Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_rhodesiae_NBB3
Gene IDProtein IDProtein DetailsSequence
375143365YP_005004014.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVDSSTHSRRDVLKYAATAPALLIVGSAVATLSGQKAYAAPMKLIDFTHR
LVPPEQIKAAGFDGALVYVSELRPGADFDFKPVTREYADALRAEGLQVVS
CYQYGKPNWPNAPSDYTRGYDGGVADGQTGMRLHTAAGGPDSAPIFFSVD
EDIDLDTWNSVAVEWFRGINSVLGVNRTGIYGHAQACAWAIQDGVIGAST
TPGHAWAWQTRAWSDGEREPAAVLYQDVIVTPDDPGVILANTSVDVDIVL
APDFGQWSLPR
375143363YP_005004012.1 mycobacterial membrane protein [Mycobacterium rhodesiae NBB3]MLIVAVVVVAIAGYAVFRLHGIFGSGHDTSTPDALSDEIVPFNPKHVVLE
VFGSPGSVATVNYLDINAQPQRANDVALPWKYETTTTQPAVLVNVMAQGD
GDSIGCRIVIDGVVKDERQVNTMNAYTYCLDKSG
375143361YP_005004010.1 cytosine/adenosine deaminase [Mycobacterium rhodesiae NBB3]MDDMKFLLHAVDVSKRSMREGNHPFGSVLVDSEGNVLLEQTNIEVTESDC
TGHAETALMRQASKKYDKDFLATCTLYTTAEPCSMCAGAMYWANVRRLVY
GITEKQLLAETGDDPRNPTLSLDCRKVFGAGQKQIEVIGPVPEVAEAVLE
PHKNYWTQQS
375143359YP_005004008.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDPALQEMLDEHALHKLVHAYCRAVDRGDIAALRELYHHDAVDAHGAFST
GSVERFFEQLVASRPYLRAMAHNITTVNFAIDGNSAEGEVYNIAVHTLAA
KGRDVDLIIGGRYLDKYEKRGNVWKLLERTIVTDWARVSDPSSMDMSHPI
TADTLKGALDETDPSYQFFALLTNLSPG
375143357YP_005004006.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSQPRSKSGEPVTADQILETAARLIDVDGVEAFSMRRLAEQLGVAVTSIY
WHVGGRDKLFDSLVEGLLEQMADLRSDGETPVDRIASIARSQRRLLIQKQ
NLLAIAHERDRTPQLFLPIQQRLAAELSELGITGSEAALLVRVVEVHVIS
SAVMQFSAVRGAKHDEEDPSLWADAWPDQALVEALQSPTDYDAVFEYGLS
ALLAPLNG
375143355YP_005004004.1 N-acyl-D-aspartate/D-glutamate deacylase [Mycobacterium rhodesiae NMFDLKITGGTVVDGTGGDRFSADVGIKDGRIVEIHRRGPGDAPLEGNATE
TIDATDKLVAPGFVDIHTHYDGQVSWDSSLEPSSGHGVTTVVAGNCGVGF
APVRPGQEDWLIGLMEGVEDIPGTALTEGISWGWETYPEYLDVIEKQEFA
IDVGSQIAHGSVRAYAMGERGARNEPATPDDIAAMARIVQEGIEAGALGF
STSRTLGHRAIDGEPVPGTYAAEDELFGLGRAMAAGGRAVFELAPQGVAG
EDIIAPKKELEWMQRLGAEIDRPISFGMIQVDAAPDLWREQLDISAAAHS
AGSELYPQIAARPFGMLFGFPGHHAFTHRPTFRRLKAECDRQELARRLAD
PAVKSAILSEDDLPPDPTKLFDNMFALVQYSLGRLYSLGNPPDYEPTQDR
AVDKIAAERGDDPLSTLYDLMLEDDATAMLMLPFYNYFYGNHDAIREMLT
HPAGVVGLSDGGAHCGMICDASYPTFLLTHWARDRHRGEKLPLEYLVRKQ
SHDTAQLFGLTDRGVIQTGKKADINVIDMNALTLHPAKMAYDLPAGGQRL
VQGASGYSATIVSGVVTRRDSVDTGARPGRLVRGAR
375143353YP_005004002.1 acyl-CoA thioesterase [Mycobacterium rhodesiae NBB3]MGGDESTSAEDLTGPLHGTSLETSVISALDTLERALQLEPLGNNRFRATN
EADRFGRIFGGQLLAQALHAASATVEGHTPHSLHAYFLQTGDSGQPVEIA
VEGVRDGRSMSTRQVSVAQGDRTLLAALASFHSNPAEPEARSEPLAVPLP
EEMPLLQHWVDHGSPPMRRNAQTWIDVPPAVEIRIAEPTTFLGGRQTSGP
RSHWMRMPRNVTESTGLHNAVLTYASDYLMLDMALRSHPLPAEYTSVAAV
SLDHAIWLHRPVRFDQWHLYTQETAAISGHRAMVRGVIRDIDGHVVANTA
QEVLIRPIAGTT
375143351YP_005004000.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium rhodesiae NBBMLSGEKILITGPGGRIAHGIAKTLAAHNEVWGIARFSDTAVRDEVEALGV
TTRTVDLGTPDFSSVPRDFTYLLHIAADFGEDYEQGLRVNAEGTGLLLSH
CRTAKAALVMSTVTVYKPHPDPWHAFAEGDPIGDAGLPTPRPYSIVKIAE
EAVARYCAREFDLPITIARMGSAYGDRGGLPLWHLNAIVAGQPVVARWDP
LPYSPIHYDDINAQVEALLAAARVPATIVNWAGDVPVTVQQWSRYFADLI
GADLDLRVDVVPGASIGSVGDHTKRASITGPCTMDWRDGFRAMAAHHYPD
RVSGR
375143349YP_005003998.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALPTWDEQMEALKGVADHLLATWRPDDASEAEVQDMNKLALSILACGY
LCHVYTDARRPVFMPLWNYACNQGGPDPDYVYLNAEVDGSGVYELVGRRG
TVRFVEITQSAPGMMKSLKGVERQMKFHAITHDLDDLTLAEDGSFRVVLS
AERPEGHDGDWWPLNPEAGKLLMRKCACDWNTEIDAQVAINRLDDAGEDM
SPAEIARRFSELGDWIKGMIDFDMELVRYYREHHGINVLLRSQWIQQGGG
LATKQAYYDGIHEIGDDEALIVEFPVPTECHYWQILVADDRFSTVDWVNR
QSSLNDVQARVDADGRFRGVVSKRDPGVHNWLDKADWPWGILQARFYRAN
EYPEATVTKVPVAEVRDHLPADTPVLTPQERAAQLRHRRTGAQFRRIW
375143347YP_005003996.1 putative CDP-diglyceride synthetase/phosphatidate cytidylyltransferMAIVDHYLWFVHLDRRMALNIDLGPLHIHLFSRAVFFMWVTAAILAVAGI
AVLISRKPELVQKWRTWVVIAPVVGFPMWIGEGTTSALAAVLAVVAVVEY
ARLAQLAKADTSVLLALAVAYPLAAWLRPSLLHLAPLVLLLCALPSVLGG
DVENGTRRSAFTAFGSVWICWSLAHLVMVWPDSFLLCFAVAATDVAAWCG
GKGLRRMAWARRPLSPLSPNKTLGGLVGAIIGAFVILSLLGTISIGLLIA
VSIGGIFGDLLESMLKRQAQVKDAGDWLPGFGGLLDRIDSLLLVLPLAYF
LA
375143345YP_005003994.1 phosphatidylglycerophosphate synthase [Mycobacterium rhodesiae NBB3MNTYVTSHTTSNPTTPQGARATGLYALKPWFTRRLTVIVDVAVARQVSPD
AFTAAGVLAAGAAGVAVAFGCWPLAAVFMVLRLAGANLDGAVARARGVSR
PWGFVVNEIGDRTADLLAFAGLAVWAAQQRGPGLNWLSWPVLQVLVAALA
ATLPTFASLAAAGAGATRRNGGPLGKTERCLFVVLATAFPVIMPFLLGQL
VNGSLITTALRLRAAHRELKTQRASEPIADVVSITKPVTVPFQLTGAVA
375143343YP_005003992.1 response regulator with putative antiterminator output domain [MycoMLRHPHEGTPDIDELGSRALDSTDGRPAARDDSQPTDGLDEDAIEFGVSA
GEPQRVGRFHFYIDGQRWEWSPSVERLHGYEPGTVTPTTQLLLDHKHPDD
RDQVAAVLDKVVRGEPFSSRHRIIDVAGRTHWVIVIGDRMLDDAGHVIGT
SGFYVDFTDTMQSDISAAVSKVAEARAEIEQAKGLLMAAYGISADHAFDI
LVWRSQETNVKVRLLARRFVDAMAGTFPVGMRTQVDHILLNIS
375143341YP_005003990.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMRFGNFLAPFHPVGQNPTLAIERDLQLIAAMDDLGFHEAWVGEHHSAGFE
IIASPEVFIAVAAERTKHIRLGTGVSSLPYHNPLMLADRMVLLDHLTRGR
VMLGCGPGQLTSDAHMLGIPADEQRPRMEQCLDAIMRLLRGETVTMHTDG
FTLQDARLQLKPYSDPCFDVAVAASFSPTGPRGAGKHGIGMLSIAATARQ
GMNMLAHHWSTWEEVALEHGHIADRSKWRLVGPMHLAETREQAERDVEYG
IAEFSRYFSHILPAGPVQGDNPAEIIANNRESGFAVIGTPEDAVAKIEEL
VEASDGGFGVFLLFDHDWAPPAAKLKSYELFAQYVMPHFTGQLEGPAASA
DWVAASGTEFVDRASHAIGKAIEDHAAERAARPAT
375143339YP_005003988.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPVWSWFFIAAGALIALTLILAAVLAAKSRRRTRRLKEHFGPEYERVVDD
TGDRRAAENELVARERNREQLDVVPLSPEAHHRYAQQWLEVQRSFVDEPS
EAVGFADRLVTEVMRERGYPVNDFDQRAADISVDHPETVEHYRAAHTLYL
AQEKADIDTEAQRQAFVHYRALFDQLLATEPAIENQTPKEATA
375143337YP_005003986.1 CsbD-like protein [Mycobacterium rhodesiae NBB3]MGAGDKISNKIDDAGGKAKEALGKASGDKSTENEGKVDQAKSSLKDAGEK
IKDAFKS
375143335YP_005003984.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MVRPAPAPRRRSEKSRLAIVTATRELLLERGFDGTSIEAVAARAGVGKQT
IYRWWPSRPTLVADVLLEDADQIIAPVTHTDDLLGDLVRWVGKLAATLTT
ERGSAMLRMLTVACMEHEDTAVRLRAGFSAPLLASVRTRLLAAGVDEGTA
ASAADAIVGAVVYPILSEGRGYSRKRAESTTRLIISGLKS
375143333YP_005003982.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MGLRGEAAIVGYVELPPERMNKATPAPFTIEQWAELSAAALDDAGVSAES
VNGIVTSHLGESEIFVPSTVAEYLGVDANFAELVDLGGASAAGMVWRAAA
AIELGLCDVVLCTLPSRYITPMSEKKPKPLVDAVFFGSSSNQYGSPQAEF
EIPYGNLGQNGPYGQVAQRYGAVYGYDERAMAKIVVDQRFNANHTEGAIW
KDKRLTVDDVLASPVIADPLHMLEIVMPCVGGAAVVVANSDVAKRSRNRP
VWIRGFGEHVPFKTPTYAQDLLQTPIARAADTAFGMTSLQRADMDMVSIY
DCYTITVLLSLEDAGFCEKGKGMAFVTDHDLTFRGDFPLNTAGGQLGFGQ
AGLAGGMHHVCDATRQIMGRAGEAQVRDCHRAFVSGNGGILSEQTTLILE
GD
375143331YP_005003980.1 putative integral membrane protein [Mycobacterium rhodesiae NBB3]MELLAAQREFVAYGPSHLVVLAVFAIGAALLIWGGRRQTEAQAKRFGRGF
AVVIAVMFLVALTYKLIRPVLDTSIPLQLCDVAELISIYALWTQRHWAFV
LTYYWCLVLSSQALITPDVGTAEEGSPDFPHHLFVTFFALHVLVVWAAIY
LTWGRGMRPSWRDYRFAIIATLVWGAFTFTFNAIVGTNYGYLNGKPPTAS
VLDFLGPWPVYLLIEVAIVLVVWALITWPWERIRRRAPESPAAV
375143329YP_005003978.1 response regulator with putative antiterminator output domain [MycoMHHPGDAPRGERSALVSPDLHVGSFRFWFVGQRWEWSDEVARMHGYEPGE
VAPTTELLLSHKHPDDRQHVQDALDHALHSRSSLSSRHRFIDTGGRVHTV
IVLADRMLDDDGAVVGTEGYYIDLTDTFDQTHRQALDASLPELLESRAAI
EQAKGALMLVYRIDANAAFELLLWRSQHTNTKVRALATQIVAELSGIEYQ
PEDLRREFDHLLLTAHERIDRGVDH
375143327YP_005003976.1 PAS domain-containing protein [Mycobacterium rhodesiae NBB3]MTTAGGERDRKAAVFSADKEIGKDLAEVDWKATPLGPPPQWPQSLQTAVD
ILLSSRFSMWMAWGPDLTFFCNDAYRRDTLGRKYPWALGRPAREVWAEIW
DDIGPRIDTVLSTGVATWDSALLLFLERAGYQEETYHTFSYSPLRDDDNR
VVGMLCVVSEVTQQVIGERRMATLRDLGSDPSVVRSEEESLTFADRQLGH
NPRDLPFTLTYLFDENGDARLAGSSGIDAGHPLSPSRIPAGEASVWPVDA
LAHGDTVSVELREVANLPTGDWHDPPTAALAVPMLQQGGTPSGFLIAALN
RYRPLDDAYRDFVTLVAGHIASGIGSARTFRDQQRRAEELAELDRAKTTF
FSNISHEFRTPLTLILDPVDQLRRRSELDEPTREELDTVWRNGLRLTKLV
NSLLDFSRIEAGRTQAQFVPVDIATVTAELASVFRSAVERAGLSLDVDCP
PLDDVVYIDRDMWEKVVLNLLSNALKFTFDGRIAIGVRRENDEAVVTVTD
TGIGVAAEEIPRLFERFHRIENVRARSNEGSGIGLALVKELVDLHRGSIV
ASSAEGVGTTFTIRLPVGMANLPANQAATTDQNRTSSAVAQPYVQEALRW
IPAETGVGDAPEPHVEGAAGSDRRTRVLIADDNADMRDYLGRLLGSDGYE
VEAVTDGQQALDSVRATLPDIVVSDVMMPRLDGLELVAALRSDPRTAAVP
VLLLSARAGQEASIGGLQAGADDYLTKPFAAAELLARVRATVGLARMRNH
HARWRTALVDSLQEAFFVCDEDGAVIEINAAFTDILGYGVEDLPYEPTYP
WWPSIDEDPDAHRQMSEAFETLLRQPHGVVSVPATHRDGHRLWVTASFNH
VDDPDTGRRVMVGTFRDVTAEHYAVQRESALAALNQALAQADSLGDAIRA
ATEEFRNVWSARRVLAVTFPADEVDPPPSEVVGSGEATTWDQLASGARDV
IRARRDGELLDSPATQPGMAAIAIRHPGGVLVMFVELDERRPFTSEDHTL
LTVLAGSLGQGLQRVHHFDQQRETALALQHAILGPHVSGGFAVRYQPATR
PLHVGGDWYDVVNLDDGRIALIVGDCVGHGLVAATIMGQLRSACRALLLE
QPSPSAALAALDRFAARLDGARCTTAFCAVLNPETGELTYSSAGHPPPIL
VMADRTTQLLDAAAAMPLGLPYDQTRPEASATIPPRSTLLLYTDGLIERR
REPLDEGIRRATDLVQDNRDTALEGLADEIMSSLAPNGGYQDDVAVLLYR
QPAPLEVEIAADVNELASSRAALRGWLTRVGVEPEQTLDVLIAVGEAVAN
SIEHGHREQLEGTVSLRATAFADRLHLTVVDTGKWKPSDFDPNSLRGRGI
MLMRALMQDVTIEPGDSGTTVRMHTRIA
375143325YP_005003974.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNIVPTRIQEQIGRVDRNYALYIGISAGITALWSIYRVFWLVYTAATFSS
VGWSPVSLVFPLVFWAVVAVGTGLVSAAFLLRYAKQP
375143323YP_005003972.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MVTMAPQTFTTAGEGGVRIVGDRIGDPGAPAVVFLHGGGQTRRSWGRAAA
AVAERGWQAITLDFRGHGESDWSTDGDYRVTSFARDVLEVLRDLPPKPVL
VGASLGGFTSMLLAGELAPGAVRAVVLVDIVPDMDQSGASRIHEFMYDRM
KSGFDSLDEVADMIQEYNPHRPRPTDLDGLRTNLRHRGGRWYWHWDPKFI
DGTSALPPIEVTEVERMHAAVAAILDTGVPMLLVRGQMSDLVTQERADEF
LARFPGVDFVDVGGAGHMVAGDRNDLFAGAVVQFLDRHAPG
375143321YP_005003970.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAVESIHVNTVYPHSDSRYEWVEATVEFAVDPDLLANQGIVDLELAPRDT
DGMVRYDADLKLLRPVDGGNGKLLFVVPNRGVPTYAPWLKNGFLLDRGYT
IASCGWQWDVQRGPATLGMSAPSADVPPGFMRLEWRSDSASADHPLSFTV
PEIDALPPGAEALFTFTDYPTVDIDDPEAVLSVRTAPDADPTVISRDSWH
FTDETHLTLDGGFKPFHWYELVYRTSRTPVVGCGLLAIRDVVSHLRSDGI
DHAFAYGVSQAGRLLRQFLSDGLNVDETGMTVFDGVFSEFASATTGEFNH
RYAQPSMAQVIGFGNMAPFAGAELLARQRELGGVPKTIFTNSATEYWNSG
GALLHVDPYTGADLPEDPDVRTYLLASTDHFGSSKLKEAFPAANPVHRLD
VTPVNRALFVALEDWVCDGVEPPDSKVPRTSDGTAVARKEVLSFFSHTNA
PDPSALSYARHIDLGPHARRGVGRWPIQLGEPYVDLVSAVDEDGNEVAGI
RLPSVAAPLAAYTGWNPRRHIDELPDVLYERVGSRLPFPPGRPSVTERYP
SREDYVAAVRNAAESLVAERFLLADEVDAVVGKAAADY
375143319YP_005003968.1 sigma-B/F/G subfamily RNA polymerase sigma-70 factor [MycobacteriumMSESTSEYADLTEMFRRLATLDEESAAFRRQRDEIIRRALPLANHIARRF
RNRGEPIDDLVQAARVGLVNAVNRFDPENGADFLAFAVPTMMGEVRRHFR
DYGWAVKVPRRLKDLQSQMVKARSALSQDLGRAPTATEIANYLGIDRESV
IEATIASNNYTTLSTDVQTSTDSEHRAIGDTLGDVDPNLDKVLALQTVRP
LIAALPDREQTVLTLRFFENLTQTQIAERMGYSQMHVSRLIAKALATLRE
QVREPDDADTSGLAVTA
375143317YP_005003966.1 poly(3-hydroxybutyrate) depolymerase [Mycobacterium rhodesiae NBB3]MSRPGVVNVQVVGRTTVLMVLLLAFLSFSGAHAAAVPAGDFPDGMRFGGL
QRTYLVHVPPGLEQPAGLVINLHGAGMTGGAQAAMTNYNAVADQHGFVVA
YPEGIDLSWADGRGAAVPDRQGVDDVGFLVAIADRLTKDFGIDPGRVFAT
GMSAGAFMANRLACSRADVFSAVATVAGTLGSAFPCNPSQPVSVLSIHGT
ADNVVPFNGGPMVGRGGPSDIVSAPALAQEWRELDGCPAPVEDSPAPSIR
