFLMTLAG
LSRFLVATAIIWVVGGFGTWLIGNLGAPTYNGMAVETNHIGASSLIFGWL
TFLIVFGFFTRKVWEIVVGVVVLLIYGSILLGVLPGTFGVSWQGHLCGAI
AGVLAAYLLSSPERRARETRRRTTAPPYLTP
392417539YP_006454144.1 glutamate racemase [Mycobacterium chubuense NBB4]MSSQQAPIGIFDSGVGGLTVARAVIDQLPDEEIIYVGDTGNGPYGPLSIA
QIRSHALAIGDDLAGRGVKALVIACNSASSACLRDARERYAPIPVVEVIL
PAVRRAVRATRSGRVGVIGTAATIASGAYQDAFAAARDVEVFAVACPRFV
DFVERGVTSGRQVLGLAEGYLEPLQRAEVDTLVLGCTHYPMLSGLIQLAM
GDHVTLVSSAEETAKDLLRVLTERDLLRPHPGDAAPPPRRVFEATGDPEA
FTALAVRFLGPTLDGVRPVQRHAGTRS
392417538YP_006454143.1 metal-dependent hydrolase- beta-lactamase superfamily III [MycobactMNVRITVLGCSGSVVGPDSPASGYLVSAPDTPPLVLDFGGGVLGALQRHA
DPNSVHVLLSHLHADHCLDLPGLFVWRRYHPTPAQERGVVYGPANTWSRL
GAASSPEGGEIDDITDIFEIRHWVDNEPVQIGALTVVPRLVCHPTESYGM
RITDPSGATLVYSGDTGYCDALIDLARDADVFLCEASWTHSPSRPPRLHL
SGTEAGRAAARAGVSELLLTHIPPWTSREDVISEAKAEFDGPVHAVVCNE
TFAVTRS
392417537YP_006454142.1 RNAse PH [Mycobacterium chubuense NBB4]MSRREDGRLDDELRPVTITRGFTSHPAGSVLVQFGETRVMCTASVTEGVP
RWRKGSGQGWLTAEYAMLPAATHQRSDRESVKGRVGGRTQEISRLVGRSL
RACIDLAALGENTIAIDCDVLQADGGTRTAAITGAYVALADAVTYLSAAR
KLSDPRPLSCAIAAVSVGVVDGRIRLDLPYSEDSRAEVDMNVVATDTGTL
VEIQGTGEGATFPRSTLDKMLDTAMAGCEQLFEIQRKALELPYPGVLPES
GEPTKKAFGS
392417536YP_006454141.1 non-canonical purine NTP pyrophosphatase- rdgB/HAM1 family [MycobacMSRLLVASRNPKKLAELRRVLDAAGLSGVTLLSLDDVVPFDEAPETGATF
EDNAVAKARNAFAATGLPAVADDSGLEVDALNGMPGVLSARWSGRHGDDA
ANTALLLGQLGDVPDERRGAAFVSACALVHGPDEANCTVVRGEWRGAIVR
EPRGEGGFGYDPVFLPAGSSRTAAELSPDEKDAASHRGRALSALLPALRA
LV
392417535YP_006454140.1 putative acyltransferase [Mycobacterium chubuense NBB4]MSASTGVPRSRVPAGRQTAPRDPALTGLRTVAALSVVGTHAAFATGYLNH
GYLGAMYARMDMGVAVFFVLSGFLLFRPWVRAAADGKPAPSVLRYSRHRM
RRIVPAYAVTVVAAFEIYTVFTPGPNPAQSLYGLLRYLTFTQIYTDNYLG
TLLHPGLSQMWSMAVEVSFYIALPAIASLLLRGPWRPGRVLAGLAALAAV
TPAWLMLADLTDVLPNSAGMWLPGHLAWFVGGMALAVLQTIGARCPAIVA
VPVAGILYLAVSTSIGGAIVGPDPWWVPTVKAVLYAVIATLAVAPPALAG
RDSYSRLLASKPLVWLGEISYEIFLVHVAVMALTMHLVLGWPIFTGSMPG
LMTVTLALTIPAAWLLHRTTRPQTSARSAGSSAESARPRCEAASFSSGLS
SAAVRLEPAGKNTGS
392417534YP_006454139.1 integral membrane protein [Mycobacterium chubuense NBB4]MSAPETPSPLTPVETIRKALLGYRVMAWATGLWLIALCYEMVMKYAFGDN
SLSWIAVVHGWVYFVYLLFTANLAVKVRWPIAKTVGVLLAGTIPLVGIIV
EHFQTQNIKAQFGIA
392417533YP_006454138.1 glucitol operon activator [Mycobacterium chubuense NBB4]MIVAAAGCLALAWWQWTRFESTSGSFQNLGYALQWPLFAGFCVYAYFKFV
RYEDAPPEPRPQHMVTEIPAGLLPERPRAATPTDADPALSEYNAYLAELA
KADGDDRTTGNGT
392417532YP_006454137.1 hypothetical protein Mycch_3726 [Mycobacterium chubuense NBB4]MAEVASRTPSSDDPFNEAVATTGLFLIMTAVIALAVALASWTLSEPLFAA
MSGAVALLSFSASIFCFKAQALESAPTEVTV
392417531YP_006454136.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMSELKYLDLHGDRVAYRDVGRGEEVLLLIHGMAGSSETWRSVIPQLSKRY
RVIAPDLLGHGQSAKPRSDYSLGAFAVWLRDLLDELGVSRATIVGQSLGG
GVAMQFVYQHPDYCRRLVLISSGGLGLDVGWTLRLLSAPGAELLLPVIAP
PPVVKAGNKIRGWLTARSIQSPRGAEMWSAYSSLADAQTRQAFLRTLRSV
VDYRGQAVSALNRLHLTSELPLLVIWGEDDHIIPVEHGYALNDVRAGCRL
EVLPGVGHFPHVEKPNDVVELLDDFLATTAQPDEAATPIR
392417530YP_006454135.1 Transcription factor WhiB [Mycobacterium chubuense NBB4]MDPIRIDEEPWTAPCTRDPDRWTVTADEGAKALCRACPRRWQCARDACVT
PGAVGLWAGIVLPESGRNRQFALKQLRSLAERNGLSPRRR
392417529YP_006454134.1 transcriptional regulator [Mycobacterium chubuense NBB4]MVVVVAQAGRTGAEEPRNIDRIRTAALHSFAMHGAAATTMRGVAAAAGVS
LGLVQHHFATKAGLIKAVDEYVLRLLTATMSQPLSEPPVDSVVEIGDRVS
ALFSENPDVATYLGRALVDGSPAGARIFDTLFTVGIARWQQRLERGELRP
DVDITWAAINGLVLALGAISLRPHLDRHLAEPLLAPAQLQRWQRAVDTLL
REGLFRRPDGE
392417528YP_006454133.1 DNA-binding domain-containing protein- AraC-type [Mycobacterium chuMTVSASSDRVLSESAKSGAPARRVIELRRGGRALGGSYLYEGDGLITGWH
SHEVHQIEYALHGVVEVETDSAHYLLPPQQAAWIPAGLEHQAVMNPDVKT
VAVMFDRALIADGGDRARILAVSPLIREMMIYALRWPIDRRLGAGEDDSV
SEGFFRTLAALVAEALDHEAPLSLPTSDHPIVTAAMAYTKAHLDTATCED
VSRAVSVSERTLRRMFAESLGMPWRTYLLHARMLRAMALLAAPTQSVQET
ATAVGFDSVSSFARAFTQFCGETPSAYRKRVAGEAG
392417527YP_006454132.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMQTDDLILVSIDDHVVEPPDMFPRHVPAKYREEAPIVVTDDKGVDQWMYQ
GRPQGVSGLNAVVSWPAEEWGRDPAGFAEMRPGVYDVHERVRDMNRNGIL
ASMCFPTFTGFSARHLNMHREEVTLVMVSAYNDWHIDEWAGSYPDRFIPI
AILPTWNPDAMCAEIRRVAAKGCRAVTMPELPHLEGLPSYHDDEYWGPVF
RTLSEENVVMCLHIGTGFGAISMAPNAPIDNLIILATQVSAMCAQDLLWG
PAMRNYPDLRFAFSEGGIGWIPFYLDRSDRHYTNQKWLRRDFGDKLPSDV
FREHSLACYVTDKTSLKLRHEIGIDIIAWECDYPHSDCFWPDAPEQVLAE
LNAAGADDSDINKITWENSCRFFGWDPFARTAKADATVGALRAKGADVDV
SIRPRAEWARLYQEKQLTRA
392417526YP_006454131.1 arylsulfatase A family protein [Mycobacterium chubuense NBB4]MTPDRPDVVIIMTDEERAIPPYESAELQAWRREKLGGRTWFDEHGVSFAR
HYTGSLACVPSRPTIFTGHYPDLHGVTQTDGIGKTHDDSRLRWLRRGEVP
TLGNWFRAAGYDTHYDGKWHISHADLIDSVTGESLDTNDDDGVVDPAAVR
RYLDADPLAPYGFSGWVGPEPHGAKLSNAGIRRDPLIADRVVAWLEDRYA
RRRSGDEQALRPFLLVASFVNPHDIVLFPAWARRSPLHPSPFDPPPVPPA
PTADEDLSTKPAAQIAFREAYYPGYGPARFIERTYRRNAQRYRDLYYRLH
AEVDGPIERVRRAVTEGGSGDGPDDTVLVRTADHGDLLGAHGGLHQKWFN
LYDEATRVPFVIARVGRRRTPARTVEAPTSHVDLVPTLLSAAGVDVDATA
SALAASFSEVHPLPGRDLMPVVDGGAADDDRAVYLMTRDNVLEGDTGASG
LARALRMAVNPPAPLRIRIPAHTAANFEGLVVRVDDSAAPGGAGHLWKLV
RSFDDPATWTEPGVRHLAADGMGGPMYRSDPLDDQWELYDLTDDPVEARN
RWTDPTLHEVRAHLRSRLKHQRAESVPERNEPWPYARRQPPRPARWSPVA
AVRQLLE
392417525YP_006454130.1 Polyketide cyclase / dehydrase and lipid transport [Mycobacterium cMTRISRSRAIRAEPSAVWGVLADFGALSDWADGVDHSCLLRRSEDGPHVG
IARRIQSGRTTFIETITDYRPPTLLGYDIAGVPRDLAVANRWNVQPAAAG
TTTVTLTSTVHLTPHPLRLISERVFARLLAKRSDALLDSLTRRCEECHDA
392417524YP_006454129.1 transcriptional regulator [Mycobacterium chubuense NBB4]MATDVAAPRRRSEKSRAAIMRATRELLLERGFDKLSIEAVAARAGVGKQT
IYRWWPSRHALVADVTLEYADRILRPVERTADVTADICEWAVGLARALTT
ARGNAMLRILTTAGMEHPDTAARLRAGFSTPLNETVRNRLLAAGHRPAVA
RDAADAVVGGIVYAILTEGRSFECSRAESITRTVIDGLGLG
392417523YP_006454128.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMSGTKLVIGASGFLGSHVARQLVARGDDVRVMIRTTSSTRGIDGLSVDTH
YGDVFDTAALRTAMQGCDVVYYCVVDARPWLRDPRPMWRTNVDGLRNVLA
VAAELPLHRFVFTSSIGTIGRAKHGLADENTDHDWLDAGGDYIRSRVAAE
KMVMRACVERGLPAVAMCVANTYGPGDWLPTPHGGMLAAAVRGKLPFFIH
GYDAEVVGIEDAADALVLAGERGRVGERYIVSERFMSTRDVHRIGCAAVG
VEPPKFGVPVGALSAAARVAGGVAHLRGKDTMLTPLNVRLMHIMTPLDHS
KAVRELGWQPRPAPESIVAAARFFREAPRRSPAAEVSR
392417522YP_006454127.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTIGLTPEQKHLADAVTQFAARHAPVDKTREAFDSLAAGELPHWWDDFVV
NGFHAVHLPEDFGGQGGTLSDAACVVEAAATALLPGPVLPTVIAGAVALD
ADDTSSARTVLRRLAEGVPAAVILPDGTGVHAAPSDTGWAVTGTSTPVIG
ACAAQVLLVAARHGDDIIWLAIDPAQQGVTVEALNGTDKTVDVGVLSLEN
VTCGKDAELTGIDTERARCVAVALTASAAAGTVRWCVGAVTDHLRTREQF
GRPIGTFQALQHQAAMLLVNSELATSAAWDSVRSASESAVQNRIAAATAA
LMAVAPAPDLVLDTLTMFGAIGYTWEHDLHLYWRKATSLASSIGAAGDHA
EALGGLTMTESRDVSVKLGDLEADFRRDVAAVLDEAQTLRNDRPGRQGDY
PNLATGPQRTLLAEAGLIAPHWPRPWGVEATQLQQLVIDEEFARRPDLVR
PSLGISEWILPTLISSAPEHIQQRFIPATQRGELGWCQLFSEPGAGSDLA
ALTTRATKVDGGWRISGHKIWTSSAHTADYGALLARTDPDVAKHRGLGYF
IVDMNADGIELQPIRQATGEAHFNEVFLTDVFVPDELLLGGPTDGWSLAI
ATMAQERVAISGYVNFDRASILRRLAAEDRPDRSRVLAALGNADAYANAI
KVLAVREVLRLLDGQAAGPASSIAKVAMNVMLRRIFSDTLQLSAPAALVE
DANPAAGPVVEPYFHLPAELIGGGTKEIQLNIIAQMILGLPRR
392417521YP_006454126.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MGLRGEAAIVGYVELPPERLNKATPAPFTLEQWAELGAAALADAGLPGES
VDGIVTSHLAESEIFVPSTVAEYLGVRANFAELVDLGGASAVGMVWRAAA
AIELGICDVVLCAIPARYITPTSEKKPKPLIDAVFFGASSNQYGSPQAEF
EIPYGNLGQNGPYGQVAQRYASVYGYDERAMAKIVVDQRVNANHTDGAIW
KDKPLTIDDVLASPVIADPLHMLEIVMPCVGGAAVVVASADVAARAANRP
AWIKGFGEQVPYKTPTYAEDLLQTPIARAADTAFAMSGLTRAQMDMVSIY
DCYTITVLLSLEDAGFCEKGTGMEFVSAHDLTFRGDFPLNTAGGQLGFGQ
AGNAGGMHHVCDAARQIMGRAGAAQVADCNRAFVSGNGGILSEQTTLVLE
GA
392417520YP_006454125.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMTVSNPMLQRPMPVKTPTTAPFWDALAEHRVVIQYSPSSQSYVFYPRVRA
PRTLADDLEWREISGMGTLYSYTIARRPVGPHFADAVPQFLAIVEWDEGP
RFSTELVNVEPDDIVIGMRVKPVFCDYPEHDVTMLRYEPADR
392417519YP_006454124.1 hypothetical protein Mycch_3713 [Mycobacterium chubuense NBB4]MTDQTDRQDISDVLVRYATGIDRRDWPLFRTVFTDDCELDYGEIGTWHGV
DAVVDFMVSAHEMAGHTLHRITNQAIDAHGDTATARAYVDALIMAPDNTS
GVNAVGFYDDEFVRTDAGWRIRRRRFTTVLVRTVRP
392417518YP_006454123.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMTFAQKYGPWALVAGASEGVGAAFAEAIAERGVNVVLLARRAAVLDEIAS
RLRRHGVETRVVAIDLAADDAVPTIIEATQDLEIGMLVYCAGADPDFRPF
LGQPIETAETMLRRNCLVPMRLCHHFAPAMVSRGRGGIVLFGSGAGFAGG
PNMVAYSATKAFDMVFAEALWTELHDSGVDVLGLILGKTDTPALRRLEYA
RGQIGSPDERPKDTASVDDVIAEAFDNLANGPTWIVGENLRAAAQMMGSV
SRSDAVRFIMQASAASMGDG
392417517YP_006454122.1 sugar phosphate permease [Mycobacterium chubuense NBB4]MTVEDTNRSPVGAGSAAIRRAVRGAAIGNTVEWFDFAVYGFLATYIADKF
FPSGDETAALLNTFAVFAAAFFMRPLGGFFFGPLGDRIGRQRVLALVILL
MSASTLAIGLVPSYDSIGVAAPLLLLLLRCLQGFSAGGEYGSGACFLAEY
ASDRHRGFVVSFLVWSVVVGFLLGSVTVTGLEAALPGGAMDAYGWRIPFL
IAGALGAVGLYIRLRLADTPEFEALRERGEVSSSPLKEAVTTAWRPILQL
IGLVVVHNVGFYIVYTFLPSYFTKTLGFSKIDSFVSITVASLVGIVLIPP
LGALSDRIGRKPLLIAGSVGFAVFAYPLFLVLTTGSLPAAVAAHAALAAL
ESVFVSASLAAGAELFATRVRSSGYSIGYNVSVAVFGGTAPYVATWLVSR
TGDDLAPAYYVIAAAVVTLATVLTMRETARRPLRKLPSG
392417516YP_006454121.1 family 3 adenylate cyclase [Mycobacterium chubuense NBB4]MRPRRLLTKYAAGLTSAYVLTLAEVVAIIASLGGRSVVTVGNLIALAVVG
LVGTATVAIGAVLIIRPTMRWLSAGQLPTPAQVRTVAKLTRRQGAITLAP
WLLTAAVLLPLNLDSGSDVIAVMGSAILFGIIATSSTGFLFTLRTLRPVM
AGVPTDAGRPPVPGIRSRLFLMWTVCTALPGLGIAVLLVLRYRHWLLAPS
TPIELALLVLALVAVVLGLRAMIVVSMSISDPIHQVINAMADVEKGDIDR
TVEVYEWSEIGRLQTGFNRMVAGLRERDRLRDLFGRHVGEEVARRAFEQA
SGQAGSLTGEERDVAVLFIDLVGSTRLAVEHEPHEVADVLNDFFRIVVAG
VDENHGLVNKFQGDAALAVFGAPLRVSCASSTALATARALAHELRRLPVD
FGIGVSAGPVFAGNIGAENRYEYTVVGDAVNEAARLADCAKEFDGRVLCS
GPAFHRAGPAEREQWVHRGETTLRGRSGATTIYAPAR
392417515YP_006454120.1 hypothetical protein Mycch_3708 [Mycobacterium chubuense NBB4]MIKTGTRLQSQVCDTQVIVVRSADSLDDLRAGGAPMVPIGDQVDASLSLD
AELSDGNLMGKRYVDDGGAEVLVTKAGKGTLSVGSTPLALKEAKPLPASD
392417514YP_006454119.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMSISLLLEMASSAEPDRTAVVSDDLRLTTGELSTLADGGAGVVAASGAQH
VAYVGTGGAMLPLLLFSSARAAIPVTPLNYRLSAEGLRALLDRLPDPLVV
VDDEYRGAVGDGYRTIGSEAFLEAARAAEPVAEFADPDAVAVVLFTSGTT
SKPKAVELTHNNLTSYITGTVEFASAEPGDAALICVPPYHIAGVSAALSN
LYSGRKMVYLRHFDAEAWVRLVAEEGVTAATVVPTMLDRIVTVLEKGNTT
LPTLRTLAYGGSKVPLPLVRKALSLLPDVGFVNAYGLTETSSTIAVLTPD
DHRAALGAADEAALRRLGSVGQPVPGIEVEIRAEDGTVLGAGEPGELFVR
GEQVSGRYTDIGSVLDEQGWFPTRDVAYLDAEGYLFIGGRSDDTIIRGGE
NIAPAEIEDVLVEHPHVRDCAVVGADDPEWGQIIVAVVVPHPDTDPDPEG
LRAHVRSQLRGSRTPDRVVFRDELPTNATGKVLRRELVNELNATSKEPA
392417513YP_006454118.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSSSPSETSFTDRTVVVSGGSRGIGLAIALAAARRGANVVLLAKTAEPHP
KLPGTVHTAVAEVEAAGGKGAAVVGDVRKEEDVARAVDTAVDRFGGVDIV
VNNASAIATEPTEHLAVKKFDLMMDINVRGTFLLTKAALPHLRRSASAHV
LTLAPPLNMNPHWLGAHPSYTLSKYGMTLLSLGWAGEYAEANIGFSCLWP
ETYIATSAVTNLADGDALAKASRSPDIMGDAAAAILARPAADVNGRCYID
SDVLAEDGVTDLSRYGGGDSPIRDIFVDAPEGS
392417512YP_006454117.1 methylmalonyl-CoA mutase family protein [Mycobacterium chubuense NBMTPPADHPVQTPSGIPLEPVYGPADRAGDPPPPGTYPFTRGNFASGYRGK
TWTFRQYSGFGTAEESNRRYRYLLDQGGTGLSVALDLPTQCGYDSDDPEF
GEEVGRVGVAVDTLADAEILFDGIPLDKISTSFTINGTAAILLAFYVAAA
EKKGVPREKLTGTIQNDILKEYASRGTWIWPPEPSLRLIADTIEFCAAEV
PRFNAISVAGAHFRDAGANAVQEMAFTLADGVTYCDTVVERGRMTIDKFA
PQISFFFYTHGDFFEEIAKYRAGRRRWATIVRERYGATTDKASMFRFGCV
AGGASLYAPQAQNNLVRVAYEAMAAVLGGVQSMFTAAWDEPFALPSEESA
TLALRTQQILAYETGVTKVADPLGGSYFVEALTDATEAKIVEIMHDLETH
GGMVRCIEDGYLQGLIADEAFKIHQDVESGERPVVGVNRFVTDEPPPEIA
TYELDAEGRDVQLKRLAKVKADRDGLAVKEALAALSEAAEGQENLMHKLI
DCANAYCTVGEMVSTLKSVWGEFQQPVVF
392417511YP_006454116.1 methylmalonyl-CoA mutase family protein [Mycobacterium chubuense NBMGVRVLVAKPGLDGHDRGAKIVARTLRDAGFEVIYTGIRQRIEDIVSIAL
QEDVALVGLSILSGAHVALTQRTVDALRAADAGDIAVVVGGTIPGGDVQK
LLDAGAAAVFPTGTSLEDLVRDVRALTEKAAE
392417510YP_006454115.1 F420-dependent oxidoreductase- MSMEG_4879 family [Mycobacterium chuMRLGVMIGAERGDMSRKVGKLVSDIEWAESAGLDTAWMPQVPNDFDCLTM
VALMAAHTSRIELGTAVVPLQAQHPIALARQALSVHAMAGGRLALGVGPS
HHWIVRDMLGIPYEKPAAYTRDYLEVLNTALAGPGDVDVENDNFTVHNPT
VLGAEQPLPVLVAALGPVMLQIAGAHADGTVLWMADEKAIGEHIAPKITK
AAADAGRPAPRIVAGIPVCLCANSEIEAAKERANRILAEAETSPNYQRLL
DRGDARNVGDLCAAGDEESILRRFQQFADAGVTDLSVRLLPIGETRDELV
ASKYRTREVIAELAKRIR
392417509YP_006454114.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTSVGPLAGIRVLEVGVMLAGPYATMLLADLGAEVIKIEPPGGEISRQVS
DSYFASLNRNKQSVCLDLRSAEGRRRLGELVANSHALLVNMKPSAIRRLG
LTYDSLKEFNEGIVCVAMTGFGLDGGDDPAFDYVIQAATGVAAMTGDPDG
PPTLPGYSSADNSTGLTAALGLLAQIVSGRGGQVDVSLRDVMLSQLNYRA
AAYLNDGVEPRRHPYGAHSYYVPAQLFPTADGYLALFITHDAFWAAFAAE
AGIEGFPTMAERAARRDEVLAVVGAALATDTAANWETRLRPLGIPVSAVR
TLPEALAATPEALITAGGFRLVGSPIRIAGYEPGYRPPPRLDEHADAPGT
GARSVHSS
392417508YP_006454113.1 ferredoxin [Mycobacterium chubuense NBB4]MSDAEGTITITLDGSTASVSGKPGETLLESARRAGMGPPFSCEAGNCGTC
MAMLTDGKATMRVNDALTEDEVAEGYVLTCQAIPDTASVAVSYDE
392417507YP_006454112.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMALAFEERQHSVAELDALASAMAVELHRRGVAPGSRVALMSSNRPEFVVA
VQAIWRLGAAAVLLSPAWKTAEVRHGISLTEPTHAVGDHPVLGELMPMLH
LDESPAPAPRAAESAEAVKPAADAVFVFSSGTTGMPKAVRHTHASLSAAV
RQWRGALGLTSADRIQVMTPPSHILGLLNIATALDTGAWIRLHRRFDIDT
MLRHIESDRITVEMAVAPIALALSAHPRLEDHDLSSLRYIMWCATPVTGS
VAEAVSRRTGVRWVTAYGASELPVISCNDLDRPRLDTVGRPVPGVSVRIA
SLDTGEVLGPGAEGEIQVHSEAAMAGYLPESSTEGAFVQGWYRTGDVGTL
DTDGWLRITDRAKEMIKVRGFQVAPAEIEAVLHGHPAVEDCAVFGVPSAD
GEAVIAAVKAGGAVDADELAALVADRLASYKRLSRVVVVDEIPRLPSGKV
LRRVLRERALSACAKSGGNCGRPSDQ
392417506YP_006454111.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDVRLTSEQRQLRDAAAELAADLGPGSVADLDDATRIARLEKAVDATGFR
SLRSDGASAVEVAIVAEEFGRRLVDVPFLGPVLADDLHRRLGRRAELPGE
AAVSVDLTKSLAGMVESPSELGELSDEDSGRWYALALAATTADIVGAARG
THALATEYAKVREQYGSTIGSYQAVAHLLAESLALIEGSISVARHAAWAV
DELPVREAVEAGRIAKIYCARAAMTVCETSIQVHGGIGNTWECLAHVYLR
RVLAATETWPAKLEELTIGLS
392417505YP_006454110.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDFRDSPDEAAFRERLRAWLTEQKGRFPTSGDEYWAKAGEWHQALFGAGF
FGTSWPKEYGGQDLPPVYDVIVDEEIAKAGAPARPSLGYLVVGLSHHGSE
ELRQRFLPGMINGTERWCQGFSEPGAGSDLASLTTTAVRDGDEYVIHGHK
IWTSYSDVADWCLVLARTEKDVPKHKGISAFIVNMHQPGIEQRPLKMISG
VTKEFGQVGFDGARVPAENMVGAPGEGWKLAMTVVSHEREPSTLGFSARY
GKTVRQMASRVDGAPPEELQWAWVQTEMLRLHVRRRLSEQLDGLTHGPQG
SLDKLLMTWVEQSVGHAALRTVGTGDDELFGAYMYSRAQSVMGGTSQIQK
NIIASRILGLGG
392417504YP_006454109.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMYGMPDEIDVRAEGGLRVITLNRPDALNAVNDALHVGLAKIWDELNEDAD
ARAAVITGAGRAFSAGGDFNYLDELRRDEALRTKTIKHGRDLVIGMVRCR
IPVIAAVNGPAVGLGCSLAALSDIVYMAESAHFADPHVQIGLVAADGGPL
VWGSQISLLQAKEFALTGVRIKAPRALELGLANHVVADPVAEAIACAEKI
MALPQQAVESTKRLMNIQLERSVMASLDYANLAEYVSFGTADFNKIVDGL
IAKG
392417503YP_006454108.1 short-chain alcohol dehydrogenase [Mycobacterium chubuense NBB4]MSSARPLDGKVAFVAGASRGIGATVAAALARAGASVAVAARSETEGRLPG
TIGAVAQRITDAGGRAAPVPCDVTSEESVEQAVAATVAEFGGIDILVANA
GVLWLGPVETTPLRRWQRCLDVNTTGVFLVTKAVIPHVRARGGGSLIAVT
TTGVTMTDRGANAYWVSKAAVERLYLGLAADLKPDNIAVNCLSPSRVVLT
EGWHAGGAGVRIPPEMIEPPEAMADAAVFLAQQTAAGITGTIQRSEALTL
392417502YP_006454107.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMQITGSSALVVGGAGGLGEATVRRLHGAGAKVVVADMADDKGKALESELG
VRYVQTDATSEESVNAAIAEAQALGPLRISVDTHGGPASGGRLVGKDGTP
LDLDGFKKTIEFYLTAVFNVMRLSAAAIAKTEPLEEGGRGVIINTASIAG
YEGQIGQLPYSAAKGGVLGMTLVAARDLSPLGIRVVTIAPGTINTPAYGK
AADQLEQYWGPQVPFPKRMGRAGEYAQLAQSIVENDYLNGEIIRLDGALR
FPPK
392417501YP_006454106.1 LAO/AO transport system ATPase [Mycobacterium chubuense NBB4]MRDVTIDELIAAARAGSPRAAGRLLSFVESPRRDEVLSALAALEGVVSAP
VVGITGPPGAGKSTTVGALVGAYRAAGKRVAVLAVDPSSPYSGGALLGDR
IRMAAHINDPDVLIRSVATRGHLGGLAASVPAAIRLVSALAFDVVVIETV
GVGQSEIEIAAVADPTVVILNPGAGDAVQAAKAGLLEVADIVAVNKADRE
GADQTVRDLRGETDAPILKLVAAQNEGIAELLDAIDAHRRSDNPARRAAR
ARSQILSLASTLLRQHPQLGRLAEAVADGVCDPYAAAAQLIVGE
392417500YP_006454105.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTSASVRFSAIQRTAAQTRVLDAALSLISEHGVSGTSLQMIADAMGVTKA
AVYRQFKTKDEIVIALTERELAGLEESLEAAEAEESAPRARELLLASVID
EAIRRRRAVATLQFDPVIVRFLASHQPFQQFVSRLYAVLVGGSGREGRLP
AAMLSGAIAVGVMHPLVADIDDETLRRELLIYTKRLVDLPG
392417499YP_006454104.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMTDWDHDVDVVVLGSGGAGLTAALTAAAHGASVEVYEKAPTVGGTTAVSG
GILWIPAHDRAPDGELTAEDAMAYLRAQSLGVMDDDLVETFVQTGASMLD
FVEAHSELEFEVAAGFPDYKPELPGGKPAGGRSLNARPFDLARLGDWRDR
ITSFPADFSNVGIDAETRARIHASVDSESGDYCVAGTALIAGLLKGLLDL
GVSPRTEARAVELISDPLGITGVRIEQGGNEFRVRARRGVILGTGGFEWD
RRLVEAYLRGPMRGAVSPPNNTGDGLRMAMAHGADLANMGEAWWVPIVQI
PGDIFGGHPRSRSVRLERTRPRSIIVNSAGKRFLNEAGEYNSMAGPFHFL
DPKLGYANDPAWIVFDSLHLKHYGFLGVEPDGPIPDWFCRSGDLEELSEK
TGIDAQGLARTLEAWNANAVDGRDPEFDRGASAYDGYWGDDKAATNAAKT
LGPIDTAPFFAVPVSIGAMGTKGGPRTDRDGRVLHVTGTAITGLYAAGNA
MAGATGKAYGGAGGTIGPAMVFGYRAGHAAATGKPVS
392417498YP_006454103.1 transcriptional regulator [Mycobacterium chubuense NBB4]MNRPSGAASRVLASGERSDPPAPPPANAVAAGGVPGSQTLARGLNALQLV
ASSPTGMTVNQVADDIGVHRTIAYRLLSTLAQYRFVAKGEDGRYRSAAAL
AVLGASFDNNVRQLCVPTLRNLADELGTTVSLLVAEGDQQVAVAVMVPTN
VYYQLAFHEGSRYPLERGAAGIALLASMPPRPGERDLVPQTRQRGWVITH
GEIEPNTYGLAVPVRRRPPSPPTCLNLISHREDVVLGGRGSVIKAADELS
AILS
392417497YP_006454102.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMSEFESVWSDLQGVAFSQGYLDAGGVRTRYLHAGDPAEPCLVFLHGSGGH
AEAYVRNLEAHAEHFSTWSIDMLGHGYTDKPGHPLEIPHYVDHLLAFLTA
IGADRAHISGESLGGWVAARAAADHPDRIDRLVLNTAGGSQADPEVMRRI
ITLSMAAAENPTWETVQARIKWLMADKSKDYDDIVASRQRVYRQPGFVDA
MRDIMALQDPEIRARNLLGPKEYGAISAPTLVVWTSDDPTADVEEGRRIA
SMIPGARFEVMPGCGHWPQYEDAKTFDRLHVDFLLGRR
392417496YP_006454101.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMWTFSWVGDERLREEKRDTMSAEQFDVVIVGAGPSGLTLANILGLQGVST
LVVEERDTLIDYPRGVGLDDEALRTFQSIGLVEQVLPHTVPNQILRFFDA
KRNLLAEMAPPDARFGWPKRNGFVQPMVDAELFGGLRRFDHVAVRFGHCM
QTCVEAEDGVTVEFADGRPPVRARYVVGCDGGRSATRRLMGVPFDGTTSP
TRWLVVDCANDPLGHPNSEVGADPARPYVSIAIAHGIRRFEFLIHPDESD
EQADDPAFVRRMLASRVPYPERVDMIRHRVYTHHSRIAGSFRKGRLLLAG
DAAHLMPVWQGQGYNSGIRDAVNLGWKLAAVVTGQAGDALLDTYDAERRK
HARAMIDLSTMVGRVISPTNKRVAAMRDRVIHAASVVPTLKRYVLEMRFK
PMPRYLQGAVHHDPTPSPNSPTGTLFIQPRVDTRDAQNVLLDDVLGSGFA
VLCWSNNMRAVLGDHAFDRWKALGARFIEARPMTQLHWPGHDDGDVVVVG
DRTGALKSWFDASTDSVLFLRPDRCIAGACIAQRAAEVSEALFCVLHLSP
LPQKGGSGSDGSNLDGKSDSAVLHVAQPTAEPSGTVTGTA
392417495YP_006454100.1 hypothetical protein Mycch_3688 [Mycobacterium chubuense NBB4]MSHSPLLNLPGPSRELLDDIEAAIATAREFVTAFDPELVVIFSPDHYNGF
FYRAMPPFCIGTAAEGVGDYGTYRGRLDVPADLATDCARAVLDDDVDVAI
SAAMQVDHGTVQPLQKLFGDATAKPVIPVFVNSVATPLGPIRRVRALGAA
VGRYLASLGQRVLIIGSGGLSHDPPVPTLATAPPAALDRIVHGVPMTAEQ
RQARQVAVIDAAREFASGRGALAPLNPEWDHAFLDLLDTQRLSEVDEWDN
SWIAEQAGNSAHEVRTWVAAFAALAAQGGYQTGNRFYRAAPELIAGFAIR
TAVSAP
392417494YP_006454099.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMNIHEDGMTDQRYDHTVDVLVVGSGGGGMTAALAAEAAGLDTLVVEKSPR
FGGSTALSGGGIWVPGAPSQRREGHVPDPDAVMTYLKHITGGLVSDARLR
AYVDAAPEMMKFLENSSTWLEFVWKPGYADYYPEAPGGSALGSTINVPAI
DLRALGDEEQNLLAPLALAPKGIWFAPKDLRLFYQVRQSWRGKAVLLKLI
WRMVRARVFGDRMAAIGQSLAARLRLAMKQHDIPLWLSAPMVELITDVDG
AVVGAVVEKDGRAVRVNARHGVILASGGFDHDMAWRREHLPELARVHELA
GAEKDWSFGNPAAMGDGIRAGEKVGASTELLDEAWWFPAICWPDGRLQFM
LNERMMPSQFVVNGDGKRFINEAAPYMDFAHAMIEGQRSGVTHIPCWLIT
DIRSFHRYVVAGHLPIPKVPFAPVPTGRTVPAAWLESGVVKQGDTWEELA
RQIGVPPTRLRDTAERFNTLALSGHDDDFNRGDSSYDNYYGDPTLPNPNL
YPLGKPPYLAFQIILGDLGTSGGLRTDEHARVLRADDSVISGLYAVGNAS
AAVMGRSYAGAGATIGPAMTFGYVAARHIADNSLTSQSPELQGGNQK
392417493YP_006454098.1 flavin-dependent oxidoreductase- F420-dependent methylene-tetrahydrMKISLFYEFPLPRPWSDGDEHQLFQHGLDEVELADKAGFSTVWLTEHHFL
EEYCHSTAPEMFLAAASQRTKNIRLGFGVMHLPPPINHPARIAERVATLD
HLSNGRVEFGTGEGSSVAELGGFNIDPADKRTMWEEALEVSIRCMTEAPF
TGFKGEHVEMAARNVIPKPLQSPHPPVWVACTRPSSVQMAAQKAIGALSF
AYTGPEALKTRVDGYYKEFEEQGTPVTPAINPNLLAIGGDLSMMVAKTDE
EALERLGIGGGFFSFGIMHYYVNGMHTPGRTGVWELYEQAVKEDPTLAYG
PGRGAIGSPETVREFLRGYEASGVDEIILLLNPRSHEGTMESIEIMGREI
LPEFIERDEKAVKDKAKRLEPVIEKVEARRQPSDAPMFDETYAFGGLPTG
RGGKFTAGEIPEAMAEINEGRVKAAQAEKAAKEAAS
392417492YP_006454097.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMAALDELVRYDGKHVVVTGCASGIGACVAQQLGHLGARVTGLDLRAPGDG
SALAEFVEVDLADPDSVDTAAAAIDGEVDALFNVAGVSSGIGDPLLVVRI
DFLGMRQLTEALIGRMPPGASITSVSSLAAWDYRENAGTTMGLVGTSSVD
DGLRWCAANPGALSDGGYRLAKEAIILYGMSRAVDLGARGIRINCTAPGV
TLTPILDQLRSAYGQQYLDSFTAPLGRVSDAEEQASVVVFLGSQAASYLT
GQVVSTDGGISAQRFIAQVSDVHTTQGG
392417491YP_006454096.1 putative metal-dependent hydrolase [Mycobacterium chubuense NBB4]MAGSMSDFRRMADQVRNWGRWGAADEIGTLNFITAEKVAEAAATVKKGSV
ISLGGDFGSSGPQGAFKFRQNPVHVMTVDGGDASTLVEYGPQWLRNAVAA
DMSAFFADNPFRFNDDIIVMPLQAATQWDALSHVYYEDKLYNGFPAGSVT
SFGAFHCGIEKVDAKGITSRGVLLDVVAHRGADVFCPPGQPITPAELDEV
VAAQNVEIRSGDVVVVHTGWWTRFLATGDGGEPGSGLDWTCAAWLHEREV
AAVAADNLMVEDPDPAQGVEGTFLPMHMLCLRDMGLMLGEYWDLGPLAAD
CAADGVYEFQLVAPPLKVVGAVGAPVSPIAIK
392417490YP_006454095.1 putative flavoprotein [Mycobacterium chubuense NBB4]MSEVTETRPPFIVGLGGTLRANSSTERALRYCLAAVERQGGRTRLFSAED
LDLPMYAPHELERTPRALELVKTLRDADAVVVGSPGYHGAVSGLVKNALD
YIEDLREDPRVYLDNTPWGCISCAYGWQAAVGTLTQLRSIGHALRAWPTP
LGVAINSADPIWDSSGELADTDQGKVVANQLELLATQVLAFAQSARETA
392417489YP_006454094.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMTDQHTVLVDGLRTTYLEAGQGDPVVLLHGGEFGASAAIGWEHTIGALAE
RHRVLAPDMLGFGGSAKVVDFTDGRGMRIRHIARFCEVVGVESAHFVGNS
MGAVNLLVDTTSDAPALPVRSLTALCGGGEIQRNDHVAALYDYDATFEAM
RRIVEALFSDPSYPADEEYVRRRYESSIVPGAWESLAAARFRRPGLEAPA
TPSSARAYDRVSVPALIVEGGADKLLPAGWAAEIAGQITQGDSAVVDDAG
HCPQIEQPAAVNTLLLQFFERNAQ
392417488YP_006454093.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTTELAGKVAIVTGASSGIGRGIAERFAAEGASVVIADVRDDLGEAVAAE
LNSEGGTTKFVKVDVGDQAQVGALVQTAVETFGALHVMVNNAGISSPLRK
GLLHEDFDEFDRVMRINLLGVMAGTRDAARHMAEHGGGSIINLGSIGGIQ
AGGGVSTYRASKAAIIHFTKCAAIDLAHYEIRVNCLAPGNIPTPILASAA
TDEDRARLERFEAKIRQQMRDDRPLKREGTVGDVAEAALYLATDRSRYVT
GTVLPIDGGTVAGKVIVRKPAADESSS
392417487YP_006454092.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTSLNQSLDLVSVTRFTGWVTTARTVRADRASSTQEAILKAAERLYAEHG
VFAVSNRQVSEAAGQGNNAAVGYHFGTKADLVRAIEHKHRGPIEELREQR
IAEISDTTDMRQWVAALVCPLTDHLAALGNPTWYARFAAQVMTDPAYHNM
IVKDALSSPSLVRVLDGINGCLPDLPVDVRVERNIMGRNLLMHSCAERER
LLAQGAPVARSSWQAAASGLIDAIVGLWHAPVTELP
392417486YP_006454091.1 ferredoxin [Mycobacterium chubuense NBB4]MKVTVDQDKCVSSGQCVLNAGEVFDQRDDDGVVQLLIPEPGPEHADQTRR
AAAACPALAIHIEEQI
392417485YP_006454090.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTDTLTEEAVSAIPEYPMERSAGCPFAPPERMLAMNQVAPLSRVRIWDGS
TPWLITGHEAARTLFADSRVSVDDRRSGFPHWNEHMLSTVNKRPRSVFTS
DAEEHTRFRRMLSKPFTFRRVEALRPVIQEVTNECIDDVLAGPQPADMIA
KLALPVPTRVISDMLGVPYADHEFFQEHANAGLARYAAADAMQKGAMSLH
QYLINLVEEKQANPSEDAVSDLAERVTAGEISVKEAAQLGTGLLIAGHET
TANMIGIGILALLEHPEQAALLRDSDDPKFIANAVEELMRYLSIIQNGQR
RVAIEDIEIAGETIRAGEGIIIDLAPANWDASTYPQPDELDLTRDAGNQL
GFGYGRHQCVGQQLARAELQIVFHTLLRRMPTMRLAIPFEEVPFKHDRLA
YGVYELPVTW
392417484YP_006454089.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMSTLTDVTLYPPEGFGAPKNRHGHSTGAVTGLPADTVIFSADNHISVADD
IFYERFPEELKGAAPRIWYEDGAYMVGMKGKAWTGGDFGRVLMQYDDLAG
AASNNIEARIRELKEDGIDKELAFPNAVLALFHYPDKALRERVFRIYNEH
IADLQERSNGHFYGVGLINWWDPAGTRSTLAELKSLGLKTFLLPLNPGKD
DDGNVYDYGSTTMDAVWDEIEAAGLPVSHHIGETPPKTPCQNNSVVVGMM
VNVDSFREQFAKYVFSGILDRHPALKIGWFEGGIAWVPTALQDAEHMLAS
YRHMFNHELEHPVRHYWDNHMSASFMIDPLGLALIDRIGVDNVMWSSDYP
HNESTFGYSEKSLASVVEAVGSEAAVKIVSTNVQHFLGLS
392417483YP_006454088.1 Xaa-Pro aminopeptidase [Mycobacterium chubuense NBB4]MTTFATAWGAGTTARDIPELPDRGRMYRECGARLRASMRDRGVDALVLLG
NGNVVYATGASWPLLDAGLSHVERPVAVVLADDEHPHLYMPFREGSSFES
ELPDDHVHGPLYLEFDEGVEHFASILAGLIPAGSSIAVDELTGAMRRSAG
RLFPAGAPTDAALVIGPAKLVKTVDQVAAIRKACRITEEAAVDVQKSLAP
GVRQIDLSAAFVRRAFELGATANMLEAIWQVMPTSKAAGTWTTTGDLALP
LLTTERALAKGDVLWTDVSITYEGYCSDFGRTWLVGEEPSARQQAQFDQW
RAILDAVLAVLRGGTTCGDLARAAIAANGGAKPWLPHFYLGHGIGTNAAE
TPLIGTDLGEDFDDNFVIPAGMALVLEPVVWEDGTGGYRSEEIVVVTEDG
YVPITDYPYAPYGEGARA
392417482YP_006454087.1 Xaa-Pro aminopeptidase [Mycobacterium chubuense NBB4]MTDEVLPDPPALRIGRRERALAQMEANDLDILVLGRQANVRYVTGAPQLW
VAGTRPFAPICVVVRATGEIHLNSSWDEGMPDEIGHDHLYGLAWNPMTLI
EVLKNIDGAAGAKRVGTDALSPTFAQLLPMAFPNAELVDGEVAMRAARRV
KTPDEIAALRGALGVAEDGLAAAVAELAPGTTEQALTGVMLEAMAAGGVS
TSATQDGAWITSREHSWRVGRRDRRVADGDLVAFASGALAGGYVGEVGRT
WPVGDVKGADELYARSNALWDRLVAACRPGASAADLFTAYEAAGESLPPM
PVAHGLGLGFDPPVISPDLAQTSADERLDPGTVLAVTGYVWEPGVGAVFR
RDAVLIGGDGPEVLTTSPLPAQATAGIG
392417481YP_006454086.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMPDVQRPSPEEIILYRKDPQTKIATVTFNRPEYLNAPTSAARLRYADLLR
AATVDNDVKVVVIRGVGDNLGSGADLPEFMEGRDDPAARLAELRLEDDGV
GEVTYPPKGTFRNGATISAWYANVAAGNRPLQECKKITIVEAKGYCYGWH
FYQCADADLVISSDDALFGHPSFRYYGWGPRMWTWVQMMGLRKFQEMVFT
GRPFTAAEMYDCNFLNKVVPRDRLEAEVDKYARSCARNRPVDTVFQQKMF
FEIFKQHQGEYMGSLLSAFFESMGGGAVSDGDDLDMNEAIDSGLADAVND
NDNRFPPDFRLSKSNRRAAEGGS
392417480YP_006454085.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTSEPPLAGYVVVDLSTGIAGAYCTKLLADGGAEVVKVEPPQGDPLRGWS
ASGSDIVEGADGALFSFLACSKRSVVADPRTDAEFLDTLLAGADAVVWTP
GSDLTQHRDFGPAGIHRANPHLTVTAITPFGLEGPWCDRPATEFTLQAWS
GGIVGLGRGAPDRAPVCVGGQVGEYVAGAYASAFTLASRMRGGAELIDLS
MLETSVLGLTYYPVTYFEMLGRPWRDARRLTVPGIARAEDGLVDIGCGTA
QQWFDLCAMTGHAEWIDENSPLTITQQANEHSADLYAWVAEQTVDEVRDL
AGAFRIPNAPVANGANIEKLDHFVERASFVVNPRDGFTQPTHPYRMAPDT
LRPPAPAPRLGEHTEAYRSWDRTPEPLPRRDSLPFEGLRVVDMTTFWAGP
SCTHLLAMLGADVIHVESTRHPDGTRLIAGIPATEAQWWERSPIFSGLNT
NKRGVTLDLQSPTGRDLLRRLIATADIVVENFTPRVLESMGLTYDAVREV
RPDVIMVRMPGFGLDGPWRDNPAFAYVIEAAAGISWLTGYPDLNPFEPYS
VGDPNAGIHALNATLLAVEHRRRTGEGSMVEAAMVDAALNIAAEQVIEYS
AYGALLQRSGNRGPTAAPQNLYLTDEIDEFGRRDCWVAVAVATDTQWEGL
RDALGRPQWAQAAELVTAAGRRAHHDLIDEHLAQWCAGRTGDEIVNALWG
HGVPVAKVMQPHRQTELPQLTGRGFFESVEHPVNPPTPHSTLPYRSTRGP
QRVHTSPAPLLGQHNHDVLRELGLTDEEIGRLEADGVIGTTIAR
392417479YP_006454084.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MGRRGYGGLMRPSEDAVGLLVGDERITGTGLSHQHVYPATGQPNATVALA
GAPEIDRAVTAARAAQREWAAMTVDRRRDLLVDLADVLHEHLDELALLNV
HDYAVPISFAGTAVLLEHFVRHFAGYVDKPQGISSPVSDSFDVNLIEREP
YGVVGVIAPWNGSLVVAGSCVAPALAAGNAVIFKPSELAPLAALRFGELC
LDAGLPPGLVNIVPAAAHGAELLVRHPGVRKIHFTGGGATARTVVAAAAE
NLTPVVTELGGKSANIVFSDADLDAAAQMSAHQGPLMQSGQSCACASRIL
VHTSVYDAFAERFLAVVAAARVGDPLDPAVAVGPVISAAAADRILADIDQ
AVRVAAGELLVGGERLGGELAQGYYIAPTVFGDVDNASQLAQVETFGPVV
SLMRFDDDTDAVCMANDTPYGLNAFLHTRDLGRAHTVARRLEAGSVWINQ
FSQIAPQGPYGGYKQSGFGRTGGLDGLHEFQQVKNIRIGMG
392417478YP_006454083.1 uncharacterized protein- gamma-carboxymuconolactone decarboxylase sMTTSGSPPTGRGRQAFAEIMTFPAAADATPAAEHLLDFVFADVWQRPELT
RRDRRFITLPCVADADADEPLRDHVYAALNSGDVSITEMRETVLHFAVYG
GWPKASRFNMVVDQEWERIHQQRGTPMPAPEPLLPLTTPSDPEERLTVGE
RSFRDINCLPFAPARDDPFQGAGILNFVFGEMWMRPGLGMRERRLITVAC
VAFQDAPYPILSHVYAALKSRDVSFGEMDELILHFAAHYGWPKASHLDRV
AAEQKQRVSAEWAAEATAAS
392417477YP_006454082.1 oxidoreductase- SDR family [Mycobacterium chubuense NBB4]MNAADGRVAGKRVLVTGAARGMGRSHAARLAEEGADLILVDICASLPAIE
YPLATAEELEETARIVESHGRRAITRIVDVRDAETLRDAVDDGVTRLGGL
DAAVANAGVLTAGTWNSTTSDQWRTVVDVNLIGTWNTCRAAIPHLLDRGG
SLVNISSAAGVKGSPLHLPYTASKHGVVGLSRALANELAAVGIRVNTVHP
TGVETGMQPASLHGLLRHERPDLAPIFGNALPVVMAEAIDISNAVLFLIS
DESRYVTGLEFKVDAGVTLR
392417476YP_006454081.1 oxidoreductase- SDR family [Mycobacterium chubuense NBB4]MSSLEGKVAFITGVARGQGRSHAVRLAADGASIIGVDICADIESNGYPMA
RRDELDETVALVEAQGGTIAASVADVRDFPALNAALDAGVSRFGRLDIVC
ANAGIATMAFRELTIDEELQMWTDVVDVNLVGSFHTARAAIPHLIAGGRG
GSIVFTSSTAGLRGFGGLQGGGLGYAASKHGIVGLMRTLANALAPHSIRV
NTVHPTAVNTMMAVNPAMTAFLEHYPDGGPHLQNPLPVGLLEPEDISAAI
AYLVSDAARYVTGVTFPVDAGFCNKL
392417475YP_006454080.1 transcriptional regulator [Mycobacterium chubuense NBB4]MARTARTTAADQGRVDPLLDVVVDILESDGYDAVQLRTVARRARTSLTTI
YKRYPTRDELILAALEAWMAENRYAGVVPHARRPGESLYDALMGLFREIF
EPWERHPRMLAVYYRVRSSPSGQRLLNRGLELVGPAGLQLLADVDDEFIG
NLDTIVSSVVYGLLGRFAIGEIAITDILPTLDRTVYWLTKGYEAAGPDSS
PAVEAGKRRGR
392417474YP_006454079.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMINPSDILLTGRVAVVTGGGAGIGRSIAEGFAAFGAAVAVWERDPETCAA
VADSVAGLGVVTDVRDADAVDAALDRTERELGTVSILVNNAGGTFHSPLL
ATTENGWDALYRSNLRHVLLCTQRVARRLVDSGTPGSVINVTSIEGARAA
PGYAAYAAAKAGVINYTKTASFELAPHGIRVNALAPDLTMTEGLRGLSSG
TLGADAGAGIPMRRAGHVDEMASAAIFLASDMASYITGQTIHVDGGTDAA
GGWYFHPRTGVPTLGPGPD
392417473YP_006454078.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMAGTVLVTGGFGLVGSATVRRLAELGRTVVVADLDTPGNREAATNLPAGV
TVKWTDLTDAEQTARLVSEVAPEAIIHLAAIIPPGIYKNRALARKVNVEA
TRTLVGVAESQPTPPRFVQASSNAVFGSRNPHHATGPVTADMPMKHSDLY
SAHKAEAESIVRASSLEWVVLRLGGVLSADPKAIPFSTDALYFESALPTD
GRLHTVDVRDVAWAFAAATTAEVAREILLIAGDDSHRKIQGDVGAALASA
RGLSGGLPMGRKGNPDSDDDWFVTDWMDTTRAQEALGFQHYSWQDMLDEA
HRRAGVERHLLRVIAPLVRMVLERRSAYWKQPGQYADPWGAIRRRIGDPS
PDS
392417472YP_006454077.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium chubuMLITMSEERAETAKWDPGFTRQITGWVGPVIKRYFRAQVRGLDSMPAAGG
ALVVSNHSGGMLTPDVLVFAPEFYKHFGFDRPLYTLAHYGVFLGPLGDLL
RRAGVIEASRENAAQALRSGAVVLVFPGGDYDSYRPTMTANVVDFAGRTG
YVRTAIEAGVPIVPMVSIGAQETQIFLARGDSIARKIGLTRARMEILPLS
IGFPFGLSVIFPPNIPLPSKIVTRVLDPIDITAEFGEDPDVDEVDLHVRA
VMQKALDELARERRFPVLG
392417471YP_006454076.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMEDQLGLLATLWRARLIAPMRPDKYLRMGAAMRRAGLTATVGFAAAAQRC
PDRPALVDERGTLSWKQLDDRCDALGAALQQATESRAGSPATVAVMCRNH
RGFIEALVGANRIGADVLLLNTSFAGPAMAEVIERESAGRPVTVIYDQEF
TATVDRALADTPDATRILGWVDGPDGTPTLDALIDSHLGQRPAASQRKSD
IILLTSGTTGTPKGAKRSAGSGGAGDLKAVLDRTPWRAEEPIVIAAPMFH
AWGFSQLLFAGLLACTIVTRRKFDPEATLELIDRYHATGLAVVPVMFDRI
MELPADVRSRYSGKSLRFATASGSRMRPDVVTAFMDQFGDVIYNNYNATE
AGMIATATPADLRAAPDTAGRPADGTEIRILDADHREVPTGEVGQIFVRS
GTLFDGYTSGTTKAFHDGFMASGDMGYLDDAGRLFVVGRDDEMIVSGGEN
VYPIEVEKILTSHPGVAEAAVLGVDDEQYGQRLAAFVVLDDGGATTVDDL
KQHVRENLANYKVPRDITILPELPRGSTGKILRNELR
392417470YP_006454075.1 Diacylglycerol O-acyltransferase [Mycobacterium chubuense NBB4]MVLMKRLNGMDAMLLYSETPNLHTHTLKVAVINAAGYDGEYGFDAFRQTV
ARRLHLLDPLRYRLVDIPWRLHHPMWLQDCPVDLDYHLRRVRVPEPGGRR
ELDQVIGEIASTPLDRAKPLWEFHFAEGMADQRFALIGKVHHTLADGVAS
ANLLARLMDLAGPVQDERDEPPQSCEAPSSGQLLWEAQADHFHNMAELPG
LCADAARGIVRLRKRSRQRRDDPDLAKPFNAPPTFLNHVVSPVRTFATAT
LSLAEVKETAKTLGVTFNDVVLAVASGGLRELLLRYDGRADRPIMATVPV
ATDKSTERITGNEIGGMMVSLPVHVDDPLRRVELTSVASRRAKEVNELLG
PTLQGRMLEYLPPPLAPALFRAQSQRADHNRLMNVAISNVPGPRERGHIG
GAPVSEIYSVGVLSAGSAFNMTVWSYVDQVDIAVLSDDRTFDDTHEATDA
MVHAFGELRQACGLAAPSTVDTAMDPAPAGT
392417469YP_006454074.1 putative aminoglycoside phosphotransferase [Mycobacterium chubuenseMSTAPGLSIPRSWDEISPEWMTSVLAQHFPGAEVADVSVALRDDGTNRRA
RLALSYSTGAGPATVFAKAVDPEHADLVALTSGLYHEPRLFSCGVTLPLD
HPAVYAAMIDEQRRDFLMIMEDVVARGADPRDSTRPMTADQVADGVRGLA
ELHSAFWGAGVTGEPALEWVEPFVAFAGLEYAPLDIAHERLGDTVPAEIL
ELSGTELFVDIWARFIGSLTTTAPTLLHGDPHIGNTYVLPGDRVGFLDWQ
MVRRGNFSLDLGYFLQGALTITDRRRCERELLDEYRDALRLPEAQKPTRH
DVWLRYRASVAHGLAIWMATLSGGDAWQRADICLAFAQRYAAAFTDLDTP
AALDDLCG
392417468YP_006454073.1 oxidoreductase- SDR family [Mycobacterium chubuense NBB4]MAGRVEGKVAFVTGAARGQGRAHAVRLAQEGADIIAVDICKKIDTVDLIA
ASTPEDLAETADLVKGYNRRIYTAEVDVRDYDALKSAVDTGVEQLGRLDI
IVANAGIGNGGQTLDKTSETDWTAMIDINLGGVWKTVKAGVPHILEGGRG
GSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRTFAVELGAQNIRVNSVH
PTNVNTPLFMNEGTMKLFRPDLENPGPDDMKVVGQLMHTLPIGWVEPEDI
ANAVLFLASDEARFITGVTLPVDGGSCLK
392417467YP_006454072.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTISADNPSAPDAATAAELYYDPYSVELNMNPYPVFARIREEAPLYYNDK
HDFYALSRFDDVNKALIDHETFISGRGALLEIIKSGMEIPPGTLIFEDPP
IHNIHRNLLSRMFTPRKVLALEPQIREFTARCLDPLVGTGRFDFVNDLGE
QMPMRVIGMLLGIPEEHQRRVTDHGEATLQSTQVDLLATGEVFAEFIDYR
TEHPSNDIMTDLLTVEFEDETGTVRRLSRDELLMYLTVVATAGAETTTRL
IGWAGKTLAEHPDQRRELAENPALIPQAIEEILRWEPPALQIARYVAKDV
EYYGRTVPAGSAMLMLVGAANRDHRRFPPDGDVFDIHRELRSHMTFGAGT
HFCMGNALARLEGRIALEEILKRFPTWEVDWANAVPSPTTAVRGWEAMPT
FVS
392417466YP_006454071.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTTASEEPAWKQRAVERSIKTAKLRAAQRVQRFLDAAQAIIIEKGSTDFT
VQEVVDRSRQSLRSFYLQFDGKHELLLALFEDALSRSADQIRAATSGQEE
PLERLKVAVQLLFESSRPDPAAKRPLFTDFAPRLLVSHPSEVKVAHAPLL
ALLTELMEEASAAGQLREGINPKRMAAMTMQTVMFVAQSSGDAGDGTAHP
ITADEVWDFCAHGFAAL
392417465YP_006454070.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMYIDYDVTDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDRDVAVIV
LRANGKHFSAGHDLRGGGPVPDKITLEFIIEHEARRYLEYTLRWRNVPKP
SIAAVQGRCISGGLLLCWPCDLIIAADDAQFSDPVVLMGIGGVEYHGHTW
ELGPRKAKEILFTGRAMTAEEVHSTGMVNKVVPRDQLDAETRALAEHIAT
MPSFALRQAKRAVNQTLDVQGFYAAIQSVFDVHQTGHGNALSVGGWPVLV
DLDQMKANIK
392417464YP_006454069.1 transposase- IS30 family [Mycobacterium chubuense NBB4]MGCRGPGRARLPESVRERFWAAVAAGLSPTAAATVAGVHGATGRHWAQQA
GYRGESKHFGIRYTAQQRAVFWTAVRSAVPPAQAAVVAGVSEAAARRWLQ
QADHVPRTPFPAEADLVAESELTSRVRAPLRFVERCRLEQLLEHGYPPAQ
AAALMGRHKDTINREIARGQTRSVYRASMGQDVADAARKRPKVRKLEANP
GLRAEVLQRLETRNSPEQIAGRLRQDFPDDPEMWVSHETIYQAVYVQPRG
ELAKELKSALRTGRIKRKPQGRNEIADRNRFKAGMVGISERPAEADDRAI
PGHWEGDLIMGAGNTSAIGTLVERTTGFVMLLHLPGDHTATTVAAAMTAK
VPEIPAILRRSLTWDQGTEMAMHTNITEATGLPIYFCDPHSPWQRGTNEN
TNGLLRQYFPKGTDLAFWGPGFLDQVAAELNARPRKRHNWRTPAEELDRL
LSDPSTYVAATA
392417463YP_006454068.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MDDHSLDMLEDALRKTMLAKSGPALDAALTELGWGEMLSDMPDVAVPMVF
RLLGETGSHASILVDVVLHATGNDVGGTLELPLPYAGNTWVVWDRTTTSV
ETTLGGLPLRREEEGYPIRVAEARLAVGWWLVGAARAMLTLARQHAMDRV
QFGRPIAGFQAVRHRLAETLVAIEGAEATLSLPGVDNPDLTALLAKAAAG
KAALTAAKNCQQVLGGIGFTAEHDLHHHVKRALVLDGLLGSSRELTRRAG
AGLRARGSAPRLAQL
392417462YP_006454067.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTDPLEPAQFRSRLVAWLGENDLTPSADDHSLQGHLRQFARVQRALYDAG
WSRYGWPEAAGGLGGPDILRAIVGEEVVGRRLVEPGPYSMLEVLAPTMID
YASPALAAEMVPKLLSGEEQWCQGFSEPGSGSDLASLTTRATPRGDTWVV
NGQKVWTSFAQFSHRCILLTRTGDADTPNHEAITAFFVDLDTPGITVRPL
RTMHGVDEFCEVYFDDVVIGADRMLGRPGDGWRLAMDLLPYERSTCFWQR
IAYLYSRFDALIGEVKNVGQAVDSDMGEAYLALHTLRCRSRATQHRLAEG
HKLGPDTSIDKVLLAGAEQRLYDTARDLLPGVIELDDTEWRTEYLYSRAA
TIYGGTAEVQRNIIARRLLDLGKE
392417461YP_006454066.1 hypothetical protein Mycch_3654 [Mycobacterium chubuense NBB4]MTAPTNPSRTDDLVEIQQLLAKYAVTITQGDIEGLMSVFTPDGTYSAFGS
TYTLARFPELVEAAPKGLFMTGTSLVHLDADDSDKATGTQPLCFIEHSKH
DMRIGYYNDTYVRTEDGWRLKTRAMTFIRRSGEHDSGRPHAIGRPEAG
392417460YP_006454065.1 amidohydrolase- imidazolonepropionase [Mycobacterium chubuense NBB4MLTLKAAGLLDVDAGEIVRPGTVTVDEGRIVSVGGAPDGEVIDLGDSVLL
PGLMDMEVNLLMGGRGENPGLSQVQDDPPTRVLRAVGNARRTLRAGFTTV
RNLGLFVKTGGYLLDVALAKAIDAGWIEGPRVIPAGHAITPTGGHLDPTM
FAAFMPGVLELTIEEGIANGVDEIRKAVRYQIKHGAQLIKVCCSGGVMSL
TGEAGAQHYSDEELRVIVDEAHRRGLRVAAHTHGAEAVKHAVACGIDCIE
HGFLMDDEAIHMLRDNDRFLVTTRRLAEAMDVSRAPKELQDKAAEMFPKA
RTSIKAAYEAGVKIAVGTDAPAIPHGKNADELVTLVDWGMPPAAVLRAAT
VVAADLINRRDLGRLAEGYLADIIAVPGDPLADISVTRSVNFVMKGGKVF
KNDCAN
392417459YP_006454064.1 hypothetical protein Mycch_3652 [Mycobacterium chubuense NBB4]MSKLPEEFADLERFTDWCLPHEEDRYQKRLSSTMQEMQEFYDAAMPRLEA
VMEYCDARFPLNGMPDDAKALIHMMQSLVNVSFPVEVWKQPRVLDSGAAY
ITCIKEPVV
392417458YP_006454063.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MAFFPKPAEGSWTEHWPDLGTEPVDYTDSIDPEQWRLEQQAIFRKCWLNV
GRVEKLPKKGSYFTREMPSAGVGTSVIIVRDTDNEVRAFYNMCRHRGNKL
VWNDYPGEEVSGTCRQFTCKYHAWRYSLKGDLTFVQQEGEFFDLDKADYG
LVPVRCEVWEGFIFINFDDAAEPLIDYLGDFAKGLEGYPFHEMTETYSYR
AEVNSNWKLFIDAFVEFYHAPILHMKQAVKEEADKLAGYGFEALAYDIKG
RHSMVSSWGGMSPPKDPNMVKPIERVLHSGLFGPWDRPKIKGILPEELPP
AVNPSRHHAWGQDSFEFFPNFTLLLWAPGWYLTYHYWPTGVDTHIFECTL
YFVPATNTRERLAHEMAAVTFKEYAFQDANTLEATQTMINTRVVKDFPLC
DQEILLRHLHKTAWDYVNAYKKEKGLTNGSDNGKASTTASEKDAINV
392417457YP_006454062.1 hypothetical protein Mycch_3650 [Mycobacterium chubuense NBB4]MRVPPLPADEWDDAVDDALSAMLPPERRNPEKAGNLLATLVRHPKLTRAF
LRFNRHLLFTSTLPARLREVAVLRMAYRSDCEYEWRHHVHMGHDVGLTDA
DIDGIRRGEAGDELDRAVIVAVDELDDKSVVSDATWATLSAHLDERQLMD
LVFTIGCYGSLAMAINTFGVEPDPDSDTDPER
392417456YP_006454061.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMNKNDMILISVDDHIVEPPDMFKNHLAKKYLDEAPRLVHNPDGSDTWQFR
DVVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGCWQVDERVKDMNAGGIL
GSMCFPSFPGFAGRLFATEDAEFSLALVQAYNDWHVEEWCGAYPARFIPM
TLPVIWDPEACAAEIRRNAARGVHSLTFTENPSAMGYPSFHDFDHWKPMW
DALVDTDTVLNVHIGSSGRLAITAPDAPMDVMITLQPMNIVQAAADLLWS
RPIKEYPDLKIALSEGGTGWIPYFLERVDRTYEMHSTWTGQDFKGKLPSE
VFRDHFLTCFIADPVGVTTRHQIGVDNICWEADYPHSDSMWPGAPEQLDE
VLKANDVPDDEINKMTFENAMRWYHWDPFAHISKEQATVGALRKAAEGHD
VSIQALSHKEKTGATFADFAANAKQLTGNKD
392417455YP_006454060.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MPGGMSFELTEDQELIRKSVAELASRFDDHYWMEKDQAHEFPREFYDAIA
GGGWLGMTIPEEYGGHGLGITEATLLLEEVSRSGAAMNGASAIHLSIFGM
QPVVKHGSDELKARTLPRIVDGDLHVCFGVTEPGAGLDTSRITTSAKREG
DHYRVNGRKVWISKALESEKILLLTRTTPYDEVTKKTDGMTLFLTDLDRD
HVDIRPINKMGRNAVSSNELFIDDLMVPVEDRVGEEGKGFKYILDGLNPE
RMLIAAEALGIGRVALEKAVKYGNERHVFNRPIGMNQGLQFPLADSLARL
DAAELVLRKATWLYDNGKPCGREANTAKYLCADAGFGAADRALQLHGGMG
YSEEYHVSRYFRESRLMKIAPVSQEMILNFLGEHVLGLPRSY
392417454YP_006454059.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTEPQPNAAPLAGVTVVAMEQAVAAPMCTRVLADFGARIIKVENPTGGDF
ARHYDDVVNGPGGLAAHFVWCNRGKESVTLNTKSAAGLDLLHRLLDHADA
FVSNLAPGATSRLGIAPSDLAERHPNVIPVEIDGYGPGGPISHKRAYDLL
VQAEAGSCAVTGYPGMPAKPGPAIADFTTGLYAAMTIVTLLYGRGRHPQA
SPAPAVALSLFDVMTDVMGYALTYTQHSGIDQEPLGVGSPAVAPYGAFPT
RDGQTVVLGTTNDREWQRVAREIIDRPDLADDPRLATNPGRCAHRAILDD
AIGVWCARHDLAEIQKRADDAGIGNSRYNLPSEVVAHPQLTARDRWRTVA
TSHGDIRALRPPPVIGDFEQPMGAVPGLGQHTDAVLSELGLTAAELAQLR
TDGVIGPAYRG
392417453YP_006454058.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMLLSADRGGVRTLTLNRPERRNALDARLWVELADALRALKRDRGVRALIL
TGAGGAFSSGADIATGEDIHPRYKLDRLTDVALALHELAIPTIAKVTGVA
VGAGWNLALGCDLVVATPESRFCQIFSKRGLSVDLGGSWLLPKIVGLQQA
KRLILLAEMIDAAEAHALGLVTWVKGGDEIDGFVDALADRLASGPPFALA
QSKALLNDGANATLREALANESRAQPGNFATADSSEAYAAFSAKREPEFH
GRWAVGGAPPGSEQK
392417452YP_006454057.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MRETVIVEAVRTPVGKRNGGLSGQHAADLSALVLGELVDRAGVDPDVIDD
VIWGCVSQVGDQSSNIGRYAVLAAGWPEHIPGTTVNRACGSSQQALDFAV
QAVMSGQQDIVVAGGVEVMSRVPLGAARATGMPYGPKVLARYDDFSFNQG
ISAEMIAQKWNFSRTRLDEYSARSHERAAAAQDAGAFRDQIVPVFTETGV
VTDDEGIRRGTTVEKLAGLKPAFTDDGVIHAGNSSQISDGAAALLVMTAE
NAVNLGLTPLVRYCAGAVTGADPKLMLTGPIPATEKVLHKAGVAIEDVGV
YEVNEAFAPVPLAWLAETGADEARLNPLGGAIALGHPLGGSGTVLMTRMI
NHMRDNGIRYGLQTMCEGGGTANATLVELIA
392417451YP_006454056.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MRRDLFTEDHEAFRELARDFVDKEVVPHYPEWEKGGRMPRDVFKQMGALG
ILGMAIPEEYGGGGQPDYRYNVVLQEEAARALVTLSTVRTQLEVILPYFL
HYANAEQRDRWFPGLASGTLLTAIAMTEPGTGSDLAGMRTTAVRDGDDFV
VNGAKTFITGGMQADLVIVVARTSTDPDNRRKGLTLLVVEDGMEGFSRGR
ELEKMGCKVQDTAELSFVDVRVPAANVLGEVDEAFGYLGHNLAQERLTVA
VGSVAQARSAIAAAIDYTRSRKAFGTPVASFQNTKFELAACSTEVEAAQA
MLDRAVALHVDGELTGADAARVKLFCTEMQQRVVDRCLQLFGGYGYMMEY
PIARLYTDARVARIYAGTSEVMKVIIAKSLGL
392417450YP_006454055.1 transcriptional regulator [Mycobacterium chubuense NBB4]MSAVRSERPYATLLAKGEDRRQRILAVAERLLARNGWRNTSLAQIAKEAG
VTPAGLLHHFESKEQLLNAVLDARDADDDAHADRSGDLVTELSRVPERFE
RAPELVGTFTVLLAENIAPDAPLHDRLHKRYRDARDIICSIMERGQRKGQ
YRKDFDAATKAVEILAFINGMETLWLLDPSIPLTEVFKGYAESLARDLAE
TEPVSKPT
392417449YP_006454054.1 hypothetical protein Mycch_3642 [Mycobacterium chubuense NBB4]MRYRLDVVAPTVLDAVRFAGGWVYDRVMAGWDVTVLVGSDEDVRPLEILG
ADTLDLEQVLASWEQRPHPQTVAVAADLFDLDDRVRRGVLGALEQGATEV
TLWGTPRSSDLDSSVDSVEHRLSAAARAFKAQALAAAGAVTEPVGATETF
CCGMSASVAADLVPAS
392417448YP_006454053.1 Zn-dependent oxidoreductase- NADPH:quinone reductase [MycobacteriumMRAAVCPHFGPPEVVRIQQHHVRRTQRGEVGVRVSVAAVNFPDVLLIANS
YQVSVPPPFVPGSEFAGVVDEIGSGVEGFAVGDLVSGTVMVGAFAQRIVV
DAASVALVPDGVDAVTAAASGVAHRTAYHALRSSARLSPGQDVVVLGAGG
GVGLAAVQLGVALGARVTAVASSAEKLAVAAHHGAHRTINHRDGELRAAL
RAALPGGADAVIDPVGGDLSEPALRSLRRGGRFVTVGYASGVIPRIPLNL
VLVKGLHVLGFQFQDIAADEFARNEGELREMLVDGRIRPHIGAVYSLDDT
ANALRHVGEGRAIGKVLIDLS
392417447YP_006454052.1 putative aminoglycoside phosphotransferase [Mycobacterium chubuenseMSDIDTARLAEWMDGAALPGSGEPLKARFLSGGTQNVIYEICRGEHRCVL
RMPPPGAPADRDKGILREWRIIEALDGSDVPHTEAVGVCSDPGVLGRPFY
LMGFVDGWSPMDTHGKWPEPFDSDLSARPGLSYQLAEGIALLSKVDWRAR
GLQDLGRPDGFHERQVDRWTGFLDRIKRRDLPGLEVATDWLRAHKPLDFV
PGLMHGDYQFANVMYHHGAPARLAAIVDWEMGTVGDPKLDLAWMVQSWPT
GDDDAAAMSYVDMRGMPSRDDVVAHYAAVSGRQVDDLDYYLVLAKWKLAI
VLEQGFQRAGDDEKLLAFGPVVTGLMASAADLAETTDYRG
392417446YP_006454051.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MWDFETDPEYQQLLDWADGFVREEVEPLDLVWPHLQFTPLTETRRRVIDP
LKEQVRRKGLWATHLGPDLGGQGYGQLKLALLNEVLGRSQWAPVIFGCQA
PDTGNAEIIAHYGTPEQKQRYLKPLLDGELFSSYSMTEPQGGADPTQFTT
RAVRDGDDWVINGWKYFSSNANTASFLIVMVVTNPDVSPYQGMSMFLLPT
DTPGVNIVRNVGLHGESDGHGSHALIHYDNVRVPDSALLGGEGQAFVIAQ
TRLGGGRIHHAMRTIGLSRKALDMMCERALSRQTQGSRLSDKQFVQGYIA
DSYAQLLQFRLMVLYTAWEIDKYNDYKKVRKDIAAVKVVMPSVLHDIAWR
AMQVHGALGVTNEVPFLGMVTGAAVMGLADGPTEVHKATVAKQVLRDYTA
SEDVWPSEWLPRKRDAARARFAEFLEHEVGNQ
392417445YP_006454050.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTSTDAAAGADRGQRRASFQRARSHETKRMLVQAAMALWRTKGYAATTVA
DICTAAGVSKALFYFYFPRKEDVLFEVGVLSTQSAHRTIHALLDKPYDIE
AVILAALTAFERSMARNPRELIIETILEGYRHEHRILAAETPPDVDADMF
TELFSRAHDDKKLPRGVDVTHLAYLAQTLVSEGARHWAAGAFGDRSFADV
VTADICTLINGYSTKPRRRRPHVGLRDRP
392417444YP_006454049.1 protein of unknown function DUF222/HNH endonuclease [Mycobacterium MLFEELAELTGQRNAIDGRIVEIVAEVDRDRLWAAAGARSVASLVAWKAG
VTPARAETIATLAHRLDGFPLCHQGLREGRLSLDQVGTIAERAADGSDEH
YAELAASATVTQLRFALKLAPKPKPEPRPEPEVEPEPDHTPEPAPAPQPS
ISKTSDEHSTTWRITLPALEAAKFDAALASHQDALITDWKRDHDTEAADG
SGQHGSGQPGSGQRPPMPTTADAFLALVEASWDAETSRRPHGQHTTVVAH
LDLDKPVAALHLGPLLSDADRRYLTCDATCEVWFERHGRPIGAGRTTRTV
NRRLRRALEHRDRCCAVPGCGATHGLHAHHIRHWEDGGPTDLNNLVLVCP
YHHRAHHRGLITITGPADQLVVTDGAGRALSSASLARTPTTPPPAAAPYK
GPTGERADWWWYEPFQPQPPPSKN
392417443YP_006454048.1 F420-dependent oxidoreductase- MSMEG_4879 family [Mycobacterium chuMRIGVMVGSDRDRARSDRLSGLLTDGVAAEAAGFTSFWFPQVPGYLDAMT
AVALIGQATTTIELGTAVVPIQTRHPMILAQQALTTQAACGGRFALGIGA
SHDWIINGQLGLSYDRPVGEVRDNLDVLSAAFAGPGTVDVENRTFCVHSP
VDVTDIRPPAVLLAALGPTMLRIAGETADGTILWMADERAIGDHVVPRIT
KAAEAAGRPAPRVVAGVPVAVCAPDEVDAARRRASELLGHAHFSPNYVRL
LEHGDADDVGDTMAAGDESTVLARLRRYRDAGVTDLAARVVPFGADDDIR
RASGDRTRAFLASIAPEL
392417442YP_006454047.1 hypothetical protein Mycch_3635 [Mycobacterium chubuense NBB4]MQLPGTPSDAVDGVLAAGRGDISTLFVSMATRHPDGLDADYLRWHTLDHR