RFTAAGCVGGTEVSFVQIDGGGHTWMDASNASGQFFATHGR
375143315YP_005003964.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MHTMTDMSDLLNGMPRVDPTAAPPWTLRVTARILSTDIGSAFHRHVMAPL
DGPLGRLSRGRLHFGKGTIPLVILRSTGAKSGIERDVPLGYFTDGDDVIL
IASNYGQANHPSWYYNLLKNPQCQLFPDGDTNRGGHFVARRTEGADHDRL
FELAAGYASNFASYAVKTDGVRTINVFRLSPKG
375143313YP_005003962.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MEQNLPFDLDALLVFGKVVENRSLSKAATLLGMPKSTVSRKLTKLESDLG
IKLLRKNTHQLTVTDLGEQVYSHAVKILAEANGVRALVEGSRQEPQGELR
VAIPIFLGIDYASRVGAAFLQHYPHSRLDIRLVDNLVDPIKDGFDVVFGT
GPLQDSTLIARKVFSLELFLCATPAFVRQLPAPIVDPVQLDALPFIDFGF
GGPRKFSIVKQKRRYDLSPQVRARANNFQVCKQYILQGLGIGPMPTQIIC
TTELREGSIVPVLPEWKLEAMDVHMIYPFELSFSTLISAFYETACEIIVE
NSART
375143311YP_005003960.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTSLPQEFSQLEHLVDEWAIEDGHERYVKRVNSSMEEIQSFYDQVFPYA
EEAVAYVDKFDYSEPLPDDVANLRNLLYSLITVSLAVELWNQPRVKHSAN
TILTRVS
375143309YP_005003958.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMKIGIATPVVTNVGGAAFGWERDATIEDVGRIAEAADRLGYHHLTCSEHI
GIPASEAGRRGARYWDPLATLGYIAARTDRIRLATMTLVLGYHHPLEIVK
RYGTLDHVSNGRVILGVGVGSLREEFDLLGAPFEDRGARGDDALRALRVA
LPTNEPAYEGEFYSFGGLTVDPCAVQPHMPIWVGGRTKRSLRRALTLADG
WCPFAVSIDTAAEWLSSRDVPDGFEVVLPADKPLDPVGKPQETKEILAKM
AAAGTTTVFAYFIHDSFEHYLEQLHALAELHGLKGAAA
375143307YP_005003956.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTSDPQTIPFDGVRLRYSSTKSFDELVNAVLNDVGREPVPIDDIGKLYP
DWESYEHEVQSHVGPHGFMLFGSFNHGGWIAKAGIHRKVLRLVIGNPLIA
ITMISHDVTAGLFAPVELLLTEEENDTSALTYVVPSSLMVVEPNPPLLSA
AQALDAKLAALAADVSGT
375143305YP_005003954.1 NAD dependent epimerase/dehydratase family protein [Mycobacterium rMTERIFLAGATGVIGSRVVPLLVSAGHSVGAMTRSMDKADWLSSLGAEPI
ICDVFDRVGLADAVKGFSPDVVLHELTDLPDAFEDIPKSQALNARIRVEG
TRNLIDAMNSLSQARIVAQSIAWTTDPGPGADAVSFLEEAVLAAKGVVLR
YGAFYGPGTYYEGELPSAPRVQIDTAAARTVEALHAPSGIVTVVD
375143303YP_005003952.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MSFFEKDTIVSGLGISRIGRKTGIPGLELTMEAARAAIADAGLTPDDIDG
FATFGDTLPAEVVASLGNQATDVGVGFGTGGVLTPFMSALAAVAENRARH
VLVYRTVQMLGGAMTGSTASPLLAPLADPPLEPRLPGTRRKLKPFEDINA
LLAAHAYSAANWVAMHCRRHMALYGTTKEQLGWLAINSRRNAGLNPRAAF
RDPMTMDDYLASRPISTPFGLFDCDVPIDGAIALVVSHADYAKDCPNPAV
KVEAIGGAYGSDGWFHRDDFPKMASSEAAAEMWSRTDLKPSDVDVAEIYD
GFTFLTFAWLEALGFCGDGEAGPFVEGATRIALDGELPLNTYGGQLSAGR
MHGYWLLHEACLQLRGQAGDRQLARRPEVAVAAAGGGPIAGCMVLTC
375143301YP_005003950.1 putative F420-dependent oxidoreductase- MSMEG_2906 family [MycobactMVKVGVQIHPQNTTMAALRAGWQGVDALGVDSQWTWDHFFPPLYGAADEA
HFEGWQILSAMAVTTSNVPQIGMLVTGGCYRNPDLLADMARTVDHLSGGR
AVLGIGSGWMEKDELEYGYPVRTPGQRLDALAEALPRIRRRLGLLQPGPL
GRLPILIGGQGERRTLRLVAEYADMWNGYGDASTIRAKNAVIDRWCAEIG
RDPAEIERTIWIERADPQLIRSLVDAGADHLILGLRAPYDLREVERLVAA
R
375143299YP_005003948.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSEIDDSPPTSRRRHIVRLAAVLVFLLGMFYLVAVARVIDVDAVRGAVAA
TGPAAPVAYVVVSALLGAVFVPGPILAAGSGVLFGPVLGLFVTLGATVGT
AVVASLIGRRAGRNSARELLGTERADRLDALIQRRGLWAVVGQRFIPGVS
DALASYAFGAFGVPLWQMAVGAFIGSVPRAFVYTALGASIGDLNSPLAYV
AVAIWCVTAVIGAFATHHGYRKWRARSTSH
375143297YP_005003946.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTARATFDFTGTHALITGGTSGIGHATATLFRDAGAAVTVTGTKASSGDY
DTDLTGMTYRQLILADAASIDELVLATGTLDVLVNNAGANFPGGLNEAEP
DGFEASVTLNLTAPYRLTVGLRKALAASGGASVVFLSSLSALRAVTMVPG
YGAAKAGIASLTHNLAVKWAPRGIRVNAVVPGVVDTPMTELAQTVPEIID
AELARIPLGRLGTPAEIAATIAFLCTEQSSYTSGALFVVDGASTSQ
375143295YP_005003944.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGAAELSFDDLTAPRLSDVQRQILQHTERRQVDLDVEQMAAEAVAEAGVD
DFAADDGFWDRVAAYVGAIESDDGLTQLIRGTLRQRVVRLLRNRLSLTEL
LKRHPEIESIPIEKPFIVVGMPRSGTTHLVNLLAADPRRRALPYWESQEP
LPIPGQGPDVHGVDPRYTRAKNEHDAMMVSAPATAAMHDRFPEAIEEEVE
ILDLDFAAYVLEWHARVPGWRDFYLGLDQTRHYGYMKKVLQALTFLRGPR
TWVLKSPQHCEQLGPLMATFPDATVAFTHRDPVAVIQSTITMMAYSDRLR
RRTIEPQWLLDYWADRVERLLRGCVRDRALVPADRSVDIGFHHLNGHELD
LLDDLYARAGVELTSKVRRAFQGYLDGNPRGKHGSVRYELQRHFGVSPDE
LRSQFAFYFERFDVRPEGH
375143293YP_005003942.1 amino acid transporter [Mycobacterium rhodesiae NBB3]MSTESTAPAHTDDVDTEGKLKRKITGPLLFMFILGDVLGAGIYALMGVLS
QDVGGMLWAPLLAALLLALLTAGSYAELVTKYPKAGGAAVFAERAYRRPV
VSFLVGFCMLAAGITSAAGLALAFAGDYLATFVDVPAIPAAVAFLALVAC
LNARGISESLKSNVVMTALELTGLLIVIIAVSIMVGGGRGDTGRAVQLPD
GATPALAILAGAIVAYYSFVGFETSANVAEEIRHPSKVYPAALFGALITA
GVLYALVGIASATALPASELSQSSGPLLAVVAAAGVGVPNWLFSAIALVA
VANGALLTMIMSSRLAYGMAEHGLLPGVLSKVLPQRRTPWVAIVATTVVA
MLLTLIGDLSTLAETVVLLLLIVFISTNVAVLVLRRDTVEHPHFRVWTAV
PVLGVASCVLLLSQQTAKVWLFAAILLAIGVVLYFSARAATRRTAAKSPT
P
375143291YP_005003940.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMTTTSETVDVLVAGSAGALAGAYTAAREGLSVAIVEATDQFGGTFAYSGG
GGMWYPCNPVLVRAGSDDTIDEALTYYRAVVGDRTPAELQETYVRGGAKL
IEYLEQDDHFAFKILPWPDYYSSVPGARNDGMRHTVCKGLPGERLGRFQG
LVRGPLDHERLGEPQPDFLTGGRAVIGRFLWAMADNPEIAAHLNTSLVEL
VVEDGRVVGGIVECDGERRVIRARRGVLLAAGGFEQNAEMRAEYGVPGTA
SGTMGAPGNTGLAHKAAMAVGASTDLMDQAWWSPGLVHPDGRAAFALCFT
GGIFVDESGRRFVNESAAYDRLGREILNAVRDGTLGTPYWMVYDSRAGEQ
PPVMATNVSFSPTSEYEAAGLWVQADTLEGLADKIGVPAANLVDTVRRFN
ELAERDDDEDFGRGRESFDRAFTGGASPLVPIDTPPFRAAAFGTSDLGTK
GGLRTDVDARVLDDEDRPIPGLYAAGNTMAAVSGETYPGGGNPIGASLLF
SHLAALHMAASR
375143289YP_005003938.1 acyltransferase- WS/DGAT/MGAT [Mycobacterium rhodesiae NBB3]MSHVRRRPMKRLNGLDAMLVYSETPQIHTHTIKLGIFDVSGLRNGYTFES
FRRVMAARMLGLAPMRYRLVDIPFKFHHPMWQENSPTEAYDHISRVVVAP
PGGRRQLDDLVGEIAAVQLPRDRPLWHLYVAEGVAGNRVAVILKMHHALA
DGVASANLITAALLAPDVLEQVGRNLQPDVVPSRRELLRDAFYDHLRQLT
RTPKLVWQTVFGISRVLIRARRNQTRPPRPMTPPPCFLNHVVTPQRRFAT
ASLALPEVKSTCKTLGVTINDAVLAMTAGALRTLLLKYDGKADTPLIAGV
PVSLDKSPERLSGNAFGYMLPPLPVHIADPAERLALTAMASRNAKENFRL
SGPTLLASWLEYLPPPLSPAMFRWQSRRLNSGTVMNLTVSNVPGPRETRS
VDGAEITEIYSVGPLAAASGMNVTVWSYMDQLNISVLTDDITVDDPHEMT
DAMIDSFREIHSLKAIPGQTIRVPLPTDNAPDMAAG
375143287YP_005003936.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MRWLLRASPSDVMLATSAAVASLPVVGRHVQRAGSFAAMGVWGGRYAGDF
AEATRRRLAPDTSGIRKRERGMTNGAVVGALSAFVPQADFADTPHEPVQL
PPLLRASTHRRAIYKSTVQYGPLPSQVLDVWRSKDLPSEPAPVLVFVPGG
GWIHGSRRMQGYALMSHLASQGWVCLSIDYRVAPKSPWPAHLIDVKTAVS
WAREHANEFGGDRNFIAIAGASAGGHLAALAGLTANDTPAEFGIPVAANT
SVDAVVSLYGRYDWEDRSTPERERFMDFLERVVVAGTAARYPDVFRQASP
IGLVHRNAPPFFVVHGTADWIIPVDQAQSFVERLRSVSESAVCYLELPGA
GHAFDLVDGTRTGPAVAAVGLFLNQVRRNSLLTKAV
375143285YP_005003934.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTHESRMLIDGKLVESETGRQFDNINPATEEVLGGAADGTRADMERAVAA
ARHAFDNTEWSRDGEARAAALRQLQAALEAECEELRGELIAEVGCPLLST
FGPQLDVPLKEALSWPADMISQFPWKRTLPDKDAFGMGTPAAREVWKEPI
GVVGVVTPWNFPLEIILNKLGPILAMGNTVVLKPAPDTPWNATRIGRIIA
EQTDIPPGVVNIVTSSDHLVGEVLSTSPLVDMVAFTGSTATGRRIMAAAS
ETVKPTFLELGGKSVYLVLDEASIDTAVGGSAFISMHAGQGCAMPTRLLV
PNSRYEDAVEIVKVAMEKNKYGDPTDPSVLQGPQVSRRQQERVLGYIEKG
KQEGARLVTGGGVPQDLPKGYFVEPTVFADVDNAMTIAQEEIFGPVLSVI
GFDDDDDAVRIANDSIYGLSGVVFADDLERAKGVASRIRTGTLGINGGLW
YGADAPFGGYKQSGIGRQCGIEGLEIFTETKTVGWPAP
375143283YP_005003932.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAKRGGTDVERRARGDQTRRDLVDAGRALFVEKGYFDTSISDLVTRSGVG
TRGAFYHHFKDKAELFRAVFEEVERDLTLRSLASPPQGADAWEVLSVGMR
GFLESALEPEVQRVMLIDGPVVLGWQTLRAIEESNSIALINEMVAKAIAE
GIIDDHPVGELTHLLVAAVEEAALLVAHADKPAKARERAARVLDRLLLSF
AVEPRKVLRR
375143281YP_005003930.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLYVARMADDEVRAYGSVAPLKVGLLNDYPTRAGTDNDTLDSLRLVFDEA
VASGLVDRPIELIERNVIGLPNGTYQAVEQGYDELVADGCLAIFGPYVSD
NAVPLASHANRVAKVPNIILSGSEGALSEWTFALNNGSMPEEPVMLAAVM
LGDGRTRIAIAYEASLIGKEYLAFAEKAYAAAGLKVVTTVAIPQVEADKA
VAVKELRAADPDALVHVGFGHGLWGFSDALLAADWDPPRYTTTAFEMAHI
NDEWRHHLRGWIGLDSYDERNAVGQAFLDRFEARYGRRPAHSMPGLAHDV
ATVIVRGLAAARPLTGEGVKDGIEQVKLVPSASGAPGTFLRFGRFIRQGW
LGSDYLIARRVLPDGSAHVFHSAPSDHIARAVGVESS
375143279YP_005003928.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MAEPATVEELEQSIRDAQEKFNEGMGAAGDASPYPMLKELRAQSPVHAGW
PEMGMEGNPDDGPQTFTAYSFDAVKAIFTDNITFSTRCYEDVVRPLQGPT
ILEMQDPEHAVYRKLHEFAFARSSMKRWDSELVGPLVDSTIAKFKGDKKA
DLVDKVFMPIPVRVIAALLGLPDSDVLWFHRLAIDLLGFRGDMDCAMRAS
SEMKEYFVGILADRRREPQDDMVSILAASEVNGVKMTDEQIYGFMRNLLP
AGAETTSRSTASLAMALLTHPDQLDAVRADRSLLPQAIEEGIRWETPLLN
FMREVTCDTEIGGVQIPKGATMMLSLGSANHDETRWDDPERFDIFRERKP
HIGFAHGAHVCLGMHLARLETTKIFNALFDELPGLRLDPDAPPPYVTGTM
FRSPPRLDVVWD
375143277YP_005003926.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTVRTMTTVSFADRVVLVTGGGRGLGAAYCREVARRGAAVVVADNGCDVD
GNGSDPTPANDVVAEIVADGGRAVACVEDVSTEKGGQMAVELAEGEFGRL
DAIVANSGNVFNAPVDDWPTERFESLLRHHLLGAFHVVRPGFEVMKRARY
GRIVLVASAAGIFGQHGMLGYSTAKTGMLGLMNVLSLEGADFGIATNAIM
PMARTRMADAVTGVGADDPDGSAFLDTLRQDQVAPVVAYLASEACTQTQT
VFSAFMGRVAAVQIGISRGWTSPDGSLSAEDVAEHLPEILDTTGLLVPRT
LYDEMGYVTSPESLPPK
375143275YP_005003924.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MEDVLGYKGKSVVVTGAASGMGQAAAQILVDLGARVTALDINPTTVDVDR
ALTIDLRDRANIETVAASIDGPVDGLFSCAGLPGPPFSEWDTILVNFVGA
RHLAEQLVPKMADGSSISVISSSAAIGWQDHIKVITELLETDGFDAAVEW
LTANEKKWSWSGYAYSKYIIDAWVGWWYPELGRKGIRINAINPGPTETAM
MPAFQDLMGKETVDQAIGPVGRYSTPEEQAWPLVCLGSPRLSYVGGEVLW
TDGGWNGAMTMGRHEAKWADTAAGEMSKNG
375143273YP_005003922.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MTDPHSDIAGIRMLIVGASSGIGQALALAAHARGVKVALAARRVSILTTL
AEQLDGSAHELDVSDPQAIERVVGEVAALFGGLDAVVFTSASAPFALIED
TDVTTWMHTYAVNAVGASHLLRAAVPHLADDAVALIASSHDVGRPRAGVA
AYHASKAALDEILRSWRAEHPELPVIRVSVGPTEGTEILRGADRDLLADL
YRTWAQEGQIPAEMSAVDDVANALLSFIAVARANPTVVSDIVHLAPRARA
KKS
375143271YP_005003920.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGATELRSFVFAVEFAVGDAGRVWPVLSHHEGNLRNLGAHYAFIYESVVE
AGRVLVVIGVRTRQPLLDLLRSPQLFEWFDAVGLDDLPAVFAGEAVERFD
IGEAPAPGTEIVVAAVTPVADVDDFMARVRESLPQFARAGISRTLVYRAF
DTAGEVMFLQQLASAEKALVWVDRSEIAASWLTAAGVGAYPPVFVGRFVN
AMRLAETSGTDLH
375143269YP_005003918.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTADNPYSRCVTYRVKVDPYYDPFDFEIDDDPYPVWKQLRDEAPLYHNEK
YGFYALSRHSDVARELVNWQDYRSGRGTVIEVLLNRIEVPPGIILFEDPP
IHDLHRRLLSGVFTPRRMAAIEPLAREFCRRSLEPLADADRFDFIADLGA
WMPMRTIGYLLGIPEDKQVAIRQKSDKLLELSEDGPGDVAADMLTNSGSM
LEEFIDWRYDHPSDDLMTDLVNAELEEPDGTRRRLTRGEVLTYTSTVVGA
GNETTTRLIGFAGQLLSDHPDQRRALAADFSLIPNAVEEVLRFEAPSPVQ
ARYVARDVEHYGQTVPEGSVMLLLNGSANRDERQFPDADTFDIHRRGAHL
SFGHGIHFCLGAALARVQAKVALEEVLTRWPDWEVDYTRAKRAHTTSVRG
WASLPVRV
375143267YP_005003916.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MITLCQFTGILQAKTIAKYWDSSAANSILTSAEATASI
375143265YP_005003914.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSASSDSRLKRRSSGEQVAAYLRDEIMAGRLVAGDRINQEETADLLGVSR
VPVREALAILENEGRIEIELHRGAFVLPIDPDSVRENTEIFGLIYAHVAQ
KAAERLTDDLDSKLAMISAELETATSDDEVWRIVGEYVDAIMEVGVSKRM
NRTLRKMRVLVEVSDVQAVSPEAVETTKRGILKTISLIRAGDGKRASENQ
IETQRVAAEHLVAALRSRQG
375143263YP_005003912.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAKTPMSEHDRRRRRALIVFQIFVYGCLIAMFLIQLQMLFVKDW