PEQHRLSALRASLRLVSTPACRAARLPGDERLDPVDHVMTYFFFDAGGLT
PFNELSVALGDAGRKLALLPPVERGAYGVVTKAAAPRVKLGADVLPWWPV
RGVFLLLEREPSSTTTLLDVSGVIGVWSTSTLSVDARMASARLGQHLTYC
FLDDDPVETAERLAPVLSRHQEDTGSAPLLAAPFYPVVPHEWDRYVP
392417441YP_006454046.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium chubuense NBBMRYDLWEGPTNEGAALLDGEKILITGATGKIAFPIARALAARNDVWGAAR
LRDPADRERLAAAGVTPVPFDLSDGRFGSLPDDFTYVFHAAVDPGQDDWA
RCVETNAHNSGELLYRCRSAKGFVLCSTGSIYGYRGQRPLTESDPPGVPL
RANYSFSKVAAEAVCGWVARHFEIPLTIIRICSTYGPEGGAPADRLESIL
ARRPIRLHPDRPNNYNPIYEDDYVELGIRAMEVATNPPQVVNWAGSETVS
VEEYCRYLGELVGIEPVFEYTPDAHTPLWPDVTHMHDVLGRTRVGWREGF
RRMVAARHPELTLADERATT
392417440YP_006454045.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MRLTFDDDVEEFRAQFIAFLDAHLPGEAEAVVERSRSSSHVPEWARRWQR
LQFDHGWLLPGNPPEHGGRNASVLQQFVHREELSRRRVYHSFNPQGVGII
AASLLSFGTDEQKRRWAVPILRGEVTASLAMSEPGAGSDLAGLRTRATRD
GDHFVVDGQKVWTSGAHDADVLLAFVRTDPNAPKHKGISALLIPGDAPGV
ERRPFASVHDRTNLDFNEVFFTDVRVPAHNLVGPLHGGWHVANGSLGHER
TMMWMAFANRLEQLLEDFRPTDELERDRYATMVMDHHALRLLGSAALGQA
ARGHRDVPAVSVLKVLGSEAEQNAAGYALAASGADGLIDPALTALYNPYS
PELFTGSWFARYVSTYAGTIAGGTSEVQRNIIAQRVLRLPAR
392417439YP_006454044.1 hypothetical protein Mycch_3632 [Mycobacterium chubuense NBB4]MSDLTNKKPVLESPSARDQPGVQAAARSNRVTIWATAGGALLALQIYVWV
RWVTGPYFQRVPGGPMEPPMYMKAFLTFDAILVCVGLPVAVWWFLVRPWR
RERRITLDGMLLVSMGLMFFQDPLLNYFNTWCTYNTWLWNRGSWSSNIPG
WVSPEEPGRQVAEPLLINAPGYAAGVLMITIFCCWVMRKIKGRWPTISNL
RLILVTYAFTIVLDFVMEAGFMLPFGLYTYPGAIRSVSLFAGTYHQWPVY
EGLMWGAVQAGLCCLRFFTDDRGRTVVERGLDHVRGGFARQQTVRFLAIF
AAVSACFFFFYNVPAQWIAMHADPWPADHMQRSYFTGGICGDGTDVPCPD
PSLPIPTKRSGFIDVRGQLVLPDGAQLPEVVPFERGGAGR
392417438YP_006454043.1 transcriptional regulator [Mycobacterium chubuense NBB4]MAERWTRERRLEHTRSVLLDAAEEVFAEKGFTSATLDDIARAAGYTKGAI
YKHFATKEELFLAVSDRYWRRYFENFSEVMSSARRVGARELDEIAARWRQ
LSLDRGAEHAALGLEFSLYLLRNPDARDRVAAKRSEVVDALAAFIVDGVG
RMGATLLISPLTFAQTLVATSDSVVLGSQLDDVDLYRPIVEMYVSAIKFP
D
392417437YP_006454042.1 transcriptional regulator [Mycobacterium chubuense NBB4]MEHTRALLLDAAEEVVARQGFGAAALEVIADAAGYTRGAIYSHFGTKEEL
FLAVMERQLQRFLDGFADVVDSFRSLDELDVDKLAQRWRDLTIGNPDRAA
LGYEFTLFLVRNPEARARVAAQRRQTADSLAEYISSHIDAIGGRMRIPAA
TLARTLIATNEGVTLGSHVDSDDLYRPFLEMILANVEPSDVSRGT
392417436YP_006454041.1 hypothetical protein Mycch_3629 [Mycobacterium chubuense NBB4]MDLVERIAKHRRMAESYRDKYVLQKVQEGESYDEWEFADDAVYTSPYFVA
DQELVLKDVATHWDTAATIEAKAYGVVFPDWKPVDFKVWPAENGFVQRYR
WEGTNVNTGKTMGFYSISFVDTDDDCRIVHWSTYVNDDEYGPFLEAAIGA
RGPFHGDEYMQALARHFEKHGITL
392417435YP_006454040.1 hypothetical protein Mycch_3628 [Mycobacterium chubuense NBB4]MRLTPLPAEEWNDDVVRALSVLMPPERAQPDRAGNMLGTFARHPRLTKAY
LTFNVHLLMNSTLSQRITETIVLRTAVRRGSRYLWEHHVPLGKRAGLTDN
ELEAVRVGSGIADPLEASVVAAVDELHDRTAITDATWGELAARLNDQQLM
DLVFTAGCYSLLAMAIESFGIEDEGGDG
392417434YP_006454039.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MPYDKLFIGGVWRAPSTGNRIEVVSPHSEAPVARVAAAGPADVTAAVEAA
RTAFDSGPWPRTDPADRVEALRRLAALYGERRADMAELITAEIGAPISFA
HRAQVALPWMVMKAFCDLAETYPWREARPGLYGSDIHIRREPVGVVTAIV
PWNMPQFLIVTKLIPALLAGCTVVLKPAPEAPLDALLLAELIDEAGLPPG
VVNILPGDGAAGQALVSHPGVDKVSFTGSTAAGKAVAAACAGDLRKVSLE
LGGKSAAIVLDDADAASVAAGVRSASLSNSGQICNALTRILVPESRASEF
TQALAAEMDSLVVGNPADTATQVGPLVAQRQQKRVLDYIERGVADGARIV
TGGTGMPAGLDRGWYVKPTLFDNADNAMAIAREEIFGPVLTVISYSDTAD
AIRIANDSDYGLAGSVWTADDERGLAVAGEIRTGTFGVNQGYTMDPFAPF
GGVKASGYGRELGREGLDGYIETKSIAVAAR
392417433YP_006454038.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MARFPKPAEGSWTQHYPELGTGPVSYEDSIDPQFYEVERKAVFRRAWLNV
GRVEQLPRKGSYFTKELKVVNTSIIVVRTTSGDVKAYHNICRHRGNKLVW
NDMPLEETSGVCRQFTCKYHAWRYDLDGNLTFVQQEGEFFDLDKSRYGLV
PVHCDVWEGFIFVNFAPEPEQTLRDFLGPMITDLEGYPFDSMTSRFHYRS
EVKANWKLYMDAFQEFYHAPVLHANQSPTAYSKAAAEAGFEAPHYRIEGP
HRLVSTSGVRAWEMAAEMRKPIEDICQSGLFGPWDKPDLGQMPPGLNPAK
CDPWGLDSFQLFPNFVVLFWGQGWYLTYHYWPTSFNTHIFEGTVYFPQPR
TPRERIAQELAAVSFKEYGLQDANTLEATQSMIESRVLDDFLLCDQEVLI
RHLHKETAAWVEDYQRKTAGV
392417432YP_006454037.1 hypothetical protein Mycch_3625 [Mycobacterium chubuense NBB4]MAATTQAKLPPEFADLEQYSDWCLGSEAERYAKRLASSMTEMQAFYDAVT
ARAEEAISYCDKFSLDDLPDDVLNLMHLLYSMIQVSFPVECWKQPKVPDS
GATSLDCDAEPRP
392417431YP_006454036.1 amidohydrolase- imidazolonepropionase [Mycobacterium chubuense NBB4MTGPSGGAVTVLRAARWADVEAGEVRSPAVVVIEGNRIRTVDSVELNDDS
AEVIDLGDVTLLPGLMDMELNLLIGGPGGPEGLPSPMHGVQDDPAYRTLR
GAVNARTTLDAGFTTVRNLGLMVKTGGYLLDVALQRAIEQGWHAGPRIYP
AGHAVTPYGGHLDPTVFQRLAPGIMPLSVAEGIANGVDDVRACVRYQIRH
GAKLIKVSASGGVMSHSTAPGAQQYSDEEFAAIADEAHRAGVRVAAHAVG
DSAVRACIRAGIDCIEHGFLATDDTIQMMADTGTFLVSTTYLTEAMAIDR
IAPELRKKAEVVFPQAQAMLPKAIAAGVRIACGTDAPAIPHGQNAKELCA
LVARGMTPMQALRAATITSAELIEADDELGRLAPGYLADIIAVAGDPSQH
IETTLDVRFVMKDGVVHKDLSSASRAHR
392417430YP_006454035.1 transcriptional regulator [Mycobacterium chubuense NBB4]MKARDVADIELTDNILWLLKQAFYFSLTTVNDAVSEHGVSTAQIGVLRQL
AGEPGLSGAELARRLLISPQGVQLALTALEKRGLVQRKQDPQHGRILQAF
LTVKGRKVAAAVVNDAIAAHDKVFGVLSSAEQETLKELLGRVVEQGTGHK
LYTDHVDN
392417429YP_006454034.1 flavodoxin reductase family protein [Mycobacterium chubuense NBB4]MSDVISAEGFAPLRIKRVVQETSDAVSLVLDVPEHCSHRYRYRAGQFLTV
RVHVEGRELRRCYSMSSAPLDDELRITVKRDRGGIVSNWLNDTAAEGGEL
HVAPPEGRFVLPEATADSDALVAFAGGSGITPIMSLVRTALAESARSVRL
FYANRGPDSVIFSDALARLAERYDDRLVLQHHYDSDSGVVTASAVASFVA
GTGTADCYVCGPAPFMETVENALVSSGLPRARLHLERFTVAQVPPGVTDD
CGEATEEVVIDLDGSRVTAAYRAGNTLLQTARLAGLKAPYSCETGSCGTC
MARIVDGSARMLNNDALDDDEVEEGWVLTCQSLPTSRRVHVVYE
392417428YP_006454033.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMTRVARVAVVTGGASGMGEATCHELGRRGHRVAVLDLNGEAAQRVAEELR
ADGVTALGVAADVTDRQAVEEAFAKVRTELGPVHILVTSAGLVDFAPFVE
ISPQAWERLIDVNLNGTFHCAQVAVPDMLDAGWGRIVMISSSSAQRGSPG
MAHYAASKGALISLTRSLAREYGPVGITVNNIPPSGIETPMQHQSQAAGL
LPPNDQMAASIPVGHLGTGDDIAAAVGFLCSEQAGFITGQTLGVNGGAVM
392417427YP_006454032.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium chubuense MARWPKPPEGSWTEHYPELGTGPVSFRDSTSPEFYELEREAIFKRAWLNV
ARVEELPRVGSYLTKEIHAANTSVIVVRGRDQQIRAFYNVCRHRGNKLVW
NDFPNEEVKGTCRQFTCKYHGWRYGLDGELTFVQQPGEFFDLDEKRYGLA
PVHCDVWNGFVFVNLDREPRQTLREFLGPMITALDDYPFEMMTERYDFVA
HNNSNWKIFADAFQEYYHVPSLHSQQVPSEVRQPNAAFECGHFQIDGPHR
LVSTAGTRRWLLAPEYMYPVERATRSGLVGPWRTPETHFSAGLNPGGIEP
WGITNFQIFPNLEILIYHGWYLLYRYWPTSHNTHKFEAYNAFHPARTVRE
RIEHEVASVVLKEFALQDAGMLGGTQAALEYGLGEPIVDDFPLNDQEILV
RHLHKVAVDWVEAYVGEDEAERSAVGV
392417426YP_006454031.1 hypothetical protein Mycch_3619 [Mycobacterium chubuense NBB4]MAETRLPGAFAELEPFAEKWCLATEPQRWETRLNTPMQEIHAFYDAFSPR
FEEAIDYCDKFPIDDVPDDALNLLHLVYSMIMVSMAVEVFGTQKPADSAD
AVIDRVSAPVP
392417425YP_006454030.1 putative taurine catabolism dioxygenase [Mycobacterium chubuense NBMTVLTINKLTDSVGAEVLGVDSERLASDPTLGAAVLDALEDNGVLVFPGL
RLGPDAQVAFCRHLGEVDHSSDGHHPTPGIYPITLDKSKNSSAAYLRATF
DWHIDGCTPVGDECPQKATVLSAVQVADRGGETEFANSYAAYEAFSDEEK
DRFSGLRVVHSLEASQSRINPDPSAEDLARWRARPTHEHPLVWTHRSGRK
SLVLGASAHYVVGMDRDEGEALLAGLLARATAPHLVYSHRWSVGDTVIWD
NNGVLHRAAPYDPDSPREMLRTTVLGDEPIQ
392417424YP_006454029.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTEDLTTVDFFRDGRLTDDPYTFYEALRNKCPVSREDHYGVTMVTGWQEA
VDVYNDAESFSSCISVTGPFPGFPVPLEGRQDEDLTELIKQHRDEIPFSD
QLPTLDPPTHTNHRALLMRLITPKRLKENEDAMWQLADDILDDFLAPGRG
EFIKGFAGPFTLRVIADLLGVPDEDRAELIDRLARGTHGSGLGNAEKTLA
KTPLEYLYEVFATYVEDRRAQPRDDVLTGLATATFPDGTMPDVGDVVRVA
TNVFSAGQETTVRLLSTALKVLGDRPDIQAKLRGDRSLLPNFIEECLRIE
SPVKGDFRLSRVPTTVGDQHVGAGTTVMVINGAANRDPRRFEDPDAFDPE
RKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTSDIRISESEHGP
AGARRYKYIPTYILRGLTELHLEFDVI
392417423YP_006454028.1 ferredoxin [Mycobacterium chubuense NBB4]MRVRVDEDRCAGHGMCLTLCPEVFEMTDDGWAVADPGEIPASLEAATREA
IDNCPERAISEID
392417422YP_006454027.1 hypothetical protein Mycch_3615 [Mycobacterium chubuense NBB4]MAKGYVIITEEVKDPAGMAEYGKLASKTMAGATLLSIGHNPEVLEGEWPA
TQTVVLEFESVDAAKEWYYSDAYQEAVKLRQAAADCNGVIISGF
392417421YP_006454026.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMRFVFVHGGFHAAWCWERTITALEALGHDAVAVDLPGHGTRVHEESTLAN
RCEAIVSALEAGGAGHSVLVGHSGGGFDATLAADARPDLVGHIVYLAAAL
PREGRTYPEAMAMRDEDDELGEQFDGDVGAMLSYLHFDEDGAMTFADFDG
AWRYFYHDCDEATARWAFERLGPERFGDTTVTPVSVPRFWEADLPRSFIV
CEQDRSMPRWLADTVARRLGVTQLSIDASHSPFLSRPRELAELLVHATAT
EAVGPLVPH
392417420YP_006454025.1 cytochrome P450 [Mycobacterium chubuense NBB4]MTTSAELVFDPFSEEFFNGPWEIYRRMREEAPVYYNADYDFYALSRHEDV
AAAFKDFQTYSSAYGLDLATVKADEPLPVKMIIIMDPPEHRQMRSLVNKV
FTPRAIGNLKPMVAATIDRYISRVDPERFDVVGDFSALFPVEVITEMLGV
PQDDRQKVRQWVDTSLHREPGQIEMSDEGMQAVAELMGLYYNIIQERRAE
PSDDMFSRLIAAEVEREDGEKESLDDFEIAGFATLLGGAGAETVTKLVGN
AAVTFARFPDQWQKLLEDRSKIPAAVEELLRYEAPNQYNVRRSMREVRLH
GVTIPAGKPVFLLGGSANRDPEAFTDADVFDIDRDRTEAQNLGFGYGVHS
CLGAALARMESAIALERLLDFMPRYEVLWDRCERVAAQNVAGWSSVPVHV
TR
392417419YP_006454024.1 ferredoxin [Mycobacterium chubuense NBB4]MTRKVEVDFGLCESNGVCMGIIPEVFELDENDYLHVLSDEVTPENEQQIR
EAVRQCPRQAISIRDE
392417418YP_006454023.1 cytochrome P450 [Mycobacterium chubuense NBB4]MAAPELRFDPVAQDYFDNPYEIYRRMRDEAPIYYDAEQDFYALTRHADVA
AAFKDYESFSSARGCDLGMVRSGEVPQKSIIFMDPPDHRHMRSLLNKAFT
PRAIQSQRDTVTELVEHYLAKADPNNFDVVQDFSGPFPVEVITRMAGVPE
DFRQQVRHWIDTSLQREPGQISWSEENMKANIDSGVYYYGLVLERRENPQ
DDMISRLIAAEIPCENGEMRKLDDVEIAGFATLLGGAGAETVTKLVGSAV
VVFAEHPDQWQMLLDDRSKIPDAVEELLRYVGPVQYNVRYSLRDVELPSG
TVPANKPVFLMGASANRDPRAFDDAETFDITRDRSQAQNLGLGYGIHSCL
GAALARMESAIALDHLLDFMPRFEVDFDGLERVHMQNVAGFHHVPVKVLR
392417417YP_006454022.1 beta-hydroxyacid dehydrogenase- 3-hydroxyisobutyrate dehydrogenase MDEEQKTMSTVGFVGAGRMGAPMVRRLAEAGHDVRALGRTSEKRRAVQEL
GAHAVSEPGEVADGADVVVVCVFTDDQVREVCLDGGLLDAMPTGSVLVVH
TTGSPRTVEELAARRPEVAVLDAPVSGGPHDIAAGHITLFVGGDDAAVER
ARPVLAAYGEPIVHVGRPGAGQWVKLINNTLFGAQLGMLREAVSFGGRVG
VDETGLLSAIGHGSAASRVIGLVEARGSVQSFIDSVGEFIGKDIAVVRGI
AAETGNSLGALEGLLDTVVGEDALSESNR
392417416YP_006454021.1 beta-hydroxyacid dehydrogenase- 3-hydroxyisobutyrate dehydrogenase MMRVGFIGLGSQGGPMARRIAEGGFETTLWARRQASLDPFADTPAKTAAT
PSELAAASDLVCLCVVGDDDVREVLEGKTGVLAGLAEGGIVAIHSTVHPD
TCREIARKAAAQGVSVLDAPVSGGGPAVEQGTLLVMVGGDEDVLDRCRPV
FETYADPIVHLGPLGAGQNTKILNNLLFSANLGSAVSTLELGEALGVARD
KLVEVLNRGSATSKAVGSISMFGGTLDGLAPIAGALLQKDVRHAASLAAA
AKAPEGAVFTAADAALEAMGHRRR
392417415YP_006454020.1 lysophospholipase [Mycobacterium chubuense NBB4]MSSSTPRPRVVVVDGVPMSALVSQAADPRAVIVAVHGGATSSAYFDCPGH
PDLSLLRSAAARGYTTIALDRPGYGMSAVYANEFADAARRVQFAFGAVDQ
ILADSSRGAGFFLLGHSAGCELALRMATSRDDVIGVELAGTGIRYSAPAK
EVISQATLTSRPAGLRDLLWQPTDLYPAEVLTGGLSSPGAAYEAEVTANW
ARRDFPAIAARVTVPVQYSVAEHEKVWESTPGALDAVAALFTASPRVAVN
AMPRSGHNLSVGLSAGEYHRRVISFVEECIAGDREPTEVEAG
392417414YP_006454019.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MSGETRMPLPQLTFDTEFFWTSGADGTLRIQECQGCSALIHPPQPVCRYC
RGADMGVRAVSGKAVLSAFTVNHRFSIPGLPAPYVVAQVALVDDPRVRLT
TNIVDADPDDLEIGQLVEVTFEQNDDVYLPLFRPVSPKQFGDEPADEIAP
EDFGKHVRPMLTTEKFEEKSAITGIGASRLGRRLMVSPLSLTIEACQAAV
ADAGLTFDDIDGLSTYPGLDVAGMGEGGVTKLEGPLGIRPTWINGGMDTF
GPGGSVIAAMTAIATGMARHVLCFRTLWEATFQQLMKEGKASPPGGARTD
SFQMPFGALSAAHTLALNAQRHFHRYGTTRETLGWIALNQRANAALNPTA
IYRDPMTMDDYLGARMITTPFGLYDCDVPCDGAVAVVVSAVETAADRPKP
PVMIEAVGTQIIERTDWDQTTLTHEPQVLGQAAHLWTRTSLRPNDVDVAE
LYDGFTFNCLSWLEALGFCGIGEAKDFLDGGGAIARDGVIPLNTHGGQLS
HGRTHGMGLVHEAVTQLRGDAGQRQVDGARVAVVSSGGLTPSGVLLLRAG
T
392417413YP_006454018.1 ferredoxin [Mycobacterium chubuense NBB4]MTDRLRIKLDRTLCDGFGICAKHAPEYFSLDDWGYAVLVGDGDIPERDHD
AVQRALMDCPVHAIMELTERRPDDAPIPEVNEPDLDQLKTEDNEAEWGFS
R
392417412YP_006454017.1 NADH:ubiquinone oxidoreductase- NADH-binding (51 kD) subunit [MycobMSTAMNAGPTVATWPGLAPRLLRTEAGVETLAEYRGAGGYTALSDPQELL
DEIGRAGVLGRGGAAFPTAVKLATVRRAALRGVDTVLVANGEEGEPASVK
DRWLLRHRPHLVLDGLRLAAQIIGARHAHVYVSDSLAAQTIRSALDDATT
DALDGITVGVRTVEAGYVAGEETAAVRAINGGPAKPTDKPPRPFEEGVGG
LPTIVSNVETLANLPFVHRYGALSYRQAGTDGSPGTFLATLTGGGRGAGL
YEVPFGTPAAELFELHGVPAQQIRGALMGGYFAGMLDRRILDGTLDHAAL
RELGSGLGCGAVSVLTEECPVAVGAAVLDYYSRENAAQCGSCFNGTAAMA
AAAAALRDGVADADDLARLRRWSVVLRGRGACATLDAATNIAASLLAMFP
DDVARHLDGRCPDCAEAPFTAQRPFEVESL
392417411YP_006454016.1 hypothetical protein Mycch_3604 [Mycobacterium chubuense NBB4]MRTAVVRIGVDPAGELTGAELTTGMTELATLAAEAGARVIANDLAGLPPK
RREVEILMTGTEPSALQNAAVELCRRAFPTQPVIGVLTFISHGTDDDARG
VLAGFGLTGVIDRRPGGDGWDIITVTLRRADLERIPESRIHTALEASTNC
EVRIVLTD
392417410YP_006454015.1 hypothetical protein Mycch_3603 [Mycobacterium chubuense NBB4]MATAGPKLRRGEKIFEVNGGNVVYEILGREGEFIALTPGGRFSKDIDGLR
PLAQALVKGGYRVLLWDRPNCGKSDVQFYGQSESHMRAETLHALITGLGI
GPCILAGGSGGARDSMLTTMLYPEIVRKLVVWNIVGGIYGTFVLGSYYIV
PSILAVRGTGMPGVAGIGEWRERIAENPANEERILSFDRDEFLKVMLRWL
NAFVSKPGQTIPGVDDEMFDNITVPTLIIRGGENDMDHPKRTSLEVSCLI
KGSTLIDPPWPEDAWERASEQRAAGKVKRFNMFDTWVQAAPAILEFLGR
392417409YP_006454014.1 ferredoxin subunit of nitrite reductase and ring-hydroxylating dioxMNDAQKTPRLAQGREHVVATVDEIPPGTHKLVPIGRHGVGVYNVNGTFYA
IANYCPHEGGPLCSGRARGRNIVDENVPGDAVMVRDMEFIYCPWHQWGFE
LATGTTAVKPEWSIRTYPVRVVGDDVLVQA
392417408YP_006454013.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMTVTETRERVPAAERIAIRCVDSDVHPMPRRGELLEYIPEPWRTKYFTNH
KVGELIYYDAPDYAHAYAMRVDTFPKDGEFAGSDPDLMLKQLVMEAGADV
VILEPTDRIARLPEATAAMSSAVNSWLANHWLDSHNNWHQRWRGSICAAI
EEPELAAREIEKWAGHPYMAQILIKAEPRPSWGHPRYDPIWAAATKHDIT
VSCHLSRGTYETLPMPPVGLPSYNHDFMVSYSLTAANQVMSLIFDGVFDR
FPTLRIVFVEHAFTWILPLMWRMDAIYDKRRQWLDIKRKPSDYVKDHIKF
TTQPLDYPEDKTELSRAFEWMECEKILLYSSDYPHWTFDDPRWLVKHLPE
HAREAVMFKNGIQTYKLPETVPALEGQVRVF
392417407YP_006454012.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMIEISHGAQTLSVPVIDASVHIFFGSNKDLRRNFLREPFSSRGFPDYEMD
WYGAPGGEYAAGTTGPDREYPGSDVGIVAEHLFADRGVDVAVLHPMTRGI
MPDRHLGTAIASAHNEMMVSRWLDDERYGERFRGTLRVNPDDIAGALREI
AKYKDHPRVVQIGIPLQSRELYGKPQYWPLWEAAAEANLPVAVHIETGEG
IASPPTPNGHTLTYEHFLSFMSLNYVYHLMNMIAEGVFERFDTLRFVWAD
GAADLLTPFIWRMDCFGRPHLEQTPWAPKIPSDYLPGHVYFVQGGLDGPG
DAEFAGEWFGFTGKDRMVMFGSSYPHWHMNELTVPATFTDEQRDRLCWRN
AAELYGIDIPVGSVAQ
392417406YP_006454011.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MLLEFDADQRLWQETVRDAVSKQCPPSLIRDIAENGVDPAPLWTGYLDAG
WTELTDPDNAVELAIVLEELGRATDPTPFLATVTQFAPLVGERFDPQSSG
AAVYTGVTAVRDAQGWVLNGTDRFVLDGDRAERVAVVTPGGVFLIGGNQL
TTRRVDVFDPVLHVAEVSFAGVRVAESERLPVDVERARHLALMGMAITMV
GACQRILDLALEHAKSRQQFGVAIGTFQAIQHKAADMHVAIERARALSYF
SALTIAADDPRRRLAAAMAKASAGECQALVFRHGLQTFGAMGFTWENDLQ
FALKRAKAGELMLGGAAEHRALIAAEYGRDL
392417405YP_006454010.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MQLAFDSDVEEFRAEFSAFLDEHTPSAAETLERPRSVSHMPQWARDWQRL
LFDNGWLLPAQPPEFGGRNATVLQTFVHAEELCRRRIYHSFNPQGVNIIA
ASLLTFGTDEQKHKWAVPVLRGERTASLGMSEPSAGSDLASLRTKAVRDG
EHFVVNGQKVWTSGAHDADFLLTFVRTDPDAPKHKGISVLLIPTDLEGVV
CRPFADMCGIENLDFNEVFFTDARVPAENLVGPLNGGWGVANGSLGHERT
MMWLGFADRIANCIADFRPNTAPERDALATSIMDYEALRLLGSVGIAKAA
RGEVDVASVSIPKLLGAEAEQRVEVLALEAAGPDGLIHPATSGPYAHMNL
DHYFASWFERYARSFGGTIAGGTSEIQRNIIAQQVLGLPRR
392417404YP_006454009.1 flavin-dependent oxidoreductase- F420-dependent methylene-tetrahydrMRVQPAAFLRTTLPLDLSHLDQLDSGRYHSIWLPDHMVSFWPDSIWTPEF
TDLATVSPSPHRHLDGMAVAAAAAVLTTNVPLVTSVVDTVRRHPSSLAQS
ALTLDHLAEGRFILGLGSGESENITPYGFDFSRPVSRFEEALQVIRLLWE
SEGPVDFDGRFFRLRHARLDTEPFGGSYPRIWVGASGPRSLDIAGRYADG
WWPAGAWTPEDYAEKLSVVRTSADRAGRDPQAITPCFIQVCLMGRDDAAL
AEILEAPLVKSFLLQVPAPLLSGLGFEHPMGDDWAGFHDIDPASLTRERI
AEFLDRVQPEMLLAVVPHGTPKQVARIIADYVDAGLRVPKILDYGAMAGL
AYTAASADNVRAAEDELMRLCEGVR
392417403YP_006454008.1 sulfotransferase family protein [Mycobacterium chubuense NBB4]MTLDAAAILERAESATGLRDYGDATLPARFAVAVTQLNALGMDADGCRRA
EEVCHGLLTTRLEFFSDRNRYPVDQEVIDRPMFVTGEPRSGTTLAHALMS
VDPGARALRFWEVMYPSPPPGAAASVETRRARADADWREINAQMPKWLHS
HPYNDMLGDGLPEDERTWAFDFRVMTPTAWWRVPMPTVVGGLPTDAAAQY
RIHKAMLQQFQYRRAVKRWVLKGFHGFRLAELFAAYPDATLMWLHRDPVQ
VAASRTMMMADIGEGIVGPVDLQAAAKMHLELTRASIANTMTNPLVDDDR
IMHVRYADFLADPVGTVRAYHAFGRRALTDAADTAMRRYLANNRGDRHGK
FTYSTALLTDIGEDIEALHDEFRPFRERFGVEIERRGQ
392417402YP_006454007.1 xylose isomerase-like enzyme [Mycobacterium chubuense NBB4]MSAIDARLSVHNVTFLGATLDELCTYWEALGVTRLSVIDTQLQELRLADV
IDAHGFTVETVYHLFSSTDGLRRVIDAAAAIGARAVYMLTGGRGGAAWEE
AADAFCTAVQPCRTDARGAGVTLAIENASPLYADIHIAHTLRDTIELAEM
ADIGVCVDLFHCWTEAHLPVLIERALPRTAMIQLSDYVLGDRALPGRAVP
GDGAIPVEQVVAQVLAGGYPHGFDLELIGPRIEREGRLQAARRACETVSA
MLERAG
392417401YP_006454006.1 hypothetical protein Mycch_3594 [Mycobacterium chubuense NBB4]MAFGDGPDDAALNAAWNTFCDRLRAAGEQAFKDHNPTAGAQRVDALRFLT
QNLGQAFDLALETRNTRYPSLHAFCGPTRKLGGDCADFTYQQAWIDGEST
YRIVGERGTARFLNVTVQGPRPEGPGVLHEPFGDVPEANLSGEQLDVAPD
GTFEIHIGGPPRAANWLPTTAGSRKLFIRQGFDSWEERPARLRIERVDMT
APKPLPTAGQMIDAIEWAGDFLTGVMGDWPEFPFTYGGVDADRPNRFPAV
ASADGDVRRGRAAVNMHWSLAADEALVIEFDAHAGLWMLTNMGVFFNSMD
FLYRPVSYTPSRTAVDGDGKVRLLLAHHDPGYHNWLDTQGFERGNVTYRH
MLDGRPAVLSTTLVRHSELSSVLPADTATVTAEERTAQMWLRFNAIRQRY
ALL
392417400YP_006454005.1 hypothetical protein Mycch_3593 [Mycobacterium chubuense NBB4]MKLGRIATAIITLAATATVLAPPSQAAMQLGNYDLLTNRYDRASWVWFAA
ACIPEKFPDCVHIGARPRLKYYAYYEGKAVLADGRYTLNVEVPDGLRCPG
YNMPTHETYSWDAVTLVGTIDSRFDVGCFNGPPGTQFWTFALQRL
392417399YP_006454004.1 cytochrome P450 [Mycobacterium chubuense NBB4]MSVDDVVDGTADDSRKQHTYYFDRHTPEYRLQFEKITEEMHSKCPVAWSE
TYNGHWVAAGSKQVFELARCPAVSNHHDISGETPYQGITIPKASRATVVR
GGILEMDEPEHSAYRGALNPYLSPAAIKRWEPFIDEITRAALDEHIESGR
IDFVDHLANVVPAVFTLAMMGIELKKWNVYSEPTHASVYTPEHAPEREKI
NEQHREMGVDLINNMMEIRQNPRPGLVNALLQLRIDGEPAPDIEILGNLG
LIIGGGFDTTTALTAHALEWLGEHPEERTRLSRERATLLHPATEEFLRFF
TPAPGDGRTFSEDVEVEGQQFKKYERLWLSWAMANRDASVFEHPNDVVLD
RKGNRHFSFGIGVHRCVGSNVARTVFKSMLTAVLDRMPDYVCDPEGTVHY
DTIGVIQGMRHLPATFTPGTKLGPGLDETLDTLQRICNEQELARPITERK
EAAVIDLA
392417398YP_006454003.1 ferredoxin [Mycobacterium chubuense NBB4]MKVFVDSSRCQGHTLCSMIAPDSFELSDIDGTSSPVNEVVPPDQEAAVRE
AAQSCPEQAISIEE
392417397YP_006454002.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMGRVQGKVAFITGAARGQGRSHAVRLAEEGADIIAVDLCENVDTIGYPMA
TPEDLDETAAFVEKTGQRIYTAKADVRDASQLKKALEDGIAALGGVDIVV
AQAGIAGMKGNPPLQAWTDVINTNLIGTINAIQVSLPHLREGAAIVATGS
TAALMDAHNKPNPGGDPGGMAYMTSKRLLSQYVHDLATELAVRGIRANVV
HPTNCNTDMLQSPPMYKSFRPDLENPTRADAEPVFGVQQAMKVNFIEPED
ISNAILWLVSDEARYVTGMQLRVDAGGYLKWYDYHI
392417396YP_006454001.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMKNAVVTGGGSGIGAAIAERLRADGLSVATIDLNPGEEKFSYTADVTDRA
AVDAALDEIRAELGPVTVLVNAAGLDRFKRFTDLTFEDWQKVIDVNLNGT
FHCIQAVLPDMIEAGWGRIVNISSSSTHSGQPFMAPYVAAKSAVNGLTKS
LALEYGPNGITVNAVPPGFIDTPMLRKAEQRGFLGDTQKQIEATPVRRMG
RPEDIAAAVAFFASEEAGYITGQILGVNGGRNT
392417395YP_006454000.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium chubuense NBB4]MQETATISSGRGSANGEARHVERRLLIDGQLLETARTFPSSNPATGEVLG
YAPDADVSDAEAAVAAARRAFDTTDWSTDVALRVRCLRQLHTALVEHRDD
LAALTIAEVGATEALCQGAQLDQPIEIVRYYADLLETYPMTEDLGNIESR
GMQHHRWVEKEAAGVVAAIIAYNYPNQLALAKLAPALAAGCTVVLKSAPD
TPLITLALGELIAEHTDIPAGVVNVLSGADPAVGVALTKSPDVDMVTFTG
STPTGRAIMAAASETLKKVFLELGGKSAAIVLDDADFGTAALFSAFSMVT
HAGQGCALTSRLLVPEKNKDEIVELIKSNFGHVRLGNPVDPSVYMGPLIS
EKQRDKVDGMVKRAVEAGATLVTGGEKVDPGFFYTPTLLADVDPDSEIAQ
EEVFGPVLTVIAYSDDDDAVRIANNSIYGLSGAVFGSQDRALAVARRIRT
GTFSINGGNYFSPDSPFGGYKQSGIGREMGTAGLEEFLESKTFAVVVPEA
VS
392417394YP_006453999.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTKPLQGIRVLEVAMYGFVPSAGAVLAEWGADVVKVEHAVTGDPQRGLRQ
TGLLRVEGDPNPNIEHANRLKRSIGLDMSVPEGREVLLELARRSDVFLTS
FLPGHRQKFGIDVDDIRAVNPKIVYARGSALGPRGTESVKGGYDMTAFWC
RAGTAATITPPGTPGMVGPPGPAYGDTISGTNLAGGIAAALLKRERTGEP
SIVDVSLLGSGLWSMGHTVALTKHLGQRMEAFPPGVHGSPINPLVGLYAT
ADDRYISFVMMQPTKFWADVCRHMELDELADDPRFSSAEAIAENTAAGVE
LLSEAMAKRTLVEWSERFATLAGPWAPVQDTLQAAEDAQVRANEYLVRAG
ELELVANPVQFDVAAPTSGPAPGFAEQTDDILAELGLDWDRIIELKTAGA
VT
392417393YP_006453998.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMPYVVSVGTYLPCWGSPLHRVAGDDEDAVTMAVEAGRAALTAGGAVERVV
LVSRDLPLVESSNAAVLLAGLGLDPELEVDERLGGAPATVDAVSSARPRT
LIIGADLDRAGAAAIVTGEQGLRVRTAARVARSLPVRTRDAIGDVHDYGD
PRLLHERGLIASLAAAWLDTPVAVAGVDHERAADLCLGDPPVLPTSGASS
SLFALAGLAERAVEGPLVAVEQAILSGITVSGGTARIHRREPAPHPLPDG
RSASDADIPISLAAYERAFEAKVRWEAGRFGDSGDLDFPPRYRVGDDGAL
ATDYELVPLPRTGRVYTETTVHIPVPGLRTPYSLVIVELDGVDVRALVKV
TGAAPGTVDIGDRGRLALRRVAVRSGVPDYGYAFEPEPSGSRSRGAA
392417392YP_006453997.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MRQVAIVGAGMTPFAEHFALGIKDLLPMAYAECARTVDKGLAKTDLQAAW
FGAMGTADGFPSGILADTLGLPDLPVSRVENSCGTGHDALRNALFGVASG
AFDVALVMGADKLRDTTSADMLWEWEAMARDMAWDYPLGLVAPAGFALHV
RRYLHESPATEEHLAMVAVKNHRHGLNNPKARLRFEITMEQALNAPTVVT
PFRLYDCAPQSDGAAALVIAAEDVVDRFTDEPVWVRGVGLGLDSVMHQHK
PDMTTFPATTRAAKQAFAMAGMTPRDVDVAEVHDFLTGIELMSYEDLGFA
ERFGGYKLLETEVTTVGGSLPVNPSGGLKAKGHPPGATGVAQCVELFGQL
RGEAVNQVDGARVGLAHNIGGPTAVAAVTILEGPEAHGD
392417391YP_006453996.1 ABC-type transport system involved in resistance to organic solventMATKGPERWSTGISLPNGVSGAMQAVGGFFAMALDAVRFVFRRPFQWREF
LEQSWFVARVSMAPTLLVAIPFTTLVSFILNILLRELGAADLSGAGAAFG
AVTQLGPLVTVLIVAGAGATAMCADLGSRTIREEIDAMEVLGINPVQRLV
TPRMLASGLVALLLNSLVVIIGIVGGYVFSVFVQDVNPGAFAAGITLLTH
VPEVIISCVKAALFGLIAGLVACYRGLTISGGGAKAVGNAVNETVVYAFM
ALFVINVVVTAIGIRMTTR
392417390YP_006453995.1 ABC-type transport system involved in resistance to organic solventMGTSAVVRARFPRLTRNAGRPVAWLAGIGDHMLFYGRALKGVPHATVHFR