375143261YP_005003910.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEKSTEASADLPAGTSPGFARMHRWLKRGLYVCLFGLVIEGALTVPALA
VWYGWPSLSLTEICSELMKVRYSDDTLDCTQPYPLSGPPFGGAPEAAGQQ
TAQDKWGIQPVPQYPRVGFRELVRIHDEREAR
375143259YP_005003908.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MALEQFQLDGQVAIVTGAGRGVGEGIARVLAEAGATVVGTARTTSEVEST
IEDIKSAGGKGLALTADALRRDDSERVVQTAVDEFGRIDILVNNVGFATY
GPFLSLTSDNLRSTFDYCVTSAFDMSQLVVPHMLEVGRGSIVNISSGAGR
FGIRGLLPYSVAKGGLEALTRAMAQELAPKIRVNAIALGAFLTTGLQSSF
DLMPGSEEKLKERTPLHRIGDVADLGRLTLYLCTKDCYATNSTFIVDGGL
QGPNSELPIPDL
375143257YP_005003906.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MPFPTITPTIPALVRSCAARFGEKAFLIADGQALSYVDLDLRSATLARAL
LAAGIGKGDHVGILMPNSVEWAIAWFATTRIGAVAVPMNTFYKASELAWT
ARHADLRAILAWSSFRNHDFVERLEEALPGLSDECDAGQIFLRKTPYLRM
IAVWGSCERPWATALGDHDPTDIDDDFLIAVESCVTPADDAMIIYTSGST
GDPKAPVHTQGTLVRHTYNLTFDYGVTHDTVMFTAMPFFWVGGLITGIHA
VIHHGATLVTQPAFDAADALELIESHRATIALGWPQQGKTLAEHPDFAQR
DLTSVQRTSMPAMVPPERRPQGPNALGMTELCGNHIGVDPYPAQPLDRAE
TGGRSIEGLSHLLVDPESGKPVPVGTNGEIWVRGYSLMQRLYKREREDVF
TPDGYYRTGDCGIAYDDGWIKFTGRLGDLIKTGGGTNVTPSEVELALTAC
DGVLEAYVVGADDGSNGTVVAAAVVPRGGSVLDSDDLRAQVRSRLSAYKV
PKFIWITTKDALPFTATGKVKKSDLAVQLSELLTNRP
375143255YP_005003904.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSDDKVLSGVRVLEVAAWTFVPSAGAVLAEWGAEVIKVEPRNGGDPQRGL
VTMGIVDEGGGSVNYMIEIPNRGKKSIGVDLSTPGGQEVVRELAKNCDVF
LTSYLPERRKKFGIDVEDIRAVNPSIVYVRGSGHGPKGPDADKPGYDGVS
YWARGGIATVLTEGADELVRSRPAFGDLLGGMTIAGGIAGALYKKATTGK
GSIVDVSLLGLAAWNLSPDVAVSQIHGGSAIPKFGHADAPNPLVGTYRTS
DGRYVQLMMLQLDKFYAEAMRVIGLPELVDDPRFADPASRFANRVELIAL
LDGAFAKHTLAEWRSTLAPLSGAWGIVQTPGELCQDPAVTANGYVAHTET
VNGVPFSLPTNPVQFDEQSVVPTGAPEHGQHTEEVLMNAGIDWDTIEEYK
KSGAIL
375143253YP_005003902.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPATSVEGDRDNEKLRDRPAIRGRATPAKLVVVAVDTADSVSAAGGLIF
DAIRAGWKVDIYLESPGDGRALQILGARSVELPEVFEFESNWPDAILLSA
VMHERHRGVQRLVATSLRRHVSEIAVWGGSISGINAKAGSEHRLSTAARA
FKPHAMHAAGLPPPVTYVESFSGGLPN
375143251YP_005003900.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MSDGIGGKAALAGIGQTEFSKESGRTEMQLACEAVKAAIDDAGLRPGDID
GMVTFTVDENEEIEVARNVGIENLTFFTRVPHGGGAAAGTVMQAAMAVAT
GAAEAVVCYRAFNERSGFRFGGAGRQPGVTPLWMAPYAPFGFMTPAAWVA
LHAQRYMSTYGVTNADFGKISVIDRKHAATNPDAWFYGKPITIEQHQESR
WIIDPVLRLLDCCQESDGGVAMVVTSVERARDLAKPPAVITAAAQGAAFD
GEVMTSYYRDDITGLPEMGVVGNKLWGNSGLKPDDISTAFLYDHFTPFVF
TQLEELGFCGRGEAKDFVSVEEFSLGGRLPINTNGGLLGEAYIHGMNGIT
EGVRQVRGTSHNQVDKVEHVLVTSGTGVPTSGLILAPDR
375143249YP_005003898.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFTFNEEQETVAKVARQLFEARATPEHLTELESTDVRHDAALWNELAAS
DLLGIALPASVGGSGSGFLELAVLLSEVGFSVAPVPVYATLVLGADTIAR
HGDSDLQRRFLPGVIDGSTILTAALAEPGNSDPATPRTTARADGDSWRLD
GAKDLVPAAQLAAALVVSAQADDGPGLFVVETASDGVTVSPVNTTNGEPY
ADVELSGAVAHRLTENAGADIVSSLYSRALVGLCATQIGVVERALKLAAS
YTTEREQFGRPIGSFQAVQQRLADAFIDVEAIRWTTWHAAWLIAEGRPVE
REAGIAKFWAAEAGARVAASAQQVHGGMGIDVTYPLSRYFLWAKQIELAL
GSASQQLARLGKTYSEGTK
375143247YP_005003896.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTELAKDELRERLDALIGTPTDGVGKPSRAPDPVNAAMIRHWAYALDDMN
PAYLDPEFAENSRYGGLVSPPVMLQSWTMPPPKLAGIHERGGVPIEIKTN
PLQFLSDAGYTGIIATNSEFEIERYPRVGDQITAETVFDSISDEKKTAMG
NGFFVTWVTTYRDQNDEVIGRQWFRTLRFKTGGSPAGTAGD
375143245YP_005003894.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MPTDSTSRPTCTLPLHSPDFYAGDPYPAYRELRTTTPIVWNDVTNFWALT
KYEDIRYVSGHPLTFTSTKGITIPDPSQPEPVQEGNLIFTDPPRHRQLRK
LINAGFTRRQVTLLEPKVREIVKGILDDVDPSREYEFAEEIAAPLPTRLI
AEMLGAPPEDWEQFRAWSDAAVGTADPDIELDNVVALGQLYEYFTKLIEA
RRSGEVVGDDLLSILAAAEVDGERLTDADLLNFSFLLLVAGNETTRNLIA
LGTQALLDHPDQFALLRANPELLPLAVEEMLRFTSPVTHMAREATEDVEI
RGQQIRAGEKIVMLYGAANRDAEIFGPTSEEFDITRNPNPHIAFGAGEHA
CLGAQLARLEARIMFEVLLGTYPTIELTGDVTRLRATMVPGVKKMPVRLK
ASV
375143243YP_005003892.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTGALAGLRVVELGTDITAPYCTKLLVDLGADVIKVESQSGDPLRGWGAS
GGLFEYLNAGKRGVTVDVDTDGDVLHNLIAQADVLVENMPPGASLRWEWG
IDHDSLRQLNPNLVVVRISDYGQDGPRCDRQSTPLTVQAASGWVSTREPD
RPPVQSGARIPEYIAGGYAALGALTALQIAAVTDRVVEVDVSTFEALLST
LPYPMLMAARLKSMGLPPNSKAGPMLGIVRAADGWIGINCLTGQHWLDVC
AMVGLPEFGEKQLAIMLGGPEREDFFAKAQPFLDSMTVADLVELSQAMRI
PAAPINDGATILECPQYRDRGFFVNSDAAGTPFSRPGAPFRFSRTPVDGP
RPAPRLGDNASVDWDTRAEVPSSSVLGDLDAPFAGLKVFDLSTFWSGAYL
TMYLAAFGADVVKVESIQRPDGHRYSGSLLRSSDDWYEVGPMWQATNLNK
RDITLDLTSQPGRELALRLAAEADVVVENFSPRVVEQFGLDYDSLVKVNP
DVIMVRMPGLGLEGPWRDYVGWALNFEQLSGMSAATGYPDGPPCNLQGPA
DPVVGTHATAALLAALEHKRKTGEGQLIEVAQIEVGAVVTAEPVIEYSLT
GRVPEREGNRHRSYAQGVYPAAGDDEWVAISVRDDADWAAALDVIGRPEL
ADDPRFNTAEERLVNHDAFDEVLRQWTAAQGPDEAADALRRRGVPAERLL
TGDRMYDVDQLEARGFYEELKHPLSGRQRYPGWPFRITPGPSRHHHTPSP
TLGQHNDEVLRAMGLSDDEISTLRQDQVIGERLLNS
375143241YP_005003890.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMSPRSLPYPVFDIDNHMYETKDALLKYLPKEHKGKVGYVEVNGRPKLVVK
DHISHMIPNPTFERVARPGSAEDYFLGNNPEGLNFREFIGEAMNVIPAYQ
EPGPRLELMDELGIDQCVMYPTLASLIEERTTDDVVLTHAIIHALNEWMH
EHWTFNYKDRIFATPVICLPLVDEAIKEFRWCLERGMKTFLVRPAPVPSR
FGGSRSMGLPEYDPFWQEVVDANMPVTFHASDSGYQKHLMEWEGGDEYLS
FKTSTLREVVMGFRAMEDTLAALICHGALSRFPDLKVFVVENGSGWVRNL
LRLLDKAYRTMPKEFDEHPVEVFKRNVYIHPFLEDDVKGIVEIMGEDHVM
FGSDFPHPEGIGDPLSFVDRLEGLSDTAKAKIMGGNAIKQLGLAKVSV
375143239YP_005003888.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQGWEIDVREQVRQTLSDYTAATDRFDLHALAGCFAPDGVLEFTGGVEPL
KGPAAIEAGLGSAMARDPDPHRQAPTHVRHHVSSIRFGSVNRDRVEVSSY
FAVHTDVGLDHWGRYRDVLVEGDGRWLFAHRRITVDAFAAASLMR
375143237YP_005003886.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MAASEADDLRVAVREFLKANSPSHRVRELMATESGYDEAVWRQMAEQLGL
HGIAVPEECGGAGAGIRELAVVFEEMGAALMCSPFFSTVAMAIPAIITSG
DQQAMADYLPSLADGTSTATLVLNGRLDAWDPANVTLTAERDGADFRVFG
DAALVLDGHTADLVLVAATSDAGISLLVLTADADGMTREPLATLDRTRKL
ARISFDGAAAKLIGDEGAAATGLARTFDLAAVALASEQVGAAQRCLDMAV
GYAKERIQFGRAIGSFQAVKHRCADMLVLVEGARSAAVHATEATDGNDLS
IAASVAKMACSEAFLHAALDNMRIHGGIGFTWEHDAHLYVRRAKATQLML
GSPDFHAERLARLVTSSSH
375143235YP_005003884.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MADEDSADVDLDLLRESAHEFLIGRVAHDSIKELAAMDWTGLLVAENLGG
SGWRPVEATVIAEELGRVQNSSTWFGCVLSAAAFASAPGDVRDRWLPPML
DGTASAGCALSGDTVRVASGDAIEILVTLGHNGVHLFELSDAIVRSPDDE
LLDVSRAAWRVDVSAADSVLIGGPERAELLLATARVLLSADSLGALSATF
ERLVSYLKERIAFGVPIASFQAVQHRLVDLLVFEAKARAVIMKAARALAS
DDVTEDAIALSAAAHAFVNAKATAAVDECMQLSGGIGFTWEYPLHHELRR
VFTNAYLLGTARASRTLLADKAGW
375143233YP_005003882.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MSATYWSLVEEAAASHPDRIVLVDDFGRSLTNAQLRDAAASTAAALAERG
IVDGSVVSWQLPTTLETMVVMVALTRLGAVQNPILPIWRESEVRFVTAQL
GTEVIIVPGVWRGFDHVALADELARDQPMTIVVVDHGAPIADGLRLPAGD
PTSLPAPPTEATLPRWVYYSSGTTAAPKGVRHCDRSVIAGSAGVVGMFGA
SNSDVNPIAFPVSHIGGAAMLAASLLTGMRLVLFDAFDPVLTPKAIAGHR
PTMLGSATPFFVAFMAAQREHGAEPLFPDLRGCVGGGAPITAELGRQVRE
TLSVAGVANAWGLTEFPVVTSPPPDGSPEVLDHTVGRPVPGVTVRVVDDN
EHEVGQGEEGELRLKGPQCFLGYVDESLNADAFDADGWFRSGDRGRIDAD
GNVVVTGRIKDAIIRNAENISALEIEGVLATHPAVADVAVIGVPDSLTGE
RVCAVVVAEPEADLTLQHLAQHCQAHGLSKHKSPERLELVDALPRNLTGK
VLKNELRARFRQPTPGP
375143231YP_005003880.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSGSDRDAIVAAYDKLDAAYDEVAALGYDAVTVPERLTLLHRLEEMRRR
QPAVEHKLIHGLLSCVAPAELGAKNWSEVLQQRLRISAPDALRRLDEAKD
LSPRTTLTGESLEPLLPNVAKRQAAGELGGEHVRIIRKFFHSLPAAVDYQ
TREGCEETLAQVAAEHTPDVLRKAADRLAALVNPDGEFNDIDRARRRHVT
IHNQGIDGMSKISGLLDPELRATLDAVFAKLAAPGMCNSDDDIPCIDGDP
STKAKSADTRSQGQRNHDALKAMGRSLLASGELGQHNGLPVTIIVSTTLQ
ELESATGNAVTGGGTLLPMRDVIRLASHAHHYLSVFDKHTREPLYLGRTK
RLASAGQRIVLHAIDRGCTKPGCTAPGYLCQVHHAELDWAEGGLTNITDE
TLACGPHNRLVMEGGWRTRKRRDGTTEWIPPPHLDSGQSRVNNYHHPERY
LLAAEEESE
375143229YP_005003878.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMRAVVLNGGRLQVRETADPVPGQGELLLKTLSTAICASDVHFMDHPELAI
DDPTGRSLYDEQRDIVMGHEFVGEVIGHGPGCSDAFPIGSRVTSMPIRLV
DGGAGGLRIIGQHPEAQGSFGELLVVPEATAKVVEGPVSSDAIAVVDAFA
VGEFYVRASRLQPGEVPIVIGAGAIGLSAVAALSARGIEPIIVSDYKADR
RELAAASFGAHALVDPAQRSVFDVFREVRAERHLGGSAVVFECVGASGLI
DSIVKEAEFSSRIYCAGGWYTGDTLDITEATRNGLTLQFGGGPMPQDWYG
VLDAVVEGRLDPLPSIGRIIGLDDVPEALDQARRSEGPPRIVIHPNGDVA
375143227YP_005003876.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MTDDFATKYGPWAIVVGASDGVGALFAERIASEGVNVVLVARRRHVLEDV
AEGIRERTEAQTRTLPVDLTDADASKKIIDATADIDIGMLVYCAGGDPNY
QPFLSNPVSAAESLLQRNCLVLMRLCHHFARPMVERGRGGIVNFTSGAAL
AGGRNMVAYGGTKAFDMVFTEGLWVELHDKGVDVLGLVLGMTDTPALRKL
EYERGRLASLDEVPTGAVSAASVVDEAFANLGNGPTVATGDDTRMAFELF
KSMSRNEVVQLIMQMSTEVMGTDERPGS
375143225YP_005003874.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSDRVALNKEIAFQKWEGYAKPIDRGRHVNFGEKFVLAPDYVMMSPHFN
DGAPQTAAEMFSDEVAAAMAEYAPDGDMLTAEWRMWWKHMPDYRLVSPFD
CVAGEWGFLSCDTYAGTLADGTVLTLREWDYIWVDKEGQVTRWDWFVDPE
PWDRMIGLIGLNPKGLTSQEYTVNFLREGAVAG
375143223YP_005003872.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTEPKAFEVWDADNHMYEAVDAYTRYLPEKYSDALKFVEVNGRKKLQILG
VITETIPNPTYEVIPTPGAWADYFRGINPEGKTLRELAEPIRCPDEFRRP
DLRLALMDRQGVDGAVMFPTTAGMLEERTKSDTELTHAVTHAFNRWLLED
WTFNYEDRIFAVPAISLNDPALGVKELEWCLENGARTVLIRPAPVPRADG
TSRSAALPEFDDFWRLVESAGISVQMHNSDSGYERYVDDWEDASEFNGFA
LSKLRGFIYEESRNIFDTLAAFIAHGVFERFPGVRIGVVENGGSWAHRLL
DVFDRVYRKRPYDFSEHPNDVFRRHVWINPFHEEDMSHLVELLGADRVMF
GSDYPHPEGLAEPVDFVKELSGLPADTTARVMGGNLKELIGI
375143221YP_005003870.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MSLDDHTVLVTGSGAGVGRGIAMALASDGAHVIVATRSENGLAVANEITA
RGDAATWARCDVTDRDTVIGAVDLAVATTGRLDAVVHNATSNASSQPHDL
AGVDRSLWNDHFSVSLRGAHHCAVSAFDALQKQGGTFIVMTSPAGIEGSA
TLPLYATMKGALRGFAKSLAREWARYGITVNVVSPLAYSPAMTAAIAAEP
AMEERLSRRIPLGRIGDPERDIGAAVAWLVGPAARFVTGQTLGIDGGHYT
NL
375143219YP_005003868.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium rhodesiae NBBMSTVLVTGALGYVGSQTVARLHEQGATVVPTDIDTPANRKAARRLPSGIS
VRWADLTERGHVTRLLTDVAPAAIVHLAAVIPAATYLNAKLSRKVNVEAT
RLLVEAAEQLSQRPRFVHASSVAVHGSRNPYHNRILTADSPLNPVDSYGA
QKLAAENIVRQSGLEWLILRLGAVVSTDVRSLPVSADVMFLEWSSPSDGR
INTVDVRDVAAAFAAAVGSNVSGEILMIGGDDSHRQLQGDMGPAVAEAMG
LRNVYPRGRPGNPNDDSAWFVCDWMDTARSQEVLDFQHHSWPDMLAEIRT
RVGALRYLLTALSPIARVVLRRRTPYRGQPGIYADPWGLAYQRWPGARPD
375143217YP_005003866.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMTYERLIVERRGPVGWIINNRPDRLNAYDVVMREEFPKAWAELDADPDVR
VIVHTGNGRAFQVGADVEELDGEAVLQFQETMRTLDLKLTGWHCNVGKPV
ITAVNGVCAGGGLHWVADADVVIASSDATFVDPHVSIGQVSALETIALMR
KMPAEAVLRMALVGSHERLTAQRAYELGMISQVVDPPEKLREVAQELAEK
IARNSPAAMRATKRALWGALEYGLTDACREGAKHLTSMWGHPDQNEGPLA
FADKRTPDWQPLESDS
375143215YP_005003864.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTALSITEATSADDAVAEVRRWIDSEVPAQWLSAAAEGPDALRAVRSKED
YRQWYPTYAASGLVVPTWAPEHGGLGVGNEVARAIDRVLSPLRLARLNPL
GLNNAAAALFSHGTEEQRLRFLPPIVRNEEKWCQLFSEPGAGSDLASLAT
RAVRDGDDWVITGQKVWTTWADEADFAILLARTDPEAPKHKGITYFLLDM
HQPGVEVRPLRQITGEAEFNEVFIDNARIPDAHRVGEINDGWRVSASTLS
SERQMVSGSGSGGMGRLGGSSAQRLITLAKETGKWTDPVVRNKVMRLWAQ
EQIRAWTNTRVRAALSAGQSPGAASSIGKVHQATLNQQIQDLMVDLLGAE
AIAWPASEDPDALPRDVQGMMRSLANATEGGTTDINKNILGERVLGLPKE
PDPWKGKPWKEIPRS
375143213YP_005003862.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDPSPASSPTGRITDEGLARLRATIGIAVPHTQPPHYFRPNEDAFRHIA
ESYGDANPLWADPDYAAKSVWGEPIAPPALVGGDTLIGEDEVTTLSDEDR
ALTKGDPLRGVHAFYASSSREWWAPLRANHRVFRRNALVAALDKSSEFAD
RAVHEWSAQVFRDDEGVILGGQYRNMIRTERTKARSRKKYDAVELKTWTA
GEIAEIDERYAREVARGAEPRWWEDVDEGDDVGPLTKGPLTVTDMVCWHV
GMGTGMYGVRPLRLAWRNRQRIPRFYTPNEHGVPDVQQRVHWEPDAARNA
GNPTTFDYGRMRETWLIHLCTDWMGDDAWLWKLDCEFRLFNYVGDLHTIT
GKVIRKYLADGDRPAVDLELAATNHRGEVTAPGHATILLPSRERGPVRLP
DPPGGATDLAELLTAVSAQFFGR
375143211YP_005003860.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MPSLAFDNQVAIVTGAGGGLGRCHALELARRGARVVVNDLGSAVDGSGAS
ISAAQAVVDEITAAGGTAIANGDSVATEDGGAAIVAAAMDAFGQVDILIN
NAGILRDAAFKNMTAEQFDAVIAVHLAGTFNVTRAVWPVMREQNYGRIVQ
TSSGTGLFGNFGQANYGAAKMGLVGMMHVLAIEGARSGININAIAPIART
RMTEGIMGEAGKALDPELVTPVVVYLSHRSCDRTAHIYSVGGGKVSRVFI
GQTKGIEDADLSAESVAEAIDRIDDSSSYTIRGGP
375143209YP_005003858.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMNKEDMILISVDDHIVEPPDMFKNHLQKKYLDEAPRLVHNPDGSDTWQFR
DIVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGCYKVDERVKDMNAGGIL
GSMCFPSFPGFAGRLFATEDHEFSLALVQAYNDWHVEEWCGAYPARFIPM
TLPVIWDAEACAAEIRRNAKRGVHSLTFTENPAAMGYPSFHDFDYWKPMW
DALVDTDTVLNVHIGSSGRLAITAPDAPMDVMITLQPMNIVQAAADLLWS
KPIKEYPDLKIALSEGGTGWIPYFLERADRTYEMHSTWTGQDFGKQKPSE
VFRDHFLTCFISDHVGVALRNDVGIDNICWEADYPHSDSMWPGAPEQLDE
VLKEHHVPDVEVNKMTYENAMRWYHWDPFTHITKEQATVGALRKAAEGHD
VSIQALSKHEHGGGGASDWQSQMSKVAQNSAGKD
375143207YP_005003856.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MPANRVALVGAALSDCGRVPDKTAMGLMAQSSIRAIADAGLTKDDIDGFG
AHGTLLPPVEVSEYLGLRPSWVDATTVGGSSWEVIARHAAAAIAAGEIDV
ALLTYGSTARSDVKRRVRASAAAMGTGGAMQYEAPYGATLIAKYAMAARR
HMIEYDTTVEQLAEVAVAAHEWAAMNDNAFERDRITVADVAAAPMLADPF
TSKHVCLRTDGGGAVVLASERVARDCAKEPVWILGSADATSHVSMSEWGD
FTTSAAAVSGPQAFARAGVSPADIDVCQLYDSFTSTVLLTVEDLGFCPKG
EGGPFIASGALRPGGALPTNTDGGGLASCHPGMRGMFLLVEAVRQLRGEC
GPRQVDDARLACVHAMGGFFTHSATMILGTQ
375143205YP_005003854.1 Taurine catabolism dioxygenase TauD- TfdA family [Mycobacterium rhoMPTAIYTDQVTDSMAWTGADFTSKEDFAFDLSARNIAALESILVKTSHKD
RDDITPDDARHPDLDDDLARLYRDLMFGKGLACVRGFPVEQHSIEDLERI
YWAFCTHLGYLVSNNSFGHRMVRVQEEILPNGVQPARGTKSRAELAMHND
AADILSLLCVYPAAEGGESQFASGPAAHNRILAERSDLLDVLYQGFPHHR
RSEQPDDQPDVTPYDVPVFSQIDGRICINFTYSSILPAMKTLGREFTAEQ
EEAIELLRNILVEQQVEFRLESGEAAVANNFAMCHSRSDFVSSNDPKKAR
CFLRAWMEVPREDRRLPIGREYFHMENKDLRLGYDPVEGRDGTIARNDYK
NVDPALADMFKAAQAKPKARQ
375143203YP_005003852.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMGFLVSAPVPQWFWREEADPVSKYDTIEVEVRGHTACVTLNRPEVLNAIN
DEMIAELAVAYAEIEKSQDIWTMIITGAGRALCVGADVNKAADHDMENAA
GIDNQGEPILSSMRQWDAPQEATPPWMQMTKPIICAVNGIACGAGMDLVT
TADITIASEHATLMDPHVSIGVTSGREGVRLARILPLPVAMRLILMGKHE
RLDAQRAYDLGVFTEVVSHETLMDRAWEMAEVVNSNAPLAVRGSRMAVRK
GMNLPIYEAELLAENYRMKVALTKDAIEGPRAFLEKRNPDWKAL
375143201YP_005003850.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTAKKRAGRNPEAGLEVVDNDVELSGSWQERTIERRLSQARARALARSSR
FLAAALELVEESGKADFTIQTLIDRSNLSLRAFYQHFAGKEELLLALYEN
ATSQFIEGIRQEVAAADGPLEQLEAFCRGFLSRAESSEAIGGRVMTIYNL
SLEIERPDDFAKIWEPHQKLLTKILTACSRAGLVRKDLTPAQLTTLLNST
LIALAQIGVFHLGVKGAELNEDQLWAWCLQALAPPAVKPKPAATKAAPRR
TTARKTNKLTG
375143199YP_005003848.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDLSLSGEQRQLVDSFAAMYARESTSDRVRAAEPLGFDPKLWKALLETGV
IEMAVDEAAGGWAASEVDLALIAEQYGRAVASAPVIESQVAARVLAGCGE
PGAELLRHALAGDKLISFTPRRGYGDSLKLVPAGAVADAVVALVDGRVVA
VPVTENRCPVTNLGSLPLADITIDDAAVLAEGEDARRLFEAALDLWLALT
SAALAGAAKKAVELGVEYAKQRHAFGTAIGTFQAVSHPLADSATAADGAR
LLALKAACAFADEPERAGELAAMAFAFAYETARDATNRSLHIHGGYGFGM
EGDIQLYYRRSRGWAMVYGEPAVALDRVADARYGAVAG
375143197YP_005003846.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMSDYRFLKWETFDDGMIVRISLNRPEQRNAQNRGMLVELDEAFGRAEADD
KVRVVILAGEGKMFSSGHDIGSKQASAEFRPGPDQHPTAAINGGTREGAE
KIMLQEWHYFFQNTLRWRNLRKITIAQVHGDVFSAGLMLMWACDLIVGSE
EVRFADVVGTRLGMCGMEYFGHPWEFGPRKAKELMLTGDAIDIHEAHRLG
MVSKVFPRDELADRTLDMARRIGEVPTMAALLIKESVNQTVDNMGFYNSL
QSCFTLHQLNHSHWVGVRDDRRAVAGPENGVPDWRTAPPIVLSVKDQVRV
ES
375143195YP_005003844.1 nitroreductase [Mycobacterium rhodesiae NBB3]MSPHEVPRVSDDLWTVMNSASAVRRYRDEPVPDDVLEKCLLAASWAPSGG
NGQPWKFVVIRSPELREVITEAARQTWEVMKDFYRLPTVAEDADDPKSRV
LRAMAEHMHVGGGAPELVLFCVQPQRGTTEMQQAGSIFPAVQNFLLAARA
QGLGAAITLWHGHCEPELRAAIGIPDDWKIATLLTVGWPAGGHHFVSRRP
LPTAAVIDTWETPWSTNEA
375143193YP_005003842.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MQLRDHAGSTKAAVLLAPSGTVVTFADLEARANRMAHFLRRAGLAPGDTI
AVLMENNEHIHAAMWAARRSGLYYTLVNTHLSAAEVAYIVTDSGAKAVLS
SSAMRPLCEQLSTSELAAAVVVDDDLDGWQRYPDCVAGEPETPIADECDG
LLLQYSAGSTGRPKGIRRPLSSASPKLTTPVFEALGVTEDAVYLSPAPTY
HTAPAMWTMAAQAVGATTVVMERFDAELTLESIERYGVTHAQFVPSMFVR
MLRLPHKTRRRYDLSSLQRVVHAAAPCPPDIKRQMIDWWGPIVDEYYGSS
EGAGISFIRAEEWLERPGSVGKPMLGEPHILDEHGIELPVGEIGEIFYGG
GYPFEYLNDQAQTMNSRSAEGWVTVGDVGYVDGDGYLYLTDRRNHMIISG
GVNIYPQETENMLISHPLVVDAAVFGIPDDVMGQAVKAVVQLTDPARASA
DLAADLMTWLRDRLAHYKCPRSISFEAQLPRTDAGKLYKQRLIDKYS
375143191YP_005003840.1 PTS system glucose subfamily transporter subunit IIA [MycobacteriumMVGSTEVFAPVGGRAVPLADVPDPVFSAGMVGHGAAVDPPHEVLEAVAPV
SGKLLKLMPHAYIVMTPHGVGVLVHLGLDTVQLEGEGFTTHASQGDDVTA
GELVITYDVPSVVAKGLNPIVPVVVMDEREAANIVASEAVFEGTQILSGA
ALFVANR
375143189YP_005003838.1 N-acetylglucosamine-6-phosphate deacetylase [Mycobacterium rhodesiaMLLTADTLLTGRELLRPGWIEISGGRVGAVGTGTPPRAVDRDLGLVTLAP
GFVDTHVHGGGGTNFSAAERVDTATAVEFHRRHGTTTLIASLVTESPENL
LHQVIELARDTGDGVIDGIHLEGPWLSTVRCGAHQPTLMRDPDPAEVDRV
LAAGAGTIRMITIAPEREGALVAIQRIVAAGVVAAVGHTDASYAQTRATI
EAGATVGTHLFNAMRPINTREPGPVIALLEDPGVTVELITDGVHVDPALY
RHVTRSAGSDRVSLITDAISAAGMSDGSYQLGPLAVDVVDGVARVSGTPT
IAGSTATMEHQFQFAVRHSGLPHEEALMAAVCMASINPARALGLPDAGLV
PGTAADLVVLDSDLTVTGVLRHGKWVIEPGGAGSADSVRN
375143187YP_005003836.1 putative esterase of the alpha-beta hydrolase superfamily [MycobactMEKPVAEPVVNRLGRREVALDLAEAVEDEVVDSVGAVDLPSAEPALLLQK
MENKLVRHHLAKPDVLSVEELRRLRYLLNFARLADFEPGAAGPGGNRGRG
DVSVGAELASWRAKVADALHGPLREERDPATALGRARDALTALTEEQDEQ
RRSLIDRHGNDFSAAELDAEVGYKKLVTVLGGGGGAGFVYIGGMQRLLEA
GQVPDYMIGASFGSIMGSVVARALPVPIDEYVAWAKTVTYGAILGPERLR
RRHGLAGLFSLRFDEFAQALFTRADGERMRLSDLAIPFDAVLAGVRRQPY
AALPSKFRRPELAALQMRSLPFRPIGIGPQVARRLWQVSAFIDVRVVKPI
VVGDNDLTRDFNVVDAASFSSAIPGVLHHETSDPRMVPILDALCDDKDVS
ALVDGGAASNVPVELAWKRVRDGRLGTRNACYLAFDCFHPQWDPRHLWLV
PIAQAVQLQMVRNAPYADHLVRFSPTLSPANLAPSARSIDRACAWGRKSV
DKAIPVTTALLQPTWWEGDRPAVPGAETDAPPKSVASPMSAVMAAIHEPA
NRLARWRSRRLT
375143185YP_005003834.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MARPPDRERRQALLDAIVEEVAVRGIGDRSLRDVAAAVGTSHRMLLHHFG
SRDELLLAIVDQVERRQMALMGELPDDPADAIAAMWTGLTRPELRPFERL
FFECYARGVQGEQPFARMLPAAVYSWLENDAARMVDPATMRLGLAVARGL
LLDLVATDDQEGVDAAAAAFVELVRRTGV
375143183YP_005003832.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDVNRVAELQRWQDSGAMWEVISRRGDTVTVALLRCDGGEEMDRFTSDDS
RLLAFIGDRRSSAD
375143181YP_005003830.1 acetyltransferase- ribosomal protein N-acetylase [Mycobacterium rhoMTDIDQAPPPVLPRELTSIPDEVRAVGAPPTPRLAEPYSVRLVDAAGDAK
MVSEWMNRPHLVEAWEYPWPPDRWQRYLQAQLDGEYSRPFIGSFRGLPFV
YFELYRAAKDSIAPRYDADPHDIGLHAAIAEMRFVNRGIAPIMLPRLVAS
IFELEPRCRRIMFDPDHRNAGARSVCEYAGGLFLGEHDMSNRRMALYALP
RSPSDAPDVD
375143179YP_005003828.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MTELGDALSAAMRGSPNRLAVLDPAADKWVHHPWQEVHSRSENVAARIAD
DGSSAVGLVGEPTVEFLAAIPGSLFAGAGLSILPGPIRRADPRQWAKSTV
DRWRGIGVTTAFSHGAELDLLREHTGGIVVHDLAEVAHIHRSTTFEGPRT
ADVAILQGTAGSTGIPRTAQIPPSAAIANLRGLMHRVNLDVNCRMQSWLP
IYHDMGLTVMLVSLLGQADLWQAPTKSFAGNPFAWLKWLDESRATMTAAP
NMAFNVIGKYGSGLSDLNLSNLGFTLNGGEPVDCEGYARFSSTLAPFGFN
PNSLSPSYGLAESTCAVSVPEPFLGLRVDEVAVKTDGGESIRRFAVLGHP
IDGMEVRVNSDQPHATEVTGREVGEVEVRGTSLMTGYVGQTPIDREAWLR
TGDLGYLTDDGLVICGRAKELITVAGRNIFPTEVERIAGKIEGVRDGCVI
ATGTGEATARPKLVITAEFKGDDETAARSAVVERVASECGVVPADVVFVK
PGTLPRTSSGKLRRLEVKRNLEGAGR
375143177YP_005003826.1 crcB protein [Mycobacterium rhodesiae NBB3]MSDDTHAQLPIDPDAPAKPIRPLHLRPWAMAWIFAGGVVGTVLRYYIEKL
LPHDGSSWPWGTFLINLCGALVLGGLLEGLVRLGDDAGWRLRARLCAGTG
FCGAFTTYSTFALEIVLLGRHGYLGTAISYGLLSVVGGVITAWLGIVIME
SVHRRRTRA
375143175YP_005003824.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMADTSDGESPMSSAELVVGWDNQPASAAALRFAVGLARRLDAHLHVVHIA
DVADLPVDPDASDYEQQFQASIEAHAVGARALLDGLGAKWTYHAMHGRPP
DVIADLAEEVDAVMIVLGAPRGGVHSFIDTFAGQSVAHQLTRTQGRAVLL
VPDRSPE
375143173YP_005003822.1 phosphoglucomutase- alpha-D-glucose phosphate-specific [MycobacteriMANPRAGQPAQPEDLIDVAQVVTAYYTVEPDPDNVDQQVVFGTSGHRGSS
LDAAFNEAHIVATTQAIVEYRHAQGTSGPLFIGRDTHALSEPAWASALEV
LAANDVVAMIDSADRYTPTPAVSHAILTFNRGREGDLADGIVVTPSHNPP
RDGGFKYNPPNGGPADTDATGAIAKRANEIVRNGLMDVKRIPLASALKTV
QRHDYLDAYIADLPNVVDLHAISAEGVRIGADPLGGASVDYWGAIAERHN
LKLTVVNPLVDATWRFMTLDTDGKIRMDCSSPNAMASLIANRESYQIATG
NDADSDRHGIVTPDGGLLNPNHYLAVAIDYLYTNRPDWPASTAVGKTAVS
SSIIDRVVGGLGRKLVEVPVGFKWFVDGLLSGTIGFGGEESAGASFLRRD
GSVWTTDKDGIIMALLASEILAKTGSTPSQRYNDLAEKYGAPTYARIDAP
ANREQKARLSKLSAEQVTATELAGEAITAKLTTAPGNGAPLGGLKVTTEN
AWFAARPSGTEDVYKIYAESFRGPEHLAEVQEAAKEVVNKVIA
375143171YP_005003820.1 site-specific recombinase XerD [Mycobacterium rhodesiae NBB3]MNSDDTRARQRGERTDNSIKRLPGGKGWRARPTLGTDPVTGKQVRPTKVF
RTKGEAAQWVNEQRQQWGAATWAPKSNQTFDEVADHWLKLREADPSIGPN
TVRADRESLAYARHAFGAIPVQRLTPAALADWSATLTGKGAKALAPATKR
RAIVRLKSVMAHARKMRWLTYDPSADLTSPEQKAVTATAADDIWTPEQMG
KFLDHVAAHRLAGCYALTLLGLRREEVGGLRWSDLDLETGALRIRQARVD
VNGRDMIVPTKTDRSARDLPVPQRELAMIKAMRSVHLRERLAVGRPLAEA
DLLLSRPDGTPLPVRDYSREFAAQRKAAGLRAITLGKLRHSNISRMRAAG
VAADVVAAWHGHTERMTQAVYGRVTDDRLTAASAVFSAAVGQS
375143169YP_005003818.1 excisionase family DNA-binding [Mycobacterium rhodesiae NBB3]METVTTAPNLTTLNELRSGPPTLSIEQAARYLGVSRAYGYAMAREGRLPT
IKLGARRVRVPALALLKMLGGED
375143167YP_005003816.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTARSQTTAHNDSPYANEPASIKRAKADQARDNSEQLAADHYRARADAST
SDGATAAADALADLRKVMADNADVLTSSGVLAHVARFAEARGAERYGVLF
GVAMRAVLAVPPQVVLPPTIGGEVSLNLLLAVVGSSGGGKGTTDKTAAAA
VRVSLGGRRSVPVLPMLPIGTGEGINRTYAHAERDKLGSGQVGLRWHTDR
ALFACRDIATLDALTARQGSTLVPELLKAYMGEELGFANADKDRRVILPM
HTYRLCLSAGVQPDNGAVLLNEQSQRDGVPQRFLWSPVRPGVARPRRSAD
AKAVDPLTVEVPDFGIDPMRFDVDEDDDADASLYDPAAQTLVPIGVGSSI
AQQIIDADTAKDLDPFGRSVDPLAGHRLLARLKLAAALAVLHNTPNVGPQ
DWQRAECLMAVSAAVARVVAAYSDAAAEHDAVRQGQLDGHRLAAADDTRQ
TAALQTVMSRLTRYLSEQTDWVSRGAVTRSVTGKLRRDLPDALLALLDGG
SIERREVERAGQKVAQYRMRAA
375143165YP_005003814.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDPTQNKPDAHERQRALSAVELRVQGQAYAQIAHALGYSDESGARHAVS
RLLARREAEGIDELRAVHSARLEGVLSAFWPAATSGDTDAARIVLRTLDS
LAKLYGLDAPTRVAVGASLTDTVGFANEAARLIESIASMGGTDDLLLSLP
DGAGHAVIAAREPAALTEAVAVADDDAESWSNIGGPDPEPLAAEPESDAE