KELIRLIAEISMGAGTLAMIGGTVVIVGFLTLATGGVLAIQGYSSLGNIG
IEALTGFLSAFINVRIAAPVVAGIGLAATFGAGVTAQLGAMRINEEIDAL
ESMGIPPVEYLVSTRIAAGMVAVTPLYAIAVILSFVASQFTTVFLLGQSS
GLYSHYFDTFLNPIDLLWSFLQAILMALAILLVHTYFGYFASGGPSGVGV
AVGNAVRTSLIVVVTVTLLVSLSVYGSNGNFNLSG
392417389YP_006453994.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MSKSYARPLAGLGLIVTLVVIVAVAIGLFSGKFTKTVPVTVISDRAGLVM
NPQAKVKMRGVQVGTVKSIDYQPDGTAALKLDMDPSQMHLIPSNVKVDIA
SSTVFGAKFVQLEPPPHPSGEALRSGQVLRGDHVTVEINTVFQQLTNVLD
KVDPAKLNETLGAIAQAFNGRGEKIGKTATDFNALLAKLEPSLPNLAHDI
EAAVPTLNAYGDAAPDLLQTFDNTSRLSNSIVDEQQNLDQFLVSAIGLAD
VGNDVVGTNRQGLTDVLHLLVPTTSLLNEYRKSLWCGIGGLIPFAKSPPQ
YSGIIVSAGLTLGVERYRYPRDLPKVAAKSGGKDYCKELGLPVQPAEFVP
PLIVGDVGSNPAQYGNSGILLNSEGLKNWLFGPLDGPPRNTAQIGMPG
392417388YP_006453993.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MTRSTGTLIKFSIFGIVMVVLTAFLFLVFSDARTGASNQYSAVFKDASRL
KSGDTVRIAGIRVGTVKGVELQADRNVLVKFDTDRSTVLTTGTKAAIRYL
NLVGDRYLELIDTPDSTHIVAPGAQIPETRTAPALDLDLLLGGLKPVIQG
LNPQDVNALTSSLVQIFQGQGGTIESLFSKTSSFTNSLADNNQVIEQLID
DLRTVLDTLSTDGDEFSGAIDKLEKLVSGLSSDRDPIGTAIESLDNGTAS
LADLLGRGRAPLNDTIDQLNRLAPLVDNDTERLDATIQRLPEIYRKLARV
GSYGAFFPYYICGITFRASDLQGRTVVFPWIKQETGRCVDK
392417387YP_006453992.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MLKYRGSQLARAGFIGVVLIILVIAVGLQPERLLSWATAIRYQALFTEAG
GLMAGNDVTVSGIKVGTVSSVELDNGDALVGFTISGKYALGSETSAHIRT
GTLLGERVLALDSAGSGTLDPRQPIPSTRTSSPYSLTDAVSDLTNNTAAT
STESLNQSLDTLAQTLDQISPQLGPTFDGLSRLSQSLNNRNQSLAELLKT
AGKVTAIFSDRSSQVNTLILNANDLVAVLNERRMAITSLLSNISAVSKDL
TGVVADNEKELAPALERLNHVTAMLEKNRDNLAKMLPGAAKYYLTQGEIV
SNGAYYNALVPNIQPAQILQPFLDYAFGFRRGVNAGQPPDNAGPRAEIPF
PVNGIPQPGDLPNDGNP
392417386YP_006453991.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MMATRKRVAAGTAVLLAILLVAGAVFLVRQVFFAPITITAYFPTATAIYP
GDEVRVSGVKVGKIDTIEPDGTQAKMTLKVDRGVPIPAGAKAVIVAQNLV
AARYVQLTPAYRSGDGPKMHDGAVISSDRTAVPVEWDEVKTQLMRLSTDL
GPKAGESGTSISRFVDSAANAMGNGNGDKLRATIQQLSGAARIFAEGSGN
IADIIKNLQTFVTALRDSKDQIVLFQNRLASLTSVVNDSRSDLDAALTDL
NVAIGEVQRFVAGSRNQTAEQLEHLRGLTQILVDHKLDFENVLHIVPNAI
ANFENIYYPNGGSVTGAFSLVNFANPVYFFCGLIGGVANTTAPETAKLCS
QYLGPALRLLNVNNIPLPINAYLRPAVDPSRLIYTDPKLAPGGAGPGDAP
EPPPTVSAYTGKGDVPPPPGWGAPPGPQGIYMSHPDAPATPSPALYPGAP
IPGPPNIQSNIAPEPPSVDGLLLPQTPPPAAPPAPAPPNGPLLPAEGTPP
S
392417385YP_006453990.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MKRLTIVGSAVALSLSGCAFQGVNSLPLPGAKGRGPDAVTYHVEVPNVST
LVSNSPVMIDDVVVGSVGKMTVKDWHADVEISVKPDVVVPANAVATVGQT
SLLGSMHLALNPPLGQQPTGQLQPGATVPLSESSTYPSTERTLSSLSTVV
NGGGLGQIGDIIHNFNAALSGRQPEIRELLIRLDEFVGVLDQQRDNIIAD
IQQLNRVAGKFAGQRDVIDRALKDIPPAIDVLIKERPTFTSALEKLGKFS
DTATGLVNDAGDDLVKNLQNLGPALGALADIGPDLNLALLWATAFPYGPT
FADRITRGDYINLFATFDLTYPRLKKTLLLGTRWGDENAKLIPAPGDPYY
LNYSYDPLKIGVAPPPDKAIPPAPEGAPGAAMPPVTGPLLPVTPPPPAAP
WLPQAQPIGPGQIFAGPYSAQAPAPPAPAAPAPPPPGAPTPGGGG
392417384YP_006453989.1 virulence factor Mce family protein [Mycobacterium chubuense NBB4]MLTRFVRNQLIIFTIASIVGVAVMIFAYMQVPTLLGIGRLSVTLELPASG
GLYRFSNVTYRGVQIGKVTGVSLTENGAEATLSLQTSPKVPADLKAEVRS
VSAVGEQYVDLRPRTDSGPYLENGSRIPASETTIPQAVGPMLDQLGKLVD
SLPKDRIPDLLDETFKAFNGTGPELGSLLDSASTITNAANGVSDQMRGLV
DDSKPLLDSQAETTDAIRTWARSLNGITAQVVQNDPQVRSILQRGPGFAQ
EVTSLLDQVKPTLPILLSNLTTVGQVLVTYNPSIEQLLVMFPGIIAAQQS
FGLPQNNPTGLPAGDFALTINDPPPCTAGFLPPSQWRNPEDETVIDTPDG
LYCKLPQDSPISVRGARNYPCMDHPGKRAPTVELCDDPRGFIPTAMRDHT
LGPYPFDPNLVAQGVQPDDRVDFGNRIYAPLQGTPLPPGAAPGGTPPEAP
APAAAPAPGPAPVPAGPLPPGQGPLLPDQALPGTPPPAPGAAPPAPAAGP
VAPDTVPAAPSAFRGNASGGPSVAVAHYDPRTGQYLTPDGQLHSQTNLAA
GGAPKSWKDLLPM
392417383YP_006453988.1 hypothetical protein Mycch_3576 [Mycobacterium chubuense NBB4]MRASRVIGGVAATVVTVMGSLGLPPSARASNFGMEFDGTYVVKSDGEWAK
TNDVFIDEQTVVETWTVRTDCVSPIECSGEVTSDHGWTGSVKLDDFWYVR
RDIPNWMPCPDGTFATGHQLYLLYGFDPAMTQRVTTTDFMAGRNVTKSDS
GACGVNKPKVIELPVSLQRVAR
392417382YP_006453987.1 hypothetical protein Mycch_3575 [Mycobacterium chubuense NBB4]MRSMNAVLAAVLAVPAWLVVAPSAIAQPPPTLPHLPPPGQECNYPDCTPG
IAPHIVLGSYCNNPTYYAFGVTDWGRLVFCGSPRRYEPRWFRSPEMHGIK
NEGDLCPALDGEVAQAPDGLFLTCVSRNSKSSWERGDL
392417381YP_006453986.1 hypothetical protein Mycch_3574 [Mycobacterium chubuense NBB4]MVFYKAVPSVAAGMVGLVTVSAVVAGAPAAAQPPLHHVHYTVGASQDTVG
SIYYREVDPPNWAEYSHNPYQYSPKADVDLGPNKPWTLDVMLADPDDWAM
VVVGLPGPTTPPLAEPGFVCELRVDDVVVKTAKGTRGALCSIRSW
392417380YP_006453985.1 cytochrome P450 [Mycobacterium chubuense NBB4]MSDFDTIDYFTDPSLVPDPHPYFDHLRTKCPVVKEPHYGVLAVTGYEEAA
TVLKDTETFSSCIAVAGPFPPLPFTPQGDDITDQITAHRPQMPMFEHMVT
MDPPDHTNARSLLNRLLTPSRLKENEDFMWRLADEVLDDIFDREPTGRCE
FLTAYAKPFSLLVIADLLGVPESDHEEFRTVLGAPRPGANVGSLDHSDLV
GANPLEWLDEKFIGYLEDRRREPRDDVLTALATAKYPDGSTPPVIEVVRS
ATFLFAAGQETTTKLLSASLRVLGDHPDIQEALRADRSRIPVFVEEALRM
DAPVKSQFRLAKKPTTVGGIDVPAGTTMMVCPGAVNRDPSRFEHPHAFDL
NRKNVREHIAFGRGVHSCPGGPLARVEGRVSIERILDRMADIAIDEERHG
PPHARRYTYEPTFILRGLTELNITFTPVGETR
392417379YP_006453984.1 transcriptional regulator [Mycobacterium chubuense NBB4]MASPRRIGAPDAKNRIVLLDAAEQMLLEEGYAAVTSRRVAERAGLKPQLV
HYYFRTMEDLFLAVFHRRAEEGLAVLATALQSPQPLWALWRFSTAPEATR
LTMEFMGLANHRKALRAEIVYYAERFRQEQNRAIADALARHGIDAAEVPA
VVWTVFATSVSQALVVERALGMNTGHAETFEFCERWLRRLEGDPLPDVSA
GDGSARLPR
392417378YP_006453983.1 acetyl-CoA acetyltransferase [Mycobacterium chubuense NBB4]MTTSAHSANDVAIIGVGLHPFGRFDKTAMQMGAEAIQAALADAGVEWKDI
QFGFGGSYEVSNPDAVTRLVGLTGITFTNVFNACATAASAIQQTADTIRL
GKYDLGIAIGLDKHPRGAFTDDPAKLALPQWYAENGQFVTTKFFGMKANR
YIHDHHISEETLARVANKNFRNGVINPNAFRRKEISVEEIMASPVLNYPL
RQYMFCAPDEGAAAVIMCRADLAHKYTDKPVFVRASEIRTRTFGAYEVHA
TSAPLDEDVSPTVYAARAAYEAAGIGPEDVDIAQLQDTDAGAEVIHMAET
GLCADGEQEKLLADGATEIGGSMPINTDGGLIANGEPIGASGLRQVHELV
RQLRGEAGERQVPGDPRVGLAQVYGAPGTASATILSL
392417377YP_006453982.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMSTTQRALAPEISTWPNDDPQLIGSRCAGCGATTFPVQQRCPKCSGGDMS
EVLLPRRGTLVAWTTQGFPPGAPYKGPTGKDFVPFGVGLVQLDDVIRVEG
RLTENDPAELEFGQEVELTVVPFTTDEDGTEIVTFAFRPVAD
392417376YP_006453981.1 hypothetical protein Mycch_3569 [Mycobacterium chubuense NBB4]MILPGPIRQIGHVVGDLDRALSGWLALGVGPWYVMRGLRQRVTYRGQPCE
ITLSLALANSGDLQVELIQQEDDTASIFTEFLGSGRAGFHQLAYWTDDFG
ATMRAVEAARWPVVWSGGADVGTRFAYAETPDGPAAVVEIMELTDATRGL
AAFLRDAAAGWDGKDPVREFGVGQA
392417375YP_006453980.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMVDLEIEEGLAVITIDRPHARNAISLETMDQLEKALDGAAGAAALVLTGA
GDRAFVSGGDLKELSALRTVEQASAMSLRMRTLCDRIAAFPAPTVAALNG
HALGGGAEFAVAADIRLAADDIKIGFNQVALAIMPAWGGAERLVELVGYS
KALLLAGTGRLISATEAERVGLIDQVIPRASFDQQWRVIARSLATTPAGR
VKRVMQGVPTTEAVAAFAHLWVSDEHWAAADKVMKKGT
392417374YP_006453979.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMRSIPAELVELYEREGWWTRETLGELLARSLDENRDVGFCVHSAVRPYTG
TFGEVAHDARRLAAGLAARGVGPGDVVALQLPNWREAAVTFWASAFLGAV
IVPIVHFYGRKELAHIMATARPKVFITAEEFGRMRHQPDLCAEVPVVGLV
GARGGRSEGTDGQSFDDLLADRPLEGTLGTDPAGPALIAFTSGTTRDPKG
VIHSHQTLTFETRQLLENYPPDRGRQLTATPVGHFIGMLGAFLIPVLEGA
PIDLCDVWDPARVLKLMERDGLSIGGGPPYFVTSLLDHPDCRPEHIARFT
TVGLGGSTVPAAVTQRLTDLGMFVFRSYGSTEHPSITGSRPGAPEAKRLF
TDGDPRPGVEIRLGPDGEIFSRGPDLCLGYTDDELTARAFDDDGWYRTGD
IGVLDEDGYLTITDRKADVIIRGGENISALEVEEVLLAMPAVAEAVVVAA
PDPRLGERTAAVLRLREGHDMPTLDEVRTHFKGAGVAAQKWPEELHRVHD
FPRTASGKVQKYRVRQDVADSAGRGLPAHQGAVASRQ
392417373YP_006453978.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium cMGQLSHRVDIPFPLFDADNHLYEPPEAMTKYLPKEYKDVVQYVEVNGRTK
IALRGVISNYIPNPTFSVVAKPGAWEEYFKYGNPDGKSKRELFGEPMKAI
PAFFEPEPRIKVMDELGVDRSLMFPTLASLIEERLSDDPVAIHVLIHALN
QWLDEVWGFNYQNRIFTTPVITLPIVEKAIEELEWCVKRGARAILIRPAP
VPGFRGPRSFALPEFDPFWERVVHHDVFVGMHSSDSGYSRYTSEWDGAAQ
EMLPFQTNAMSILNEWRPIQDAVASWVIHGALFRHPKLKVGIVEAGSKWM
FPLLDSMAEVYKKAPEAFLGNPIEEIKNRIYVSPFYEEGIDDLINLIGVD
QVLYGSDWPHPEGLAEPTHYVTALEHLSVEDQAKIMGGNLGRLVTT
392417372YP_006453977.1 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [MycobacteriumMPRWQTIPEMVASAADRFGDREAVVDGPLRLSFAELVDRIRRAAGSFVDL
GVAKGDRVALWAPNSADWIIAAFGIMTAGGVLVPVNTRFKAEEAADVVSR
SGAKAVLVQSGFLGQDYSLALDVPMIDLGSDFLCRSAPFERAPSEWLDGA
DIADVIFTSGTTGRPKGAMMNHRQTLRAYEEWATLADLREGDRYLMINPF
FHTFGLKAGLVASFLRGATMVPVAAFDVDRVVDLVARESITMLPGPPTLY
HSLLTVADKGRLATLRAAVTGAADIPVELIRRIRDELPFQTLMTGYGLTE
AGNVTLSRPGDSPENVARTAGLPCEDVEVDIADDGEVLVRGYNVMQGYLD
DPLATAEAIDEDGWLHTGDLGTFTDEGRLCIVGRKKDMFIVGGFNAYPAE
IEGFLLEHPGIAQAAVIGVPDERLGQVGKAFLVRSDAAQSLSADEVIDWS
RARMAGFKVPRSVEFLDELPLNATGKVMKDRLQDNLR
392417371YP_006453976.1 VirB8 protein [Mycobacterium chubuense NBB4]MPSFRRRASVIDADRADEPRPDADRTADAERARALADEAEAEAAEAEAMA
AAARARARALRLRREAEAAGAPAGAVEVEPEAEAEAPVEVGDATAPVEDG
DGEGDETGGEALLDESIEASKARRFRVPRPSWKAIAASLVILCTAALLGL
SGFMVWHHRQADKLRQQNAEYSAAARQSVVTLMSLDFTKAQEDVQRIIDN
STGQFKNDFQSQAKDFVKVAQDSKVITEVTVNSTAVEQMDDDTAQVLVAA
ASRVTNSAGAKQEPRTWRLSVSLQREGGQIKMSKVEFVP
392417370YP_006453975.1 hypothetical protein Mycch_3563 [Mycobacterium chubuense NBB4]MSDEEKATEVTEAEPTAGTEAEPTAGTEAEPTAGTEPETTAGAEAEPTAG
TASQRPGGVRRAVRARAVAILLAAALLASAGLAGWLYLNQYRPDQQTDKA
AAKVALDAATSGTVALLSYSPESLDKDFAAAKSRLTGDFLSYYTQFTEQI
VTPAAKEKSVKTAASVVRAAVSQIQPYKAEVLVFINQTTTSKENPDGAFA
ASAVKVGMKKIGGTWLISSFDPV
392417369YP_006453974.1 4-diphosphocytidyl-2-methyl-D-erythritol synthase [Mycobacterium chMSLTAILPVPVCFADRPDAVFTPVAGQAPLVRAVRTLESSAQVLVAAAAP
LADAVRETLDSQSFSRVRVVVAAPRGERAECVAAALRVVDGPYVLVHDLE
WPVFGADTAHRIAEALRGGAVAVVPAQPVTDSVKAVDEQGRLLATVDRAQ
LRTVQYPRGFDVTVLSALSARAGSGSFDEFEVALSEGVAVTLIDGDPAAL
HVELPRDGRYLAAVIASQQDDR
392417368YP_006453973.1 4-diphosphocytidyl-2-methyl-D-erythritol synthase [Mycobacterium chMGMAVGVVLAAGLGTRVGADGNKAYLPLAGRSMLVWSLDTVSRVPGIART
VLVYRQGEYELASDTVRRELPGVAVEFVEGGATRHASETNVLRHLSGDIE
SGALDVVAIHDAARPLAGPDMFATAIALARTHGGALPALPVDNVVRCTEH
GLESVAGHGSLVRVQTPQAFRARELLDAYARADREGFEGTDTSSCIERYA
DVEVQTFAGRADNLKVTYARDIVVAQRLLSGRPADSR
392417367YP_006453972.1 putative membrane protein [Mycobacterium chubuense NBB4]MSDDEPQAPISRAHRIRRMSGRDPHEAGRVATPLELLFDLTFVIAFGVAA
SEFAHALAGDHVVAGLAGFFFAMFAVCWAWINFSWFASAYDTDDWVYRVT
TMLQMVGVIILALGIPQMYASIGHGGHVDNTVVVAGYVVMRVAMVAQWLR
AATQDPARRKACVTYALWITVAQIGWIAAIFVHTSVPATAAIVIGLVLVE
MIGPVVAEWKQGGTPWHAHHIAERYGLFTIIALGEGVVGTVASLTAVVGA
QGWSVEAVFVAVAGTGLTFGMWWTYFVLPQADILHARRERSFWFGYLHIA
LFAAIVATGAGLHAAAYYIEHDSALDSVATVCSVVIPVGVYIVTIYALYA
VMARAVVWFHVLLVVLTAVVLGAAVALAMGGISMANCLLVVTLAPVVSVV
GYEAVGHRHAAQVVARSVGES
392417366YP_006453971.1 nitrate/nitrite transporter [Mycobacterium chubuense NBB4]MRPWIVWATGLLAYIVAVLDRTTLGVSGLAAAERFGAGPSLLSTFVVLQV
VVYAGAQVPAGLLLDRFGSKVLIVCGAAVMASGQFALAFTESLPTAIAAR
AVVGLGDAVTFISVLRLVPHWFTPRRVPLVTQLTGICGQLGQVLSAVPFL
ALLSASGWTTAYTSVAAFGVLSIALILLVVKNTPDGAAPPVETTSLQETL
ASIKTVWLRPGTRLGFFTHMGTQFSVTVFALMWGVPYLTSAQGLSPGAAG
TLLTISVAAAISAGVAIGILTGRHPHRRSWLVLGIIASNAVAWTAVLAMP
GRSPLWLLVLLVVVISVGGPGSMVGFDFARTFNPSATLGTAQGMVNMGGF
LASLLLMQSMGLILQAAGGLSFASFRLAWTLQYVVWAVAVVGILITRRKA
RRLLALQDDRSLLESIGN
392417365YP_006453970.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MAEYRLEELAKVSGVSTRNIRAYRERGLLDPPRRVGRSALYDDYHLSQLN
TISQLLRKGFNSAHIAEFFESMRQGADLADILGLQRAVLGTQPEEAPRTE
AAVGIEPDSEEARKLVSYGMAEIDEGRLTLVDGAAEILAKTPDQLVYVRA
LLRFLEAADSSIDHLAEMFVNSLVDLYRVRVGPDYLPKPQQMDEIRRVIQ
DYRVLGERVMTARFERATRKLLVASASDYTAGILLTGAWEPKHTA
392417364YP_006453969.1 3-oxoacyl-(acyl-carrier protein) reductase [Mycobacterium chubuenseMTINDQHSATAGSDTKAGHETARSHSANAHALVDRLHSGEPYAVAFGGQG
GPWLENLEELVNSAGIESEISQLVGEAELLLEPLARELVVVRPIGFEPMK
WIRALAAEEPLPAARDLTTAAISGPGILLTQMAAQRALRRQGLDLAGHPP
VAIAGHSQGVTAVESLKAGGARDVELLAIGQLIGAAGSLVSRRCGMVGRG
DKSPMVSVTNVDPARIAELLDEFAQDVRTVLPPALSIRNGRRSVVITGTP
EQLARFELYCEKITEKEEAERKNKTRGGAIFRPVFNQLNVEVGFHTPRLA
GGIDVVNEWAARTGLDRDLTRVLTEQIFVKPVDWVSEVEGLAAAGAKWII
DLGPSDTVTRLTAPVIRGLGIGIVAAATRAGQRSLFTVGAAPEVAPAWAS
YAPKPIALPDGSVKASTKFTRLTGRSPILLAGMTPTTVDAKIVAAAANAG
HWAELAGGGQVTEEIFDARIAELTQLLEPGRAVQFNSLFLDPYLWKLQVG
GKRLVQKARQSGAPIDGVVVTAGIPDLEEAVDLIEELHTVGISNVVFKPG
TVDQIKSVIKIAAEVPDRDVIVHVEGGRAGGHHSWEDLDDLLLTTYGELR
KHRNITVCVGGGIGTPERAAEYLSGDWAKSYGFPAMPVDGILVGTAAMAT
KEATTSPAVKQLLVDTTGTDIWVGAGKAINGMASGRSQLGADIHEIDNTA
SRCGRLLDEVAGDADAVAERRDEIIAAMADTAKPYFGDVGDMTYLQWLQR
YLELAIGDGDSTADTAGPGSPWLADTWRDRFSEMLERAEARLNERDSGPI
ESLFSGAESQALLEDPDTAVAALLARYPDAETVRLHPADVPFFVTLCKKP
GKPVNFVPVIDKDVRRWWRSDSLWQAHDARYTADQVCVIPGTQAVAGITR
VDEPVGELLDRFEQEIIDRLLATGAEPVPVVSRRQARADVTGPLAVVLDS
PDVLWAGRTSINPVHRIGAPGEWQVNDVPGKPSATHPNTGARLELVADGS
VTLSVPLSDIWIDIRFTLPSATVDGGMPIVTVEDASTAMRSVLAIAAGVD
GPESLPAVEDNTSTLIVEWDPEKVADHTGVTATFGAPLAPGLTLVPDALV
GLCWPAVFSAIGSAVTDDGFPVVEGLLSLVHLDHAAHLLSAMPADKAELR
VTATTSAATDTEVGRVVPVTVSIADAQGTVLATLEERFAIRGRTGAAELT
DPPRAGGAITDNATDTPRRRRREVVVNAPVDMSAFAVVSGDHNPIHTDRA
AALLAGLKQPIVHGMWLSAAAQHAVTATDGRATPPARLVGWTSRFLGMVL
PGDEIEFRVDRVGIDRGAEIVEVSAKVSGELVMSATAQLAAPKTVYAFPG
QGIQSKGMGMDVRARSKAARKIWDTADKFTRETLGFSVLHVVRDNPTSLI
ASGVHYYHPEGVLYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIACGHS
VGEYTALACVSGVYELPALLEVVFHRGSKMHDIVPRDAAGRSNYRLAAIR
PSQIDLDDADVKDFIAEISERTGEFLEIVNFNLRGSQYAIAGTVAGLEAL
EEEVEKRRELSGGKRSFILVPGIDVPFHSSVLRVGVADFRRALERVMPED
KDPDLLIGRYIPNLVPRPFTLDRDFVQEIRDLVPAEPLDEILADYDTWRT
ERPAELCRKLVIELLAWQFASPVRWIETQDLLFIEEAAGGLGVERFVEIG
VKNAPTVAGLATNTLKLPEYSHNTTEVLNAERDAAVLFATDTDPEPEIDD
APPAAAEPAAPVEAAPAAAPAPAAAPAGGPRPDDLSFDASDATMALIALS
AKIRIDQIEPLDSIESITDGASSRRNQMLVDLGSELNLGAIDGAAEADLA
GLKSQVTKLARTYKPFGPVLSDAINDQLRTVLGPSGKRPAYIAERVKKAW
ELGDGWTKHVTVEVALGTREGSSVRGGALGGLHDGALADAASVDKVIDAA
VAAVGARRGVPVSMPSAGGAGGGVVDSAALGEFAEKVTGPDGVLASAART
ILGELGLANSFSTPEASADAELIDLVTAELGSDWPRLVAPVFDSRKAVLL
DDRWASAREDLVRIWLMDEDAIDADWARLSERFEGTGHVVGTQATYWQGK
ALAAGRTVHASLYARAAAGAENPGKGRYSDEVAVVTGASKGSIAASVVAQ
LLDGGATVIATTSKLDDSRLGFYRSLYRENARFGAKLWVLPANMASYNDI
DALAEWVGTEQTESLGPTSIHIKDALTPTLLFPFAAPRVGGDLSDAGSRS
EMEMKVLLWAVQRLIAGLSHIGADRDIAARLHVVLPGSPNRGMFGGDGAY
GESKSALDAVVSRWKAESSWAQRVSLAHALIGWTRGTGLMGHNDVIVDAV
EEAGVTTYSTEQMAAMLLDLCDVETKVAAAREPVLADLTGGLAEAELDLS
ALATKAREEATADSDEEARDEAAEHTIAALPSPPRPATPAPAPEWDDLDV
DPADLVVIVGGAELGPYGSSRTRFEMEVDNELSAAGVLELAWTTGLIKWE
DDPQPGWYDAQSGELVDESELVERYHDAVVERCGIREFVDDGAIDPDHAS
PLLVSVFLDKDFRFVVSSEADARAFVQFDPEHTLTRPIPDSGDWEVIRKA
GTEIRVPRKTKLSRTVGAQIPTGFDPTVWGITPDMANSIDRVALWNIVAT
VDAFLSSGFTPSELMRWVHPSLVASTQGTGMGGMTSMQTMYHGNLLGRSK
PNDILQEVLPNVVAAHVMQSYVGGYGAMVHPVGACATAAVSVEEGVDKIR
LGKAELVVAGGFDDLTLEAIIGFGDMAATADTEMMRARGISDSKISRAND
RRRLGFLEAEGGGTVLLARGDLALKMGLPVLAVVGYAQSFADGVHTSIPA
PGLGALGAGRGGRGSVLARSLAKLGVGADDIAVISKHDTSTLANDPNETE
LHERLAASLGRSDGAPLFVISQKSLTGHAKGGAAVFQMMGLCQVLRDGVI
PPNRSLDCVDDELATSAHFVWPRETLRLGGKYPLKAGLVTSLGFGHVSGL
IALVHPQAFLATLSAEQRAAYTAQAQERTLAGQRRLASAIAGGRPLFERP
ADRRFDHDHPEKAQEAAMLLDPASRLGENGVYLR
392417363YP_006453968.1 holo-(acyl-carrier-protein) synthase [Mycobacterium chubuense NBB4]MLRVGIVGIGIDLVSIADFAEQVDRPGTVFAETFTPGERRDAADKSSSAA
RHLAARWAAKEAVIKAWSGSRFSKRPVLPEAIHRDIEVVTDMWGRPRVRL
TGAIAEHLKEVTIHLSLTHEADTAAAVAVLEER
392417362YP_006453967.1 acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-lMSDLVQRVRDVLPAVRTDLEDLVRIESVWADPARRPEVERSAEAVAKLLS
EAGFGDVQVVAEGGAPAVIARHPAPDGAPTVLLYAHHDVQPEGDGAAWQT
PPFEPTERDGRLYGRGTADDKAGIATHLAAFRAHGGNPPVGVTVFVEGEE
ESGSPSLAQLLAAHRDALAADVIVIADSDNWSTDIPSLTVSLRGLADCVV
EVATLDHGLHSGMWGGVVPDALTVLVRLLASLHDDEGNVAVAGLHEERAA
DRDFPDYSPERVRADTGLLDGVREIGSGSVAQRLWAKPAVTVIGIDTTPI
ATSSNTLIPSARAKVSMRVAPGGDAAEHLAALTRHLEQHTPWGAHVTVTP
GDVGQPYAIEASGPVYDAARQAFREAWGHDAVDTGVGGSIPFIAAFAAAF
PDADILVTGVEDPDTQAHSINESLHLGVLERAATAEALLLERLGGHT
392417361YP_006453966.1 putative exonuclease of the beta-lactamase fold involved in RNA proMAFGGERARNGELTLRSLGAAGTVTGSKHLLESNGRRILVDCGLFQGVKN
LRELNWEPLAVDPSGIDAVVVTHAHLDHTGYLPRLVRTGFRGPILCTEAT
AAVADIILRDSAYLQERDAAFLNKHKASKHHPALPLYDSDDARRAIELFD
THPFGRELRLPDDGPVVTFRRAGHILGAATVDLVWHGRRIVFTGDLGRYD
DPVMLDPDPVPAADYLVMESTYGDRLHDRSDPADALAEVIAATVSRGGTV
VIPAFAVGRAQTLLYYLWQLRSAGRLPHVPVYLDSPMAINASDLLGLYRS
DHRLSPEVYEGMCGMATYTREAEQSMKISADHEPKIVISASGMATGGRIL
HHLKAFAPHPRNTIMVTGYQVPGTRGAAIAAGQRFVRIYGEWIPIRAQVA
NLAMLSAHADADELIRWASGFSAPPRRVFVVHGEPQPADTLRTRLDREFG
WQATVPRPNQLFTL
392417360YP_006453965.1 Peroxiredoxin [Mycobacterium chubuense NBB4]MPLTPRLEVGDKAPAFSLPDADGNTVKLSDFAGRKVIVYFYPAASTPGCT
KEACDFRDNLAELNDAGLDVVGISPDKPEKLAKFRDKEQLTFPLLSDPDR
KVLEAWGAYGEKTMYGKTVQGVIRSTFVVDENSKIALAQYNIRATGHVAK
LRRDLSV
392417359YP_006453964.1 Protein of unknown function (DUF3618) [Mycobacterium chubuense NBB4MADRDPDTIKAEIDQAREQLAVTVDSLAARANPRRLADDLKAGVVRFVKQ
PPVAISLAGVGVIVVVLTVRRMRQP
392417358YP_006453963.1 hypothetical protein Mycch_3550 [Mycobacterium chubuense NBB4]MSSLGDPVSAGADGEDSAKGVATQPPVMVHSCSRLGRVANPPKFSLADLF
RRR
392417357YP_006453962.1 hypothetical protein Mycch_3549 [Mycobacterium chubuense NBB4]MAWFLALQGPSQPSHQSSVYELQDSTDVEALAQELVSAVTLDRVVAVPAM
LPQNNRKRQKVTLYVRPAAWAMWTFYELTDDDRRALMENNPLLQAIQAQQ
AAQQRAGVPQGGPGVNPLMGHGGAHL
392417356YP_006453961.1 hypothetical protein Mycch_3548 [Mycobacterium chubuense NBB4]MIPILTAVIGAVVVIAGAFVARNATHYAAELEAVQSRREAELRDLLEFRD
ALIDALHAMGEYLFVLRHIALPHEADFERLGGESPALERRMKHLLPLIGK
RERLRNLALGLLWEDLREATKPLDELIQLLRDDKVVEAFAVHEAHPDMTD
HLVHLIGQRRRELVETYPTSVPMTPFRYWPSQNASS
392417355YP_006453960.1 hypothetical protein Mycch_3546 [Mycobacterium chubuense NBB4]MSHVSTVTSVRRRPAWWLVAALVPAIVLCLTACGGNAAPDHPRVISDKGT
PYGDLLVPKLTASVTDGAVGVSVDSPVTVTAESGVLGAVTMVNQSGKTIA
GTLSDDGLTWSTAEPLGYNKRYTLTAESLGLGGVTSRKMTFETHSPENLT
MPYVLPNDGEVVGVGQPVAIRFDENIPNRLAAQRAITVKTTPSVEGAFYW
LSNREVRWRPAEYWKPGTKVEVKVNAYGVDLGDGLFGQENVRTSFTVGDE
VITTVDDTTKTLTVRRNGEVVKSMPVSMGKNSTPTNNGTYIVGDRRTHMI
MDSSTYGVPSNSPNGYRTEVDWATQISYSGIYVHAAPWSVGSQGYSNVSH
GCINVSTSNGKWFHDNSKRGDVVEIVNSVGSTLPGTDGLGDWNIPWEQWK
AGNANI
392417354YP_006453959.1 SnoaL-like polyketide cyclase [Mycobacterium chubuense NBB4]MVTVDPIAFSVSWVQAWNRHDIEAVLAHFDEQVVFSSPVAAGVVPGSGGV
VRGKAALRKYWTTALAHIPDLQFTLEGVYQGIGTVVIAYRNQDGGRVSEV
LRFNDDGLVIEGHGTYLAPGP
392417353YP_006453958.1 oligoribonuclease (3'->5' exoribonuclease) [Mycobacterium chubuenseMWSPVRDELVWIDCEMTGLDLKSDRLIEIAVLVTDSELNVLGDGLDVVIH
TDEDALSSMIDVVAQMHSKSGLVEEVRASTVDLATAEEMALDYIREHVKQ
AKTAPLAGNSIATDRGFIARDMPKLDDYLHYRMIDVSSIKELCRRWYPRI
YFGQPEKGLAHRALADIHESIRELRYYRQTAFVAPPGPSTSDIAAIAAQL
GPGSQSDSAPGPSNG
392417352YP_006453957.1 putative ATPase [Mycobacterium chubuense NBB4]MTTDPAGTSAQQIAAGYAADGAALELGTVVVDGACDPAARVRVPLATVNR
HGLVAGATGTGKTKSLQVLAEQLSAAGVPVVMADVKGDLSGLSRPGQAGE
RITQRAADTGDAWEPAAFPVEFLSLGTSGVGVPVRATITSFGPILLSKVL
GLNQTQESTLGLIFHWADQRGLPLLDLKDLRSVIQFLTSDEGKPELKALG
AVSPTTAGVILRALVNLEAEGADTFFGEPELEPDVLLRTDSSGRGVITLL
ELGTQAARPVMFSTFLMWVLADLFTTLPEVGDLDKPKLVFFFDEAHLLFT
DASKAFLEQVEQTVKLIRSKGVGVFFCTQMPTDVPKEVLSQLGARIQHAL
RAFTPDDQKALTKTVRTYPKTGVYDLESALTSLGIGEAVVTVLSENGVPT
PVAWTRMRAPRSLMDTIGPEAITAAAKASPLQAQYGQTVDRDSAYERLAA
KLAPPAAPVPPSAPAPPRVEVPPPLEVPPMPAPAPETGFFDKMMESPAFK
SAMRSAGTVIGREITRSLFGTGRRRRR
392417351YP_006453956.1 short-chain dehydrogenase of unknown substrate specificity [MycobacMPVPAPSADARAVVTGASQNIGEALAVELAARGHHLIITARREEVLNALA
ERLRERYGVTVEVRAVDLADPSARAAFCDELATRNISILCANAGTATFGP
VVSLDPAEERKQVQLNVLGVHDLVLAVLPGMVERRAGGILISGSAAGNSP
IPNNATYAATKAFVNTFSESLRGEVKSAGVHVTVLAPGPVRTELPDPDQQ
SLVERLIPDFLWIDTEYTAKVSLDGLERNKMRVVPGLTSKAMSAASGYAP
RAVVAPIVGAVYKRLGGD
392417350YP_006453955.1 major facilitator superfamily permease [Mycobacterium chubuense NBBMSEPSAVRASTGATRARVGAWALWDFGATAVNAIVVTFVFSVYLTQTVGS
DLPGDTSPASWLGRALALAGLVVALTAPLTGVWVEAPDRRRRALTVLTGL
VVILTASMSAIRDDHRYLWPGLVLLACAAACSELATVPYNAMLRGLSTRE
NAGWISGMGLASGYVGSVLALLVVYLGFVSGAGDTRGLLHLPAADGANVR
AAMLLIAGWFALSALPLLVTARSGPAAAGARVSVLGGYRRLAAEVRELWR
TDRNVLYYLAASAVFRDGLTGVFTFGAVLGVTVYGVSQADVLLFGVAACV
VAALGAVVGGRVDDRIGSKRVIVASLAAMSAIGLVLLASSGVLMFWLCGL
ALCAFIGPTLSSARTLMMRMAAHGKESIAFGLYTTAGRAATFLAPWLFSL
FIDLFDSARAGLGGLLVVLLAGLLGMLAVRAPHRLD
392417349YP_006453954.1 mycobacterium membrane protein [Mycobacterium chubuense NBB4]MTDPYDRRRDEPTQAYGTGHPGYNDPAYASQTPYGSPYQPPQHTERLTSY
SPYGYDPYATGQYQPGYGSEPPPPEGPKSPRWLWVVAGIAVVTVVGLVIA
LVIVNSSRQQTVVAPLPSLPEPSVTTPSRAPTTTSRIPSTPVLPLPTLPS
APSTTAPTGTARPGATDTVVYTVAGAGRVINITYVDTGGLLQTEFNVMLP
WSREVSLPAPGQSSASVSIINVGRRVTCSITVNGVQIEEHTGAGLTVCAA
PR
392417348YP_006453953.1 dipeptidyl aminopeptidase/acylaminoacyl peptidase [Mycobacterium chMSPDATAFAHLVDDGGYPRAVQRFLRGWRASSSRDVELPVEGPVTRVLHS
ADGHWLACEVAPEGGSRTQIWVVTTDPDDRDARRIDHWPSGVEGTAELIS
WDGTLVAAILTGEDNVGSSCLIDPADGTTTVLDRRSGGRLVDAWAGASLV
RVGPRGYRDLIMLRGLTETALLPYDPGSTTDTGIILDDHTPRRLRSGAEG
EITQLYQPAREYGLNSTDGYVRALIRSENGAEHARLLEVTVTADGVAYHV
LAERPGYEIDEFTVSDDLSTIAILWNMHGASELQVLEYADNTLHDPIPLP
GMVAGELSISAGGTMLAVTVEAPSRPPTVELVDPRTREWQLVDREPSSGP
TSAEPTLETVTARDGLTFTGWLFQPPAGVKTIGAMLFLHGGPEGQGRPGY
NEFFPGLLDAGICVFLPNVRGSGGFGRSFMHADDRERRFAAIDDVADAVR
FVVDNGHAPAGCVACCGWSYGGYLTQAALAFHPDQFAAGISICGMSDLNT
WYRTTEQWIAAAAYPKYGHPISDRDLLEELSPLPRAEAITAPLLLVHGLN
DTNVPPSESQQMYEALSELGRHTELLLFDDDGHEIDKRENRAVLLKAMTT
WLTAAFGPGEES
392417347YP_006453952.1 hypothetical protein Mycch_3537 [Mycobacterium chubuense NBB4]MRGILGVIVLVWLLIGVFAAYQRDYFKGGDANCATAGSIALTVVAGPLNY
AGVNPKVSNCNVPQPSQ
392417346YP_006453951.1 hypothetical protein Mycch_3536 [Mycobacterium chubuense NBB4]MIVLGAILLILGLIFGISILTYIGVVLLVIGAVFWVLGSIGRPVGGRKVW
Y
392417345YP_006453950.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTTADAASRRSRAKSDRREQLIAAAEKLMAEHGYLAVRLEDIGAAAGVSG
PAIYRHFPNKEALLAELLVGISARLLAGASDVVARTDDADAALEGLIDFH
LDFAFGESDLIRIQDRDLGSLPPAAKRQVRRAQRQYVEIWVDVLRRRDPA
LSEAAARLMAHATFGLLNSTSHSVKPGSTKAAEASARTVLRTMTVAALTS
AG
392417344YP_006453949.1 acetyl-CoA carboxylase- carboxyltransferase component (subunits alpMAARTSHRDDHVVLVEKLRAKLAAAALGGSQRARERHVSRGKLLPRDRVD
GLLDPGSPFLELAALAADGMYDDECPGAGMIAGIGRVSGRECMIVANDAT
VKGGTYYPVTVKKHLRAQEIASENRLPCIYLVDSGGAFLPRQDEVFPDRE
HFGRIFYNQATMSAKGIAQIAAVLGSCTAGGAYVPAMSDEAIIVRNQGTI
FLGGPPLVKAATGEVVTAEELGGGDLHSKVSGVTDHLAHDDRDALRIVRD
IVATLGPKADAPWEVAPAVEPVADQTELYDVVPTDPRVPYDVHEVIHRIV
DGGEFTEFKASYGTTLVTGFARIHGHPVGIVANNGVLFGESAVKGAHFIE
LCDKRVTPLLFLQNISGFMVGRDYEAGGIAKHGAKMVTAVACARVPKFTV
VIGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRGDM
SPDEEEAFKAPIRAQYEHQGNPYYSTARLWDDGVIDPADTRTVVGLALSV
AGQAPLEPVSYGVFRM
392417343YP_006453948.1 acetyl/propionyl-CoA carboxylase- alpha subunit [Mycobacterium chubMGVSHFDTVLVANRGEIAVRVIRTLRAMGIRSVAVFSDADAGARHVTEAD
AAVRIGPAPARQSYLSIEALLDAIERTGAQAVHPGYGFLSENAQFAEALA
AAGVVFIGPPVPAIRTMGDKISAKAAVSAFGVPVVPGISRPGLTDDDLIA
GAPDVGFPVLVKPSAGGGGKGMRVVHDAGELPAALASARREAASAFGDDT
LFLERFVLNPRHIEVQVVADTHGNVVHFGERECSLQRRHQKVIEEAPSPL
LDQQTRARIGAAACDTARSVDYTGAGTVEFIVSADRPDEFFFMEMNTRLQ
VEHPVTEMVTGYDLVELQLRIAAGEKLTVSQDDIVLRGHAVEARVYAEDP
ARGFLPTGGDVLALREPHGPGLRVDSGLARGTVVGSDYDPMLAKVIAHAA
DRPAALRALDAALADTAVLGLTTNVEFLRFLLADADVAAGRLDTGLLDRR
TPDFAPAPAGDDVLIAAAAYRWLQSWPTAPRSPWELPSSWRIAGRAATAI
RLRAGERIDHVWLTGSPQHATATVEDGQSHALSASLEGERLAVTLDGLRT
EYLVAASDGQIWLAGAGRVAVVEEVREAPVRPDDAHAGDAELTSPMPGAV
VAVGIDDGGTVTSGDVVVTVEAMKMEHALAAPVDGVAELLVAVGDQVKVG
QVLARITASKEPNHD
392417342YP_006453947.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTDFLATGTLPDHYEQLAKTVRDFARSVVAPVAAKHDEEHSFPYEVVAGM
ADMGLFGLPFPEEYGGMGGDYFALCLALEELGKVDQSVAITLEAGVSLGA
MPVYRFGTEDQKQEWLPLLASGKALGAFGLTEAGGGSDAGATKTTAKLDG
STWVINGSKQFITNSGTDITKLVTVTAVTGENNGKKEISSILVPVPTPGF
TAEPAYNKVGWNASDTHPLSFDDVRVPQENLLGERGRGYANFLRILDEGR
IAIAALSVGAAQGCVDESVRYAKEREAFGRAIGTNQAIAFKIARMEARAH
TARAAYYDAAALMLSGKPFKKAAAVAKLVASEAAMDNARDATQIFGGYGF
MNEYPVARHYRDSKILEIGEGTTEVQLMLIGRELGL
392417341YP_006453946.1 acyl dehydratase [Mycobacterium chubuense NBB4]MVVQRGLWFEEFEAGVLYQHRPGRTITEADNVLFTTLTMNTQALHLDAAF
SDALPPFHQRLVNSMFTLSTLVGLSVAQLTQGTIVGNLGFGEVAFPKPLF
HGDTLYAETEVLDKRESKSRPGEGIVTFAHTGRNQHGDIVAVASRKTMVR
KRPEGEV
392417340YP_006453945.1 citrate lyase beta subunit [Mycobacterium chubuense NBB4]MLGNNGPGWLFCPADRPERFAKAAAAADVVILDLEDGVAAKDREAARTAL
IETPLDPARTVVRVNPVGTPDHAADVEALAATDYTTVMLAKTETAEQVAS
LAPRHVVVLVETPLGALAVTETARVENAYAVMWGAEDLFAVTGGTNNRWP
DGTYRDVARHVRSQSLLAAKAYGRLALDSVYLDIKDLDGLRAEGDDAVAV
GFDAKVAIHPTQVAVIRAAYAPTDEQVDWARRVLDTAQTERGVFAFEGIM
VDAPVLRRAERIVALAPHPGS
392417339YP_006453944.1 pyruvate dehydrogenase E1 component- alpha subunit [Mycobacterium cMAGPIEAVQVIAPDGVPTFREDYSRNLPPETLSWLYELMVLTRDLDGEFV
NLQRQGELALYASCRGQEAAQIGAAACLRKTDWLFPQYRELGAFLLRGIP
PANIGAVWRGRWHGGLGFTEKCCAPLAIPIGTQGLHAVGAAMAAQRLGED
SVTVAFLGDGATSEGDVHEALNLASVYRAPCIFFVQNNHWAISVPVSRQV
GGPAIANRAAGYGIPGVRVDGNDVLACFAVMSEAATRAREGGGPTLIEAV
TYRMGPHTTSDDPSRYRSDDEVELWRTRDPLTRYRTYLETAGVWTERLEE
RVTHRSQRLRAELRDAMVNAPDIDIAEVFDTVYHDITPELVRQRDELATE
LAREA
392417338YP_006453943.1 pyruvate/2-oxoglutarate dehydrogenase complex- dehydrogenase componMTQLIERPFGFDDEVPEPPATPSTMAHAINRALHDAMSADDRVLVFGEDV
ATLGGVFRVTDGLAESFGDTRCFDTPLAESAIIGIAIGMAVRGFVPVPEI
QFDGFAAPAFDQIISHLAKYRMRTRGDVDMPVTVRIPSFGGIGAVEHHSE
STETYWLHTAGLKVVTPSTPTDAYWLLRHAIESRDPVIYLEPKRRYWAKE
VVDFDRPGAPIGRAVVRRPGEDVTVITYGPLVATALNAAELSSARMEVID
LRSLNPLDFGTVADSVVKTGRAVVMHEGPRTLGFGAELAARIQEECFYDL
ESPVLRATGFDTPYPPARLEKLWLPGVDRLLDCVEKAMSRP
392417337YP_006453942.1 pyruvate/2-oxoglutarate dehydrogenase complex- dihydrolipoamide acyMSAVREFLVPDLGEGLEDATITSWQVAIGDEVALNQTLCTVETNKAAVEI
PSPFAGRVTELGGAEGQTLAVGAVLVRIETEAAAVRTPVLVGYGTDDTMD
GSRRRARAIPPVRKLAAELDVDLAHLAPGSGPDGIVTRADVLAAASATGA
QEAPVDTAVTGVRLEMARRMALSRSEIPDANASVEVAGTELLRVRDILRD
AGAEAITPFVLLLRLLVVALRRHPVLNATWLDTLDGPRVHVHPSVHLGVG
VAAPRGLLVPVVRDAQMRTTRALAEEVGRLVEAARNGTLTPTELQGSTFT
VSNFGALGLDDGVPVINHPEAAILGVGALKPRAVVVDGAVVARPTMRLTC
AFDHRVADGAQVAGFLGDLRGLIEAPELALLDL
392417336YP_006453941.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMQVEDRVALITVNDPDRRNAVTAEISAALRAAVDTAEADPNVHALIVTGA
GKAFCAGADLTALGAATESGLRVIYDGFLAVADCALPTIAAVNGPAVGAG
LNLALAADVRIAGSAALFDPRFQKLGIHPGGGATWMLQRAIGPQAARAAL
LFGMRFDADAAVRHGLALDVADDPVAAARELAAGPASAPREVVMATKASM
RACANPGISDIHQHHMAVDIEIGPQARSIESPEFAARLAAAKRK
392417335YP_006453940.1 acyl-ACP thioesterase [Mycobacterium chubuense NBB4]MPTNDVDHRLSAQPEAGYVYRTAWRVATGDVGGDLNLRLDGVARYIQEVG
AENLVDAGEAEEHPHWLVQRTVIDVIEPIEFPNEIAFSRWCSALSLRWCT
MRVDLVGSDGGRIETEGFWIAMNAKTLTPQRATDTLLERFGSTTTEHRLK
WRPWLTNPDAVDHSVPFALRRTDIDLFEHVTNTAYWHAIHEVMALVPDVC
EPPYRAVIEYRKPIKYGEDVTIGWTRGGDGEIPDVHIALTVGDDVRAAAL
LRKL
392417334YP_006453939.1 dienelactone hydrolase-like enzyme [Mycobacterium chubuense NBB4]MAESESTLTSLRHDIDGTQFDAVLTSGDRAPGAPTVLVFHGMEGRSELQL
QFAARLGEWGYQGIAVDLFGEEVSRGGMEATSVEMARFLDDRSALAQRLA
TVFEALVAAPQVDPRRVAAIGFCFGGLCVLDLARAGHPLAGVASFHGLLT
AGPDGGRNDVTAKVMVFHGWDDPLAPPEDVVALGREFSGRAIDWQLHAYG
NTMHAFMAPWANDPERGILYSQSAAERAWTSLGHFLRECFGDDG
392417333YP_006453938.1 hypothetical protein Mycch_3523 [Mycobacterium chubuense NBB4]MKRYIIEREIPGASELSQAELAEIAAKSNSAVESLGVPYRWITSYVAGDK
MFCVHEAESEEAIREHARCGGFPANRVTLIANEFGPQTAGNAST
392417332YP_006453937.1 putative ATPase [Mycobacterium chubuense NBB4]MATAFRILGEIEALVDGQPLDVGHARQRCVLACLLVDVNRPVPAHELIER
IWADAPPYKARNALAAYISRLRHLLGAAGAARIVRGPNGYALDTDPRSVD
LCEFRDLVSRARCAANADTATGLFDEALGLWRATPLATLATPWADEVRRS
LETDRMRALLDRNDAALAAGRHAELLGDLAMMLRSQPLDERVAGQLMLAQ
FRSGRQADALDTYRTMRGRLVDELGVDPSPALQSVYHQILDGDPARPAPS
PHPHAGIPKRATRLIGRQQDIAHVSAALAEGPVVTLTGVGGVGKTRLAFE
TADRALADRAGGAWVCEFSPLGDGAAVGQAVAHALAVQRSRGQEFDDAVL
DYLRPLGLLLVLDNCEHVLADAARLVERIARECPHVTVLATSREPLGVEG
ERVLPVQPLSEDHAAELFTERARASRPDFDPEREPVGAVAEICRRLDGVP
LAIELAAARMRAMSSLDVARRLDRLRLLSGGSRGAHPRQQSVTATIDWSY
RLLSPAEQQLFARLSVFAGGFDLEAVREVCVDEATGEDDVLDLVTGLVDK
SMVTVRSGAGATRYSVLHTLRSYGRQRLEEDGSAEDVAARHARHYVELIE
RAAAGMRGPDEAAWVERITPRAGTTYAAPDFDNLRSAYEFAMARHDMDLV
LRLVTSLPDVHLRIGYHSIDWVERAVTTADPDHPLYPAAVGTIARAAWVL
GEFSHACELAGLAGGRAPRAGASYIAHPSDVVADAALYEGDARSALTYYR
RLLANPHDVADPLRLALIVDRITFCHRRLGTSEDDLIRLVEDAVGAADDT
ANPSARSLARCSLGRAVAEADPDRAMRVLREAAELATSVENNWLIGMARM
EMAVIRATRGDLADAARSFVDVLDHWERGGPGIIAQQWDTLGHVVALLRR
SGDAGSAAALRRVMTTRGRQALLQSAEMDEITDAGRVELSDAEVVDFART
ALRQYSGSD
392417331YP_006453936.1 putative protein-S-isoprenylcysteine methyltransferase [MycobacteriMSTKPHTGPSAPEGGATGGPVRHRAPAHGAGPQARIATVLYGAAAYVMFV
LVFLYAIGFVTNMVVPRSIDNAIEAPLGQALVIDLALLALFAVQHSVMAR
PAFKRWWTRFVPVPIERSTYVIAASAALALLCWQWRSIDTVVWSVGPAPA
RIAVTALGLTGWVIVLASSFMIDHFELFGIRQVMAAWRSKPVHPPGFRTV
LLYRLIRHPLMLGFLIAFWATPTMTAGHLLFSVATTGYILIALWFEERDL
VAALGEPYRQYRARVPMLIPGLGR
392417330YP_006453935.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMITADEADRQTKARHRALWASGDYAAVARDLIPGLGTELVLATGVRAGDR
VLDVAAGSGNAAIPAAVTGAVVTASDLTPELFEAGRRSAAERGVELEWVE
ADAEAMPFADNSFDVVMSCVGVMFAPRHQVTADELVRVLRPGGTLGLINW
TPQGFIGQLFATIKPYAPPPPPGASPPPLWGDEAHVRALFGKRVSDLSMQ
RRHVVFDHSATPSEFREYWKHTYGPTIAAYGFNAETPERIAELDRSFLAL
LERWNHSTDPGRTAYPAEYLLITARKV
392417329YP_006453934.1 serine phosphatase RsbU- regulator of sigma subunit [Mycobacterium MGTGAPRSERRPRVDRFVRMEGAQGETAFTWRGRRQLVSRMHEQLDELVA
ARDQMEHLIRAIVAIGSDLDLDVTLRRIVDAAKELSGARYGALGMRASDG
TLVSFLDTGLDEATARRLGELLVGDGIRVDDLRAQTWTGGLEQDHAAMRA
LLGVPITVRGAQVGSLYLVDDRPGRVFTDAQEGAVRALATAAAAAIDNAR
LFERERESAKWTKASREITTALLSGDPQTGPLQLIVNRALELADAEQAIL
LVPREPNLPAEEVHTLVVAATAGRYASEVIGRQVPMDGSTTGGVARRGLP
MITDSFQYPIEGFTDVGSRSAIVMPLVADEAVLGVIAVARRPHQSPFDDA
YLELVADFARHAAIALALAAGRENALNQQLAQADTVDDAVTAAAQELRRL
WRARRVLAVTFPAHAPSTENVPEVVSVGEVARWADLPLETRQMLRSLRDG
DLLTPNATLPGTAGIALQHPVGVLVVWIDLVEQRPFTLEDQTLLTVLAGR
LGQGLQRVHQVDQQRETALALQHAILGPAQLLHGFAARYQAASPPLQVGG
DWYDVVDLEDGRIALVVGDCSGHGLAAATVMGQVRSACRALLFGNPSPSA
ALASMDRFAARLPGARCTTAVCAVLDPDTGELVYSSAGHPPPILVHADGA
IEMLEDGHTIALGMRPGWPRPEAHITLPAGATLLLYTDGLVERRRVALED
GMSRAAELVEDRRGAALDALADQIMSGLAPAGGYQDDVVLLLYRHPGPLE
LEFPADVSHLAPARTALRTWLTRARVAPEKAVDVLVAAGEAVANAIEHGH
RRTSGGTIRLEATALVDHVQLTISDTGSWKAPPPVPDSRRGRGLALMKEL
MADFSIDHDAGGTTVRLSASIA
392417328YP_006453933.1 anti-anti-sigma regulatory factor (antagonist of anti-sigma factor)MPTLLTLRTARRDDGTPVLIATGEIDLSNVDDFEKALSTAAAGAVRQGAT
LTVDLSAVEYLDSSAINVLYAEARNIETVIAHPLLVTILEVSGLSQLVAV
ESPPSVAER
392417327YP_006453932.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMMADTIPDIARMPRGGPGASWLDRTLQTDRLEYLDRNDVDELKDRVVRAL
DRGGRRRHGIYGKCAQVALDVVADVPRPKILELGAGLGGLSEQLLRHRPD
AEVTITDLDPAFVDEIARSDLGRHPRAIIRTMDATAIDAPDGGFDLAVFA
LSLHHLPPASAARVFAEGTRVARKLLIIDLRRPPAPLHAVVLAAVMPFTP
VIPLTHDGVISSMRAYSPAALKALARHAAAEIEVEFRTRRFGPTVVVAAR
RSEAAA
392417326YP_006453931.1 non-ribosomal peptide synthase/amino acid adenylation enzyme [MycobMTGATRRLLSIELLDDDEQADLDEWGHRAVLIEPVSPVSITELFSAQAAR
TPHAPAVTFRGETLSYRDLDAAANRLAHLLRAHGARAGQCVALLLPRSAD
AIVAILAVLKTGAAYLPIDPAVPAARVGLLIDDATPAVAVTTSELRSLLP
AGSFPVVDVADSAVGEQPDTAPPAPSPDDIAHIIYTSGTTGVPKGVAVTH
HNVTRLFEALDVGVHMSSLQVWTQCSSLAFDFSVWEIWGALFFGGRLVVV
PETVARSPEELHALVIDEHVTVLSQTPSALGALSPDGLESVTLMVAGEAC
PAEVVDRWAPGRTMINGYGPTETTVYATISAPLKRGSAQVPIGSPVPGAA
LFVLDTWLRPVSAGVVGELYVAGRGVGVGYLGRAGLTSSRFVACPFGAPG
ARMYRTGDLVRWDVDGQLQYLGRSDEQVKIRGHRIELGEVRAALAALDGV
AHAVVVVREDRPGDKRLVGYVTEIGSGTVDTATVRTRLAERLPPYMVPAA
VVQLEALPMTVNGKLDVRALPSPDYSDGVAYRAPATAAEDILAGIFAGTL
GIDRVGVDDSFFDLGGDSILAMRVVAAINARLDARISVRALFDTPTVAQL
APQLGTGSGRRQPLVAGSRPDVIPLSFAQSRLWFLDQLHGPSPVYNMAVA
LRLRGRLDTSALSAALADVVGRHESLRTLLTAPEGVPAQLIVASELADFG
WEIADAAGWSADELAEAISGAARHPFDLSGEIPIRATLFRIADDDHVLVG
VVHHIAADGWSIAPLVRDLSSAYAARSAGRPPTWTELPVQYADYTVWQRA
HLGDLGDDQSPISAQLAYWRDALAGMPDRLQLPTERPYPAVADLRGAVVT
VEWPAELQQLVRRVAAEHNATTFMVVQAALAVVLAAVSASRDVAVGFPVA
GRGDPALDELVGFFVNMLVLRVDLTDDPSVADLIAQVRRRSLAAYDNQDL
PFEVLVERLNPTRSLTHHPLVQVALAWNTSDTAAADPAALTLADLEVSRM
PVDIRTARMDLVFSLGERWTASGEPAGIGGTVEFRTDVFDAAGISTLTDR
LPRVLAAIAAGPEQRVSSIEVLDAQERSRIDDLANRKALTAPAPPPESIP
TLFARYVEARPDAVALRSGTRSWTYRDLDASSNRLAHRLIEHGAAPGHCV
ALLFHRSAEAIIAMLAVLKTGAAYLPIDPTVPAARLDFMLADAAPIVTVT
LTELAESLAGSPVPVLNADDPAVADRPGTAVPPPEPDDVAYLIYTSGTTG
LPKGVAVSHHNVTQLLGTLDAGLPRHGVWPQCHTLAFDVSVWEIFGPLLR
GGRVVVIPESVAASPEDFHGVLVDEHIDVLTQTPSAVRMLEPEGLGEVAL
VVVGEACPPEVVEQWAPGRVMINAYGPTETTMCVAISEPLTPGAGVPIGK
PVPRSALFVLDEWLRAVAPGVVGELYVAGAGVAYGYLGRAGLTASRFVAC
PFGGAGTRMYRTGDLVSWRPDGQLQYLGRADEQVKIRGYRIELGEIQAAL
AAQEGVAQAAVVAREDRPGDRRLVGYVTETAPGTVVSADLRAHLGQRLPS
YMVPAVVVVLDALPLTPNNKLDTHALPPPGYRDEARHRPPTNAVEEILAG
IYAQVLGIDRVGIDESFFDLGGDSILSMQVVARARAAGVRCRPRDIFVEQ
TVAGVARVAEIDRSATAVADDGVGEIIPTPIIRWLQSVGGPVDEFNQTMV
VQAPAGVTEDHVRTVLQALLDRHAMLRLRIRDGWSLFAGAPGAVQAHTCT
QAVDTLTDEALVAARSRLSPADGRMLSALWVRSTNQVVMSVHHLGVDAVS
WRILLEDMNIAWAQLRSRQPVELPAPATSFRSWAALLAEHARSTAVTRHA
QQWRQLAAAPAALPAVDPRADTYATAGHLTVALDTETTRRLLDDASAAFH
TGVQDLLLIALALAFGEFSDTHGAVGIDVETHGRDEELSPTADLSRTVGW
FTCKHPVALTVDRMAWRSVISGDAALGPIIKQAKEQLRAVPDGITYGLLR
YFGGEDLLPAQDPAIAFNYLGRLTGRSAESSDGLWHISADGAAVTARATA
VPMPLAHGLELNIGTVDTGAGPRLHADWTWAPSVLHSHDVDRLSGLYLEA
ITGICAHVQQGGGGLTPSDIAPARLSQRQIDELTAHEPVADVWPLSPMQQ
GLLFHTKAVGGETNDVYAMQLDVTIAGPLDVNRLHRAVQDVVARHPHLNA
RFCERFDQPVQVIPAEPIAAWRLAESDSEDGVQRLCAQERAAVCDLGDPP
AFRTTLIRTGSDEHRCVLTFHHIVVDGWSLPILLQEIFAGYYAQQLPPAP
SYRRYVSWLAERDVTAAEAVWSAALSGFDTPTLVGAPGVQGHRSVESFRL
PADLTAALNGLARTHHTTLNTVLQAAWAQLLTWLTGQHDVAFGTAVSGRP
AEIPGAESMVGLLINTVPVRAQLSSDTTTADLLGQLHSAHHDTLDHQYLA
LSEIHRITGHDQLFDTLFVFENYPIDTGSLSAADGLSVTGVATRERNHYP
LTLQAMPGREVSLRLECDTAVFDHNGVAEIVRRLHRILNAMTADPLEPLS
SIDLLDGDEHARLDEIGNRAVLTQPRSRSSIPGLFAAQVARTPDAVAVIC
GAQSMSYRELDERSTRLAHLLIAQGAGPGRSVALLFPRSCEGIVAIVAVL
KTGAAYVPIDPAHPSARIAFMVGDAAPVSAITTAALADRFSGCELTVILH
DDPRIETYPATPPPEPDPDDIAHIIYTSGTTGEPKGVAVSHHNVSRLYAG
PTVGVALTPGQVWSQFHSYAFDFSVWEIWGALLCGGRLVVVPEAVATSPE
RFHDLLAGEHVSVLSQTPAAVAGLSPEALESMSVLVGGEACTTEVVERWA
APGRVLFNVYGPTETTVFATISTPAQPDSGVPPIGSPVNGAAVFVLDRWL
RRVAPGVVGELYIAGRGVGLGYWRRPGLSALRFVACPFGEPGDRMYRTGD
LVSWGADGQLQYFGRADEQVKIRGYRIELGEIQAALADLDGVDQAVVIAR
EDRPGDKRLVGYIAGTADPAQIRVALGRRLPPYMVPAAVVALPVLPVTVN
GKLDARALPAPEYVGIDRYRAPSTPTEEIVAGIYADALGLERVSVDDSFF
DLGGDSLSAMRVVTAVNAGLRTDLSLRTLFDAPTVAALALRLQPGDGRVP
LVAGDRPPVIPLSFAQNRLWFIDQLQGPSAVYNMATGLRITGALDVEALH
AALTDVVGRHESLRTLIIAPDGVPQQSVVAPDEAHFGWDVVDATGFSESR
LRQAIDAVGGHTFHLAHDIPLYTNLFRVAENDHILVGVIHHIAADGWSIA
PLMRDLGEAYASRSAHQAPGWRPLPVQYVDFALWQRVRLGDVGDAGSVIS
RQVGFWRGVLAGLPERLGLPTDRPYPAVADQRGSRVAIEWPVEVQQGVRR
VAARYQVTEFMVMAAGLAVVLSRLSASADVAVGFPIAGRTDPALDELIGF
FVNTLVLRTDLSGDPSIADLLAQVRRRSLAAYEHQDVPFEVLVEQLNPTR
SMTHHPLIQVMLAWQNLPGVVTDSTGLSLGELQVTQLPVDTHTARMDLTF
SLAEHFTDTGAPAGIRGAVEYRTDIYDPPTIEALIHRYHRVLTTLTTQPE
SRLSAIDLLDTDEHTRWTELANLATLTEPCPPSRSVPQVIAGHALGTPEA
VALCGAGRSLTYRELDETSNRLAHLLIGAGAGAGRCVAVLFHRCPEAVVA
MLAVLKTGAAYLPIDPAHPDTRITYLLHDAAPMAAVTTTDLTDRLTGHDL
TLIALDNTDLSRQPPTPPPPPAPEDIAYLIYTSGTTGTPKGVAVTHHNLL
HLADSTPTTLPEPAVWTQCHSYSFDFSVWEIWAALLTGARLVIIDEDTTT
SPTEFHHLLTREHVTVLTQTPSAVTALDPDGLDSVALLLGGETCPATVID
HWAPGRVLINAYGPTETTVYATLSPPLHPSTGAAPIGAPVPTAACLVLDP
WLHPVPAGVVGDLYIAGRGVAAGYLGRPALTATRFLACPAGPPGTRMYRT
GDLVSWRPDGQLHYHGRADDQLKIRGHRIEPAEIQAALTALPGVDHAAIT
THTDGPTTRLLAYITETTPGTTNPTELRAQLAEQLPSYMVPAAVITLASL
PMTVNGKLDTHALPAPEHQADRYRAPTDAVEEILAGIYAQVLGLDHVSID
DSFFDLGGDSILSMQVVARARAAGLTCRPRDIFTEHTIARLARIVETGSG
RTGHVDHGVGEVTATPIMRWLHDINGPVDQFNQTMVIQAPAAVTPHDVAT
ILQALLDHHPTLRMRAEDHADGWSLTIPEPETIDAGELLSTAEILSEEAL
VAARSRLNPATGTMVSALWATTTQQLALIVHHLAIDAVSWRILLEDLNIA
WAHHHNGQPITLPAPGTSFRTWATQLTDHARTPAVLDTTPTWHHITTTPP
ALPPPDPARDTYATAGHLSVALDTETTRHLLTDVPAAFHAGVADVLLIAF
ALACSEFLGTASAPVGIDVEGHGRREELSPDLDLSRTIGWFTTKHPVALD
TGALQWHHVRSGDPALNPVIKHAKEQLRALPDGLTYGLLRYLGDSPRTGT
DPTIGFNYLGRMGDTTADTAAELWHPSREGLTLAESASRVPMPLGHTMEL
NAGTVDGADGPRLQANWTWASSALDEAQMTRLSRLWFDALTGICTHVHHG
GGGLTPTDIVPAHLTQTQLDALEGQFDVADVLPLTPLQQGLLFHAGAVRE
ITDLNDLYAMQLDIAISGALDPDRLRDAVTAVIRRHPNLAAIFCDQFDQP
VQIIPTDLTIPWQYLSVESENEIQQTCAVERAAVCDLTRPPAVRAMVIRV
APDRHRCVLTFHHIVVDGWSMPIVLREIFAGYCGQRLPATTPYRDFVTWL
AGRDVPAAREAWRAALAGFDTPTLVGPPGRPRLGPRGKTSFTLSEAATRA
LGDLARTHHTTVNTVLQGAWAQALTILTGQHDVAFGVAVSGRPADIVGAE
SMVGLLINTVPVRARFSGTTTTADLLAQLHDHHNATLDHEHLSLAEIHRV
AGHDRLFDTLFVFENYPIGTGTELNADGLVITDLRASESTHYPLTVQALS
GRELGLRLEYDSEVFDAQSAAAITGRLQSLLIRMAAEPDRPLSSVDVLDD
DEHARLDMLGHRAVLSCAPPSASLPQLFARQVTSRPDAPALTCDGQTWTY
RELDDESNQLAHMVARLGAGPGQCVALLMERSAPTVIAILAVLKSGAAYL
PVDPALPKARVDFMMADACPVAAITTPAFAGRLDGVDITVLDIDDARIRR
CPSTPLPGPAPDDLAYLLYTSGTTGVPKGVAIAHQNVVQLLAGLDAHLPT
SGVWSQFHSLGFDVSVWEIWAPLLHGGRLVVVPDPVARSPEDLHALLVRE
QVTVLTETPSAAGMLSHRGLDSMALVVAGEACPAELVDRWAPGRLMINGY
GPTETSIIVGISAPLSAGGGAPIGSPAPGAALFVLDGWLRPVPVGVVGEL
YVAGRCVGVGYARRAGLTAARFVACPFGAPGARMYRTGDLVRWGPDGQLR
YLGRADEQVKIRGYRIELGEVQAAVSELDGVGQAAVVAREDRPGDKRLVG
YVTESLSGAVDPATARHALAERLPAYMVPGAIVVLDELPLTRSGKLDVRA
LPAPDFGDRDHYRAPSSPAEEILAGIFAAVLDVQRVGADDSFFDLGGDSL
SAMRLVAAINTGLDADISVHTLFDAPTVARLAPRVGGDGARRQPLVAGAR
PASIPLSFAQSRLWFLDRFQNGAATYNMPNALRISGPLDVGALAAALDDV
IARHEALRTVFPDTDGEPRQEVLPAEPGMWRGAGPAVVALPESGLPAELT
ALAVHRFDLSSEIPVRARIYATGPGEHVVAIVVHHIAFDGWSLGPMMRDI
GTAYTCRSAGMAPGWPQLRVQYVDYTLWQRAQFGDLADRDSPIAAQLAYW
QDALAGMPERLDLPTDRPYQPVADYHGSSVDVSWPADLQRRVRDVAHAHN
ATSFMVIQAALAVLLSEVSANPDVAVGFPIAGRRDPALDDLVGFFVNTLV
LRTDVSGNPSFADLLAQVRRRSLAAFDHQDVPFEVLVERLNPARSLTHHP
LIQVMLAWQNVLGQDGGSAGVDLGDLRVSQMSMDTRTARMDLVFHLSEHW
SDTGEPAGIAGIVEFRTDVYDAAGIAAMVRRLERVLDSVTSDPAAPVSSI
DLLDSDEHALIDVHGNRAALAHPRRSGPSIPELWAAQVTRTPDAVAVTFQ
GRSTSYRELDDASNRLAHHLVAYGASPGQCVALMFTRSAEAITAILAVLK
TGAAYLAIDPAYPDARIEFMIADAAPVATVSTADLRCRLGELRLPIIDVD
DPCIAEQPQLPLPTPAPEDIAYLIYTSGTTGRPKGVAIPHRNVVELLQSL
DDVVPRDGAWTQCHSLAFDFSVWEIWGALLGGGRVVVVPESVARSADEFH
TLLADEGVTVLSRTPSAFYALQTAAVTNPRRLQLEAVVFGGEALEPQRLR
TWFDHDPGLPRMINMYGITETTVHASVREITVVDTDITGSPIGAPLAHLA
FFVLDRSLRRVPTGVVGELYVAGAGLAYGYSRRSGLTASRFVACPFGAPG
ERMYRTGDLVSWSAAGDLRYVGRADHQVKLRGYRIELGEIENALVACPEV
DQAVATVQHTGSGMQLAGYVTLNPASDDDHDADVVGQWQHMYDDLYGEEL
DASNFGSDFRGWNSSYSDSPIPLSEMAEWRSATVDRIMALCPRRVLEIGV
GSGLLLTQIAPYTERYVATDMSPVAVANLARSLDRFDVPWRDRVELHAQP
AHVTGNLPPGAFDTIVVNSVAQYFPHSAYLADLMAASLELLAPGGALFLG
DIRNHALQRAFQTGVALARTEGDAAAVRQRVQRAIVSEPELLLAPEFFTT
WAARNAAVAGLDIQVKRGVADNELTRYRYDVVVHKGPASAVSLATLPVWR
WSEDSDLDTVHRRIARERPPAVRVAGIPRAGVAADVHIEQALAAGCSVTD
AVAGAQRLAAAVAPEQLYRLGESCGYRVAVTWGAEPGTLDAVFLPATDPV
PITGLYLPTEESTHTASANNPQTNTTIGDVRRRLSARLPEYMVPTHIIVL
PDLPLTPSGKIDTKALPAPILTSTTFHAPQTPTERIIAGVFARVLGLERV
GIDDSFFDLGGDSLSAMRVIAAVNTELGTHLAVRTLFSAPTVRSLGAQLA
AEDHAAEVVPIEVFRQGSGVPLCCIHDGFGLSWSYRSLSKHLDCPILGIN
QIPDDGHAEADSISTMAASYADRLVSAYPSTRYKLLGWSLGGVVAHELAV
ELQRRGCEIENLILIDDALTADRVIGPAQAADEGAVLEHLLESNGVQLPS
DARPLTYPRAAEIVQSVGGATGLVLPPQPLLEFMVHCVAVNQIRLRQHRP
GVFDGDMTVFCAARNGPETTAFAWEHHVTGRVTVHPVDAGHHDMLTPATL
DTYIEQLKLHLGA
392417325YP_006453930.1 non-ribosomal peptide synthase/amino acid adenylation enzyme [MycobMDRRGEALTPRQLDIWLAQETGRSGTEWQLGLFARIEGALNRDLFEQAIR
LGLLEAEPIRAAFFQSGGQVFQEALDYSDVELPFFDLTDSPHAVEDARAI
AATIQHTPMPLTQRLVKFALFQTRADEFYWFVCCHHIVIDGMSMGLMGRR
IATIYTALLTDCAVPPAFFGSLRDLMDIESRYEASADYAADEAYWSSILS
TVRDADVLYPDVTPTPDSHYPSTPIHLDPCALGGIKKTARALGARQSSLL
TAACALMVQQLSSRGSQIILDFPVSRRVDARMKTLPGMVAGVVPLVLEGL
PRSTVSDFCRHVDARMREALHHQRFPVTTLAGGNGLQPFEAYPDRVVLNF
VPSRLSMNLAGVPGTATYTTFGPVDHFGLFFFGAGDQQAFCTAGAGLPFA
GLAPADLADRLQRILLAVVREPNSKLSCLTSIAAGEREHLDAVGNRRALS
RPAEPVSIPGLFAAQAARSPDAVAVVCGAQSMSYRELDERSTRLAHLLAK
CGAGPGRTVALMLPRSAGAVVAILAVLKTGAAYVPIDPAHPSARIAFMVA
DAAPVAAITTAALADRFSGCELTVILHDDPRIETYPATPPTEPDPDDIAH
IIYTSGTTGAPKGVAITHRNVTQLLGRANRHLPSRAWAQWHSYGFDASVE
EIWAALIHGGRLVVVPEEMTGSPDELQRMLSTHQVGVLSQTPSATGVLEP
ERLASMALLVAGEACPADLVDRWAPGRVLINGYGPTETTICATRSAPLTA
GSGTPPIGSPVEGAAVFVLDGWLRRVAVGVVGELYVAGRGVGLGYWRRPG
LSASRFVACPFGEPGDRMYRTGDLVSWGADGQLKYFGRADEQVKIRGYRV
ELGDVRAALAGLDGVDQAVVIARDDDGGGPRLVGYVVESAAGAVDPAAAR
CVLAERLPGYMVPAAIVVLDSLPLTVNGKLDVRALPAPVYGDLARYRAPG
SPVEELLATAFADVLGVSRVGVDDSFFDLGGDSLSAMRVIAAINTSLTTE
LTVRSLFDAPTVARLAPLTVPATRKQERLQVVDRPAVVPLSFSQTRLWFL
DRFQGGSTAYNMPTAIDIRGPLDHQALAAALDDVIARHEVLRTVYPDADG
VPQQSVRPPSAGMWRRGNSTVVPSTPRDIAAELTGLAHHRFDLSTEVPIR
AQVYSLGPEHHVVGIVVHHIAFDGWSFAPMVRDVGEAYLARSHGDPPKWR
PLPVQYVDFALWQRVRLGDVGDAGSVISRQVGFWRGVLAGLPERLGLPTD
RPYPAVADQRGSRVAIEWPVEVQQGVRRVAARYQVTEFMVMAAGLAVVLS
RLSASADVAVGFPIAGRTDPALDELIGFFVNTLVLRTDLSGDPSIADLLA
QVRRRSLAAYEHQDVPFEVLVEQLNPTRSMTHHPLIQVMLAWQNLPGVVT
DSTGLSLGELQVTQLPVDTHTARMDLTFSLAEHFTDTGAPAGIRGAVEYR
TDIYDPPTIEALIHRYHRVLTTLTTQPESRLSAIDLLDTDEHTRWTELAN
LATLTEPCPPSRSVPQVIAGHALGTPEAVALCGAGRSLTYRELDETSNRL
AHLLIGAGAGAGRCVAVLFHRCPEAVVAMLAVLKTGAAYLPIDPAHPDTR
ITYLLHDAAPMAAVTTTDLTDRLTGHDLTLIALDNTDLSRQPPTPPPPPA
PEDIAYLIYTSGTTGTPKGVAVTHHNLLHLADSTPTTLPEPAVWTQCHSY
SFDFSVWEIWAALLTGARLVIIDEDTTTSPTEFHHLLTREHVTVLTQTPS
AVTALDPDGLDSVALLLGGETCPATVIDHWAPGRVLINAYGPTETTVYAT
LSPPLHPSTGAAPIGAPVPTAACLVLDPWLHPVPAGVVGDLYIAGRGVAA
GYLGRPALTATRFLACPAGPPGTRMYRTGDLVSWRPDGQLHYHGRADDQL
KIRGHRIEPAEIQAALTALPGVDHAAITTHTDGPTTRLLAYITETTPGTT
NPTELRAQLAEQLPSYMVPAAVITLASLPMTVNGKLDTHALPAPEHQADR
YRAPTDAVEEILAGIYAQVLGLDHVSIDDSFFDLGGDSILSMQVVARARA
AGLTCRPRDIFTEHTIARLARIVETGSGRTGHVDHGVGEVTATPIMRWLH
DINGPVDQFNQTMVIQAPAAVTPHDVATILQALLDHHPTLRMRAEDHADG
WSLTIPEPETIDAGELLSTAEILSEEALVAARSRLNPATGTMVSALWATT
TQQLALIVHHLAIDAVSWRILLEDLNIAWAHHHNGQPITLPAPGTSFRTW
ATQLTDHARTPAVLDTTPTWHHITTTPPALPPPDPARDTYATAGHLSVAL
DTETTRHLLTDVPAAFHAGVADVLLIAFALACSEFLGTASAPVGIDVEGH
GRREELSPDLDLSRTIGWFTTKHPATLHTGGLPWHHIHSGDDALGPAIKH
AKEQLRTQPHPLTYGLLRHLTSHSPLTNPDPTIGFNYLGRLTTTPTRDLW
HIDHESTSAAGTVTATPMPLPHSVELTAGTIDGLDGPQLHTNWTWAPSIL
DDTQIARLSRLFLDALTGISTHVHHGGGGLTPTDITPTHLTQTHIDTLEQ
QLDIADILPLTPLQQGLLFHATTAGETTDLYAMQLDITLTGPMDPDRLHN
AVQTVVSRHPNLVARFSDAYDEPIQIIPTHPAAPWQFVDLVPDCAGVDAA
CAAADDRPRAALTLPVPTVPALVDDQVERRCAAERSAVCDLARGPAFRTL
LIRTAIDTHRFVLTNHHIVVDGWSLPILLREIFAGYYGQRLPAPGSFRRF
VTWLAAQDTAAARAAWRDALAGFDTPTLVGPPGRLRIGRRGTATFDVPED
VTTGVGELARYCRTTVNTVLHGAWAQVLTWLTGQHDVVFGTAVSGRAADV
AGAESMVGLLVNTVPVRATITPTTTVADLLAQLQTAYNHTLEHQHLALTE
ITHAAGHDRLFDTVFVFENYPMESGALLGNGLAITDIRGHESTHFPLAMI
AQPGQRLRLRVEFDSEVFDTARVDKLLKRFTRVLSAMTADAGQL
392417324YP_006453929.1 hypothetical protein Mycch_3514 [Mycobacterium chubuense NBB4]MSINPFDDENGSFLVLVNDEEQHSLWPTFAEVPAGWRVVFGEADRASCLD
YIEQQWTDIRPRSLRERLAQRS