PEPLTVVEIEPPPVAEVEQVAEPDVTPLPSPPSPRVDPWARRVTYRYDPL
AGWRR
375143163YP_005003812.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTTAQLHYDPFDANIQDDPYPVYQQLRDDAPVFRAETANTWVLSRHEDVI
PALLDHDTYSSVNGVFPTPPDAPFLESFLPMMITMDPPRHDQLRGLVSKA
FTPRRIVALETGIDELAASLVERLTSSGSEGRSDFVADLAGILPAVVIAD
LLGIPREDRQQFRQWSSTLIQSNPARGEVAEGLAAAAAVYAYFADFLADR
RKAPRDDLMSALVAAEIDGQRLSDDELLGFCLLLLIAGHETTTNLLANAA
VVLAGHPRSRHRLAADPTLIGQAVEELLRYDSPVQGLSRVLTTDVTLHGA
TMSQGDSVLLLFGSANRDERVFARPDVFDIDRKPEHQVAFGRGIHFCLGA
ALARLEARIALGALLSRLPDWAVDVDSAVRLRSGPIRGYLSLPIMWPAS
375143161YP_005003810.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSESAAPPERLPSHTPTCMGCGPDNPHGLGLEVYRSVDSVYADVTFDERH
IGAPGLAHGGAVAAACDDVLGFTLWIARTPAVTRALTVEYLQPVPLHQPH
RITAHITAREGRALHVAAAGVQEGVTRFTANAVFVVVDTAHFAAHGDISG
FGERLEQFSRRGGGLDDDQAS
375143159YP_005003808.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MYTQWIEDCVVQRVSVRDGLVLDLDDYNEIVISRPLMLTLPAVDRFPVEA
VLIDPLRISVYERPLLNLAGAVCTRAWSDDEGGLHLSFSRGHRIDVDPDI
EETAWELYGKRHGYMACLPRGRVRVVRHDVPEDDNANIVNPQ
375143157YP_005003806.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTRVFATLALLIGAAITTAPTADADQDSYLKRIEPKMAFLTRTQILTEGQ
KVCQLIRSGHSSSDAIPMVVEDLNMSVPSAVDLIIAAVVELGC
375143155YP_005003804.1 serine/threonine protein kinase [Mycobacterium rhodesiae NBB3]MTDSTANYPAVFTQTQAKTETGESTQPPTGTFGSAFADISPSADFTQIEI
GQRLDDFDLLLELGSGAFARVFLARQLSMQRLVAVKISANKGHEPQTLAQ
LDHDYIVRVFDQHVLPDRDWRLLYMQYLPGGTLLDLGRLVFAAGPPDSGQ
ALLDAVDVALESRGESRPTESVTRAELATLSWPETVAWLGKRLAAALHYA
NSRGVLHRDIKLANVLLARDGTPKLADFNVSFSRNVSGASAFEYFGGSLS
YMSPEQLTACRPGHTLEAADLDTRSDIYSLAVVLWELLTGVKPFDDSAAQ
AARAASAELVGDTTALDLMLTTREKGITSASLDALPSDCPTALRRVLLKA
LNGDRDKRWGSGAEFAEQLQLCLDPQARDLVDPPARSWRLRLRPFILPVT
ALAILIPVMLAGAYNIQHNHLLIVSHLSEQAQHRFVLVTTVINLITFPLG
AAAVVYLCRYVILVPRRLRRGPAPPAETQARARHDCLVMGDRVVIVVAGL
SLVSGLTFPVLMQLFAGGITARSALHFFGSITVCGAIGVAYPFFLLTFYI
VRSVYPELVAHGQTDVQEAEQLERLSRRLPPYLAVAASVPLLGIVAVSFL
TAPEIAAVVVPMRVLCIGGIAAFVLAYWLSRQIESDIRALQRVIRSRAPH
DLPH
375143153YP_005003802.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAESSRDRILGEALRLFGEQGYAGTSIAQIEKAAGLSPGSGALYRHFKSK
DELLVQALQARVLDRGQWAQFLAPDFSVRAMLDLVAPDSDIIDRLMMLCR
IGLQRLDHDRDVTRILLRDNTAPQDALEVARRDEHLVVLSVLSRGLAELA
GPDRGDEDWDALAVVIQAAVAHYWLVSDVFGGEHPSTIDTDRYLRAIAEM
VAARLKAPVAEAIRT
375143151YP_005003800.1 putative calcium-binding protein [Mycobacterium rhodesiae NBB3]MIRNIIRGMLLATLVSAGFAAGASPIANAQQPYRNCSEARANGDTNIPYD
SPHYGPHLDRDNDGVGCES
375143149YP_005003798.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDDVPPLGILGDLPARDFLVSPGFAGLLAILAAVIAAAAVLYASRRARQR
SEQLRDQEERRQVQARDDALSALAWERWQWVVDNAGIEPTASEGATLGLG
PAVALELLGGLLRDAERLGDETLAKAVAVYQEQVLLVLAQQAGPVSDFAG
ATTGRPDQNRDNTATSAHRKPGASTLDAETSSVDTISDNLTEASGGRRRR
375143147YP_005003796.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSPRSGSSDLPTTAYLVLGILAANDEQLTAGEIKIRAEFSVSYFYWSPSV
SHVRRELLRLAERNMVQDSEVTIGKRTSTLYRTTDTGLAALKRWVEQLPD
TDQVVIKHPVILKTWMSKDSDATRTLDALDRHLEVTRKRLDEALWSRQRT
REVGISEEPSMRTSLAVLNYSIRSLYAELSNITQLRDEVAVGTDEDPAKR
VHRPKGQLRRTQD
375143145YP_005003794.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MPTKGRTAAIAGVYNTKQGRRLEGETTRRLIIEAIGGALDDAGLALEDVD
GITSENTASLIYDLRLGPVWQGSTFGVGMVTEAVAAIEYGLANVVVLVAA
QAQAYRDHAATAPWTRPENEFVAPWGMFTAAEFALIARRHMEVYGTTREQ
LSIVAATIRNNGSTNPEAVYAGRGPFTPDDITASRLVADPFHLLDCATTS
EGGCALAIANVDLLDSACRPAYVLGSGADFFGPSYQHPPAWDLVGRRGAH
PNGLVGRHAADMAFAHAGIDRDDVDVLELYDPFSFEIIRQLEAFRFCPDG
EGGPFVEDGHIAITGSHPITTDGGTMSFSHAGTNPQMMQRAIRAVQQLRG
DAGALQVPNARIALCSNGGAGALFTTVLLLGDEPR
375143143YP_005003792.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MTSRPGPSVESLRLESFGTRHARLLAAARRHGIEPDGMVLPAEGMFTADD
GAGIHYLEWPGPADELAMIFLHGGGLHAHTFDVVGNLLRQHARCIALDQR
GHGESEWTPGRYGSEHCADDIAAAVDRLGLKRVVVVGHSMGGIGAVEWAA
RNPPELAGLVIVDVGPELTSSATASINDFITSRPTYAGVEDVESDSLAAN
LRWGDDGRLGSKYDDSQFHPGATALPMDDEMRALGRRIACPTTILRGERS
KVLSDEAAASFAADIDGADWQCISGAGHTIQSSNPRGLADAVLHFLERLR
375143141YP_005003790.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMHKDDLILISVDDHIAEPADMFEAHVPAAYREFAPRVVLEDDGTQQWYYG
DLRGRNMGLNAVAGKPREMYNIDASSYDEMRPGCFNVDERIRDMNAGGQL
AGLNFPNWTGFSGQVLNQGPDRDINLVMIKAYNDWHVDEWCGAYPGRFIP
CGILPLFDVEEAAKEVKRLADKGCHAVTFSENPEALDMPSIHTKHWYPLF
EAACENKTVLCTHVGSSSRAPMFSVDAPPSVNMTGSSMMSMYTLTELIWA
EFYSDFPDLKFSLTEGDVGWIPYFLWRAEHVLNRHSGWTEPKFPKGYSGP
TDVFKRHLYTCFISDKVGVQNMDWFNEDMLCWESDFPHSDSNWPFAPEDV
IETMGHLDDRVINKITHENAMAAYSFDPFQHIPPEHARAGHLRSQATDVD
VVTHVGRRASQRDRDAWARMTAFGQARTAEAAGIAQRATTLGR
375143139YP_005003788.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MTAAFDSTLAHNAFEAVRPAWTPGDHCVERTVTTSDGVALAVRDYGSDRA
DAPTVVLLHGLCLSQESWEPQVCQMRRRWGNRIRIISYDHRGHGRSADAP
MSTYRIEQLAADLSEVLTALRVTGPLTLAGHSMGGMTALAYFARPASHRP
VEPQGLVLVGTAAGGVAERGVSRLLATPATVAVFGLVDRMPRRATENVVS
AWLRPVGAALSRCAGNAAVALAADAVRTASLTTATGFLPSLKSYNAYGVL
ASIAAKTIIVSGGTDVLTPASHSRDMAAAIPDAIHLHHPAAGHMLLQDAS
DCVGNAIARAMDMFGRSGRAARAGLSRSCAGHLAVIVS
375143137YP_005003786.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDNVLDLFDQTVFDGERATGATNLLQVVWVYNQAVDIDGLRRFHGHLQQG
RLSRRIERSPLPFGRHRWVSPDNGPELEIVSTPRPREEFDAWLGAQAGTP
LDAEHGPGWHLAVLPFTDGGAGVSLVISHCLADGVGLCEALADAASGRRD
PVAWPAARARRLWQAVCEDGRQTVHDIPAIRRAVAAAAALARRGNEADTS
DTPAPAVPTVEVDEVVSLPTATVFVDADEWDSRAAALGGTANSLLAGLAS
RIALRAGRLSADGSVALTLPVSERTADDTRANAITNIDITVDAHAAALDL
RDIRTTVKQALIRSKDVLNERWELLPIAPLLPQWLIRRCVGVSAGSASSV
ISSNLGVVDPAAHRPDGTDADQFIIRTLGPGVTKATMHRLGGLLVVLAGR
AQGQVFVSVLAYQPGDSNTNNDLRRNLSGALSDFLLTSTTGWSCPESVGA
AG
375143135YP_005003784.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSNVLDLVDQSFFRLGQASGVGQCVWVYNRAVDIDGLRRFHEHLQRGRLA
RRIERSPLPFGRHRWVTPSDRSELEIVAIPRPREELDAWLIEQAATPLDP
EHGPGWHLATMPFTDGGAAVSLVLTHCLTDGIGGCVAIVEAACGYDIAIE
WPAAGSRRKWHAIRQDARQTMRDMPAIGRAAIAAARFARRNRGSAPAPVP
PAPITGGDELVTLPTATIFLDADEWDARADALGGTGNTLLAGLSARIAER
LGRVAVDGTVNVAMPVNERTADDTRANAVAMVDVMVDPAPAANDLREIRT
STKEALIRHREVPDERQDLLPLVPLLPERVTKRMASVATGGTTNVVVSSN
LGEAPAPVNQPDGTDADYVALLSRYPAVSKTMIDQLGGVLVVHSGRVHDQ
VFVSVLGYQPDRPNSNDTLRSNLVSALGDFSLAPVTGWECADAVDALPAV
375143133YP_005003782.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MARRIEYSGELCECGEPMFSRVVTLGVGVESRRGPTCWLDECWVHRSWLQ
AADRRAAARNALLMS
375143131YP_005003780.1 cellobiohydrolase A [Mycobacterium rhodesiae NBB3]MISSAAHAVARLLVLAVAAIAGIGLLADPVGQTSAVRLASDANPLLGAPF
YVNPGSAAMRAANAAEPPNPQLRAVADTPQAYWLVPGSSAATVGKYTADA
AAAGSIPVLSIYGIPHRDCGSFAAGGMASGDAYRGWIDGIAAQIGGSRAA
IVLEPDALAMADCLSDDQRQERYDLIRYAVDALTRNPAAAVYVDAGHLRW
HSPEEMASRLSQAGVEHARGFSLNVANFFTTEEEIGYGEAISGLTNGKNY
VIDTSRNGNGAAPDSPLHWCNPSGRALGVAPTTATAGAHADAYLWIKRPG
ESDGSCDKGDPPAGTFVNQYVIELASNAGR
375143129YP_005003778.1 membrane protease subunit- stomatin/prohibitin [Mycobacterium rhodeMKKSAVALGLSLVILSGCSYASVGAGEQAVVVDGYWMIPTDPTVKGCIEP
ENSQNEITNHVYRYPARQISWDATGDPGSERGPYVVVSNAKAPADMNVPV
VVTFDLTTDCEKLKQFHRDFGTKYNGWLNDDGTVSAGWVELLNYVIGQPL
QDTLNGVAQKYTWQQIWNDEQARTEFRNALLRSLPDASKARTNGVDFFTN
FQVTVLKPTPVNPELKAAIEREQAAIQNAQATQAQGVAEANAKKAKAEAD
LAAAVAETKVAEQEALKRAAEVKGYPSVEDYLRAEAIKQGLNPYQPTYVV
PQAG
375143127YP_005003776.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium rhodesiaeMSRASRVLVLGSGFAGLWAALGAARRLDELGAQDAVDVTIVSSRPFHDIR
VRNYEPDLSACRIPLPDLLDPAGVGHLTADVTAVDPTRATVGTAGGATLA
YDRLVLAVGSAVAKPNLPGLAEFGFDVDTYDGAMRLQAHIRDLAGRPADA
STRTAVVVGAGLTGIETASELPRMLADVLGSGATPRVILVDHNPHVGSDM
GESARPVIEKALADNDVESLTGIGVTAVDARSVTLSSGDIVPAATLVWCA
GMRANPLTAQFGVPRDKLGRLPVDDYLRVEGVSGVFAAGDVAAARMDDAH
MSVMSCQHGRPMGRYAGYNVIGDLLGASMMPLRIPWYVTVLDLGPAGALY
TEGWDRRVVSTGAEAKATKQVINGRRIYPPLTGDRAALLAAAAPDLQAAP
TYGD
375143125YP_005003774.1 2-nitropropane dioxygenase [Mycobacterium rhodesiae NBB3]MPNRVQTLLGVDYPVVQAPMTYIARAELAAAVSEAGGLGMIETLTPEGRA
DLLRVRSLTDRPVAANLMIQGWKGDPSIVDTLAAAGVRHVFTSAGDPALF
TARLHDSGMTVVHVVGSLRAALKAVDAGVDALVVEGVEGGGFKSALGAST
MVLLPLVSAHVDLPIIAAGGMCDAQSAAASLVLGAEGVQMGTRMLASRES
LVHMNFKDAIVAANDAGTVLLDIPGNPTMRVLRTGLAARVAAHDPNAKLL
GKVTELYFGGDMDASVANTGQVSSRIAGLLPVAAIVRNTWIEIEKALDAA
RTRAG
375143123YP_005003772.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAHRKPIRVFQVATGNVGSEMIKRIADRPDLELIGVHCYSPDKVGKDAG
ELAGVAPNGVIATGSIEEIIAAKPDVLTFHGVFPDEDLYVKVLEAGINIV
TTADWITGWHRDTNHPHPSGKPVSQLLREACEKGGSSFYGTGMNPGLNQI
LGVVCSADVAEIENVTTIESVDVSCHHSKDTWIEVGYGLPVDDPSIPGKL
EKYTRVFADSVLMMADCFDLQLDEVKFSYELGACTKDVDLGWYLLPKGSL
GGNYIKYQGMVDGVPRVEVHLEWQMTPHTDPSWDIKGCYITQIKGDPCVY
NKHMIFPKPGVDLSDPANFASIGMTVTGMPALSAISSVVAAAPGLITSAD
LPLRGFAGRFRL
375143121YP_005003770.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPRTDWLVGDDRRTAAAERIYAAATEMIATGGLDAFDVDALASRVHCSRA
TIYRHAGGKNEIREAVLVRVAARIIDTVREASDHLTGSERIVTAILVALK
EIRSDPLGRLMMSSVKAQEISWFTESPVVARFAREINGLAEDDSQAGQWI
VRVVLALMYWPVNDAETERQMVQRFVSPAFPSAVTSGRP
375143119YP_005003768.1 putative permease [Mycobacterium rhodesiae NBB3]MSSRGWILFLAMSVIWGIPYLLIKVAVEGVSVPVLVFARVAVGAAVLLPL
ALSRRTVEIVRGHWKALAGFAFFEIIAAWWLLSDAERHLTSSMTGLLIAA
APIIAAVLDRLTGGERLGTKRILGLAVGIAGVTVLAGPHLGGSTWPIVEV
LLVATCYAIAPLIAARYLADVPALPMTAVCLGFAAVVYAGPAAATWPSEM
PSTRVLLALAGLALICTALAFLVFFALIREVGAARALVFTYINPAVALAA
GVIVLNEPLTLWNVAALVLILVGCVLATHRRAAAPARAGSEPTHVGPASP
CAPRRRTP
375143117YP_005003766.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDLTFSAADIAFRDEVREFLNDKLTPELRRAGRLMTSVYADHEASMEWQR
ILHERGWAAPAWPVEHGGCDWSLTQHYIFSRESQLAGAPSLSPMGIRMVA
HALVKFATDEQKKFFLPRILTGEVFFCQGYSEPEAGSDLAALSMAAVDDG
DDLVCTGSKIWTTHAREANWMFALVRTSKSAKKQQGITFVLIDMTSPGIQ
IRPLVMTSGEEVQNQVFFDEVRVPKANVLGKIDEGWTVAKYLLEFERGGG
ASSPALQVMADEIATVAADQPGPAGGRLLDDPAFAKKLADARIRTEVLEI
LEYRVLAAVAEGKNPGVASSMLKVIATELSQTLTELAMEAAGPRGRVYQP
HATYPGGPVTEYEPPADDYISGEEWQAVAPLRYFNDRAGSIYAGSNEIQR
NILAKAALGL
375143115YP_005003764.1 3-oxoacyl-ACP synthase [Mycobacterium rhodesiae NBB3]MAGPMTITGIGAVTGYGWGAEQLWNGLLSGKPAAKLVGGYGSSGDEDAWV
ARVADEGDPLDGLSRSSRAMRGAAREALTDAADRGWVPGARVGLLHAVVV
SEVEGWRDFYLKDAAHRRIRDYLTLMPSTPVSMLMQEYDFHGPAMNVSAM
CSSGNAGLITAKMWLDSGYVDDVVFVSTDLSLTPENVEHFVRLGVAVVDV
EPLDACRPFQEGSRGFPAGEAAVAFVLSNRAERGYVDVLGGDMTHDAYHL
TSVDPQRTYIDGCVRNALKAANTSTDQVAYLNAHGPGTAQCDKAEGEIVD
EVLHGAPHIYSVKQLVGHCQGAAAAVELAAAALGYAHGTVPAPPTVAPGH
PRLLDGPTPLKPGAVTLKTSLGMGGHNSAVVLAPAA
375143113YP_005003762.1 diguanylate cyclase [Mycobacterium rhodesiae NBB3]MAAGGRTERNRDHYYWLTAFLAARGLQTRTCLVVAGMIISAGSIPLFTTA
SPAGASYFWGRIVAVVGAVCSVAMAGVWLRKRWPTRVTSEACVIIGSVYI
AAASVMTTNPVVGLLGSTAFAILGGFVALFHSVRLLVSMWVVGAATVVAL
AVRVAETDSVLAITGALLVGLVNVFTVFACRTLLRSITSDVRLDDLEPLT
NLLTHGAFAEQAATLMSSRDRGGDRYLMVAVVNLDSFSLYRDMAGVAAAD
RARVAVGQRLRETVRQVALIAHVSEDEFLIADVLNTDDPSPLVERVRATV
ASSPSRLTASIGVVSTAMSPLAGHPPYDVLDEVLSVATDAMHDARRAGGN
RAQLILSPALTVLKRPAGGVWSAEESA
375143111YP_005003760.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MSARLTGRVAFITGAARGQGRAHAVRMANEGADIIAVDVAGALPPSVPYP
PATPEDLAETARLVEATGQRILTYAVDTRDHDGLRKVVDEGVAELGRLDV
IVANAGITAPHAWNEITPDEWRDVIDVNLTGTWNTVMAGAQHIVDGGRGG
SIILISSAAGVKFQPFMIHYTASKHAVTGMARAFAAELGTHSIRVNSVHP
GPVVTEMGSPEMVEAIAKAAEIVGNNALLNVLTPFLPTWVAQPEDIADAV
CWLASDESKMVTAQAISVDQGSTQF
375143109YP_005003758.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MSLLTGQTAVVTGGAQGLGYAIAEQFIAEGARVVLGDLDLAATEAAAKQL
GGDQVAQAVRCDVTKADEVDALVAAAIEAFGGLDIMVNNAGITRDATLRK
MTEEQFDQVIAVHLKGTWNGTKAAAAIMRENKSGAIVNMSSISGKVGLIG
QTNYSAAKAGIVGMTKAAAKELAHLGVRVNAIQPGLIRSAMTEAMPQHIW
DQKLNEVPMGRAGEPAEVAKVALFLASDLSSYMTGTVLEVTGGRHV
375143107YP_005003756.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTRLAQTLGLTEFQTEIIANVRQFVDKEIIPVAQELEHADTYPQAIVDQM
RDMGLFGLMIPEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAY
MIRQHGTDAQKQHYLPRMSTGETRGAFSMSEPELGSDVAAIRTRGKRNDD
GTYTIDGQKMWLTNGGSSTLVAALVRTEEGADKPHRNLTAFLVEKPTGFG
EVVPGLTIPGKIDKLGYKGIDTTELIFDGYVAQATDILGEAPGEGFFQMM
DGIEVGRVNVSARACGVGIRAFELAVRYAQQRQTFGKPIAEHQAIAFQLA
EMATKVEAAHLMMVNAARLKDSGERNDVAAGMAKYLASEFCAEVTQQSFR
IHGGYGYSKEYEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRI
375143105YP_005003754.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MADTIDNLVRMHAAQNADKPMVVDTDSRTTYGELDAVTRDLAAAFVAAGV
SKGTRVGLIMPNCVQWVQIAVALTRIGAVLVPLSTLLQPPELVAQLRVAS
VQYLVAVREFRGHRYLDDVAPERSNLPALREVWDAAALPAVRDGTVDAIA
ATVTPSDTLAIMFTSGSSGPPKGVLHSHGNALGAVRSGLAARCIDSDTRL
YLPMPFFWVGGFGSGVLSALLAGATLVTEQIPRPETTLRLLERERVTLFR
GWPDQAEALARQTASVAADLSSLRPGSLEALLPADQRARPGARAKLFGMT
ESFGPYCGYPADTDMPRSAWGSCGKPFDGIEVRIVDTDDGTPVAHGSIGE
IQIRGPHVMRGICRRTHEDVFTVDGFYPTGDLGHLDDDGFMFYHGRSDDM
FKVSGATVYPSEVEEALRTIDGVDGAFVTQVDGAVGAVVISGLGAGDLHA
AARERLSAFKVPTVWLPVESDDAIPRKATGKVDVRALQQMLREG
375143103YP_005003752.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MAAHPLSRRIRDVLNLRPDGPAVEFDGAWLTRSEVAELARRIESLDSADR
QVGILLRNTPAHIAAFLGVLMGGGTVVVINPSRGDDRIRSHIESLRLPII
IGTIDDLKTLVVSTAQTATVAIAGLDDPPVVTAAEQPAEDTGRAGVAVRM
LTSGTTGPPKRIDLTYDMLARSVIGTDFDVAPSPTEARRGVAIVNAPLVH
IGGVFRVLQCVCEARPFALLDRFELQRWTDAVRRHRPQAVSLVPAALRTV
LHSDLTRDDLKSIRAVTSGTAPLSAEDADAFTDKFGIPVLTSYAATEFGG
GVAGWTLADYQTYWHTKRGSVGRATLGAHLRVVDDNGAPVGDDQPGLLEV
KPGQLGPSGGWMRTTDLARIDADGFLWILGRADQAIIRGGFKVMPDDVRS
ALETHPAVQGAAVVGRSDPRLGETPVAMVELRESADVDTLLEYLRTRLAR
YEIPTEIAIVEQIPRTPSGKADLTAVREHFTTVEHA
375143101YP_005003750.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMSFDDILYEVDGHKATITLNRPSALNALSPAMIAELRTAYDEAENDDNVW
ILIVTGTGRAFCTGADVGEIPEDGRVIYERPYLSTYDQWEAPQEGTPPFR
RMAKPVLTAINGLCCGAGLDWITTGDIAIASDKATFFDPHVSIGLVAGRE
MVRLARVLPRNIALRMALMGKHERMSADRAYELGMISEVVEHDRLLERAH
EIADVVNSNAPLAVRGTRLAIHKTLDLPLHEAEILAETFRERVVRTDDAD
EGPKAFMEKRAPNWKCR
375143099YP_005003748.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAQGAPRFGEQPLPQTVAAAGGLRRLTGLLLSLEHEHPTVDAIVAQIDEW
EQQLATAAPLDPTPRIGPQSTETQRVYLDHAFDVGAYNPCFPEYTFDNLD
ADTASGRVTFPVVYEGPPGLVNGGFLAVFFDCITQHQSCASGRTGKTRSL
TVTFRRPTPVLVELRFDVARAEADGRVTSTARLLLGDEVLCTGEFSTAAS
SPDKLSVFDFGHRRVAEG
375143097YP_005003746.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMTTTDERVLFDADREKRIATITINNPSQRNSYDAAMRETVGRYLDQVAED
DDLTVVLLRGAEGVFSTGADMNNAYGWYGDTSGSEKRAPKAKRRPSQRRR
LTVDRKSFGFYHNLMGFPKVTVGEISGYALGGGFEIALMTDISVIGRNTK
IGMPATRFLGPALGSLHMFFHRLGPVLARRLLLTGDIIEAGAVEHLGVFT
ETCDPGSVTARARYWAEKAAKMPADGVVIAKEAFRLVEQSQAYQGEEVAS
YLFHAYGTNLQFAPGEFNFVKTRAQHGTKEAFRLRDEHFHVPEPE
375143095YP_005003744.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MARQATAEKRPRRERGSINPDDIIKGAFELAEEVGIDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTDRALRQYVFATPYVEAKDWRETLRNHARSM
RKTFLGNPILCDLILIRSALSPRTARLGVQEVEKAIASLTEAGLTADDAF
DTYSAVSVHVRGSVVLQRLREKNRATAEGPSDIDEAMAIDSDSTPLLALV
TEKGHHLGAADDNNFEFGLECILDHAGRLIDEAKSTPAKKSARKR
375143093YP_005003742.1 dihydrodipicolinate synthase/N-acetylneuraminate lyase [MycobacteriMATAKDARDWARSNLRGIGNSLYTPFCGDDGDDIDWDAYRTLVRYCVGEL
GHPMLWCTSGIAEFWSLTMDERKRLLEAAIDEGRAADPDVVVQACTAATS
AKDCLELTLHAQHAGADIVYIQTPMMEAHGGEGVLNFFRYVADRSDIALG
MFNSPSSGYVLTPAESARIYEEIPAVCATKEGAFRPAASRLLHDLAPGLA
IWECDTTVYRAGWLRAGIVGPAQLGTAGYLYETPQHPVLSEYWALVWSDQ
LSDAIDYAAKSGMDQFGVDMRSWFTCYPGRPDYFTHWGGAFKYAASVLGL
PIGSYPHSRPPQAELPKVAKAQIDAAYRRFGLVGG
375143091YP_005003740.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTLDYMAIDVDNHYYETIDSCTRHLPKEFKRRGVQMLTEGKRTFAVMGGV
VNHFIPNPTFDPIIEPGCLDLLFRGEIPDGVDPASLMKVDRLSDHPEYQN
RDARVKILDKQNLETVFMLPTFACGVEEALKHDIEATMATVHAFNLWLDE
DWGFDRPDHRFLSAPIISLADPDKAVKEVEFVLSRGAKNVCVRPAPVPGV
VKPRSLGDPLHDPVWARLAEAGVPVIFHLSDSGYLAIAAQWGGKATFEGF
GKKDPLDQVLLDDRAIHDSMASMIVHQVFTRHPKLKVASIENGSYFVYRL
IKRLKKAANTAPYHFKEDPVEQLKNNVWIAPYYEDDVKLLAATIGVDKIL
FGSDWPHGEGLADPMTFTADIPQFPEFSYEDTRKVMRDNALELLGANVKA
SA
375143089YP_005003738.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMSPKAIDCLVNVHFGETEKQPEFMLKVRDDYFKGPTSLYDQVELPQLLEE
MDEHGVEKAILMDNLTKPSVTARKFVDQRPDKFALAMGGVNLLRPMPSLR
ELSAVVRDLPVAYTAVGPSFWGDGQYPPSDAVYYPLYTKCAELGLPLCIN
TGLPGPPIPGEVQNPIHLDRVCVRFPELKLCMIHGADPWWDVAIRLMLKY
KNLRLMTSAWSPKRLPDSLLHYMRTRGPDKVIFASDWPVLRMHRVVPEAR
ALDLPAETLDNYLFNNANEFFFGPREEQ
375143087YP_005003736.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSRVELSDDDQAFLDETRAFLRTHVTDEVIRRDRETGDNFDAGVHLAL
GAAGYLEKEWKPESEGGFNRLRARIWALEKRRAHVPWVTSGTTAMIAHSV
EKFGSPELKAEVMPQVYSGHARLCLGYTEPEGGSDVATCKTRAVRDGDGW
VINGSKMFTTGAHNCQYVFLITNTDPAAPKHKSLTMFLVPLDSPGIEIQG
VRTVDGDRTNIVYYSDVRVDDKYRLGEVNDGWTVVREPLNVEHGAVAAAQ
DGLQDVSIMMHQASFMAAAVDKAAAKVGETGPDGRRLIDDGSVAYRLGRS
VARMEASLSAPSIFGRVALAQTMRDISPDLMDILGTAASLPIGTDGSADD
GAAEYVYRFAPLVGIYGGTLEVFRNMIAQYALGLGKPAYAPAAKKAS
375143085YP_005003734.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MNDPIALFDLTGEVAIVTGSTRGLGRAIAEGFARAGASVVITSRKQDRCD
AVAAEIGETTGNSVLPLACHVGDWEAVPAFVDEVANAYGRIDVLVNNAGI
NPTLQKRVFSVNVEGALRMSQCVAPVMRDGGGGSIVNVGSMEGYASTPIS
VAYGASKAALRHLTVSMANEWAPWGVRVNILSPGPFATDMITSFEEQQPG
TMAMLAEGPAQKRVAGVSEIVGPALYLASRASSFVTGDDITVSGGMRK
375143083YP_005003732.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MSKTVVIGASSGLGRCIGVGLATKGAHVALLARRIERLEAAAQEAGPRAI
AVECDVTDDVSIRAAIDRSAEALGGIDNLVYTPAIGPLVRLVDTEADAWR
RIFDTNVIGAALATAAAIPHLTASEGKVVYLSSDAGTYGPPWPGLGAYGV
SKSALERLTESWRAEHPSVGFTCLVVGECAGGEGDGQTGMTTGWDMELAS
KTFPLWVSRGCMPGKVMPVEDLIEVVHTILSTNSATSMPMVIARGAPGGA
ETLAN
375143081YP_005003730.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMIEHKPTFCRICEPLCGMVATVEDGRLVALRPDKEHPLSAGFACQKGIAF
TEVQNDPDRVTTPLRRGPNGFEAVTWDEAMTDIAARLSAVLQRHGSGGVG
WYMGNPGAFSYAHTFAALLFIKGLGRHGHYFTASSQDTNSRLIASQLLYG
VPTSVPIPDLTRTDLLVMMGANPVVSHGSFLTAPRIKDRMHDIVKRGGRV
VVVDPRRTETAVAFEWLGIVPDSDSYLLLSLLQVMFSEGLVDVARVSDVA
DGVQWLRSLSEPFTPEATTTHTGIDPASVRTLARDLVHTERAAIYGRLGT
CVGRYGTLTTYLIDAVNLIAGNLDAPGGSVFSSMQTVGQKWQNTMMGVVM
RRSRSRKRSRIGGIPSAIGSEPAALMAKEITTPGDRQIKAMFVSAGNPVL
SVPNGDELEAAFGTLDLSVALDFYVTETTSRCDYILPVTTMYERDDFPYT
FQAFQATPFRQATEAVVAPAGESRSEWDIVDDLARRLGRQVPAFAAFGAA
RKALSAFGKTLSPRLMIDALVRMSEGGDRFGLRRGGLSLRGLTERHPHGV
VVSPHIRTGVLRTAVAYLSRRVQLVHSDIADEVAKLSQSAHPEGFPLRMI
GMREPRSENSWMHNSPMLMRGDRRHHALIHVDDAAELAITDGDVVQISSP
YGQITVPVTATKDLVAGVVAIPHGWGHKGTGGWQLANRAGGANVNRLTSS
EPNDVESMSGMAWLTGVPVRIDKV
375143079YP_005003728.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MEGVRVLEVAQFTFVPAAGAILADWGADVIKVEHPIRGDTQRGFVNMGGF
QLDPERHPLIEHPNRGKRSVGIDVSTPGGQEVLHEIARTADVFLTNYMPA
QRQKNKFDVEHIRAANPNIIYARGSAYGDKGAERDTGGFDGTAFWTRSGV
GHALTPEEIGGALPQGIPAFGDSIGGMNIAGGISAALFHRERTGEAVELD
VSLLSTAWWAAGASVTQGMETGETMRSLMPGTTTSVNPFMANYLTSDGGT
INLCIVSPTGYIRDAFEHLGLPELADDPRFCDVMPLIQNAEAGVQLIAEA
IAAKPFEYWRQHLKTMKGQWAPFQSLIDLASDEQAIANDMIVEVEAAGGG
APFKVVRGPVQFNHEPLETTRAPQASEHTEIVLMELGMDWDRIEELKDAG
AIA
375143077YP_005003726.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MESSVHTVTVEEAADLIRDPYPLFAKRRQEFGVFKGSVMDWSKTPESMMP
EHLYAAVSFDAVNRVFRESKVFNSHIYDSTIGLFIGPTILAMEGKRHWEH
RNLVSAAFKTRSLSRWEPEIVRPVVNGLIDEFIDVGHADLVKQFTLEFPT
RVISKLLGLPEEDLPWFRKRAVELISYTVKWKRAFEASAALKEYFLQQIE
QRRSKPTEDIIGDLVSAEIDGEKLTDEAIYSFLRLLLPAGLETTYRSSGN
LLFLLLTHPEQFRAVQADRDLIGPAIEEGLRYETPLTTVQRYAAEETELE
GVTLPQGAVIDVCIGSANRDEKRWERAEEFDIHRKRVPHISFAAGEHTCM
GLHLARMETRVAVECLLDRMTDFQLVTDDNPHIHGQPFRSPTAIPVTFSA
AG
375143075YP_005003724.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MNTSMQSAAVDTRERMSAVLERQRRAFIADGPPSADVRRNRIDRLLALVL
DNTDAFVDAMGADFGTRPRAGTLFTEILGMISVIEHTRSHVRQWMRTTLL
MRAARLFGLRAEVQPSPLGVVGIIGPWNFPLNLVVLPATAAFAAGNRVMI
KMSEVTPRTADLMAALAPNYFDETELAVITGGVAVAADFSALPFDHLFFT
GSPSVGARVQRAAADHLVPVTLELGGKNPVVVSRDADLTRAATRIAQGRM
INGGQVCVCPDYVFVPDERVDAFVGIARNVLEDMFPSIVDNDDYCSSVNE
ANFDRVVGLIDDARANGATVESVVPRGEVLPDRGSRKVAPTIVRDVDDRM
RIANEEIFGPVLVVRPYSQVADAIDYINQRPAPLVAYWYGPDSDDFRRFV
RNTRSGGVARNDFAAQMIPSAAPFGGVGRSGMGAYHGKAGFDTFSHYRTV
VGTDLPFTITGRAAPPFGGSMQAGSRVALRMARNRTRRRLRRL
375143073YP_005003722.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTETQRESTAFPEIKPVDTGPELGRFMTAMRRLQDIVVSTNPDDTLWADG
ADQIEELCARLEDHRAPQGVAPAGRGPHLPGLGHPLMPPWTMTEFGSDGV
VMTGHFSRFHVGGNNAVHGGVIPLFYDWHFGMIVSAAGRANSRTAYLHVD
YRKITPIDQPLVSHGRIDSIDGRKAFVTATMTDSEGNVLSEANGLMLRLL
PHQP
375143071YP_005003720.1 ring-hydroxylating dioxygenase- large terminal subunit [MycobacteriMKVPFTWKVTGWFMVGWSAEFPQSEVRPLRYFGEDLVAYRDDSGELHVMQ
AHCRHLGAHIGHGGKVVGDCVECPFHGWRWGPDGTNRYIPYQPDRPNRAL
KLRVFPVNEQYGCVFLWHQPQGKEPQWEMPDIFTSFPQFETDPSAYYRPY
PEFSRRTENEPVHPQIVAENGPDSSHFHYVHGATVTPVNLEWKIVDEQWQ
FLTGWPDARSDDPNKMALHIHSHMFGLGGAISVFEGSSNHRLIFAVTPVE
DGLSTMFYSIWWPKLDGETSDVPPDEVRERVERQFLGTVWEDLDIWRYQE
YVENPPLAKIDAKPYMALRKWAQQFYEIPATPPGEVPASV
375143069YP_005003718.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMTKPSPSRFDAIVIGAGFSGLYALHRLRELGVRTLVLEAAEDVGGTWLFN
RYPGARCDIESIEYSYSFSDEIQQEWVWTETMPAQPEIEAYLHFVADKLD
LRRDIRFNTRVVAMTYDEAAGEWMVQTQSGESLVASFVVAASGILSVPLD
PDFPGMETFTGASLFTGHWPKEGFDLSGKRVGVIGTGSTGVQLIPVVAKE
AEHLTVFQRSPAYTLPWEVRPFDDGELDELKANYAEIRAAQRQHAVGAAR
LSAFSVLFDMMAKPPLKAASRQEQLRAIEEGGVMGALSWGDVFFDIEANR
MAAKLYGEAVARIVKDPETAASLTPSHPFGCKRPIIDQGYYDTFNRDNVT
LVDLRKGPIVEITPTGIRTEQGHHDLDVIIYATGFDAMTGALTRINVHGR
DRLSLADFWSSEGPYTYLGIAVAGFPNLFIVQAPGSPSAATNFVAALEQH
IEWIGDCIAYLRDNGYRTIEALPDAQHEWIEHTTALVAPTVLVDPSCSSW
YNGGNVPGKKRMYMGYTAGIPEYRRRCDEIADAGYTGFKLG
375143067YP_005003716.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MQCVPSPSRGLTQPERVEISSRRLVEAAAELIVEKGWEATTAAEIGRRAG
YSRAMVHARYGSKDAILDAFFLHDYVKQLSPDPDPDATGLQEALGHFDRV
QRLFSEDQDFLRAMFVATFEGVKTTSPLRQRVQRWLQRGVDKVEAGLRRG
VDDGSVRNDVDIDRATSDLSAAIFGAAYLWTVLADGYDLDRELGYIRDRF
TRVYGSPAR
375143065YP_005003714.1 SnoaL-like polyketide cyclase [Mycobacterium rhodesiae NBB3]MTRSAREVVELYNLVVWNERRFDLAEELMGDSVIRHDVGESTTLTHDQAV