392417323YP_006453928.1 O-methyltransferase involved in polyketide biosynthesis [MycobacterMAVTLDAETWGRRTVTNTAGPDDSKVDFTAVAWGSVEWTLLCMLYLRAHE
SRLPHSILGDHFAQEAVERIDYDFDRIHRTVRPAVNQFGAALRGAYFDAV
ITDFLTRHPAATVLHLGCGLHSRAFRIAPAGTRWFDVDLPQIIALRRRLY
AETGTYRMIGSSVTDPEWITELPAGGPVMIAAEGLLMYLTPAETTQVLHR
LTQRFDSGELVADLLSKWGPRLSRVFTSGMIKWGTRDGRELERWEPRLRL
IDERSVVAGFHQIPLRAPRLLYRTQHAIPVTRDHDRLFRYLF
392417322YP_006453927.1 Transport protein [Mycobacterium chubuense NBB4]MRWRADRPDPPAPDAITSAGSTGAFGRLGSLVVRRPWWVIAAWVVLAVAL
PPLFPSLATVIQKQPVSPLPPDAPAMVANRDIAQAFPESGTENTLLVLLT
NERGLGKPDEETYRTLVGRLTRDSHDVVMLQEFAGTPELRDTLSSKDGKA
WILPVGINGDLGSPESNDAYTRVADIVHTTVRGSSLTADLTGPAATVADF
IDVNMRDQVRIEAAIITLLLVILLIIYRNPITMLLPLITIGVSLNVAGAV
LAGASQFGLAVSSQTLVFLTGMLAGAGTDYAVFLISRYHDFLRHGADSDQ
AIKNALGSIGKVIAASAATVGLTFLGMSFARLDLFATTGPALAIAIAVAF
LAAVTLLPAIMVLAGRRRWIKPRRDLTTRFWRRSGIRIVRRPRTNLIVSL
VVLLALAGCVSLVHYNYDDRKALPPTVASSLGYVAMEQRFPLTSIMPQYL
FIQSPRDLRTPEALADMEQMAQRVSQLPDIAAVRGITRPTGKPLEAASTT
AQAGEVGQRLNDASAMIHDRSADLDKLNSGAAQLADALASVRDQMSKSMS
SVGSLLDMLTAIQKQLGQLGGTTNFGQLGDGDRLVSGMRNLGAALDSIFG
KVANFDWIDPVVIALDGSQYCDTTPLCVSARDQFRAMQKARQDGTFDKLA
GIARQLQSTGPMSDLTKTVRQLTTSMSSVTGSMGSLGLGGGGQGSITDLQ
KGFEKLADGSRQVADGVDELVNQTKRMGDDLDTASDFLLAMKHEATSPSM
AGFYIPPRMLSSDDFKKAAKFFISSDGRSARYLVETKLNPFTTAAMDQVD
AITHTARGAQPNTALEHASVTMTGYSATLRDARDYYNHDIRFIIALTIAV
VLLTLIVLLRAIVAPLYLIASVIISYLAALGLGIATFQFLLHQELHWSVP
GLTFIILVAMGADYNMLLISRIRDESPRGIRSGIIRTVGSTGGVITAAGV
IFAGSMFGLLFASIGTIVQAGFVVGTGILLDTFLVRTVTVPAMAVLVGRA
NWWPSRWTPRPGGAGR
392417321YP_006453926.1 Protein of unknown function (DUF2505) [Mycobacterium chubuense NBB4MSRTVDFAVESTASVEQIHRAFCERDYWLARLKAFGGFGRLDSLEVGADG
CATVVVTQDLRHDALPGLVARFFPHEWKVVQNETWGPVEDGRLRGIVSIT
TYGAPGTGVGKVVMEPVPVGSRLTCAATVEFKVPLVGAMIEAVMGKLLAQ
QISVIQQFTTKWIAEFAL
392417320YP_006453925.1 X-Pro dipeptidyl-peptidase (S15 family) [Mycobacterium chubuense NBMGAARYVGRVGGLAIALGVGTAILTGQAVASADDTGTSGSGSASPSSESR
TSSTPSNTGTGTVKINKRPLGKHQANDGTSLGDTVKGIVDRVAGERGKRA
TDDSENADPGVDEQAPAEEAAAARPGDRRKHRVDANEQAPQQNPQTDPTP
AAAQDQPAVKQSPGLTWLKSPRVAAAREAKPVATTSSSLWTPPGALVTED
AATAPAATTTVAPVKTAVAEFLTSIHDALAPNGGTAPVGGSLSDLLLLAG
TRRELVQPQAAALPDYSVGLTEGVIGGCVVGATCTMPDGSTYTVIGTPSK
GGKLALDATTGAFTFLPFSPEYNADGSQNADGPSGQESFTVLVAQNTKFD
TFVTGLPIVGTTFIAPVIMTLQQLQILTPLIGTAARQDVTVNVDELRGVL
DTPVAYTTMVTSWDGTQISTNFFPAITTGNPDVGSPGYETIFNGPGLAQP
GATSPADPFVATFRQAGYNVVTWDPRGEFASGGVLQLDSPQYEGQDVSQL
ISWAAGLNGVQLDAPNDPTMGMVGVSYGGGIQLVTAAGDNRVDAIAPGWA
WNTLPDSLYPDKAFKTAYSSLLLLGLVTTGARINPMIYGGILTGATLGIL
TPGQIQLLQNSGPGQTVRGISAPTLIIQGTVDVLFPLQQSILNAALLAQN
PDVKLLWFCGGHGSCLPGQGNPAADDVWVMGETLAWMDRYVKNDGTTDPN
VFEWTDQNGDRWTSETLPTAADFYDTTSKVPATTWDTGKVLPIIPILGGS
GPNPQVPLPYSLGDGSIATNAVTIPLDNPDSEANVVGAPHVVINYSGLGT
SRHVYAQVVDKTTGQVVGNIVTPIPVTLNGRDQTATIDLNDIAYTVTPDS
DLELQIFTTATPYLNLTQFGFIDVQSVQVSLPTTSQGTNQGPNPVPAAAQ
ELVAV
392417319YP_006453924.1 hypothetical protein Mycch_3508 [Mycobacterium chubuense NBB4]MVGHHTKDKGDLGIAKAHADLVSKGFTVLFPATEHAPFDLVAYAAGRFHR
LQVKYRSARAGAISVKFRSTWADRNGTHTTPMDKSAIDMICIYCPETDDC
YYIRPAAHGASVTLRIAPSKNGQRVGVLAASDFRRLPAGAG
392417318YP_006453923.1 Diacylglycerol O-acyltransferase [Mycobacterium chubuense NBB4]MSNAPELDAAGLPEELSPLDQILHRGEANPRTRSGILTVELLDTTPDWEV
FRTRFENASRKVLRLRQKVVTPTLPTAAPRWVVDPDFNLDYHVRRVRVPQ
PGTFRQVMDIAEVAAQSPLDISRPLWTATLIEGVENAQAALMVHLSHAVT
DGVGGVEMFASLYDLERDPAPQATPPLPIPADLSPNDLMRQGLSRLPGTI
AGGMRDALFGAVQVVGHVVRDPVARLGGVIDYAMSGARVLGPVADPSPIL
RRRSLSTRSEAISIEFGDLHRAAKAAGGSINDAYLAGLCGALRLYHRAKG
VPVDTLPMAVPVNLRSEADPAGGNRFVGVNLAAPIGLSDPEVRIKNIRSQ
MTRKRDERALDMVGAVAPVVSLLPDSVLESMAGSIVNSDVQASNVPVYAG
DTFIAGAKVLQQYGLGPLPGVAMMVVLISRSGYCTVTTRYDRASITDPTL
WAQCLLAGFNEILALGGDGRATPATFTDESQPPSSPALQNGSAAQ
392417317YP_006453922.1 HAD-superfamily subfamily IB hydrolase- TIGR01490 [Mycobacterium chMTSESTSGNPQLRLPGSVAEIEASPPGPEIGAFFDLDGTLVAGFTGVVMT
QDRLRRGQMSIGEFIGMVQAGLNHQLGRSEFEDLIGKGARMLRGNSVDDI
DELAERLFVQKIVSRVYPEMREIVRAHMAAGHTVVLSSSALTVQVDPVAR
FLGIDNVLSNKFETDEDGRITGEVQRPIIWGPGKARAVQEFAAAHDIDLS
KSYFYADGDEDVALMYLVGNPRPTNPGGKMAAVAAKRGWPVLRFSSRSGA
SPVSQLRTVAGIATMAPVAAGALGVGLLTRNKRTGVNFFTSLFGRTLLNT
IGINLNVLGKENLTAQRPAVFIFNHRNQADPLIAGRLVNDNFTSVGKKEL
ESDPIVGTIGKILDAAFIDRDDPQKAVEGLKKVEDLARKGVSILIAPEGT
RLDTTEVGSFKKGPFRIAMSVGIPIVPIVIRNAEVIAARDSSTFNPGTVD
VVVYPPIPVDDWTHDNLDERIEQVRQLYLDTLKDWPRDSLPTPDVYQRTT
KPAKKSAAKKSAAKKAATKSTATKGRS
392417316YP_006453921.1 glycerol-3-phosphate O-acyltransferase [Mycobacterium chubuense NBBMKIRAADIAAFTAVDDSLVLASVSSPAEEALLADWLQHQRREHPDSQIEV
LKLPADDDPPAGVLAQLVELLEADEDRSVVPVRVFWVPGGLPTRSKVVAL
LSGRDTYCPPKVLQRSILHRDPSRARVVAGEPAKVSELRQHWSDTTVAEN
PRDFARFVIRRAILAIERVELRLLGPEYKSPRLIKPEVLASTRFREGLDK
IPGATVEKAGEMLDELATGWSRFSVDLIPSLGRAIFSRGFDPNIDYDRTE
VEAMRHALEAHPAVLLFSHRSYLDGVIVPVAMRENRLPPVHTFAGINLSF
GAMGPLMRRSGVIFLRRKLDDPLYKFVLRQFVGYIVEKRFNLSWAIEGTR
SRTGKMLPPKLGLLAYVADAYLDGRSDDILLQPVSISFDQLHETAEYASY
ARGGEKTPEGLSWLVNYIRAQGERNYGKIYVRFPQAVSMREYLGEPHGAM
TTDESAKRLAMQKMAFEVAWRILQVTPVNATALVSALLLSTRGVALTLDQ
LHHTLQDSLEYLERKQTPMTNSALRLRTPEGVRAALDALSNRHPVTCVEG
GREPVWYIAPQDELEAAFYRNSLIDAFLETSLVELALAYAARAEGDRLDA
FWTQVMRLRDLLKFEFYFADSAAFRDHVAEEMSGHPDWEADVAAGGDRID
GVLRAKRPAIAGPLLRPFFEAYQIVADALLDAPADISEKELTTKALGLGR
QYVAQDRIQSNESVSALLFTTARQVAADQHLLEPAADLADRRKAFRDELR
GILADMNKVDSYSREQFFTRERNRRALRSQAV
392417315YP_006453920.1 putative membrane protein [Mycobacterium chubuense NBB4]MTSAVQDTTQGVRRAPVWSVLSGVALLAGLTAAALAGLSVADALTATGLP
DAGPVTNYGLPFIKAAGEIAAVTATGCFLFAAFLVPPQANGVLDAAGYRA
LRTGTVASALWTVCALLMVPLTVSDVSGQSLSTRLSPADIWSVAGLIEAA
GAWRWTALFAAVVTVVSIPVLRWSPTPVLFAGSLVTLLPLALTGHSSAGG
SHDLATNSLLIHLVAAALWAGGLLALLVHALRGGEHADIAARRFSAVALW
CFVAMALSGVVNALVRIQPADLVHSRYGWLVVGKAAALCALGYLGWWQRR
RGVAALQTNASARGALIRLALVEAVLFGLTFGIAVALGRTPPPPPANLHL
SIPAVEIGYDLDGPPTVARLLFDWRFDLLFGTASIVFAVVYLAGVRRLRR
RGDAWPPGRVAAWLLGCLVLLVATSSGIGRYTPAMFSMHMIGHMILSMLA
PVLLVLGAPVTLALRALPAAGRDQPPGLREWLLAALHSRVSRFLTHPIVA
TALFVLGFYGLYFGGIFDAVNGSHAAHVAMNLHFLVSGYLFYWVVIGVDP
TPRPLPPLAKLGVVFASLPLHAFFGVVLMGTKSVMGESFYRSLQLPWHTD
LLADQKLGGGIAWAAGEIPLVLVLIALFVQWQRSDTRTAKRLDRAADRDD
DADLAAYNAMLAEMARRDRAES
392417314YP_006453919.1 single-stranded DNA-binding protein [Mycobacterium chubuense NBB4]MFETPITIVGTIITNPERRWVGDQELFKFRVASNSRRRTGEGTWEPGNSL
YATVNCWGRLVTGVGAGLGKGDAVIVVGNVYTSEYEDRDGNRRSSLEIRA
TSVGPDLARCIARIEKRRHPDAASDTAADGTGAGTADDERDEEQSAVGVT
GLPLSA
392417313YP_006453918.1 ATP-binding cassette protein- ChvD family [Mycobacterium chubuense MIPRATPGSRKATSKAMAEFIYTMRKVRKAHGDKVILDDVTLNFLPGAKI
GVVGPNGAGKSSVLRIMAGLDQPNNGDAFLAPGASVGILQQEPPLDDTKT
VRENVEEGVPIKGKLNRYNEVAELMATDYSDELMEEMGKLQEELDAADAW
DIDSQLEQAMDALRCPPPDEPVTHLSGGERRRVALCKLLLSKPDLLLLDE
PTNHLDAESVLWLEQHLAEYKGAILAVTHDRYFLDNVAEWILELDRGRAF
PYEGNYSTYLEKKAERIAVQGRKDAKLQKRLKDELEWVRSGAKARQAKSK
ARLQRYEEMAAEAEKTRKLDFEEIQIPTGPRLGSVVVEVSHLDKGFDGRQ
LIKDLSFTLPRNGIVGVIGPNGVGKTTLFKTIVGLEQPDSGTVKIGETVK
LSYVDQSRSGIDPKKTVWQVVSDGLDYIEVGQNEIPSRAYVSAFGFKGPD
QQKPAGVLSGGERNRLNLALTLKEGGNLILLDEPTNDLDVETLSSLENAL
ENFPGCAVVISHDRWFLDRTCTHILAWEGDTDNEAKWFWFEGNFAAYEEN
KVERLGAEAARPHRVTHRKLTRG
392417312YP_006453917.1 NAD-specific glutamate dehydrogenase [Mycobacterium chubuense NBB4]MSLNSGAIGGQTAEDGIPDIVDRLLPAYLRTYHGPHGGAPGAEAAVTGPV
RKPAANTLAGPALVEAQYRLGSQRSAGATRVAVYGADDSGGFGPAMQIVT
DNATMLMDSVTVLLHRIGVAYKAIMNPVFRVRRGAGGELLDIVPASEATF
SDGVDETWVHVQLSSSVDRRALEEAERLLPRVLADSRQVALDSADMAATL
RILAAELDSDTGRRFPSPDRKDVAALLRWLADGHFVLLGCQRCRVHDGEA
TVDPSSRLGVLRLRTDVLPQLTNKDELLALAQATIPSFLRYGAYPQIVVV
REQSGDANDPGAIEHRFVGLFTVASMNANVLEIPLISRRVNDALAMAHRD
PSHPGPLLLDIIQTIPRSELFALSARGLLDMAMAVVDLGSRRRTLLFLRA
DPLAHFVSCLVYLPRDRYTTAVRLEMQDILVRELGGVSIDYAARVSESPW
ALVHFTVRLPEGSRPSDVDVSEANESRIQDLLTEAARTWGDRLLGAVRAG
SIDQAAAEHYAAAFPEVYKQAVNPLHALSDIAIIEELDDDSVKLVLDDTE
STAVDGVSNLIWYLGGQSASLSQLLPMLQSMGVTVLEERPFTVTRPDGLP
VWIYQFKVSPHRGMPDVPPGPEHESRAQRFADAVTAIWHGHAEIDRFNEL
VLRAGLTWRQVALLRAYAKYLKQAGFSYSQSHIAAVLNEHAGTARSLVEL
FEALFCPVDQDQTAANRDAQAAAAAVSADIDALVSLDTDRVLRAFASMIQ
ATLRTNYFISRDDSARARNVLSFKLNPELIDELPLPRPKFEIFVYSPRVE
GVHLRFGYVARGGLRWSDRREDFRTEILGLVKAQAVKNAVIVPVGAKGGF
VVKHPPASTGDPATDRDATREEGVACYRLFIAGLLDITDNVAKASGAIVA
PTDVVRRDGDDAYLVVAADKGTATFSDIANDVAESYGFWLGDAFASGGSV
GYDHKAMGITAKGAWESVKRHFREMGVDTQSEDFTVVGVGDMSGDVFGNG
MLLSKHIRLLAAFDHRHIFIDPDPDAATSWEERKRVFELPRSSWEDYDAS
LISRRGGVYSREHKSIPVSDEARAALGIDDEVTELTPPALIRAILKAPAD
LLFNGGIGTYVKAETESDVGDRANDAVRVNGNQVRAKVIGEGGNLGVTSL
GRIEFDLCGGRINTDALDNSAGVDCSDHEVNIKILIDSLVTSGKVQPAER
TDVLLSMTDEVGRLVLSDNESQNDLMGTSRANAASMLSVHARMIRDMVEE
HGLNRELEALPSEKEIARRTEAGIGLTSPELATLMAHVKLLLKHDLLSSE
LPDQEVFASRLPSYFPARLRDQFSADIRSHQLRREMVATMLVNDVVDTAG
ITYVYRVTEDVGVSPLDAVRSFVAGDAIFGYGRVWRQIRAAGAEGASVAV
TDRMTLDLRRLVDRASRWLLNYRPQPLAVGAEINRFAEKVSALTPQMSQW
LRGDDKAIVTKEAGEFSAQGVPEDLAYMVATGLYQFSLLDVIDIADIVDR
DPAEVADAYFALMDRLGTDGLLTAVSRLSRDDRWHSLARLAIRDDIYGSL
RALCFDVLAVGEPDESGEQKIEEWEMTNSSRVTRARRTLTELYESGEHDL
ATLSVASRQIRSMTRTSGTGTSG
392417311YP_006453916.1 putative thioesterase [Mycobacterium chubuense NBB4]MTQHGFTAPVGVRWSDIDMYQHINHATMVTILEEARIPFLLEPFGDDFAT
IGLLIAEVNISYKAQLRLVDSPLQVTMWSKRVRAVDFTVGYEVRSAGAPP
DSRPAVVADTQLAAVHIEEQRLQRLSGKQREYLQRWAR
392417310YP_006453915.1 hypothetical protein Mycch_3499 [Mycobacterium chubuense NBB4]MTAAERGLWLRDAGHRDDLAVFAERAQRLDPAAVVRLRQRPSGLLAAWVA
TGFDVLASRVVGGRIRPADLSAGADALLRGLAAMTPDGFVDPGFAMDSAW
RGVLPPEAGFAHLDDVPARVVLDLAQRGTSLAKQHSGAHGPPTSLLDQDV
LNVTAGGQTVGIPMRCVFALTAMGFLPQSPASEDFAPESVGSGEVVRIRL
TAAWLRIDARFGSVYRRRGDPAVVLR
392417309YP_006453914.1 truncated hemoglobin- partial [Mycobacterium chubuense NBB4]MDSVDKQQSFYDAVGGHETFHAIVSRFYQLVREDEILRPLYPEDELDAAE
ERLLLFLEQYWGGPRTYSDRRGHPRLRMRHAPFRIGYLERDAWLRNMHIA
VAEIDSRTLDEAHRRELIAYLEMAADSMVNSPF
392417308YP_006453913.1 response regulator containing a CheY-like receiver domain and an HTMPHGWQILERPSEFSEVRSALTGAGSYGVVLVGAAGVGKTTLARSVTESL
RSQVHWVASTESSRSIPLGVFAHLVGPSTSRDATALLASARESLVSQGNS
IVGVDDAHLLDELSATLLHQIAVDQTGRILATVRTGEPVPDAVTSLWKDG
YLRRIELQPFTKKQSVGLVESVIGGRLEGLSADLMWKSSGGNPLFLRHLV
EGSIDAGTLRKVDDVWQLRGPTAVPSGLVELLESRLEQSGEDVLGVLKIL
ALCEPLDIDALTELAGDAAVDAAEMRGLIRFQQDGPTLNARFSHPLVGDV
VRSKIGRAAERRLKGQVVQILRRRGLDTPASRIRMAQLSIDSDQSVDNEL
LTTAAKDAIYLSNLPLGERLARTAFDRTGSLQAGALLSRALLWQGKPAAA
DDILAKFAPDELDELQLVQWAIPRLSTLFWSMGEVEKAWKILELANERVR
HPSLALVLDATAAALTVHQNEIGEGIDKALTVLADPQAPDQAVEFAAFAA
GLAMPVAGSGDEFEPIAARCRAEQKTTDGMIRVMVRYCDVLALTHTGQLD
LAAKRAADYADFSSVGQFLAWAIAKIMAGVVATARGDFPEVVSSIEQALA
ALSAESPLPWQLPGRLLLARAYAALGRVGEAERVLNDAAAHSGPSMALHE
PQRLISKAWYAAAKGMERRAVELARAAADNARHSGQFALEAEALHHATRF
GDRTTAARLAELTGVVHGSPAPLFARHAAAFAASDAAGLDAVSVDFEHAG
LLLSAADAAAQAAHLHDAAGDRRKTNESGANALRLADLCGGATTPAVKTA
ARPLPLTSREREVAELVAAGLTNREIAEQLTLSVRTVEGHVYRACFKLDV
ADRDELAKLIKKKS
392417307YP_006453912.1 catalase [Mycobacterium chubuense NBB4]MTDGGTRQQNAYLPYRPELAASPPGEDALISAMVRSLRWNNRLQYAKSFV
VPRLKRNGRAHAIRDAHAKSCAVLYGELTVRTDLPPELRQGMFARPGKTY
PLIARLSATSGSIRSDQVRGVRGLGLKVLGVYGESGERADARFSDSNQDF
VFVTEPMFLFSDAADYAKSGMRTARVLAWSPDAAVKTLNVASRLARRAME
RRGRELPPKLKVFADPNHHVLGQTFYTAAPIRFGDYVAKLKVAPSSPSVT
RLIPRTISRSGYDALTEAVVGFFDSNSAEYELSAQLCTNEIDMPIEDATV
RWPEDSSPYRPVATIRYPVQTAYSNELRDFGDDSLTFNSWRGIAEHRPLG
SINRLKLRVYEASSEYRHAKNKVDRTEPTDLSAFGR
392417306YP_006453911.1 restriction endonuclease [Mycobacterium chubuense NBB4]MAQRKNGRGHRHHRAATGSSGSTANTASRALHSVLPTAATGVDSHLHPHP
AAVHEASLWGRRRVLLLNSTYEPLTALPMRRAVIMLMCGKADVVHDDPMG
PVIHSASRSVVVPSVIRLRTYVRVPYRARIPMTRAALMHRDRFRCAYCGT
KADTVDHVIPRSRGGDHSWENCVAACSSCNHRKADRLLTELGWTLRTTPL
PPKGQHWRLLSSIKELDPAWVRYLGEGAA
392417305YP_006453910.1 hypothetical protein Mycch_3494 [Mycobacterium chubuense NBB4]MHASLLVVPLALAGILSLFIFTKKGPHPKTYQIAETWTHEPILWAAEEPA
DHGHGGHGAHLTIGGGASGKW
392417304YP_006453909.1 protein of unknown function (DUF477) [Mycobacterium chubuense NBB4]MASGEITRTGGRDLAELPRGSVVTASGRISAVTEPGVLSVQYPFPNKDLV
VLDNALKYGSRAAKARFAVYIGDLGQDTAATARDILARVPTPDNAVLLAV
SPNQRAIEVVYGSQVKGRGIEESAPLGVSAAAASFREGNLIDGLISGIRV
LSAGVSPR
392417303YP_006453908.1 hypothetical protein Mycch_3492 [Mycobacterium chubuense NBB4]MAVSNSRRARAARRRKRRVAAVVNDLTDEQWAALKLAWNGCAYCGATSGT
LQRDCVMAISRGGRYTIDNVVPACAACNASKCNDEVTGWLRRKRLDERLF
LERYVRIKAELAARSAG
392417302YP_006453907.1 transposase- IS30 family [Mycobacterium chubuense NBB4]MGCRGPGRARLPESVRERFWAAVAAGLSPTAAATVAGVHGATGRHWAQQA
GYRGESKHFGIRYTAQQRAVFWTAVRSAVPPAQAAVVAGVSEAAARRWLQ
QADHVPRTPFPAEADLVAESELTSRVRAPLRFVERCRLEQLLEHGYPPAQ
AAALMGRHKDTINREIARGQTRSVYRASMGQDVADAARKRPKVRKLEANP
GLRAEVLQRLETRNSPEQIAGRLRQDFPDDPEMWVSHETIYQAVYVQPRG
ELAKELKSALRTGRIKRKPQGRNEIADRNRFKAGMVGISERPAEADDRAI
PGHWEGDLIMGAGNTSAIGTLVERTTGFVMLLHLPGDHTATTVAAAMTAK
VPEIPAILRRSLTWDQGTEMAMHTNITEATGLPIYFCDPHSPWQRGTNEN
TNGLLRQYFPKGTDLAFWGPGFLDQVAAELNARPRKRHNWRTPAEELDRL
LSDPSTYVAATA
392417301YP_006453906.1 Membrane alanyl aminopeptidase [Mycobacterium chubuense NBB4]MEHNRTRPPRVPRLRLVLTAVALPNLTRDQATERAALVTVDSYHVALDLT
DGDGRPGERTFRSVTTVEFDALAGADTYIDIAADSIRSATLNGADIDVSG
YDESTGIPLTGLAARNVVVVDADCRYSNTGEGLHRFVDPVDDEVYLYSQF
ETADAKRMFACFDQPDLKAVFDVTVTAPAHWEVISNGATVDVADDGAARR
HTFKATPRMSTYLVALIAGPYARWDDVYSDDHGDIPLGIFCRKSLAEYMD
DERLFTETKQGFSFYHNNFGTPYAFGKYDQLFVPEFNAGAMENAGAVTFL
EDYVFRSKVTRYSYERRAETVLHEMAHMWFGDLVTMQWWDDLWLNESFAT
FASVLCQAEATEYTQAWTTFANVEKSWAYRQDQLPSTHPVAADIPDLHAV
EVNFDGITYAKGASVLKQLVAYVGLEAFLAGLRDYFRDHAFGNATFGDLL
GALEKSSGRDLSGWGHQWLKTTGLNTMRPDFDVDSDGTFSRFAIEQGGAK
PGAGETRVHRLAVGVYDDDASGKLVRVHREELDVDGATTEVPALQGVSRG
KLILVNDDDLTYCSLRLDPDSLQTVLTRIADIADPLPRTLAWSAAWEMTR
DAELRARDFVALVMSGLHAESEVGVAQRLLLQAQTALGSYADPGWAAENG
WPAFGDALLDLARESAPGSDHQLAFVNALCSSVLSPNHVAVLSTLLDNEP
AEVNLAGLVIDTDLRWRIVTALARAGVVDADGPATPLIDAEADNDRTAAG
RRQAAAASAARPQQAVKEAAWEQVTEDDTLANITARAIIGGFVQPGQGEL
LKPFTQRYFGAISGVWQRRSSEVAQTVVVGLYPSWDISTEALDAADTFLS
DPEVPPALRRLVLEGRAGVERSLRARTFDAG
392417300YP_006453905.1 putative dithiol-disulfide isomerase involved in polyketide biosyntMANKDVAGFWFDPLCPWCWITSRWILEVEKVRDIEVNFRVMSLAVLNEGR
DLPEDYQKMMTRAWGPVRVAMAAEQREGRQVLSPLYTAMGTRIHDKGYPE
TDPDFTRVIAESLEEVGLPAELAEAAGTDKYDDALRKSHHEGMDVVGEDV
GTPTIHVNGVAFFGPVLSRIPRGEEAGKLWDASVIFASYPHFWELKRTRT
ESPEFG
392417299YP_006453904.1 cytosine/adenosine deaminase [Mycobacterium chubuense NBB4]MKSQLEMLDVAVEEARKGLAEGGIPIGAALFAADGTLLGSGHNRRVQLGD
PSLHAETDAFRNAGRQRGYRSTIMVTTLSPCWYCSGLVRQFNIGAIVIGE
SSTFTGGHDWLAEHGVDVTVLDDQRCVTLMREFIAASPDLWAEDIGE
392417298YP_006453903.1 ribose 5-phosphate isomerase [Mycobacterium chubuense NBB4]MRVYLGADHAGYELKKAIIEHLTATGHEPVDCGAFDYDADDDYPAFCIAA
AEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALGWSVETASLAREHN
NAQLIGIGGRMHSTEEALAIVDAFLTTKWSEAPRHQRRIDILTEYEKTHV
APPVPGA
392417297YP_006453902.1 formamidopyrimidine-DNA glycosylase [Mycobacterium chubuense NBB4]MPEGHTVHRLARQHHRIFRGQYVAVSSPQGRFVDGADAVNGRRFDRASAW
GKHLFHHYAGGRIVHVHLGLYGKFADFRVDAGVPEPVGQVRMRIVGTERG
TDLRGPTACEVVNEAEVSAILARLGPDPLRKDADPATAWARISKSRRVIG
ALLMDQTIIAGIGNVYRNELLYRHRIDPHRLGTGMEESEFADAWTDLVEL
MNVGVRKGRIITVRPQDDHGAPSYGPRRPRTYVYRRAGEPCRICGTPIRT
EVLEGRNLFWCPTCQT
392417296YP_006453901.1 hypothetical protein Mycch_3485 [Mycobacterium chubuense NBB4]MNGALLVLIVLVVAAIAFAVYASSKASSQRNAASLADAKADARRVIERLG
GQVFALTGNDDAAKQALADASERYTAASSQIDQATTARQAALAKESAMEG
LYYVRAARSAMGMDPGPELESLSGQRSAGVVTEDRRVDFNGRQIEASPIP
SQRTPNYYPGGRVAGRPVPAGWYSEPWWKPALVAGAWGVGSALLFSTLFS
GMSGVGYDAQAFENGYGDGFQEGFEQGQLDDGGFDGGDPGGGGWDGGGWD
GGGWDGGGNDWGGGDFGGGGFDF
392417295YP_006453900.1 putative Zn-dependent hydrolase of beta-lactamase fold protein [MycMQIDVTFIGNATTLIRCGDITVLTDPNFLHQGQHAYLGYGLWSKRLRPPA
LSIDQLPRLDAVVLSHMHGDHWDRVAERRLDRTLPIITTHHAAKRLRHRG
FETTKGLSTWDAVVIDRGATRVTMTALPGRHAPTPLNRLLPPVMGTMLEF
GPVDGGQRRRLYVSGDTLLIDELREIPVRFSSIDAGVLHLGGTRLPAGNR
LPFGVTVTMDGRQGAETVERLRLPKVIPVHFDDYGVFASPRSDFVTAMAE
RGLGERIVDVERGHTVTV
392417294YP_006453899.1 putative hydrolase or acyltransferase of alpha/beta superfamily [MyMRAVGRQYAHGVAETSYAPCGDLSLAFQVFGDGPIELVFVGPFVTHIELW
WTIPEFKAFFDQLAGFCRIVVFDKAGVGLSDPAPRIRTVDDRATEIEAVM
DAVGFERAVLFGMSDGGFAASVFAATRPERTRALILVDSYPFYAFMREWD
DAECDPIELWDRTRELYPELGERYMPSLEQIARLQEMARSVRWHWGSGAT
FSITAPSAYARFQPMLAMFERMCASPGMARASMEATFRIDIRPILPTITA
PTLVVHARGDLVVPVQAGRYFADHIPGARYLEVDSADHLPWFSDPDRILS
EIEEFLTGSHAVPAQAHRALRTVLFTDIVASTQHAAATGDERWRAVLQRF
REITADVTRRFGGTVVQHTGDGHLVTFDAPTRAIRCAEALRTDAETLGIQ
IRAGIHTGECALLDADVGGIAVHIAARICAQAGAGEILVSRTVRDLVVGS
GIGFENRGSVELRGVPGTWQLLAVDRHGPRAGSAEAELVSTPTPGPRSAM
RRSDRAVAAMARRTPWILRGVARLAPATGRNGEARISSLGRPAP
392417293YP_006453898.1 hypothetical protein Mycch_3482 [Mycobacterium chubuense NBB4]MLTANSLTLGAAVVVAAGLTGAGLSIAPIPAQAAPGGCQQFAFNGFTTIR
ATQDGQVTDINFTSNDPTFNGPVSAPSTGLSAPGSAAIDGGGHVELNVAD
AQSLINFAGDVGPDNKIHGTLHLQKADFVRDLPANSQGTVKCAKQAPKEG
PTVEYSPILGGLNVHVTDRSGTTSQCTYNSDGFTRTFRLDANSSTDLKIV
PAIPKFANWNVKITCDNGAVTETTQFF
392417292YP_006453897.1 trigger factor [Mycobacterium chubuense NBB4]MKSTVEKLSPTRVRINVEVPFTELEPDIDRAFKQLAQQIRLPGFRPGKAP
RKLLEARVGRGAVLEQVVNDALPGRYSEAVTSSSLQPLGQPDIEITKLED
NEELVFTAEVDVRPEIDLPDLSALKVTVDPIEVADSDVDAELESLQKRFG
TLTGVDRPAENGDFVSIDLSATVDGEDVPEAKTEGLSHEIGSGQLIEGLD
EAIVGLKEGESKTFTTTLVAGEHAGQEAEVTVAVKSVKVRELPELDDDFA
QLASEFDTIAELRESLREQVSRVKRVQQAEQIRDKAIEELLAQVEVPLPE
KVVQAQIDDTLHNAIHGLDHDEDKLAESLAEQGSSREEFDADNRTNAEKA
IKTQLLMDAIADKLDIQVGQNDLTERLVLMSRQYGLEPQQLLQMLQQNNQ
LPAMFADVRRGLTVAAVVHGATVTDTDGTVIDTTEFFGPSGEQAAEDAEI
ATGEDADTDEATGEVADTDEAGGEVADTDEAGGEVADTDEAGDDDAK
392417291YP_006453896.1 protease subunit of ATP-dependent protease [Mycobacterium chubuenseMTDMRGASAGLNLVDSVYERLLSERIIFLGSQVDDDIANRLCAQILLLSA
EDPTKDIHLYINSPGGSISAGMAIYDTMVLAPCDVATYAMGMAASMGEFL
LAAGTKGKRYALPHARILMHQPLGGITGGAADIAIQAEQFASIKKEMFRL
NAEFTGQTIERIEADSDRDRWFTAQEALEYGFVDHIITSASINGDGPGAG
LDK
392417290YP_006453895.1 protease subunit of ATP-dependent protease [Mycobacterium chubuenseMTDHTDPRRAPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVD
DASANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRAD
IQTVCLGQAASAAAVLLAAGTPGKRLALPNARVLIHQPALGGVIQGQFSD
LEIQAAEIERMRTLMEETLSRHTGKPADVIRKDTDRDKILTAEAAKDYGI
IDTVLEYRKLSAQKG
392417289YP_006453894.1 PPOX class probable F420-dependent enzyme [Mycobacterium chubuense MTTIDEAFALARDDNGLAVVATLRADDTIQSSVINAGPLSHPATGEPVLG
FVTYGKVKLNNLRARPQIAVTFRRGWHWATVEGRGELAGPDDPQPWLESD
ALPQLLRDIFTAAGGTHDDWDAYDRTMREQRRTAVLITPTRIYGNG
392417288YP_006453893.1 hypothetical protein Mycch_3475 [Mycobacterium chubuense NBB4]MTVGVKRSAAIAALAMSAAAAWCAPAVAGAQEPVCPAGMYWNVDTAQCVA
DVNVYVNPPNPVIGPAGPVGVGGVIGPVGPGPVGPGPVGPGPLGPGR
392417287YP_006453892.1 endopeptidase Clp ATP-binding regulatory subunit ClpX [MycobacteriuMARIGDGGDLLKCSFCGKSQKQVKKLIAGPGVYICDECIDLCNEIIEEEL
ADADDVKLDELPKPAEIREFLEGYVIGQDTAKRTLAVAVYNHYKRIQAGE
KSRDSRSEPVELAKSNILMLGPTGCGKTYLAQTLAKMLNVPFAIADATAL
TEAGYVGEDVENILLKLIQAADYDVKRAETGIIYIDEVDKIARKSENPSI
TRDVSGEGVQQALLKILEGTQASVPPQGGRKHPHQEFIQIDTTNVLFIVA
GAFAGLEKIVSDRVGKRGLGFGAEVHSKAEIDTQDHFAEVMPEDLIKFGL
IPEFIGRLPVVASVTNLDKDSLVQILSKPKNALVKQYTRLFEMDGVELEF
TGDALEAIADQAIHRGTGARGLRAIMEEVLLPVMYDIPSRDDVAKVVVTK
ETVEDNVLPTIVPRKPSRTERRDKSA
392417286YP_006453891.1 plasma-membrane proton-efflux P-type ATPase [Mycobacterium chubuensMVEAVQHLAVAALPEVLAELDATADGLTSAQARERLTRYGPNEIPEKHRN
PLVVFLGYFWAPIPWMIEVALALSLAARHWADAVIIAALLLMNGLVAFVE
EHQAAGAVAALKQRLAASARALRDGVWTTVGVRELVPGDVVRVRLGDVVP
ADLRILDDATIEVDQSALTGESLAVSRRRGDTLFSGSVLQRGEADALVYA
TGASSYFGRTAALVETAGSVSHFQRAVVRIGNYLIGFAAILVTVSVAASL
IRGNPVLQTLEFALVVTIASVPVALPAVLSVTMAVGARQLARQQAVVTHL
PAVEELGGMDLLCSDKTGTLTQNRLEVAARWTAPGVSPEDLLGAAALASR
PEDGDPIDLAVLAAAQMPAHLRVDGFTPFDPISKRTEAVVRDQDGRVFRV
SKGAPQAVTALCAAEGPAEAGAAVDRFATRGYRSLAVARVDGDAGWRVLG
VLALADPPREDSAATIAEAEKLGVAVKMVTGDQVAIGREIARRVGLGDHI
LDAAALDAGADERELARTIDEADGFAQVFPEHKFRIVELLQSRGHIVGMT
GDGVNDAPALKQADAGIAVAAATDAARAAADVVLLAPGLSVIVSAIRQAR
EIFVRMSNYATYRIAETLRVLLLITLSIVVMNFFPVTAVMIVLLALLNDG
AILAIAYDHVRGSAQPAAWDMRAVLTIATVLGVLGVLETFMLLWLAQTAF
GLDHDVIRTLIYLKLSVAGHLTVFVTRTRGPFWSRPAPAPLLLAAVVGTQ
ALATLIAVYGVLMTPLGWELAGVVWAYALLWFVVEDVVKRATYRLIGPHG
RSACTRSSSRHAGKPPASGRTERRGRRPATTAPTPPPTPESRPSRPSG
392417285YP_006453890.1 formate dehydrogenase family accessory protein FdhD [Mycobacterium MGRVTARRRAQHVTARDAVARPETLAVEEPLEIRVNGAAITVTMRTPGSD
VELAQGFLLTEGVVAKRDDIVAVRYCRGAAEDGVNTYNVLDVTLAPDVAA
PDVDPTRNFYTTSSCGVCGKASLEAVRLSSRHGPGDDPTTVAAGTLSSLP
GKLRDAQRVFAATGGLHGAALFSTDGTPLVVREDIGRHNAVDKVIGWALE
QGRIPLGGTVLLVSGRASFELTQKAVMAGIPVLAAVSAPSSLAVDLAAQS
GLTLVAFLRGDSMNVYTRSDRVDRSGDTSPS
392417284YP_006453889.1 hypothetical protein Mycch_3471 [Mycobacterium chubuense NBB4]MRHRLCESAGTGTRPVMRRLCGVFALVLLVGACESRPAHQAAPSTTPSGP
STTPTTTGLLPPGVPTEGSRPPAQSLPAPAEPQSAPAPSQPPPGRQVAVG
AAPEGIVVDAVTRTVAVAKRNPDELVLINADTGEITHRTPLPGVVRHLQL
AKPGGPVLVPVESADALVRVDLPNGRAQPEIVTGTVPHDASEAPNGTVFV
ANEHGGTVTALRGNDIVKVFTDSVQPAGLAAVGDRMGMLDVRKNDLTIYD
TEKLTIVGATPAGDGPTHLVADKHGRMIAADTRGDAVRVFDTRPRQLAEI
AQPGGPYGITYDATRDTLWVASSGTNEVIGYAMADATPREVKRISTVQNP
YTLGVDPMTGRLFIAGVTAGVVQIVDPG
392417283YP_006453888.1 methylmalonic acid semialdehyde dehydrogenase [Mycobacterium chubueMTNVISHWVDGGVFAGDSGVTASVTNPATGAVTGEVALASVADARAVIDA
AAAAFPGWRDTSLSKRTAVLFRFRELLNERKTELAELITAEHGKVVSDAL
GEVSRGQEVVEFACGIPHLLKGGYTENASTKVDAYSIRQPLGPVAIISPF
NFPAMVPMWFFPIAIATGNTVVLKPSEKDPSASLWLAALWKDAGLPDGVF
NVLHGDKTAVDELLTNPKIKSVSFVGSTPIAQYVYTTATATGKRVQALGG
AKNHAVILPDADLDLAADAMVNAGFGSAGERCMAVSAAVAVGPIADDLVA
KIAERARNIKTGDGTKDSDMGPLVTAAHRDKVASYIDAGEAAGAKVVLDG
RHVTPDGGQDGFWLGPTLLDNVTPDMSVYTDEIFGPVLSVVRVETYDQAL
DLINTNPYGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFG
GWKASLFGDTHAHGLDGVHFFTRQKAITSRWLDPSHGGINLGFPQNG
392417282YP_006453887.1 putative dehydrogenase [Mycobacterium chubuense NBB4]MSELRVAVLGVGVMGADHVTRITSRISGARVKMVNDYVTDKAEQIASGID
GCRAVADPLDAIADEDVDAIVLATPGTTHEKLLLACLEHRKPVMCEKPLT
TEVSTSLEIVRREAELGSRFIQVGFMRRFDEEYMALKALLDAGELGRPLV
MHCVHRNPGVPSYFDSSLIVKDSLVHEVDVTRFLFGEEIASVQIITPASN
PGAPDGVIDPQIAILRTVSGRHVDVELFVTTGVAYEVRTEVVGEHGSAII
GLDVGLIRKSAASTRGQAGPGTWGGQITPGFRERFGRAYDTEIQRWVNAV
TSGRGTGDHTDGPTAWDGYAAAAVCAAGVESLQTGLPVDVRLADHL
392417281YP_006453886.1 acetolactate synthase [Mycobacterium chubuense NBB4]MVSTAPKSTEKLVDNEPTVRLTVAQATVRFLANQFVERDGQRHKFFAGCF
GIFGHGNVAGIGQALLQDEVEACEAGAEPGLKYVLGRNEQAMVHTAVAYA
RQQDRLQAWAVTASVGPGATNMLTGAALATINRLPVLLLPADTFATRVSS
PVLQELELPSSGDVTVNDAFKPLSRYFDRVWRPEQLPAALLGAMRVLTDP
VETGAATVALPQDVQAESFDWPVSLFAERTWHVARPLPERSVIARAAEVI
RSAAKPLIVAGGGVIYSGASEALAALASQTGIPVCESQAGKGSLLHGHPQ
SVGAVGSTGTTAANALASEADVVIGIGTRYSDFTSASRTAFNNPDVRFVN
INVASLDSVKQGGISVVSDAREALDVLAESLGGYVVSDEYRARAAELMSE
WNDTVSEVYRTEDGAALNQNQVIGLVNTLSDTRDVVVCAAGSMPGDLHKL
WRTRDRKGYHVEYGYSCMGYEIAGGIGVRMAAPDRDVFIMVGDGSYLMMA
TELVTAVQEGVKVIAVLVQNHGFASIGGLSESLGSQRFGTSYRYRGADGR
LDGGKLPVDLAANAASLGADVIRVTTAAEFADAVKVAKAGDRTTVIHVET
DPMISAPDSHSWWDVPVSQVSTLESTQQAYQRYADWKKVQRPLINPSDR
392417280YP_006453885.1 putative enzyme involved in inositol metabolism [Mycobacterium chubMKSTLYIPAKSAAAPFTVAITPEDAGWAESSLHVVDLGDGQTVSLETAGT
EVMILPLAGAGTVECGGETFEMSLRASVFDGPADMVYLGIDQTYTLSGRG
RIAICGARATTSFPNRRVAAADVAVELRGAGNCSRQVHNFGTATAFEADS
LIACEVITPGGNWSSYPAHKHDENTDVETQLEEIYYFEIDDSPAGTPGFG
YHRVYGTPERPIEVLEEVRTGDVVLVPHGYHGPSIAAPGHHMYYLNVMAG
SGPTRAWLICDDPAHTWLRGSWEHQQIDPRLPFTGSS
392417279YP_006453884.1 hypothetical protein Mycch_3466 [Mycobacterium chubuense NBB4]MSESALCRDYAEITEIRAHDPSAVARAWDHRTTRPTLRGNGRLMIVAADH
PARGALAVGSRPTAMNSRTDLLDRLRAALADPGVDGVLATADILDDLLLM
GALEDKVVFSSFNRGGLAGSSFELDDRMTGATAASTAAAKMNGGKMLCRI
DLDDPGTVATLAACAKAVDELAGHGLIAMLEPFMSSRVDGKVRNDLSPDA
VIKSVHIGQGLGSTSAYTWMKLPVVDEMERVMESTTMPTLLLGGDPTDPE
EAFASWEKALALPSVRGLIVGRTLLYPPDDDVSSAVATAVAMIR
392417278YP_006453883.1 sugar kinase- ribokinase [Mycobacterium chubuense NBB4]MTNQPYDVLAIGRCGVDVYPLQVGVGLEDVETFGKFLGGSAANVAVAAAR
LGNRSALISGVGDDPFGRFVRAELARLGVDNRFVATHGEFPTPVTFCEIF
PPDDFPLYFYRKPSAPDLQIRPDEIDVDAVRSARLYWSTVTGLSEEPSRS
AHFAAWEARGRAPLTVLDLDYRPMFWDSPAAATEQVRKALTHVTVAVGNR
EECEIAVGETNPHKAADALLDLGVEIAIVKQGPRGVLGKSRRSSVTVPPN
EVDVVNGLGAGDAFGGSLCHGLLANWSLEKTLRYANAAGAIVAGRLECST
AMPTATEVAALAEQTAVEAVNV
392417277YP_006453882.1 transcriptional regulator [Mycobacterium chubuense NBB4]MPLTVELDRSSPVPLYYQLAQAIEAAIRDGELAPGDRFENELALAKRLTL
SRPTTRRAIQELVDKGLLVRKRGVGTQVVQNPVHRRVELTSLFDDLARAG
QEPTTQLLEYRVGPPDEEVARELNLAADREVAAIHRLRCANGEPLALMTN
YLPADLAPDPEELESNGLYQSLRARGVHIRLARQRIGARSATRAEAQLLD
EKPNAPLLTMARTAFDDSGAAVEYGTHCYRASRYYFDTTLVDR
392417276YP_006453881.1 hydroxypyruvate isomerase [Mycobacterium chubuense NBB4]MSFQLAVCSEMVFTELPILERVKRIDELGFAAEIWSWHDKDLDALAATGA
VFTSMTGYLHGDLVDPATCDEVVRTAELSIKAAETLGVTRLNVHTAELVD
GRAARPRRRATGQMWLTAARTLERVGELGAAAGVTFVVENLNTIVDHPGV
PLARAKDTLALVEGVGHPNVKMMLDLYHAQIGEGNLIELVRRCGDAIGEI
QVADVPGRCQPGTGEINYPAIAAALRDMGYTGTIGMEAWASQAGAAGSEA
ALQAFRAAFS
392417275YP_006453880.1 putative dehydrogenase [Mycobacterium chubuense NBB4]MPFPLSFGLIGAGWIGSFHAETLARRLPHARLVAVADPVPGAAQRFCAPK
SYHDPMELIADPAVEAVAISSPAATHADLVVAAARAGKHVFCEKPMALTL
EDADRAIEAARTAGVALQVGFNRRFATDFAAMHARIADGAIGTPQLLRSL
TRDPGISAEVAARVKPWTIFNETLIHDFDTLCWLNPGARVIQVFAQADAL
VRPQFRDRGFLDTSVVQLRFDNGAFAVAEASFQAVYGYDVRGEVFGSGGV
LLAGREPQQAAGANIELFGDAYVAQFAHFVDSVQAGTEPSVTGADARVAL
EIALAARESVETGTPVVLDRVLQ
392417274YP_006453879.1 transcriptional regulator [Mycobacterium chubuense NBB4]MQRRPTLEDVAARAGVSRALVSIVMRGAAGASDETRARVKRAADEIGYRP
DPQARRLRQQRTRLVGVTFTAGQEFHADLVDGVYVAAETLGYDVVLSAVT
PHRDEPRALRTLVDDRCEGLVLIGPQMPARQLVDLASSIPVVVVARRVRG
VDAVRSDDVAGAAMGVEHLLGLGHRRITYLDGGGAPGAAERLRGYRRAVR
AAGVAEVVRPGGLTEREGALAAAEVLESGELPEAVFAFNDRCALGVLDVL
IRAGVSVPQQISVMGFDDSPLAGLAHIDLTTVRQDSCALAAAAMHRLVAR
LDETVDQKRTVDVVCEPALVVRGSTAAPGS
392417273YP_006453878.1 monosaccharide ABC transporter substrate-binding protein- CUT2 famiMTARAKSDRPKTFTRLAVLAGAGVLALGIVSCSSTGGRPQGSGAGGGGGT
VDTPRMTVAMITHEVPGDSFWDLIRKGAETAAKKDNIELRYSNDPEAPNQ
ANLVQSAIDSGVDGIAVTLAKPDAMAPAVKAAEAKGIPVVAFNSGFDDWK
SMGVQEYFGQDEKLAGVSAGEKLNADGAKKIICVIQEQGQVALESRCAGV
TQGFKGQTELLNVNSKDMPSVESTITAKLQQDPSIDTVVALGAPIALTAV
QSKKNAGSNAKVVTFDTNAALVDAIKSGDVQWAVDQQPYLQGYLAVDALW
LYLNNKNLIGGGQATLTGPSFIDKSNIDAVAELAKGGTR
392417272YP_006453877.1 monosaccharide ABC transporter membrane protein- CUT2 family [MycobMTTQADLDVAAHAVVRDERVKERNRLQRLLIRPEMGAGIGAIGIFVLFLI
VAAPFREAASLATVLYASSTIGIMACGVALLMIGGEFDLSAGVAVTFSSL
AASMLSYNLHLNLWAGAALALILSLAVGFFNGFLVMKTKIPSFLITLSTF
FMLAGINLAVTKLVSGQVATQSVSDMQGWDSAQKVFASSFTLFGVGIRIT
VVWWLVFTAIATWVLFKTKIGNWIFAVGGDADSARAVGVPVTKVKVGLFM
FVGFCAWFVGMHLLFAFNTVQSGQGIGNEFFYIIAAVIGGCLLTGGYGTA
IGAAIGAFIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVIANNAFRNYAA
KK
392417271YP_006453876.1 monosaccharide ABC transporter ATP-binding protein- CUT2 family [MyMTISVEKPTSDSHSGGKVPLVELKNVGKTYGNITALKDICLRVHAGEVTG
ILGDNGAGKSTLIKIIAGLHQQSEGELLVDGEPTKFASPAEALNKGIATV
YQNLAVVPLMPVWRNFFLGQELRKKSFPFSLDANAMRATTLTELSKMGID
LPDVDVPIGSLSGGQRQCVAIARAVFFGARVLILDEPTAALGVKQSGVVL
KYITAAKEAGFGVVFITHNPHHAHMVGDHFVLLNRGRQKLDCTYDDITLE
HLTQEMAGGDELEALSHELRAAKG
392417270YP_006453875.1 hypothetical protein Mycch_3456 [Mycobacterium chubuense NBB4]MVVMDRAPGSQADTPVWRDPLSVGWRAHRNLLLLRLRWHERRAAKGDQY
392417269YP_006453874.1 hypothetical protein Mycch_3455 [Mycobacterium chubuense NBB4]MHVAVKPPLATAVALVGAGAIALTPVYPSLPEVAVPTVSSAAVHLVAQPN
PIALWSEVIAGAIHNAGGIGQEVLSDPVPVLRQILTNQLGNLNIVGSAGK
GVIEGLAEYFAPDNPFGLRAGIQDAVEQIKAGQIAAGFATLTSTVIAGPL
VVGVGLPLLMSGLLQVPVKIAQNVTDAVGALFDNANIVPLLTAAMGPIVA
PINAFGASLQDFVEALGAGHLGDALTAVINVPARLVGAVLNGYTDASGGF
AAGLLTVSNDPFSAGLLQAALVNLPRAMATALGAQSAAPATTRLVDKVAS
PVIHASTTVTLAVPSTETGPATTDGVPVPHDAPPTTHGAVETPVDRAPNE
ETAAKKPDETPVEQPAAVDKTDVAESPGTEAGDVDGTHTGGATDGTDSDG
ADGGSASETTDGASGGASSGTGASERTSSGTGASERTSSGTGASERTSSG
TGASEGAASGTGASHESSRTDKSSGE
392417268YP_006453873.1 putative dehydrogenase [Mycobacterium chubuense NBB4]MSLRIGVLGASRIAEDAIVGPARQLGHRLVAVAARDPLRASAFADKYGVE
RVLPSYRDVVTDPEVDVVYNPLANALHAPWNLAAVAAGKPVLSEKPFARN
TVEAAQVAAAAQAAGVTVMEAFHYLFHPVTRRAFELATDGTLGELTRVEV
RMGMPAPQAADPRWSLELAGGALMDLGCYGLHIMRRFGEPSVNRATAGER
SPGVDAWCDVELTFPSGATGLSTNTMEADDYSFTLRVIGTRGEAFVHDFI
KPHHDDRLTVRTHDDTRVEHLGRRPSYTYQLEAFAAHVQHGAPVPLDTAD
AVANMALVDEAYRAAGLSPR
392417267YP_006453872.1 sugar phosphate isomerase/epimerase [Mycobacterium chubuense NBB4]MKVAGAPISWGVCEVPGWGYQLSPDRVLSEMRQVGLTATELGPEGFLPSD
TAELVSLLDRHGLSCVGGFVPAVLFDEGHDPLDDLAGPLESLVAAGAGVV
VLAAATGAEGYDARPELTESQWATLLLNLDRLAGVVAARGLVAVLHPHVG
TMVENRAEVDRVLAGSSIPLCLDTGHLLIGGTDPLELARAVPERIKHAHL
KDVDAALAAKVQSGELTYTDAVAAGMYVPLGAGDVDITGIVTALEDSGFD
GWYVMEQDNILDGEPGGEGPLADVLASVAFLEGAASGVWA
392417266YP_006453871.1 putative dehydrogenase [Mycobacterium chubuense NBB4]MTTLGLIGLGRIGAFHADTLTNLPEISGLVVTDERPDSVAEVAAKYDATP
VDSVDKLLSSGIDGVVVAAATPAHAELALAAVERGLPTFCEKPIAATAAE
SARVAEVIARSGVPVQVGYQRRFDAAFAAAKQAAYSGALGALHTVRSTTM
DPAPPPMDYIRGSGGIFRDCAVHDFDVIRWVTGQEVLEVYATGSVQGDPL
FTEYGDVDTAAIVVRFDGGALGVVSAARYNGRGYDCRLEVHGFDDTVVAG
WDRGVPVRNVDPAQSGPSGFPSGMPHHFFMDRFAEAFRAELSAFVKVVQG
GPIQGATVADAVEVAWIAEAATESLRRGVPVRIEEVKQ
392417265YP_006453870.1 protein involved in biosynthesis of mitomycin antibiotics/polyketidMAAPVRTPSTGASAAWIGESDVDLDEFRVQVERDTDLADYPHAAEVRSKV
LVYSADALAEVTERAGGRRALQSELIRALADGPGVVVFTEAFEAGVVDRA
NEAFFTLIEAQRAGGREAGDHFGTPGANDRIWNAAQKLALHAPQVFAEYY
ANDAVALICQAWLGPRYQVTSQVNVVNPGGTAQVPHRDYHLGFVPEEHLA
EYPAHVHRASPALTLQGAVAHCDMPVESGPTMLLPHSQRFAGGYVAFNRP
EFVDYFAAHHVQLPLQKGDAVFFNPALYHGAGANVSAATPAIRRIANLLQ
ISSPFGRAMEAMDRTAMVAAVYPELRAMKAAGRPWRDLHNVVVATAEGYA
FPTNLDSDQPVGSLAPPSQVDTVLGALAHALTAEDLAVALRDQNERRHP
392417264YP_006453869.1 monosaccharide ABC transporter substrate-binding protein- CUT2 famiMAHRYKVREIAQQSGLSEATVDRVLNNRPGVRENTIAEVKQAIADLDKQR
AQLRLNGRRYLVDVVMQTPQRFSDAFRAAVEAELPVFAPAMVRARFHLWE
AGSTAQMVDALGRLRGSHGVVLKAQDDPEVAEAIDRLVDSGVPVVTYATD
VPASARCAYVGIDNHGAGVTAAYLVQQWLGEAPSDVLITVSRSVFRGEGE
REVGFRSALRNSGRSLVEVSESDGIDATNERLVLEALEAHPNVEAVYSVG
GGNVATVAAFEKIGRFCRVFVAHDLDADNRRLLREGRISAVLHNDLRADA
RMALRLILQERGALPVEPARPVPIQVITPYNLPVQC
392417263YP_006453868.1 2-oxoacid:acceptor oxidoreductase- alpha subunit [Mycobacterium chuMGENGNVTGSADRTPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGN
DLATQPNYPAEIRAPQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPA
ALKANVSDLPRGGLIIANSDEFTKRNLAKVGYDANPLETDELSDYVVQAV
AMTTLTLGAVESIGATKKDGQRAKNMFALGLLSWMYGRELEHSEAFIREK
FSRKPEVAEANVLALKAGWNYGETTEAFGTTYEVAPAKLKTGEYRQISGN
TALAYGIVTAGQLADLQVVLGTYPITPASDILHELSKHKNFNVLTFQAED
EIAGIGAAIGASYGGALGVTSTSGPGISLKSEAIGLAVMTELPLIVIDVQ
RGGPSTGLPTKTEQADLLQAMFGRNGESPVAVLAPRSPSDCFDIAVEAVR
IAINYRTPVMILSDGAIANGSEPWRIPDVSAYAPIEHTFAKEGEPFQPYA
RDPETLARQFAVPGTPGLAHRIGGLESANGSGNISYEPKNHDLMVRLRHE
KVAGISVADLKVDDPTGDADLLILGWGSSYGPIGEACRRARRKGTKVAHA
QLQNLNPFPANLGEVLNSYSKVVVPEMNLGQLALLLRGRYLVDVQSVTKV
EGMAFLADEVEGIIDAALDGTLGDREIEKAKFARLAAATVETGVNA
392417262YP_006453867.1 2-oxoacid:ferredoxin oxidoreductase- beta subunit [Mycobacterium chMTDVIGTDLGLTPLTKTSGVPTTDQPQKAKDFTSDQEVRWCPGCGDYVIL
NTIRNFLPELGLRRENIAFVSGIGCSSRFPYYLETYGFHSIHGRAPTIAT
GLALARPDLSVWVVTGDGDALSIGGNHLIHALRRNINITILLFNNRIYGL
TKGQYSPTSEVGKITKSTPMGSLDYPFNPVSLALGSEATFVGRALDSDRK
GLSEVLRGAAEHRGAALVEIMQDCPIFNDGSFDALRKEGAEERLITLTHG
EPITFGADGEYCVVKSGYGLEVAKTADVSAEDIVVHDAQLEDPAYAFALS
RLSEQNLDHMVMGIFRRVSKPTYDDAARAQVTAARDAKAHDTAALQTLLR
GKDTWTVD
392417261YP_006453866.1 molybdopterin-guanine dinucleotide biosynthesis protein A [MycobactMGRDKATMPFHGPSGATTLVEQVVSVVRSRCRPVLVIAAPGQALPELPAT
ILRDEVRGVGPLLATGRGLRAAAEAGLSHAFVCAVDMPLLTTEVIDALAG
PAQRLGADVVLPWDGRDHYLAGIYRTALFETVDALVKNGERSMRALVDRV
DTQRIVMPEQPALANVNTAADLESVVPPRLS
392417260YP_006453865.1 transglycosylase-like protein [Mycobacterium chubuense NBB4]MKNIRKTFGMATIAGALAVAPMALATGTANADSVNWDAVAACESGGNWSI
NTGNGYSGGLQFTQSTWSANGGTGSPHNASREEQIRVAENVLHTQGIGAW
PVCGRRG
392417259YP_006453864.1 transglycosylase-like protein [Mycobacterium chubuense NBB4]MNVRTAVNKGLLAAAISGAMAVVPMALTEGATATAHADSVNWDAIAQCES
GGNWSTNTGNGAYGGLQFKEATWSANGGVGSPAGASRAEQIRVAENVLQS
QGLQAWPKCGAKGLAAQVWGNPATSTPSVVPVAQAKGCATMPTSLFGGIL
DLRKMCSAIFTPRAAR
392417258YP_006453863.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMPARILVVGAGIAGLATAVALRRSGHDVTVVEQRTDLASGSGISIWPNAL
AALDEIGLGDAVRDAGGRVTAGAIRWRDGAWLRRPSAQRMVTALGEPLVV
VRRAALTGILREALPPGAVQTGFCATNLTATGSSARVTLSDGRSRETDAV
VGADGVNSLVARTLNGPLSSRYVGYTAWRGVAQFALDPDLAGETMGAGIE
VGHVPLGPDHTYWFATERAPEGSAATGGEHAYLTAKLAGWADPIPQLVAS
TAPADLLRNDLYDRAQPRVWSAGPVVIVGDAAHPMRPHLGQGGCQGLEDA
AILGRCVTDCTNLAEAFGRFAAFRRRRVRALVRESAAIGRVVNLRPAFLS
GVASRATALIPEPVVTRHLAWIAARSAFVLPTAGDRAT
392417257YP_006453862.1 dipeptidyl aminopeptidase/acylaminoacyl peptidase [Mycobacterium chMACDPPLGTPFHELDDFLAVPRVSGLAVSPDGSRVVTTVSRLNDKRTEFL
SAVWELDPAGRRDARRITHGAKGESSPRFTSDGDLLFLAVRPGDDDEPPK
SLWCLPAGGGEAYQLSAPPGGVDGVVSARAADATVIASSLLPSATDVDDD
RRLRKARKDNNVSAVLHSGYPIRHWDHDLGPQQTNLFLTDGCRNLTPDPG
TGLRDAAFDLSGDGSFVVTTWQEPAAGASVRSLLVRVDVATGRRSTIAED
LDADLGLPAISPDGSSVAFTRETHSTPELAPRITLWLLHFGGEPRELTAE
WDRWPTSVAWSSDGASLIVTADQNGRGPIFAVDPSSGEVQPIVDDDFTYT
DVHTAPGGVLFALRSSYRRPPHPVRIEPDGSVTELPAVPAPELPGTLTEM
TAAADDGQPVRSWLALPHGEAPAPLVLWVHGGPLGSWNSWHWRWNPWVMV
ARGYAVLLPDPALSTGYGQDFIQRGWGAWGSAPYTDLIAATDAACAHPRV
DESRIAAMGGSFGGYMVNWIAGHTDRFAAIVTHASLWALDQFGPTTDGAY
WWAREMTPEMASANSPHRFVSKIRTPMLVIHGDKDYRVPIGEALRLWYEL
LSSSALPAGDDGTTDHRFLFFPSENHWVLSPQHAKLWYQVVLAFLGRHVL
GEDIEVPELLG
392417256YP_006453861.1 hypothetical protein Mycch_3442 [Mycobacterium chubuense NBB4]MSASDREHDIVLYGATGFVGKLTAQYLAAHGGNARIALAGRSADRLLAVR
DSLGEAAQSWPLVVADASEPSTLNDMAASTRVVVTTVGPYLKYGLPLVGA
CAAAGTDYADLTGEPLFERKAIDLYHKQALDNGARIVHACGFDSIPSDLT
VFALYRRAESDGAGQLGDTNFVVRRFAGGVSGGTVASMAELAREASLDPE
ARRLLDDPYTLSPDRAAEPELGAQPDARWRRGRDIAPELDGYWVGAFAMA
IPNTRVVRRSNALLDYAYGRRFEYAEQMSLGRSILAPVAAAMATAGNVAT
VELGSRFLNRVPRSALERVLPKPGTGPSDRAREQGHYTVETYTTTSSGAR
YVARMSQKGDPGYKATSVLLGESGLALALDRDKLSDLHGILTPAAAMGDA
LLARFPGAGVSLEVSRLN
392417255YP_006453860.1 Bacterial protein of unknown function (DUF937) [Mycobacterium chubuMADLDELFNEIPTQQIATRLGVGEAEVDSAVKTLVPVLVGGLAHNAQDPA
AADSIASAASDHAARGLLDGGVSVDQVDEADGSRAVAKIFGGNNPDQVSS
ALAGGGAGNSDLINKLLPILTPIVLAYLGKQLSKGQAGGGGGVGDILGGI
LSGAGGGRDNPLGSILGTVLGGDKGGGLGDILGGLFGGKSGRGK
392417254YP_006453859.1 valyl-tRNA synthetase [Mycobacterium chubuense NBB4]MTSQPIADHSPPGLDALPKSWDPGAVESELYDGWVNAGYFTADPASDKPA
YSIVLPPPNVTGSLHMGHALDHTLMDALTRRKRMQGYEVLWLPGMDHAGI
ATQTVVEKQLALDGKTKEDLGREQFIERVWDWKRESGGTIGAQMRRLGDG
VDWSRDRFTMDEGLSRAVRTIFKRLFDAGLIYQAERLVNWSPVLQTAISD
LEVKYEDVEGELVSFRYGSMSDDEPHIVVATTRLETMLGDTAIAVHPDDD
RYRALVGTTLAHPFLDRRLIVVADSHVDPEFGTGAVKVTPAHDPNDFEIG
LRHQLPMPSILDTKGRIADTGTQFDGMDRFAARVAVREALAEQGRIVAEK
RPYLHSVGHSERSGEPIEPRLSLQWWVKVESLAKAAGDAVRNGATVIHPA
SLEPRWFAWVDNMHDWCISRQLWWGHRIPIWHGPDGQTVCVGPDEAPPEG
WEQDPDVLDTWFSSALWPFSTMGWPDHTPELAKFYPTTVLVTGYDILFFW
VARMMMFGQFVAGDPAVTGDGARGPQVPFEHVFLHGLIRDEHGRKMSKSR
GNGIDPLDWVEMFGADALRFTLARGASPGGDLAIGEDHARASRNFATKLF
NATRFALLNGATPAPLPATSDLTDADRWILGRLEEVRAEVDSALDSYEFN
RACEALYHFAWDEFCDWYVELAKVQLSEGISHTTAVLAAVLDVLLKLLHP
VMPFVTEVLWKTLTGGESLVVADWPRPTGFAVDPGATQRVGDMQKLITEV
RRFRSDQGLADRQKVPARMSDVTAAGLDAHVPAVSALAWLTPPAEGFTPS
ASVEVRLSGATVVVEVDTSGTVDVAAERRRLEKDLAAAQKELAGTTGKLG
NQGFLSKAPAEVVDKIRTRQQVAGEEVERITARLAALPAER
392417253YP_006453858.1 folylpolyglutamate synthase/dihydrofolate synthase [Mycobacterium cMSAADPEPAPDEIASLLQVEHLLDQRWPETRIEPSTARIAALMEMLGAPQ
RGYPSIHIAGTNGKTSVARMIDSLLTALHRRTGRTTSPHLQSAVERISID
GKPVSPATYVNTYREIEPFVQMVDQQSEEAGGPRMSKFEVVTAMAFAAFA
DAPIDVAVVEVGLGGRWDATNVVNAPVAVITPIGMDHTDYLGDTIAEIAA
EKAGIITRQADDLVPTDTVAVIARQVPEAMEVLLAQAVRADAAVAREDSE
FAVLGRQIAIGGQLLELQGLGGVYSEIFLPLHGEHQAHNAVLALAAVEAF
FGAGAERQLDIDAVRAGFAAVTSPGRLERMRNAPTVFIDAAHNPAGATAL
ARALADEFDFRYLVGVVSVMADKDVDGILAALEPAFDQIVVTHNGSPRAL
EVEALAVKAEEAFGPERVIVAATLPDAIETATAVVEESGGGADGAGGMSG
AGIVITGSVVTAGAARTLFGKDPA
392417252YP_006453857.1 hypothetical protein Mycch_3438 [Mycobacterium chubuense NBB4]MSEHPPPPDPWKSFRGVMAGTLILEAIVVLLALPVVGAVGGGLTAPATAY
LVGVAVVLVLMAGVQGRSWAIWANLAVQLLLIAGWVLYPGVGFIGLLFTV
VWLLIVYLRAEVLRRQKRGLLPGQQNNDG
392417251YP_006453856.1 nucleoside diphosphate kinase [Mycobacterium chubuense NBB4]MTERTLVLIKPDGVQRRLIGEIISRIEAKGLTVAALELKSVSDELARAHY
AEHEGKPFFGSLLEFITSGPVVAAVLEGPRAIAAFRQLAGGTDPVEKAIP
GTIRGDLGLETQFNLVHGSDSPESAAREIELWFPAR
392417250YP_006453855.1 ribonuclease- Rne/Rng family [Mycobacterium chubuense NBB4]MADNENLQAPAHELPEETQQVAGSSGEAKDAPPERLRVHSLARVLGTTSK
RIIDALVELDGRARSAHSTVGREEADRVREALAEPAPEPEPQAAPEPAAE
AEAPEPEQEPETPAEEEPESRLILETPAPQTAEPADYLPLFVAPQPVRFD
DAADKSDEGGDEDDDSTEDDTDSDDEQSERPAAKRRRRGRRGRGRGRGEQ
NGDDSGTDDTDAQAEGESSETGDDSDDDSGEDDGAGGDGSSRRRRRRRRR
KSGSGDDNDNTSVDDPPNTVVHEREPRQSGKSDKSSQGDSEIQGINGSTR
LEAKRQRRRDGRDAGRRRPPILSEAEFLARREAVERMMVVRDKVRSEPPH
EGARYTQIAVLEDGVVVEHFVTSAASASLVGNIYLGIVQNVLPSMEAAFV
DIGRGRNGVLYAGEVNWEAAGLGGAQRKIEQALKPGDYVVVQVSKDPVGH
KGARLTTQVSLAGRYLVYVPGASSTGISRKLPDTERQRLKEILREVVPSD
AGVIIRTASEGVKEDDIRSDVDRLQKRWNEIEAKAAEISAKKAGAAVALY
EEPDVLVKVIRDLFNEDFTGLVVSGDDAWKTINDYVTSVAPELLPRMTKY
EPASPEGPDVFAVHRIDEQLTKAMDRKVWLPSGGTLVIDRTEAMTVVDVN
TGKFTGSGGNLEQTVTRNNLEAAEEIVRQLRLRDIGGIVVIDFIDMVLES
NRDLVLRRLTEALARDRTRHQVSEVTSLGLVQLTRKRLGTGLIEAFSTAC
THCGGRGILLHGDPVDSTSSAGRKSESGGGRRSKRGKRGGKEQEVQVAKL
PSHSPGDHPMFKAMAAANGKHDDDEHEEAAEEVAELEPDSIRQAVAGPAD
GELDDDFEEDDEDDDSDDETDSDDEDSDEIDLDSDDEDDEIDDDIEVLDD
DSDDSDDSDDSDDSDESGDSGVDEDSDDSDDEAEPPVAATRPGRHRRRAA
ARPAGPPGHD
392417249YP_006453854.1 LSU ribosomal protein L21P [Mycobacterium chubuense NBB4]MAAQTATYAIVKTGGKQYKVAAGDIVKVEKLDVEPGASVSLPVALVVDGA
NVTTDAKALESVAVTGEVLEHTKGPKIRIHKFKNKSGYHKRQGHRQQLTV
LKVTGIK
392417248YP_006453853.1 ribosomal protein L27 [Mycobacterium chubuense NBB4]MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGAN
VGRGGDDTLFATAPGAVEFGTRRGRKFVNVVRVTRVEA
392417247YP_006453852.1 Obg family GTPase CgtA [Mycobacterium chubuense NBB4]MPRFIDRVVVHARAGNGGNGCASVHREKFKPLGGPDGGNGGRGGSVVFVV
DPQVHTLLDFHFHPHVVAPSGKQGAGSNRDGAAGTDLEVKVPDGTVVLDE
HGHILADLVGTGTRFEAAAGGRGGLGNAALASRARKAPGFALLGEKGEVR
DLTLELKTVADVGLVGFPSAGKSSLVSAISAAKPKIADYPFTTLAPNLGV
VSAGEHTFTVADVPGLIPGASEGRGLGLDFLRHIERCAVLVHVVDCATLE
PGRDPISDIEALEAEISAYTPTLQGDSTLGDLAERPRAVVLNKIDVPDAR
ELAEFVREEITRKFGWPVFEVSTVSREGLRPLTFALWDMVAAYRAAQPEA
VPRRPVIRPVAVDETAFSVEPDGQGGFVVRGTRPQRWVAQTNFDNDEAVG
YLGDRLARLGVEDELLKLGARPGCAVTIGDMTFDWEPQTPAGVDVRMSGR
GTDMRLDQTDRVSADERKAARKARREHVDERLREE
392417246YP_006453851.1 glutamate 5-kinase [Mycobacterium chubuense NBB4]MSQHREAIRTARSVVVKIGTTGLTTPTGVFDTGRLQDLAEAIEARMKSGS
DVVIVSSGAIAAGMEPLRLSRRPTDLATKQAAASVGQVALINAWNTAFRR
YDRTVGQVLLTAHDISMRVQHTNAARTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSALVAHLVGADALVLLSDIDGLYDGDPRKAAPGNPARFIPE
VAGPDDLQGVTAGRGSHLGTGGMMSKLSSALLAADAGVPVLLAAASDAAA
ALTDASVGTVFAPRAGRMSARKFWVRYAAEAAGTLTLDDGAVNAVVRQRR
SLLPAGITALTGRFYGGDVVELRAQDSTMVGRGVVAYDATELATMLGRST
SDLPAEMRRPAVHADDLVAV
392417245YP_006453850.1 protein of unknown function DUF222/HNH endonuclease [Mycobacterium MLFEELAELTGQRNAIDGRIVEIVAEVDRDRLWAAAGARSVASLVAWKAG
VTPARAETIATLAHRLEGFPVCHQGLREGRLSLDQVGTIAERAADGSDEH
YAELAASATVTQLRFALKLAPKPKPEPRPEPEVEPEPDHTPEPAPVPEPS
ISKSTDGQSTTWRITLPALEAAKFEAALASHQDALITDWKRDHDTEAHDT
EAADGPGQPGSGQRPPMPTTGDAFLALVEASWDAEASRRPHGQHTTVVAH
LDLDKPVAALHLGPLLSDADRRYLTCDATCEVWFERHGRPIGAGRTTRTV
NRRLRRALEHRDRCCAVPGCGATHGLHAHHIRHWEDGGPTDLNNLVLVCP
YHHRAHHRGLITITGPADQLVVTDGAGRALSSASLARTPTTPPPAAAPYK
GPTGERADWWWYEPFQPQPPPSAN
392417244YP_006453849.1 transposase [Mycobacterium chubuense NBB4]MAWTLGIDVAVRAAHQATLARDGTTVWRGRKFSTRPADLERLWADLFLAD
ATDVTVVVEPTRNAWIVLAEWFRRRGARVVMVPTTQSADLRKYYSKHTKN
DRIDSELLARLPLLHPEGLREYSGQGPADPLRRLVKQRSTMIKRRVAVYS
RLDALVELLGPAWYAVLGSNYGTAALEFLARYADPNTVIRLGQGRLSRFL
IARSRGAWREDHAAGLIVAAKETLMLWGPDGMNFAELGDDIAHEAEQALF
LTRQIKQIDERVANLYADADPEAIVASAPGVGPVISAVIAGRIGDPHRFT
SLAAIRAYTGLIPKVNQSGLSKVESSITKAGDPLLREMLCTAADQARKID
PQIAAKYQRLMTGNRHHDSAICHLATLLVTRIATCMRNGQPYVLRDVDGT
PITNAQGRKIVKERYHIEPRRRDNIRHQRMRDRRKQAAGQESQESPSAPT
SRPAKHKPTGQHVA
392417243YP_006453848.1 hypothetical protein Mycch_3429 [Mycobacterium chubuense NBB4]MTALLPRLRPPPGPVSGRWGFAVGDTIAGLVRAPRPVARVIRLLDNFGGL
VISDQSVEFDGDAVDWSDVQSIETHSLVGYLLSGALSKQANRLPLPWFPG
RRLLLDVASDTALTALVATVGNAAAAVLDVRIPAEVNYRGTLRNRTLTAG
VLATVLLADPAVRAALVETARAHGVTVRRADDDALDAAERRVRWLKDR
392417242YP_006453847.1 NAD-dependent protein deacetylase- SIR2 family [Mycobacterium chubuMPALTLSQAAPTLGGVEAPELVELLRGRRVAVLTGAGMSTDSGIPDYRGP
DSPPANPMTIRQFTSDRVFRQRYWARNHVGWRHMDQRRPNAGHRALAALE
RAGVVTGLITQNVDLLHTKAGSRAVVNLHGTYVQVVCLDCGHTMSRAELA
DLLEAANPGFLERAHDVGSIAVAPDADAVVGDTANFRIVDCPACGGMLKP
DIVYFGENVPKPVVDLAYSLIDDADALLVAGSSLTVYSGYRFVRHAAAQG
KPIAIVNRGRTRGDDLATVKIDNGCSPMMALLADELPALASSA
392417241YP_006453846.1 nicotinamidase-like amidase [Mycobacterium chubuense NBB4]MHGPMSDTVVLVIDMMNTYRHPDADKLIPHVEPIIDPLSRLVASAHERDV
DLVYVNDNYGDFSAEFSDIVRGALDGERPDLVKPIVPQHGCRVMTKVRHS
AFYATSLAYLLSQLKPERLILTGQVTEQCILYTALDAYVRHFPVVVPPDA
VAHIDPALGDAALQMMERNMSAEIIPSAECLP
392417240YP_006453845.1 NAD synthase [Mycobacterium chubuense NBB4]MSMDFYSAYRHGFARIAACTHHTALADPAANAESVLRIAHECHDDNVALA
VFPELTLSGYSIEDIVMQDALLEAVEEALTTIAAGSAALLPVLVVGAPLR
FRQRVYNTAVVIHRGRVLGVVPKSYLPTYREFYEKRQIAAGDDERGEIRL
GGDVVPFGPDLLFAATDLAGFVLHVEICEDMFVPVPPSAEAALAGATVLA
NLSGSPITIGRAEDRSLLARSASARCLAAYVYAAAGEGESTTDLAWDGQT
MIWENGVCLAQSERFPKGERRSVADVDLEMLRNERTRMGTFDDNRRHHLI
DDDTYRRVEFRLDPPDGDIGLRREVERFPFVPADPARLEQDCYEAYNIQV
SGLEQRLRALEYPKVVLGLSGGLDSTHALIVAARAMDREKRPRSDILAFT
LPGFATGDRTRSNATRLAEALGVTFETIDITSTAELMLKEIDHPFSRGEK
VYDVTFENVQAGLRTDYLFRLANQRGGIVLGTGDLSELALGWSTYGVGDQ
MSHYNVNGGVPKTLIQHLIRWVISSEQFEDTVNEVLADVLDTEISPELVP
AGEDEEIQSSQDKVGPYVLQDFSLFHVLRYGFRPSKVAFLAWHAWSDSER
GDWPFGIPEDKRPSFTLKEIRHWLQVFAQRFYSFSQFKRSALPNGPKVSA
GGSLSPRGDWRAPSDMSARTWLDEIERSVPES
392417239YP_006453844.1 putative Co/Zn/Cd cation transporter [Mycobacterium chubuense NBB4]MPTASARRAVLTRRVRLLVAATITYNVLEAAVALGEGARVSSTALIGFGL
DSVIEVSSAAAVAWQFSARDPETREKAALRFIAFSFFALAAYVSVDAVLA
LAGVRDPRPTVIGIVVAALSLVVMPALSLAQRRAGRELGSLSAVADSKQT
LLCTYLSAVLLAGLVLNSTLGWSWADSVAALAIAVIAAREGVNAWRGDAC
CA
392417238YP_006453843.1 putative transcriptional regulator [Mycobacterium chubuense NBB4]MQTAIGGDALSRFGCALSDPTRAQILLILRNGPGYPSDLADRIGVSRQIL
SNHLACLRGCGLVTVSPEGRRSRYELADPRIARALDDLIGLVLAVDPACC
AAADELACC
392417237YP_006453842.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium chubuense NBMARVCVVGSVNADLTFSVDALPRPGQTVLASLLTTSPGGKGGNQAVAAAR
AGAQVRLVAALGTDPAADLLRAHLRANGVGLDAVTSVPGPSGSAAILVDT
RAENTIVVAPGANAHLTLSSSAIRSAIAGSDVVLLQLEIPMATAIAAAHA
GKAAGAAVIVNASPAGVAPAELVALARASDVVVVNETESTPWQDGAARVE
HLVITRGARGASCLGRRRFDVPAPAVEAVDTTGAGDVFAGVRRRPGPPAS
RPRCGARAPRGRWRHWYPVRVTVGLTVRPSTTSSDKACDVLTGRTTAVTT
PPRPPDGDWLGTPYLRFTREGAFGVCTLDRPEARNAMTPAMYFGIKYAVK
HVDGDPDLAGLLITGTGDVFAPGGDMGGGGADNWLTFGSALGMDALPFDT
LRQSSKPVVAAVNGLCQGGGLQIALCADMAVVSDRATFRVPELYRGIADT
YYSQMLARLIGPVRTRDLMFTGRTLSAAEALDWGMVARVVAHDELADTAR
EVLAQCCRTAPAARTLIKSSLDNYLGFYDRIGMQASLGAPESIEGFLAFK
ERRSPDWVHPQLRIDGRL
392417236YP_006453841.1 glutamate-5-semialdehyde dehydrogenase [Mycobacterium chubuense NBBMSLHAPERSVGSQAVADDLRGQVHDAARRARVASRALATLSTDAKNRALR
TAADHVLMNTRAILEANEADLAAAREAGTADAMLDRLALSPTRVEGIADG
LRQVAGLADPIGEVLRGRTLPNGLQLRQQRVPLGVVGIVYEGRPNVTVDA
FGLTLKSGNAVLLRGSSSAARSNAALVDALRAALATEDLDVDAVQLLPSH
DRASVTHLIQARGLVDVVIPRGGAGLIDAVVRDAQVPTIETGVGNCHVYV
HSSADLEMAERILLNAKTRRPSVCNAAETLLVDAAVADIAVPRLTGALRD
AGVTVHADPSEDELRAEFLSLDIALAVVGGIDAAIAHINEYGTGHTEAIV
TTDLAAAQRFTERVDAAAVMVNASTAFTDGEQFGFGAEIGISTQKLHARG
PMGLPELTSTKWIVWGDGQIRPA
392417235YP_006453840.1 MoxR-like ATPase [Mycobacterium chubuense NBB4]MSVPARPAPLFADIDDVARRLAETGYLPDTATATAVFLADRLGKPLLVEG
PAGVGKTELARAIAQATGSGLVRLQCYEGVDEARALYEWNHAKQILRIQA
GSGDWDQTKMDVFSEEFLLSRPLLTAIRRTEPTVLLIDETDKADIEIEGL
LLEVLSDFAVTVPELGTIVAERKPLVVLTSNATRELSEALKRRCLFLHID
FPDADLERRILLSRVPELPEHLAEELVRIVGVLRGMALKKLPSVAETIDW
ARTVLALGLDTVDDEVIAATLGVVLKHQSDQIKAAGELRLN
392417234YP_006453839.1 protein containing von Willebrand factor type A (vWA) domain [MycobMAVRRTRPPQPLAPHGIPGHLVEFVEALRGSGISVGPSETVDAGRVMSVL
GLGDRGALREGIACAVLRRPDHRETYDALFDLYFPAALGARTVLDEDGAD
DSDGLPPEDIEALRGALVDMLSGNDELADVDERLAAMIAQIVEAYGRYNS
SRGPSYSSYQALKAMSLDDLEGRLLAGLLAPYGEEPTPTQEQIAKALAAQ
RIAQLRKMVEAETKRRTAEQLGRKHVQTYGVPQLAENVEFLRASGEQLRQ
MRRVVAPLARTLATRLAARRRRSRAGEIDLRKTLRKSMSTGGVPIDVVLK
KPHPARPELVVLCDVSGSVAGFSHFTLLLVHALRQQFSRVRVFAFIDTTD
EVTELFGPDSDLAVAVQRITREAGVYTRDGHSDYGHAFVSFLDKYPNVLS
PRSSLLVLGDGRNNYRNPESELLAHMVNASRHAHWLNPEPRHLWGSGDSA
VPRYEDVITMHECRSAKQLASVIDALLPV
392417233YP_006453838.1 thioredoxin reductase [Mycobacterium chubuense NBB4]MNHVAVAIVGGGPSGLTAATALAAQVDGEILVLEREARTGGIPRHSDHLG
YGMRDLRRFITGPAYAGRLTAMASEAGAVLETEAMVTGWAGDRTLQITSP
RGVRTVTADAVILATGARERPRPARLIPGDRPDGVYTTGQLQNLVHLHHG
RVGERAVIVGAELVSWSAVLTLREAGCATAAMITGHRRAEAYAAFRVPGR
LLMDGPVLTHSRLVAIHGKGRVRSVTVERTDTGERREIACDTVVFTGDWI
PDHELARTAGLQMDRGTRGPVVDAALRTSKPGVFAVGNLCHPVDTADGAA
LDGRHVASAVAAWLRSGDEADISPAAAQIRTEAPLRWVAPQLVSSDGGLP
ARGDLLLWTDEYRRLPRLRATQDGRVLAVKRTPWPAAPGRIFRAPWSLVA
DADPKGGDITLSLA
392417232YP_006453837.1 putative dehydrogenase [Mycobacterium chubuense NBB4]MSSDVISDVIVVGAGIVGCAIARALAATQLSVTLVEARADVGDGTSKANT
ALLHTGFDATPGTLESRLVARGYDLLGAYAEQTGIPVERTGAMLVAWTEE
EADALPGLMVKAERNGYRECGIVRADEIYRRVPDLGPGALAGLAVPGESI
ICTWTTNLALATDAVARGARLLRGARVTAAVHGPEYTTLRTTRGDLRGRW
VINAAGLGADRLDAEFGYHRFTVTPRRGELLVFDKLTRPMVPLIVLAVPS
SRGKGVLVSPTIYGNVMVGPTSENLEDRTATGTSEEGFEFLVAKGRALMP
ALFDEEITATYAGLRAAIDHDDYLIDVDRAARYVLVGGIRSTGLTSGMAV
AEHVAGLLDEAGVDVTERDHLPAPPRMPNIGEAGMRPYQDAERIAADPEY
GRIVCFCERVSAGEIRDTFDSSIPPADLDGLRRRTRVMNGRCQGFYCGAH
TAELLAAGAAR
392417231YP_006453836.1 glycerol kinase [Mycobacterium chubuense NBB4]MSEPLLAIDQGTSGTKAVVVDGRGAVLATAEIALRPEYLPGGGVEQDPEA
MFQSVVTAGRQALAQAGVPVAAVALANQGETVLAWDRATGRPLTPAIVWQ
DRRAESLCATLADHSDDVAHRTGLVLDPYFSAPKMAWVRANLTPDGVVTT
TDTWLVHRLCGAFVTDASTASRSLLTGLDAVTWDDDLLALFGLSGEALPD
IVGSDEIVGHTDVFGPTLPVAGLIVDQQAALLAESCLDPGSAKCTYGTGA
FLLAQLGAEPVRSRWGLTTSVAWRLRDRVSYCADGQVYTAASAVRWAVDL
GLVPSAAEIDSVAAESSDGVLCVPALAGLAAPWWNSAATASFTGMTLSSG
RGQLVRALLEGIAAQVTALTDLVSADLGRPLTRLRVDGGLTRSAVLMQAQ
ADLARMPVDVYPSLHATALGAAACARLACDADLAVADAVGPWEAQHTYQP
RWSADRAADFLGRWRGAVEETTS
392417230YP_006453835.1 amino acid transporter [Mycobacterium chubuense NBB4]MTDPSSRSDSAELAKFGYEQSLERRTGKFASFAVAFAFVSIATGIFTTYG
SVLNTSGPVGIWTWPIAVAGQLAVAFVLGALASRIPVTGYHYQWMSRLAN
PVLGWIIGWISFTFLAIVVVAVDYTIASTILPVLLNYESTATIAWVMTAG
VLLIQALLVALSTPWAERVNNSLVTLELIGMATLTVLLLVVAAIRGDMDF
SNLFSKGAVAADANYWSFGDWTSAGPWMLGFLLGAFTIVGFESAANLAEE
THDPERVVPRAMWQAVLASGVLGFIFLVAVTLAAGDPAALAESGTPIADV
IDHTLGSVVATLLLLMVVLAIFACGLVIMITGVRLTWAMSRDERFPGWQQ
WKQISPRFHTPLKATLLYFCLAQLILAIFAHSETALFTLFSAATLLPAVM
YASTVVLYLVKRRSLPQNGRFDLGVWEIPILVVAIVWLVFELALFRDASF
KQAWAYVIVMVAIGAAYLAYLLIRRGMHGLSMPDMHSIDAELRE
392417229YP_006453834.1 transcriptional regulator [Mycobacterium chubuense NBB4]MTIAADVRDRIATEQLGPHTLLPSERELAEQHGVSRMTARQALSLLESEG
VVYRKPPRGTFVAEPRVHFHVGSFSEEVARMGRRPAAKLLWAEYQIAKPA
VRRALGLAEGAAVHVFHRLRSVDDVPFALETTFLPAELTPGILDVPDDGS
LWALLRSRYGIDLARSTAVLESIVLDDASSVQLGVRAGSAGTLLTRTTYD
TEGRCVEYARDVYRADRAAFEVSEELAAHRLSSV
392417228YP_006453833.1 nicotinate/nicotinamide nucleotide adenylyltransferase [MycobacteriMGGTFDPIHNGHLVAASEVADLFELDEVLFVPTGQPWQKRSRPVTAAEDR
YLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLRDLHALNPDADLYFITG
ADALASILSWQNWEEMFAIARFIGVSRPGYELDGKHISAAMAELPADALH
LVEVPALAISSTDCRVRAEQSRPIWYLVPDGVVQYVAKRDLYRSHTPAGE
GDRP
392417227YP_006453832.1 iojap-like ribosome-associated protein [Mycobacterium chubuense NBBMATVAARAAASKLADDVVIIDVSEQLVITDCFVIASASNERQVNAIVDEV
EEKMRLAGYKPARREGTREGRWTLLDYVDVVVHIQHQDERNFYALDRLWR
DCPTIAVDLDDLDDADADPAGDGT
392417226YP_006453831.1 fructose-2-6-bisphosphatase [Mycobacterium chubuense NBB4]MRIRRLVMLRHGQTEYNAGSRMQGQLDTELSDLGREQAVAAAEVLAKRQP
LLIVSSDLRRALDTAVALGERSGQPVSIDARLRETHLGDWQGMTHLEVDD
VAPGARTAWRDDARWAPHGGESRVDVAERSLPLVKDVVAQQTEWGADEPD
RPVVLVAHGGLIAALTAALLQLPVDNWPVLGGMGNASWVQLAGHTRADGS
AASFDDIRWRLDVWNASAQVANDVL
392417225YP_006453830.1 hypothetical protein Mycch_3411 [Mycobacterium chubuense NBB4]MSSDASCAPGRRTLLVFCDSLSYYGPTGGLPSDDPRIWPNIVAAQLDWDL
ELIGRIGWTSRDVWWAATQDPRSWAALPRAGAVIFATSGMDSLPSPLPTA
LRELIRYVRPPWVRRWVRDGYGWVQPRLSPVARAALPPHLTVEYLEMTRA
AIDFNRPGIPVVASLPSVHIAPTYGMAHHGRPGTVAALSRWACEHDVPLV
DLKAAVAEHVMSGRGNPDGIHWNFEAHEAVAELMLKGLAEAGVALPDSHG
392417224YP_006453829.1 EDD domain protein- DegV family [Mycobacterium chubuense NBB4]MPVVVVTDSSSRLPPDERKRLNVREVPLHVLIDGTDLRDGVDDVPYDVHD
RPKVTTAGATPAELVATYRQALADSAGDGVVAVHLSAALSSTYGAAVSAA
REFGPAVRVVNSRSAAMGVGFVAMAAARCAAAGGDLDAVEAAARSALNRS
HVYLVVHRLDNLRRSGRIRTAASWLGTALSLKPLLRLDVDGRLVLDQRIR
TVTKAHAAMVERVADVVGEHTADVVVHHVDNHDAADELGAALTQRLPQIS
SLDVSDMGPVLSVHVGAAAVGVAVSVHDD
392417223YP_006453828.1 transcriptional regulator [Mycobacterium chubuense NBB4]MRHNQKLSPNVAVVELAAVRTFVAVADSGGFQAAGDELGISQQAVSKRIA
VLESALGVRLLARTPKGALLSVDGQAFLPHARELLRAEERAMNAVRPGRR
ALRVDVRNRRTAPATLLHGFYQQHADIELDVVVLPEDNVEAALTAVATGA
LDATFRGLIDPTAQLAGTGLSCRRVVEDRHQLLVGPRHRLANAVTIAPAN
LAGHPIWMPGLPVGSEVRSYYDELATAFGLTIDVLGPAFGAEVLLTEIAD
SPTLANLVGERSQYLWPAHYDLRRIPIVDPTPVYPLWIIWRTDNGHPGLA
SLLAHLETDYAARKTDNTWLPSWAR
392417222YP_006453827.1 Major Facilitator Superfamily transporter [Mycobacterium chubuense MGARVRLGRRFGWLWGAYAVSAYGTGLGFGAFSYVAVTVLHANAAQVSAL
AVTGLAVGTVLAVPLGPWAEYRPKRPVMIAMDVTRFLAMATVPIAYVAGV
LTFAQLLAVGIVSATAKIASNAASGAYLKHVVEPGHLLVATSRFESTTWS
ATVVGPVVGGAAIGLIGPVVTIVADSVSYLLSAVGVAAIGGTEATSPKRL
ERNRFRDLMVGWRYVWEHAALRRLFLNAVAVNALIMAAEPPLTVLMLDRL
GFTPWQYGLAFGLPCVGGLIGSRLAGRVVARYGEHTVLVRVGALRALWPI
GLAFVRPGLPGLVIVIAVEFALVLCISVHNPAVAAFRLKNIDQSRVARVL
SAWSITSSAGIAVTTACWGVLADVAGPRTAIAAAGALLLATPVLLPGRDL
DDATPRRRKSVIQIHGMWRWP
392417221YP_006453826.1 putative membrane protein [Mycobacterium chubuense NBB4]MSTRAGQAKHPVSAMLAGPYGHPFHPILVTVPIGAWAAGLVFDIASHVVG
DPGFLVRGAHWLIAIGVIGAAAAAVVGFLDLLAIPTGTRAFTVALAHMTL
NLVVTAAYIVNFLWRQSLSVDSPVRAGPLALSVVSFAVLGASGYLGGMLS
YRYGVRVADEATQEDGFAGR
392417220YP_006453825.1 hypothetical protein Mycch_3406 [Mycobacterium chubuense NBB4]MGIASLIAWILTAGGGAFMLAKWVGAGGHRDGSSTHLPPAAVFGHFVLAA
LGLVLWIVYLVIDNDSVGWVALALLVPVVVLGVVMVARWRSVRRGQPQPV
GGQPAPVGAAPERSFPVPVVLGHGVLAVVTIVLALLAITAP
392417219YP_006453824.1 hypothetical protein Mycch_3405 [Mycobacterium chubuense NBB4]MPTDRPLRVIQWTTGNIGRRSLHAIIGRDDMELVGVYAHGADKVGVDAAD
LAGWPEPTGVKATADVDALVALQPDACCYNPLWPSVDELVRLLEAGINVC
SSAAWITGGKQTPEDLDRIRRACETGGSTIFGSGAHPGMSNLVGMVLSGA
CERVDEIRITESVDCSTYESAGTQTAMGFSQDPNTPGLAESVRSESEVFA
ESAAMMADAIGARLDRMTFDVTFTAATGDSDLGFMKIPAGTVAGVHGYHR
GWVGDHNIVSVGFNWTMGEHVTPPKPLEHGHVVQVFGLPNMRTVVHCLPP
KDWTEPGFMGLGMIYTAMPVTNAVPAVVAAPPGIVTLADLPPITGRSAV
392417218YP_006453823.1 dehydrogenase of unknown specificity- short-chain alcohol dehydrogeMSDTAPVAVVTGASRGAGRGIATALAAHGWRVYGTGRTVGDAPAWGTGVQ
LDHRDDDAVGRFFERVRQECGRLDLLVNNAAVISDDLIGAEPFWRKPREL
ADVLEVGLRSSYVASWFAAPLLIERARGLIVFTSSPGSVCYMHGPAYGAQ
KAGVDKMAADMAVDFRDTGVATLSIWMGILMTDRLRAAFDGKPDALAAFA
AQAETPEFTGHLIDAAFSDPALAELSGRTVIGAELARRYGLTDDGRTPPS
HRDMLGAPREPSSVVVR
392417217YP_006453822.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MTVVDIDPALAQMMEAVLAEHGGDPDLWSRLDALGLVRLTGAEERGGSGA
GWYEAAELMSTAVRHGVRIPLVEHDLLACWLLDAAGLGHDDARRTVCVLD
SGGSATQVPWAADAERIVVVWQRAGEYAVADVGVGQLSITPGVNMIGEPR
DTVVADIDTLGGVSLDSALVGALRLKSALVRSIQVCAALDGALRLSVEHA
SAREQFGRPLARFQAVQHLISDIAAEAALARSATEAALSAAVSSDWTSAH
LEFLVAAARSCSGHAATVVARNAHQVLGAIGTTREHRLPEYTRAALAWRS
EFGSVRYWDARVTDMATEAGADGLWALIRP
392417216YP_006453821.1 acyl-CoA dehydrogenase [Mycobacterium chubuense NBB4]MALPRLVPRSTVEAASTTALRHEVRAFLAEQIAAGAFTPAVDAWLTGWDE
DFTAALAARGWLGMTVPFEYGGHGRSFLERFAVTEELLAAGAPVAAHWIA
DRQIVPSLLKYGTEAQKTHFLPRIVRGECFFAIGMSEPDSGSDLASVRTR
AERVDGGWTLTGTKVWTSGAHLAHAFIALVRTAPVDPAHRHAGLSQFIVD
LRGPGVDIRPIVSMNGAHHFNEVILDGAFVPDEMVFGEIGEGWRQVTSEL
SFERSGPERFLSTFVLLAACAEPTAPPAVSRSAELGRLVARVAGLHQMSS
AVAGALERGEPADVPAAVVKVLGTTTEGDVAEFAHLAGDDVAPQAFRETS
GAAMDQRPGFTLRGGTNEVLRGVIARGLGIR
392417215YP_006453820.1 hypothetical protein Mycch_3401 [Mycobacterium chubuense NBB4]MIAGVAFAVLYATAVLVLPAVQGTDQGAARVQALLLAFAALALVFVLAFA
RDRLSGPPAHLFTVGSALLVAQLCAAIWFISGSAVRPGQTASVNSALGDV
GSMWLPTATIANILIAVPVLLSANEDRLPRWLGIGAAVFTVEQLIETITI
IGPPGSFISPGGPMNHYLGGTLSVAFFVALGAAVTLPEKAAEAAEPSDES
ARVDDDAPVQETTAE
392417214YP_006453819.1 competence protein ComEA-like protein with helix-hairpin-helix repeMDRALRPCSSAGGHSVADMSTELPADLLRRRLGPAGEADAEVDEQPDTSL
SRWLPDPAPAGPAAWLSRIRADPGRTGVIALCAVAAVAVLVTVISVMRDK
PPAVVSAKLPPVEMVSSAAPTTSGAPSSGAPGSPEPVVVSVVGLVHTPGL
VTLKSGARIADAIDAAGGALDGADVMGLNMARRVTDGEQIVVGIDAPPGQ
PAEMGSSVVPGATPPDGVAPPPETTSGAKGLVDLNTATAEELDALPGVGP
VTAAAIVAWRETNGRFRSVDQLGEVDGIGPARLGKLRDLVRV
392417213YP_006453818.1 ComEC/Rec2-related protein [Mycobacterium chubuense NBB4]MDGPAAAAPVDLRLVPAALTSWAVTAAGIVWAVPGAVVGAAVSVVATAAA
GWWGARRGRRAVPSRALAMGVAAVAVVGAGFALAVCMRVEQVRQHPATGY
FGSSTRVVVTPSESPRVLEGGRTMVRGSLVQLDGSPSSGRVLVFASGSAY
ARLAAGQPAAFDAAVNRPKRRDLTVAVLAAKGEPRLGRAAPLQRAAHHLR
ERFAEGSRLVLPPEQAAMLPALVLGDMSMVSNRTTKDFRLSGLAHLTAVS
GANVTIVCAAVLLSAALVGPRVAVALAGVTLSGFVVVVQPSPSVLRAAVM
GAITLLAVLSHRRRQALPALATCVIVLLVGAPELAVDVGFALSVSATAAL
VIIAPAWSRRLAHRGWPRPLADAVSVSLAAQLVTAPLVAGITGSVSLVAV
AANLAVAPVIPPITVMGTAAAALSALWPAGAQLLIRFTGPEVWWLLSVAR
WSAAAPLASVPVPSGVLGVATVAGAGLAVAAVWHWVVSGRRDTIVR
392417212YP_006453817.1 DNA polymerase III- delta subunit [Mycobacterium chubuense NBB4]MSQVTGLHLVLGDEELLVERAVAAVLRQARKSAGTPDVPVDRLRAGEVNV
SELAELLSPSLFADERVVVLESAAEAGKEAVAVIEGAAKDLPDGTLLVVV
HSGGGRAKALADQLKKLGAQVHPCARIAKASERADFVRKEFRALRVKVSD
DTVTAVLDAVGSDIRELASACSQLVADTGGAVNAAAVRRYHSGKAEVKGF
DIADKAVVGDVAGAAEALRWAMMAGEPHVVLADALAEAVHTIARVGPLSG
DPYRLAGELGMPPWRVQKAQKQARRWSRDSVAEAVRVVAALNADVKGAAA
DADYALESAVRKVAELVSD
392417211YP_006453816.1 ribosomal protein S20 [Mycobacterium chubuense NBB4]MANIKSQEKRNRTNERRRLRNKSVKSSLHTAVRGFRQALEAGDKEKAGEL
LLATSRKLDKAASKGVIHKNQAANRKSALARALNKI
392417210YP_006453815.1 hypothetical protein Mycch_3396 [Mycobacterium chubuense NBB4]MLQHGIRAFGTARGYEERDRLGDILATETVRTARTNARATRRHDGIFGGY
NKLGWYSQAFDEMFDAQGNVRGPYRGIHKELAPSDVSDLEARADALGRAF
IDQGITFSLSGQERPFPLDLVPRVISAAEWTRLERGIRQRVQALEMYLDD
IYGEQEILRDGVIPRRLVTSCEHFHREAVGIVPPNGVRIHVAGIDLIRDA
QGSFRVLEDNLRSPSGVSYVMENRRTMARVFPNLFATHRVRAVGDYSSHL
LRALRNAAANNVADPTVVVLTPGVYNSAYFEHSLLARQMGVELVEGRDLF
CRDNTVYMRTTEGERQVDVIYRRIDDDYLDPMQFKPDSVLGVAGILNAAR
AGNVVISSAVGNGVGDDKLVYTYVPTIIEYYLGEKPLLANVDTFRCWLDD
EREEVLDRIEELVIKPVEGSGGYGIVFGPDASEKELATITKKINADPRGW
IAQPVVQLSTVPTQIGDHLAPRHVDLRPFAVNDGDDVWVLPGGLTRVALP
EGSLVVNSSQGGGSKDTWVLASRTSAADRELAAAEVVRSLPKAPASKNSS
RNGKAESTQDQQQQQQ
392417209YP_006453814.1 hypothetical protein Mycch_3395 [Mycobacterium chubuense NBB4]MLARNAESLYWIGRYVERADDTARILDVTVHQLLEDSSVDPDQASRTLLR
VLGIDPPDELLDVWSLTDIVAFSRDTYGACSIVDAISAARENARGAREVT
STEIWECLNTTYNALAERERAAKRLGPHEFLSYVEGRAAMFAGLADSTLS
RDDGYRFMLLGRALERVDMTVRLLLSRVGDSASSPAWVTLLRSAGAHDTY
LRTYRGVLDAGRVVEFMLLDRLFPRSIFYSLKLAEHSLDELLKRPQGRLG
ATAEAQRLLGRARSELEFLQPGALLESLEQRLAGLQTTCFDVGEALALQY
FHSAPWVAWTDAGRNALVIEEGEI
392417208YP_006453813.1 transglutaminase-like enzyme- predicted cysteine protease [MycobactMWRMRVMHATGYAYRSPVTASFNEARLTPRSDTRQNVILNRVETVPATRS
YRYTDYWGTAVTAFDLHAPHTELEVTASSVVETDRPEEPKTKASWADLAG
EAVVDRYDEVLAPTHYVPASKRIERVGRRIAKYHDPAEAVIEAARWVQGE
LKYVPGTTGVHTSGVDALREGKGVCQDFAHLTLMLLRGMGIPSRYVSGYL
HPQRNAKVGDTVDGQSHAWIQAWTGEWWNYDPTNDSEINEQYISVGVGRD
YADVSPLKGIYSGEGSTDLDVIVEITRLA
392417207YP_006453812.1 metal-dependent hydrolase- beta-lactamase superfamily III [MycobactMIEVTLLGTGSPIPDARRAGPSTLVRAGGQTFLVDCGRGVLQRAAAIGIG
ANNLTALLLTHLHSDHIADLGDVLITRWVSNFAPDLAPLPIIGPPGTAEV
VENTLKALRFDIGYRIAHHADLTTPPPVEVEEVTEGVVWGRDGVSIRVGR
TDHRPVEPTIGFRIEHDGASVVLAGDTVPCASLDELAKGAGALVHTAIRR
DLIETMPLQRLRDICDYHSSVEQAAETAARAGVGILILTHYVPAPAPGQE
EDWRALAASVFDRQIEIGEDLHRVEVHPGVCAKPAG
392417206YP_006453811.1 putative oxidoreductase- aryl-alcohol dehydrogenase like protein [MMPDSVSLGDQLEVSAIGFGGMALTPVYGGAVDDEESLATLHHAVDVGVTF
IDTANIYGSGDNERLIARLLADRRDEVTLATKFGIQANPAERTQGRISPR
GDAAYVRQCIDESLQRLQTDVVDLYYLHRRDPNVPIEETVGAMAELVTSG
KVRHLGLSEVSAAELRAAHAVHPIAALQSEWSIWTRDIEAVIVPAAAELG
VGIVPFSPLGRGFLAGTVRSAADIGEKDFRRTMPRFADTALDANQAVVDA
VIGVANEVGATPAQVALAWLRQRADELGAASVPIPGTRRAARVDENLASL
SVTLSPEQIAGLGNAGNAVTGARYADMSSIGSSRE
392417205YP_006453810.1 putative signal-transduction protein containing cAMP-binding and CBMTWVTREVPVRISDVLRNKGATVATITPETSVAGLLTELSVHNIGAMVVV
SPDGLQGIVSERDVVRKLHEIGPDLLRRPVSDIMTTLVATCSPDDSVDSL
SALMTTNRVRHVPVVVGDRLAGIVSIGDVVKTRMEELEREQQQLQAYITQ
G
392417204YP_006453809.1 acetyltransferase [Mycobacterium chubuense NBB4]MAIDVAPARRSDVKTLARVLGRAFHDDPVMMWMVPNGARRAKALPRIFAA
MTRHHFLANDAVEIASTAGAVGAAALWDPPGRWKQTAIEELRMLPAFLLA
MGSEGRRGQVVSELMKRHHPEEPHWYLAVIGSDPGVRGTGFGQALMASRL
DRCDAEGAPAYLESTKESNVPYYLRFGFEVTGELTVPDGGPTMWQMWRSP
R
392417203YP_006453808.1 NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Mycobacterium cMYTGMVAMVLVALLGIAGVYALHRLAAVAPTVLVSLPFQSGWRPEEHALS
RYHARWYPASIVFLAFDVEMLFMYPWALVVAEKGARAIVEMFVFLAALFV
AVAWAWREGALRWA
392417202YP_006453807.1 hypothetical protein Mycch_3388 [Mycobacterium chubuense NBB4]MGLRDTLARLAVTRVRVLTVEVAGHWVTRCALEREMSARGWRRALCAADA
DVLAVCGPPGPEMSTVVEQIWRQLPGPRARVDIRDAAHAARELDSAAATL
LDIAGQRVDARDRPRHPEPAPDSEDGEAGDGDGDGEADMDHDSDHSGMDH
GDMDGDMDMAPEGIPLAQGGEDRDGLEMDTLHLRLGPVLSFWPAALVLRC
SLHGDVIAEAQAWIVDAAGPVGDWTAGRSATGSVAAARECDHIHDLLALA
GWARGAVLARRCRDLLLAGDDRGALPLLERLQRSVRRSGVLRWSLCGVGP
LTERELDRCQLPAGLSGDAYDRLLERLRIASGLASKSLRDSPLPGGAVVE
ALPDLVAGLDIAAARLTVAGLGIETSLRAGVGTA
392417201YP_006453806.1 NADH:ubiquinone oxidoreductase subunit 1 (chain H) [Mycobacterium cMTASTITTVSGVWATVAAALVLALGYYAAALDSGLSGRDVGAAAHLRAPL
AESVRLLCQRRRTTVAADRLLWRIGGGGLITVALLMITVVPLGRWTLFDS
DVGIVWFNAMDVCVWALVWLAGWGPNSIHPLIGGYRFLAQALGYELPLMF
ALVGPAIAAASLRVGTVADAQHGLWYGVWMPVAFGVYLLAVTGFSVWGPL
SAAVGADISGGVAAELSGVDRLLWSVGRYTVLAAGSAFSVPLFLGGGAGP
VLPEWLWVLVKTVAVLTFLVWVRRRLPILRPDRFMEVGWLVLLPAVLVQD
LVVAVVTVWR
392417200YP_006453805.1 NADH:ubiquinone oxidoreductase subunit 6 (chain J) [Mycobacterium cMVADVVFWIAAVVAVAAGAAVFVVDSMARATYALATSFIAVGVAVLLLAQ
NYVGVIVILMMVMEMAVMAVYMVMFMGMNPALMPMSMVHGKRMSIAVSAA
TFALLAAGILSVDWPQRRGSPPGDVTAALGAALMGPKMLAMVVISPVMVA
TIVGGVVLATHRSRYDRLGDDLRRRPPRDPQPGGVGR
392417199YP_006453804.1 NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) [MycobactMTLQTVLLVAAALFSVGLYGALSQQVVVMVMMGLELMINAVILAAAAFWW
FLAPAPTGQVLLMVIIAAMTVEMAMGFAVATLLHRDRQSDMTDSATDLTG
392417198YP_006453803.1 NADH:ubiquinone oxidoreductase subunit 5 (chain L)/multisubunit Na+MTAAMLAGAQWSLWGLVGLPAAGGIILSLNAFRSPTADRLPSVVSVAVSA
VMVALSAVVAVARPTVDVPFMAGADLTLRVDALAATMAATVAVTTLLVLI
FTVGDDSVAGGRFYGLMLVFAAAAMLTVTAATLPALLLAWEVMGAVSYGL
IGFWWRENDRVSAGLTAFLTTRTADLGLYLAAGGALAGGAGLALADLADA
SGGWRHVIAAGFLVAALGKAAQLPFSFWLSRAMEGPSPVSALLHSAAMVA
LGAYLLLRMGDLLAASGWAAPAAAWLGVATAVVLGAVALAQRDLKQLLAA
STSAQLGFVVMAAGLAAISGGATQLVAHAATKAGLFLTAGAWLSLVGSKR
LDDLQGIGRRRPLVGVTAAVSALALAGVAPLSLWATKDEILAAAQERSVW
LYLAGLAAAGLSAAYSGKVLLVVWRRPRQAPSEQLNRSTLSGWQQEPLVV
LAAGAALAGVLALPPVGPRLSRALDHGATPHATVLEWTISAVLAAVVVLA
VLRWGAPEPRWLVGWLGLQKGVDAVVVAPTLRLARLVARFDDRVIDRAVH
AAAAGAMTAATGAARLDVGGVDRSVRAVAGLMRRLGELARKPQTGQLHHY
YLSAVALVVLAVLLLIVAR
392417197YP_006453802.1 NADH dehydrogenase subunit M [Mycobacterium chubuense NBB4]MLSIIVFLPLAAAVALLAFSALADAVARWVWVAVAAVEVVLVAVLWSQYD
TPGPHALAFEEQVAWIPGVNSSYHIGVDGLSLPLVAMTVVIFLACAVYSL
RDTDRPRTQAALFLFLQTVSLGLFVSADLILFFVFFDLSIVAMYFVIAGW
GHGDRGRSALQFFLYTFLGSLALLVGFIGLYVAARPHTFDMLELAATAPL
AGRPLAGGLVLAAIVVGLAVKTPTFPFHTWLPPAHTDAPAIGSAVLAGVL
LKMGTYGFVRIAMPMLPQAWRDWAWAIIAVGVISVLYGALVALAQDNLKR
MIAYTSINHMGYIVLAVGAAGLAAAGTATAREVAVTGAVTQMVSHGLITG
ALFLLAGVFHARTGSYEMDDYGGLAGPAPKLAGLFAIGAFASLGLPGFSG
FIAEFQIFAGSIAAAPVTAIALPAIVVTAALFLRALQRIFTGETRGRSEG
FVDLRTTETWSTAMLLALSVVIGLFPRVLLDAIEPAADALIGLVGR
392417196YP_006453801.1 NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Mycobacterium cMNPQTGMHLPLMLPEMLVFGAGLAVLIGGSFTARQNQWRGRMLAAAALCG
AVVVAAVQLAGPDRTAFDGTFAVDTTTGVARIVAVVGVLAVLAVAGDEIA
GAARESETYALVLFATSGVLVLAGATDLLVLACGYLLASLPMYALIGMVR
TAKGAEAAMKTYLLGALFGILLLLGVSILYGVTGSTWYPTLAGALGAAPA
GVVAAGLIGVLGGLLFKAGGVPAHFWVPDTAQGATGTAAMFLTTVPKVGA
LIALYRLVAVLPDTIAWRLLIGLIAIASMTLGNLAAYWQSDPRRLLGWST
VSQVGYLLVPLTAVGHSGIASPSLLFYLSAYTVTNVAAFAVSTALPGLRD
IDAYRGLVGARPWLAAALVVALLGLLGTPPTAVFVGKLTVATAAWDGGAA
WVAIALFVNTLASLFYYLRWIIPCFRRAREGHEVPAAARWSAGTAVVAAG
LSVVAGLGAGVVWAVVAG
392417195YP_006453800.1 PemK-like protein [Mycobacterium chubuense NBB4]MFSEAPRFVRQLQRSETLQRGLAQGIRFGLDVIAGSQEAPARALPPGRPI
SSNFVPTAHRARRVSYSPALDGRADPGEIVWTWVVYEDDPNRGKDRPVLV
VGRDRSILLGLMLSSQDHHRDDPNWVGIGTGSWDYEGRASWVRLDRVLDV
PEEGIRREGAILDRRTFDLVAARLRAEYSWS
392417194YP_006453799.1 GTP-binding protein LepA [Mycobacterium chubuense NBB4]MLDCVVTASARYSGLAVSGTQAALTRRNPISSFADKTFTAPAQIRNFCII
AHIDHGKSTLADRMLQLTGVVDERSMRAQYLDRMDIERERGITIKAQNVR
LPWKVGDEEHVLHLIDTPGHVDFTYEVSRALEACEGAVLLVDAAQGIEAQ
TLANLYLALDRDLAIIPVLNKIDLPAADPDRYAGELAHIIGCEPSDVLRV
SGKTGEGVAELLDEVVRQVPAPVGDADAPTRAMIFDSVYDTYRGVVTYVR
VVDGRIVPRERIKMMSTGATHELLEVGIVSPEPKAADGLGVGEVGYLITG
VKDVRQSKVGDTVTTARGGAAEPLTGYREPKPMVYSGLYPVDGSDYPDLR
DALDKLQLNDAALTYEPETSVALGFGFRCGFLGLLHMEITRERLEREFDL
DLISTSPNVVYRVIKDDGTELTVTNPSDWPEGKVREVYEPIVKTTIIAPS
EFIGTIMELCQSRRGELGGMDYLSPERVELRYTMPLGEIIFDFFDSLKSR
TRGYASLDYEEAGEQEAQLVKVDILLQGEAVDAFSAIVHKDAAAAYGNKM
TTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
RKLLEKQKEGKKRMKTIGRVDVPQEAFVAALSTESGSDKAGKK
392417193YP_006453798.1 hypothetical protein Mycch_3379 [Mycobacterium chubuense NBB4]MSGKLAALVAGAGACVLLAGCSAAPVDQRPVLHIAEAAKPSPAVPLGRFL
PDALELSAALGTGPAGFTGQLVQGDGHMLLDGVAETDATPAECVGAAYRL
QRSVYNGSPVQSVATNSWAGGGFDGPPVSGFFGVVQMTSAVAAQQFFAAA
TDRWRRCDGETLARHGSGQVVDELSRITDVVFDRRVVSASVLHASDGTGS
PTGMRALGVAGDCIVEVELTDPRPSADTHGAAGVANLILDKITTRR
392417192YP_006453797.1 hypothetical protein Mycch_3378 [Mycobacterium chubuense NBB4]MRHNDPVTRAAATRHVGAVGVLTVASLLLAGCANTVGGTAVRGAGGPGQR
DIAPLDEASLDRILLGIGELNGIVGSTQMTVTSSLEEMTDHSAGVSDPAC
LGAIYGAEEPVYAGTGWTAVRDRVAREPTDDNDHWVEQTAVLYPAAQNAQ
DFFGHSSDTWQKCANRSVDVGDGEYTWQLGDAEAGDAMLTQTTSQNDSGG
WACQHALSLVSNVTVEAWSCGYSVTDEAVQIADAMIKNAGGK
392417191YP_006453796.1 response regulator with putative antiterminator output domain [MycoMSFSGTDTTSRQVIDNAVGILIALRGCTRREAFDELVQVVNQTGVGIGSL
ATGLVAVAGGSASPQHAEAFTVWGELIRRARPMATAS