ARIVDHWDMFESIRFDLNLVVAGEDNEHVAIVYQSPMKLKDGTETTVSSM
EIFRVVDGRISEVWNCGYKQGVWA
375143063YP_005003712.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMTNEQGWKETLEDLDLRRERSRAMGGPERLAKHRGKGKLDARARLDHLLD
KGSFREFGTLVGGEIAADGIVAGSGLINGTPVMIGAEDFTTLAGSIGPGG
NAKRYRLAELALRDRVPLVMLLEGAGFRPSGEHYGRTPTDLLAQAQCSGK
VPMVGGLLGPSAGHGALVAPVCDWTIMSNQGAIFTAGPPVVKESTGEEIS
KEDLGGPSVAIASGVIHNLAENDEAVLDDIRRYLSYFPPSAWSYPASLPA
DEAAEARSTPELLDIVPRGNRRVYNMRAVLDVVFDDRGWFEVQPKFGQAM
ICALAHLGGHPVAVVANQPKVLAGSIDADAADKAAHFINVADSFHLPIVF
LADNPGMLPGSRSEKTGVLRSGARMFAAQTAATTLKLHVTLRKAYGFGSM
VMSLLGFDNQSATFAYPGATMGAMSAAALSKASHAAEDMEAKLRKAEVEA
SFRSAGHLGFDDLIHPEETRNALLAALQRGIYSRQAAAEPVSRTVITP
375143061YP_005003710.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MATRIMDEAAKVFADPKSYTDEAALHAALTHLRANAPVSWVDVPNYRPFW
AITKHADIMAIERANTLFTNSPRPVLTTAAGDDQQAAIGVKTLIHHDDPE
HRAIRAIGADWFRPKAMRALKVRVDELAKRYVDQMVAAGPECDFVQEVAV
NYPLYVIMSMLGIPESDFPQMLKYTQELFGTDDEEMQRSSSIEESMGVLL
EMFAYFNELTAARRATPTEDLASAIANATIDGEPLSDIDTVSYYLIIATA
GHDTTSAVISGGLHALIEHPEQRRRLRDNMDLMPLAAEEMIRWVTPVKEF
MRTAQQDTEVRGVPIAAGESVLLSYVSSNRDEDVFDEPFRFDVGREPNKH
NAFGYGVHFCLGAALARMEVNSFFSELIPRLNEIELTGDPAYTATIFVGG
PKHLPIRYSLK
375143059YP_005003708.1 Mg/Co/Ni transporter MgtE with CBS domain [Mycobacterium rhodesiae MLLLSTVVGRWVEADGRRVGRLADLVVTAADADLPTVRRILVRGNHARTV
SVPWTDVDRIGPGHIALRSGSETLVVESAAEGLSSDEVLVVRDILDSQII
DIAGQRLARVADIVLARSPSGLLEIVGVEVGFGALLRRMGFRRLAARMAP
DAVRWSDLHLASKRGHTIQLATKRSAVHRLGARDLAVLVTKLDTESATGI
LSAKGPAMAADVIRVSQPEVAERVLRAMPAATAADVVATMPADHAAHWRR
RLSDVSFMRGRRLLRSRAWSRRRHPKRGELP
375143057YP_005003706.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGRVAEIVRQIGWYWGSLMGDNHYRRYVEHHRKTHPGEVVLSEREYWRMR
HDATEASPNPRCC
375143055YP_005003704.1 nitrate/nitrite transporter [Mycobacterium rhodesiae NBB3]MSTAIALNTGTSRTVNLVLATWVSAINFWAWNMIGPLSTTYASDLSLSST
EASMLVATPILVGSLGRIVIGSLTDRFGGRTMFIVVSTASIVPVLAVGAA
GTASSYPLLLVCGFFLGIAGTVFAVGIPFANSWFEASRRGFATGVFGMGM
VGTALSAFFTPRFVRWFGLFTTHVVVAVALALTAVTCVVVMRNSPSFTPN
TGPVVPKLIAAAKLPVTWEMSFLYAVVFGGFVAFSNYLPTYIKTIYGFTA
VDAGARTAGFALAAVLARPVGGALADRIAPKYVVLVSFAGTATMAFVAVF
QPPPDVWSAATFITLAIFLGIGTGGVFAWVARRAPAQSVGAVTGIVAAAG
GLGGYFPPLVMGATYDATDNDYTVGLLLLVATALVALGYTALRLHAHEPQ
AQPSKGDT
375143053YP_005003702.1 nitrate reductase subunit beta [Mycobacterium rhodesiae NBB3]MKVMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNVETRPGQ
GYPRTYEDQERWRGGWRLDRRGRLRLRDGGRLAKLARIFANPKLPSIDDY
YEPWTYDYDNLISAPLGDQMPVAPPRSLISGKPMKVSWSANWDDDLAGSP
EIVPGDPILAQVSQDVKLQLEQTFMFYLPRICEHCLNPSCVASCPSGAMY
KRSEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRIE
VGLPTVCSETCVGRLRYLGLVLYDVDRVLEAASVEDEKDLYEAQRRILLD
PTDPQVIAGARAEGISDEWIEAAQRSPVYALINTYRVALPLHPEFRTVPM
VWYIPPLSPIVDAVSRDGHDAEDVGNLFGALDALRIPMEYLAGLFTAGDT
AIVEGVLRRLAAMRSYMRDINLGRETQPHIPQAVGMTEEQIYEMYRLLAL
AKYEERYVIPTAYVAEGSQHLEEPGCSLSFDGGPGMYESGPFGEASGGPV
PVAVETFHALQQRQTHEGMAANAERPSRVNLLNWDGRGVPPDMFPGRRS
375143051YP_005003700.1 respiratory nitrate reductase subunit gamma [Mycobacterium rhodesiaMSGWEIFWDVVPYVTLAVVVVGTWWRYRYDKFGWTTRSSQLYESRLLRIG
SPLFHFGMLVVIVGHVIGLVIPQSWTKAVMSDHFYHLQAGLLGGIAGVAT
LTGIALLIYRRRTRGPVFMATTANDKAMYLVLVLAIIAGLSCTLIGATPQ
GAEHDYRETVSPWFRSIWVLQPRGDLMVQAPLYFHIHVMIALVLFCIWPF
TRLVHVFSAPIGYLFRPYIVYRSREVSTGETLVGSHPPRRGW
375143049YP_005003698.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MSVRSQPSGRREDVLAVLRGTASAMTIVDIADQLEVHPNTVRFHLEALID
DGRIERIEPDRKRQGRPPLMYRAVAGMDPGGTRRYRLLAEILTVALADDP
HASAKALDAGRAWARRVTRPERSQPGVRASITRLMDLLGDLGFSPQRLDV
GGDVKVGLRHCPFLELADEARSVVCPIHLGLMQGAMKMWNAPATVDRLEP
FVEPDLCVAHLALDQEAS
375143047YP_005003696.1 putative flavin-nucleotide-binding protein [Mycobacterium rhodesiaeMPGEPLSAEESWNLLSSRALGRLVACVEGYPEIFPVNFVVQHRTVLFRTA
EFATKLFTVVQNARVVFEADDHNIADGWSVIVKGVAQVLNTDAEVQEAER
AQLLPWTEGPKPRFVRVHPDEISGRRFRFGPTAATE
375143045YP_005003694.1 sulfite oxidase-like oxidoreductase [Mycobacterium rhodesiae NBB3]MTARGGKAMAGVAAAAVALGVTQLLAVFFGPEADARTAVGSAVIDLTPGP
VKEWAIQTFGTADKLFLSILVVAMIAAIAAVSAQYESRRFPIGSAAIVLA
GLAGCAAVLSRAGANVADIVPTVIGTVCGVAVLRLLTSGRFTDEPGPDPA
TDAPDRGRRLSLVTLGFLGAGALTGVGGAVLSRLTTSVAGDRNAFALPKI
DVAAPAVPPTVQPQGVALPSFVTNNGDFYRIDTALSVPQLSRADWELKIH
GMVDREITYRFDDLERFEVIEKLVTLTCVSNPVGGDLIGNAAWTGYRVRD
LLAEAGIHADADMVLSTSIDGFTAGSPVEALTDDRDSLLAVGMNGQPLPT
EHGYPARLVVPGLYGYVSATKWVVDLELTRFDRAQGYWTPLGWSARGPIK
TQSRIDVPRSGQEVAQGAVTFGGVAWAQNRGVRGVEVRIDEGDWQPADLG
ANYADDTWRLWSFKWQATKSGPHTISVRATDNTGAVQTGDNAGVIPDGAT
GWHTVSFEVN
375143043YP_005003692.1 thiamine pyrophosphate-dependent protein [Mycobacterium rhodesiae NMATVADHVIEALRISGVHRVYGLPGDSLNGFTDAIRRCSEISWQHVRHEE
TAGFAAAADAALTGGLAVCAGSCGPGNLHLINGLFDAQRSRVPVLAIAAH
IPRSEIGSEYFQETHPQDLFRECSVYRELVSTAEMLPRILEMAMRAAVEE
SGVAVVVVPGEIFLEKADASGWSTRPVVATRSVVRPDDESLQRAAAILNE
AEAVTILGGAGVAGSHGALIDMAATLNAPIVHALRGKEFIEYDNPYDVGM
TGLLGFASGYKAIKESDALLMLGTDFPYQQFYPDNAKVIQVDIRGRNLGR
RTPIDIGLVGTVKDTLAALTPLVRQKTQREHLDRALRHYAKTRKRLDELA
VNDRDRTPIRPEYVAGLANQLATDDAVFTVDVGSPTVWAARYVAMNGRRR
LVGSFNHGTMACALPLAIGAQTAYPGRQVIALAGDGGLTMMFGELVTLIQ
NRLPVKVIVFNNSSLNFVELEMKAAGIVNFGTDLVNPDFAAVAQAMGIFG
RRVEQPSDLEQALTDAFTHDGPAVIDVVTARQELSIPPAITVEQAKGFSL
YAIRTILAGRADELLDLVTTNVARRILD
375143041YP_005003690.1 putative aminoglycoside phosphotransferase [Mycobacterium rhodesiaeMPDDAQQLPTLSDDDRAAVQRWAQQQGLGSAVTDVQPLTGGTQNIVVRLQ
IDGRPMVLRRPPLHPRPTSDKTMQREIAALRTLAGTDVPHPGFIAGCEDL
DVLGVVFYLMEEIDGFNPGSEVAEAYVRDQSFRHDVGMSYAASLARLGNA
AWQDKPLAELKRPGSFVERQVPQFLRLLESYRHERYEPESLAVTELADWL
QANLPPDSEPGIMHGDPHLSNVLLRRDKPELAAFVDWEMCTVGDPLLDLG
WMLITWPLDTSTITAGGALGALGGLATRRELLEAYWDAGGRETPRLDWYM
AMACFKLGVVIEGTWSRYLMGKASRDAGEALHANAQNLINIGTRVVKGDN
PFDLN
375143039YP_005003688.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTFEPATSAAPIPGASAFASHIDGPMPRGLREEADAMSFDSFLDHYGPTT
GPLRLGQWACTDERPATRLGPQVRNYQATLAFGDRISTSSATACGPVAAL
TEMLYERGIAVEMTAFHQVPAGENTATFIYGSDGGRSTWAMGLADDPTQS
ALRAMIACANRLLVA
375143037YP_005003686.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MPTISTTDYLLDQAKRRFTPSITNFPGLGMVEKRLLKTDFPQKKMTEPPA
GSDLKAVAGDAGLPILGHMIEMFRGGPEYLLHIYRKYGPLYYADSPVLPA
VTALGPDAAQAIYSNRNKDFNQQGWVPVIGPFFHRGLMLLDFEEHMFHRR
IMQEAFVRTRLVGYQEQVDKVVSQVIANDWVTNDSRFLMYPAMKELTLDI
ASMVFMGHEPGTDHELVTKVNNAFTTTTRAGNAIIRTPVPPFTWWRGMQA
RKLLEEYFQERVRERRGKDGSDLLTVLCQTEDEDGNKFSDDDIVNHMIFL
MMAAHDTSTSTATTMIYHLAKHPEWQDRCRDESDRLGDGPLDIDSLEKLE
SLDLVMNESIRLVTPVQWAMRQTVRDTELLGYYLPKGTNVIAYPGMNHRL
EEFYPEPMKFDPLRFTEPRNEHKSHRYAFSPFGGGAHKCIGMTFGQFEVK
TILHRLLRKYRLELPHKGYTTEWDYGGMPVPKDGMHIVLRPLH
375143035YP_005003684.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MVASESRESDFAGKRCLLTGAASGIGRATALKLASAGAELFLTDRDAEGL
AKTVADARALGGVVHAYRAFDISDFDAVDMFAADVHAEHPAMDVVMNIAG
VSAWGTVSTLTHEHWKSMVDINLMGPIHVIESFVPPMVAAGKGGHLVNVS
SAAGLVALPWHAAYSASKYGLRGLSEVLRFDLARHRIGVSVVVPGAVKTP
LVQSVHIAGVDREHPHVKKWTDRFGGHAVSPEHVADRILRGVRRNRFLIY
TSHDIRALYLFKRTAWWPYSVAMRQVNVLFTRALRPPSSNRN
375143033YP_005003682.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPPHALPISDDAPQERGDAARNRTLLLEAARRLITERGADAVTTDDIAAA
AGVGKGTLFRRFGSRAGLMIVLLDEDEKVQQQAFLFGPPPLGPGAPPLER
LIAYGRARLKFVTAHQALLSDANRDPQMRFNAPANLHHRHVTVLLEDAST
TGDLDAQAAALLALLDADYVHHQLTERGQTLKSLGDAWETVARKLCGT
375143031YP_005003680.1 Glutaredoxin-like protein NrdH [Mycobacterium rhodesiae NBB3]MTVTVYTKPACVQCNATYKALDKQGIAYTSVDISLDTEARDYVMALGYLQ
APVVVAGNDHWSGFRPDRIKSLSTVAATA
375143029YP_005003678.1 ribonucleoside-diphosphate reductase subunit alpha [Mycobacterium rMSPTVTAAEPVTVPSAAPAETDYHALNAMLNLYDADGKIQFDKDREAAHQ
YFLEHVNQNTVFFHDQDEKLDYLIKENYYEREVLDQYSRNFVKTLISRAY
AKKFRFPTFVGAFKYYTSYTLKTFDGKRYLERFEDRVVMVSLTLAAGDTA
LAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRS
INSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFS
YANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIP
DITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDARIRKT
KIKAREFFQTLAELQFESGYPYIMYEDTVNRANPIDGKITHSNLCSEILQ
VSTPSVFNEDLTYSQVGKDISCNLGSLNIAKTMDSPDFAQTIEVSIRALT
AVSDQTHIWSVPSIEQGNNDSHAIGLGQMNLHGYLARERIHYGSEEGVDF
TNIYFYTVLYHALRASNRIAIERGTHFKGFEKSKYASGEFFDKYTEQVWE
PKTDRVKELFEKAGIRIPTQEDWTRLKESVQKDGIYNQNLQAVPPTGSIS
YINNSTSSIHPVASRIEIRKEGKIGRVYYPAPYLTNDNLEYYQDAYEIGY
EKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYY
IRLRQMALEGTEVENCVSCML
375143027YP_005003676.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADQKQNYDPKRGGKFEPTTKAQPAPTAKPGDNKNKNK
375143025YP_005003674.1 multidrug ABC transporter ATPase [Mycobacterium rhodesiae NBB3]MIETVNLTRSFDGRRAVDGVTAEFPAGSVTALLGLNGAGKTTLLRLIAGL
DRPDGGTVAVCGQHRLGDPRLLGVHLGPDAMNPGHTVHRHLSWLAALGGI
GPARIEAALDETGLRERRSVRIGRLSLGARQRLAIAGALLGEPCALLFDE
PLNGLDVPGIVWFRSLLRQLAAAGATVVIATHLLGEVTLTADRIALLVDG
RLETLGALEQLTPAGEDTREWLETTLLERV
375143023YP_005003672.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTGRETLPLAGRSDADMPGHWLLARLGKRVLRPGGLELTSRMLNAAGIGD
ADVVELGPGLGRTARDIVALQPRSYVGVDDTAAATEAVRDVVRPVGGTVI
VADAATTGLPADSADVVIGEAMLTMQGDKAKRAIIDEAFRILRPGGRYAI
HELGLTPDSMPHETKDDIRRDLARSIKVNARPLTASEWAQLLSDAGFEDV
TVDYAPMALLNPARVLADEGPSGALRIVGNLIVRGAARRRVIGMRRTFHR
YRRSLTAVAAVGVVPGS
375143021YP_005003670.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRPNAQSMKPATAAKKLDVYLPATPAAFQENPITRAELADLQADPPQWL
QDLRKNGPHPKNLVAAKLGVSIAGLARGGVGDALTTEQINALLEDRPPWL
IAERESYQAVLSEQRRLKAARAEQVREK
375143019YP_005003668.1 geranylgeranyl reductase [Mycobacterium rhodesiae NBB3]MTQRYDLIIAGGGPSGSAAAWQAAQTGAKVVVLDKAEFPRAKPCGDGLTA
RAVSYLQKMGLADEVATYHRVNRVTVFSPSEWELSFPKRPGMPDHGHTVS
REHLDTVLLKHAESAGAEVRQGAEVTGPELDPSGRVVGVTLKSGEKVYGD
AVIAADGAYSPIKRALKIDSEYNGYQAIAIRSEMHANRPDSDSLDIYLKL
AFQGDQLPGYGWVFPMGGGVFNIGLGYVNSYKNWQSINATQFLGDFLRTL
PADWELPPIEELKKNKSVRAWRLPMGFTAWPPWRPGVLFTGDSLGAGKPA
SGAGISKALESGLAAGECAIAALQNGGPDDFTNYAQRMEAAWGREYRRGR
YFHKLLGQPKLANAGVKLIDNAAFRDRMLKALYKKAQGPQHTTK
375143017YP_005003666.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAALLANPVLPSGDDERFVGFGIMGLPFANGHYLAMRQMPATTYSPPYVS
VWHRDPSCNWTFYATTPGQQSCARYFSSTTPNDAVQCDIDVTWTGPRTFL
VEIPGRLEWTVELQSTRATRLMGKISGRLSESAWTNPVMLHRLGRVARRT
LDVGDVKLTGRAPNGQCYSMAPKQVWLAADSQAVLNGRDLGPSGPLLRQA
RLGDFRMPQRGIGMVGSGHFETFDPDRHLSSQGALSFA
375143015YP_005003664.1 ribonucleotide reductase subunit beta [Mycobacterium rhodesiae NBB3MKLIDRVSAINWNRVQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLN
DHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMES
VHARSYSNIFSTLCSTSEIDDAFRWSEENPNLQRKAEIVMRYYKGDEPLK
RKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYI
GYKYQRGLAATDAATQAELKDYTYELLFELYDNEVEYTQDLYDEVGLTED
VKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSG
SGSSYVIGKAVNTEDEDWDF
375143013YP_005003662.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIVAGVLDEKHAEVRPLAERLGRVAPAVHMKLVDLDKAHAEPRVYAGKHW
RFSKLDRKVADR
375143011YP_005003660.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSVFVCRRCNEHMCEHEEKCDMLLRWYDCKWTGTFWRPCECRERSEGPVF
PVSFRAKSP
375143009YP_005003658.1 Cutinase [Mycobacterium rhodesiae NBB3]MKSRPLISHVCTLAAAAVLAAIFLMTPAMSLTAAPLIPVASAACPDAEVV
FARGRQEPPGVGQIGDALVAALRSKTPMSVGVYGVNYPADLDAATGARDI
GAHVRSMASSCPNTRIVIGGYSLGATAADLFARANSLPADINQHVAAIAL
FGNGGKRLGPAPAYAGRMIDQCADGDPICGRGFNWDSHLQPSYLGSGLVD
QAAGFIAGKL
375143007YP_005003656.1 GAF domain-containing protein [Mycobacterium rhodesiae NBB3]MLPMVPGFDEWMNLALAEEAARAGESVETYIGRAVASRMVVGRARRGDTD
TQELLARVRSSNLDVPGPVVSSAADAVISNPDRLRALYDSGLLNTERAQS
LDRIVAMVVAAVGVPSAAVTLVDRDTQYMCSAIGLAGAVAIARKGPLDGS
LGREVVVSGRPLIIEDARQEPLLGDHLAVREGYVVAYAGFPLTDGQGQTI
GALAAWDTRSRRWTSGHTQVMGDFVMMIRARIFGIALT
375143005YP_005003654.1 Zn-dependent alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MTTVSAYAATSANEPLTKTTITRRDVGPHDVAFDIHFAGICHSDIHTVKA
EWGEPNYPVVPGHEIAGVVTEVGTDVTKFKVGDRVGVGCFVDSCRECDQC
RAGEEQYCTNPGMIGTYNSVGRDGEPTQGGYSGAIVVDENYVLRIPDSLP
LDAAAPLLCAGITLYSPLRHWNAGPGTSVAVIGLGGLGHVGVKLAHAMGA
KVTVLSQSLKKMEDGLRLGADEYYATSDPGTFETLAGSFDLILNTVSANL
DLNAYLKLLKLDGTLVELGMPERPMSVAASALVFARRSLAGSLIGGIAET
QEMLDFCAEHDVRPEIEVITPDYINEAYQRVLASDVRYRFVIDTATLRG
375143003YP_005003652.1 Fe3+-hydroxamate ABC transporter periplasmic protein [MycobacteriumMLISGPRAGLLAASAAIVAAVAVSGCGSLGGESSAPPGQQAPITSTTKIA
SAGVLGNQRRPDESCAPEPTPVDPGPPDRQVTHAAGETMVQADPQRIVVL
AGDQLDTLCALGLQSRVVAAALPDGADSQPSYLGKVIHDVPGAGSRSAPD
IDAIKAATPDLILGSEALTPDDFGELSAIAPTVFTGPPGAKWQDNMRTVG
AATGRLDVANQMIDGFERAADKTGADNDATHFQASVVQFTETAMRVYGLD
NFPGSVLGAVGVDRPASQRFTDKPYLEIGITDTDLDNAPDFSAADGDIVY
ISFDSAAAKDRAPRVLESDAWRKLSANRDNRIFAVNNEVWQTGEGIVAAR
GILADLPWINAPIN
375143001YP_005003650.1 phosphoserine phosphatase SerB [Mycobacterium rhodesiae NBB3]MTSPIGPPASRAGGAPTSRDRSSLLITVTGPDQPGVTSALFEVLSRHKVE
LLNVEQVVIRGRLTLGVLVAAGGEVTGGAALRDEVRSAIGDFGLDVSIEP
SDDLPVLREPSTHTIVVLGRPISAEAFGVVAREAAALGVNIDFIRGVSDY
PVTGLELRVSVPPGAAYQQLQAAMARVAVDEGVDIALEDYSLSRRAKRLI
VFDVDSTLIQGEVIEMLADRVGAHAAVAEITEAAMRGELDFTESLNRRVA
TLAGLPANVLEEVGEQIELTPGARTTLRTLRRLGFYCGIVSGGFRQVIEP
LAHELEMDFVAANELEIVDGKLTGRVIGQVIDRPGKAKALRDFAQQAGVP
MEQTVAVGDGANDIDMLAAAGLGVAFNAKPALREVADASISHPYLDTVLF
ILGITRGEIEAADARDGVVRRVDIPDD
375142999YP_005003648.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSANWISKLGRGLSRTFHWDAPAGCVDYFDRDAERMAREVELIKMRFPHH
S
375142997YP_005003646.1 ABC-type molybdenum transport system- ATPase component/photorepair MPVAEGDTADPDLLIDFAKVSLRRGGQVLVGPVTWSVELDERWVVIGPNG
AGKTSLLRIAAAMEYPSSGTAFVLGERLGRTDMSELRSRVGLSSSALSQR
VPDDEVVRDLVVSAGYSVLGRWRERYEDVDYERAVDMLESIGAEHLAERT
YGTLSEGERKRVLIARSMMTDPELLLLDEPAAGLDLGGREDLLARLEDLA
LDPDSPALVLVTHHVEEIPRGFSHGLILSEGKIVDSGLLSDVLTSENLSK
AFGQSIVLENSEGRYFARRARSRAAHRRRA
375142995YP_005003644.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMTEFVSVHTSDEQPGVATLLLSRPPTNALTRQVYRELEAAAGDIATRDDV
HAVILFGGHEIFSAGDDVPERSLLNGDEAASATRVCRSAVDALAAIPKPT
VAAITGYALGGGLNLSLAADWRVAGDNVRFGVTEILAGLVPAGGTARLAR
AVGLSKAKDMVFSGRFLDAKEALALGLIDEMVAPDGVYDAALAWAQRFVE
RPAQVLAAAKATFHV
375142993YP_005003642.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MREVADLRLTPATLIADIASARARFGEWSAVLVETTVLRRKAAAKVGDPA
DWLFTDEALQQATTQSVANHRARRLAGAVVHDATCSIGTELAALRHSAAA
LVGSDLDPVRLAMARHNVADVDLCRADALRPITGSAVVLLDPARRSRGRR
RFDPRDYTPGLDALLDVYRGRDIAVKCAPGIDFDGLAQLGFAGEIEVTST
AGGVREACLWSSGLAAPGVTRRASMLDAGEEITDAEPDDCGVAPAGRWIV
DPDGAVVRAGLVRHYAARHGLWQLDPDIAYLSGEQLPTGVRGFEVLEELA
YSERRLRQALSRRDTGAVEILVRGVDVDPDVLRHRLRLRGSQMVSVVITR
LGVGAASRTTAFICRPSR
375142991YP_005003640.1 FOG: WD40-like repeat protein [Mycobacterium rhodesiae NBB3]MVLVSTALITAFVAGCQNTDSWVEAQAASGWPAQYGDARNSSYQSTAGAD
ALRLEWTRSVKGDLAAAVALGSGSYLAVNAQTPAGCSLMVWETDNRARQR
WCTRLVQGGDTSSPLWDGVDNLYVGQPGAMISFPPTQWIRWRQPVIGMPT
TPRILNAGHLLVVTHLGQVLVFDAHKGIVDGAPLDLVAGVDPKDSERGLA
DCRSARAGCPVAAAPAFAEQTGVIVLSLWEPEAEAPVLVGLRYRPGQNPV
LSQEWTSDAVGGGPLASPALSSDGSTAYVNGRDERLWAINTADGKPKWSI
ALDYLAQTPPSVSPDGLIIAGGGPGAKLVGIKDAGDNGEVKWTRDEVVPL
TTSSQSGADVAYTVARDGEDGQALIVFDPADGRTLNSYPLPNAGGWPVGV
SVGHDRRVVTATSEGRVYGFAPA
375142989YP_005003638.1 carboxylesterase type B [Mycobacterium rhodesiae NBB3]MTEAGDATRRVDLSTGPALVIDDGVLMRARGVPYGSADRFASPTPPAPWA
EPRALIRRGPVCPQLPSRLAFVTGPVTDGLQRSEDCQVLSVTAPSGADGL
PVMVWFHGGAYVSGGGESPNYDPDALVTEGRVVVVTVSYRLGIFGYCTPL
GVDEDNLGLRDQLLALRWVHDNIAAFGGDPQRVTLFGQSAGGDSVYSLML
SEAADGIYSRAIIQSAPLGMRDGRDAMRTAMRAAAAESLSDTDPFAADVE
RLHLAQTRSLIAARRFGAISGLSYAPILGVDPLPAAHEVTARIAHVARSV
DLFVGSTKLDAAPFVELNQNASRLRALGPVGKVGARTAAAAMTRRVFSGP
AERLARSWRADGGRASTYRLDWSPRDAPLGACHCMDLPLLLGTPGAWSSA
PMLGPHPDPLDHRLAIQIRRLWTRFAHDGVPGLGAEKFRLDAVR
375142987YP_005003636.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTNEPVRRSDVAGDPAPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWA
AAYVPLMRVLRRLAAEDRRHLVTLGMTPVVTAQLDDPYCLTGMHHWLANW
GLRALEATTLGDPLRQFGIRERAEADRALDDFSTLWAHGGSPLLRELIDA
EAIELLGGPLSHPFQPLLNPRLREFALREGLADAAQRFAHTPTGIWAPEC
AYAPGMEIDYAAAGVGHFMVDGPSLHGDTALGRPVGSSDVVAFGRDLQVS
YRVWSPKSGYPGHAAYRDFHTYDHTTGLKPARVTGRNVASDAKAPYDPAR
ADGAIDGHVTDFVNVVRQRLVDESERIGRPAHVIAAFDTELFGHWWYEGP
VWLERVLRALPEAGVRVGTLSDAIADGFVGSPVELPPSSWGSGKDWQVWA
GEQVADLVQLNSEVVDTALTTVDKALAEADSAPARSFVADQILRETLLTV
SSDWPFMVSKDSAADYARYRAHLHAHATREIAGAMASGRHEHAQRLAAGW
NRADGLFGALDARRLPRP
375142985YP_005003634.1 electron transfer flavoprotein subunit beta [Mycobacterium rhodesiaMTNIVVLIKQVPDTWSERKLSDGDFTLDREAADAVLDEINERAVEEALLI
KEKEGGESTVTVLTAGPERATEAIRKALSMGADKAVHLVDEGMHGSDMVQ
TGWALARALGTIEGTELVIAGNEATDGVGGAVPAIVAEYLGLPQLTHLRK
VTVEGGKVTGERETDDGVFTVEASLPAVVSVNEKINEPRFPSFKGIMAAK
KKEVTTLTLAEIGVEADEVGVANAGTKVNASTPKPPKTAGEKVTDEGEGG
TKVAEYLVAQKII
375142983YP_005003632.1 nitroreductase [Mycobacterium rhodesiae NBB3]MDAHVSDLTKAIEERRSIRMFLRDKPVPRDLLDEALALAMRAPSNSNIQP
WRLFLATGPRRDKLVEALLERASRGYPATVGLPQSFSALRSEIGALVYGS
MGIARDDSEGRRMAQLRNWEFFRAPVAGVVCMHRDLGPADSLAVGMFLQT
LVLALTERGLGTCLQVSIAHFPDVLREQLDIPDDLQIICGLAVGYADPEF
AANQLRTPRNPVGENVVFLDG
375142981YP_005003630.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium rhodeMTAENPWVPRATCNVSCVAATEAPTGQRIVVAWRVAIRATFAVVLLSAVP
LLAIPMPGRSHLQRSYCRLMLRCLGVRITVSGGPIRNLQGVLVVAGHVSW
VDIFAIGSVLPGRFVAKAEMINWPGLGFLARLMKVIPIDRDNLRRLPDVV
STIAVRLRAGQTVVAFPEGTTWCGLAYGQFRPAMFQAAVDAGRPVQPLRL
SYHRRDGAASTIAAYVGDDTLPASIRRLITAQRTVVRVQVESLQLPGADR
RDLAARCESAVRGDVTARAQGHALVA
375142979YP_005003628.1 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [MycobMMRVLAAMSGGVDSSVAAARMVDAGHDVVGVHLALSSAPGTLRTGSRGCC
SKEDAGDARRVADVLGIPFYVWDFADRFKEDVVDDFISSYARGETPNPCV
RCNERIKFSALAARALALGFDAVATGHYARLSGGRLRRAVDADKDQSYVL
AVLTAEQLRHAVFPVGDTPKPQIREEAANRGLSVAEKPDSHDICFIPSGD
TRAFLGARIGVRRGSVVDAGGTVLAEHEGVHGFTVGQRKGLGIAGPGPDG
QPRYVTGIDADSGTVQVGVAADLDVWTLTGERPVFTSGAALTGPVECQVQ
VRAHGGIGDGVAELRDGRLVVDLRAPIRGVASGQTMVLYRPDADGDEVLG
SATITR
375142977YP_005003626.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPVAARLVWGAVALLAAGCTQSITGTAVRSVPGLDDDSLSPIDVETVVLD
QSQMRAITGAGDDLSIIPSMDGKIPVDIDPLAKDAPPQCQWLFADTQTFG
PDIEEFHKTTFQNPPDGGLISEAVAAYRDPGVARSAFDNLVRLVDDCSST
GLGSMLVGEWSAGRDALTARPGACGRDYRVKSVVLVEVTFCRFPGSVPDI
VMTNILANVPE
375142975YP_005003624.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGNLPVNLLDETGQMLRRVVDAHLAPERWSDIATTLDRVEHAVQAGEEA
ALQRELVELRWVVDDYQPAPARYGAPPPPAGSTRRGSHRWALWAFLVLCA
VLVAPAALVLLDSELPKSGSPPGDPSVDDTGTNSLWIAGGLVALAVAVVA
VAVAINVVRRRRRVPSASEPVVARRPVIGPPRVMPAPAQVREQANRTIMS
LAAHGGRQ
375142973YP_005003622.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNPDRIEKEVVLKAPLERVWRAISDADEFGQWFGVRFDGPFVPGTSVTGV
MTPTAVDEEVAKAQQPYAGQADRWQIVAVEPPRRLAFRWHPFGVEDGEDE
ASQPTTLVEFTLEDTSGGVLLRIVESGFEAIPAARRQSAFEGNSEGWSAQ
TELIRKYLTLSEKM
375142971YP_005003620.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MARFNHRMAAGVGVLAALLLLGAPTTVAVAHPGGSHSDRGDNSDRGNDRS
NGRGGFGRDDNYRGSNNGSRKPDGADDRQVGVAPGIIDSPQSRVGSGRAG
VADAEEPAPSTAARSAVPEQSQARVSAADPGDARLSSSEGSDAPSSASAP
NVFGGVGAPSQSGSDTAGAPSARFESPRVTVGNGREPVIERRGPEPQWQA
PVLPPVPAAPPPALPPPAAPAPPLPARVDRAPEAPVLTQQLGLAPARDWS
NPLWGLAGLLLIPVAGAVLGYRQARAAHAAERLRRT
375142969YP_005003618.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPHPIMFSDDDPLLAKVRKVALGFPEAFEKVSHGRPAFFVSKMFVMYGGS
VRPQTKGADYVQYPRSIMVKVDESDRRALEQDRRFFYPAYLGPSGWLGLD
LAATKKVDWNEVTELIDASYRLVAPRKLLLRLDEA
375142967YP_005003616.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAPTPVAGWYPDPQNPSQQRYWNGTVWAAQHPPPRRVGGVFGRVFAYLL
VIAVLTGLVSGTVAMPIFGTIFGLVVGVGIGLPVALLAAAVIAAAARPSV
TRKTYCRCIDATLVTLFVAVILLAVAWINQHALAGSRGAYTLLGVTLICL
IAVRPLLRRLVPATPTPSS
375142965YP_005003614.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLTVRRCETVLRVPSYLLRVQLEDRPGSLGSLAVALGSVGADILSLDVVE
RGTGYAVDDLVVDLPPGAMPDMLITAAEQIKGVYVDTIRPHLGLLEAHRE
LELIDHIAAAPSAKKLQVLADESPRVLRVGWCTVVRLTDSGPERIVGSHG
APETQAAETPWLPLDHAESLDGGADWVPQLWRDMDTTLAAAPLGNPNTAV
VLGRPGGPLFRPSEVARLGYLTGIVATILR
375142963YP_005003612.1 glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase subunMSDLTRLDAATLGAKIAAKEVSSTEATRACLDQIASTDGEYHAFLHVAED
KALAEAARVDALVAAGETLPSPLAGVPLALKDVFTTTDMPTTCGSKILEG
WTSPYDATVTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWDTG
RVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTSTVGVKPTYGTV
SRYGLIACASSLDQGGPCARTVLDTALLHEVIAGHDPKDSTSVDAAVPDV
VAAAKTGADGDLKGVRIGVVKQLRGDGYEAGVLASFNAAVDQLTALGAEV
SEVDCPHFDYSLPAYYLILPSEVSSNLARFDAMRYGLRVGDDGTHSAEEV
MALTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDEA
YQKVDVLISPATPTTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSVP
SGLSADDNLPVGLQIMAPALADDRLYKVGAAYEVARGPLPTAI
375142961YP_005003610.1 glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase subunMTVAASELLDYDEVIARYEPVMGMEVHVELSTATKMFCGCTNEFGGEPNT
QVCPVCLGLPGSLPVLNQSAVESAIRIGLALNCDIAPWGRFARKNYFYPD
QPKNYQISQYDEPIAVNGYLDVPLEDGTTWRVEIERAHMEEDTGKLTHLG
SDSGRIEGATTSLLDYNRAGVPLIEIVSKPIEGTGERAPEIARAYVTALR
DLLRALGVSDVRMDQGSMRCDSNVSLKLTGATEFGTRTETKNVNSLKSVE
VAVRYEMRRQAAVLEAGGSITQETRHFHEDGYTTAGRSKETAQDYRYFPE
PDLEPVAPSAELVERLRGTIPELPWLTRKRIQQEWGISDEVMRDLVNNGA
IDLVAATVEHGASSESARAWWGNFLVQKANEAGIELDALPITPAQVAAVV
KLVDEGKLSNKLARQVVEGVLAGEGEPEQVMADRGLAVVRDDSLIQAAVD
EALAANPDVAEKIRGGKVQAAGAIVGAVMKATKGQADAARVRELVLAACS
375142959YP_005003608.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSNPHDPSAWQRPDDAAGRPMSASLVDPDDDLPSANYSGDFETTAIPSY
DSGQTSVVTPGYSLLNDPEPLPYVQPSGRHAMSSFGAEPTEFGPDLDSQV
EHRRGTVDLGLFLLRLGAGAILIVHGLQKALGLWGGPGLDGWRDSLTAMG
FKYGEILTYVTTIGQLAAGLLLVLGLFTPVAAAGALAYLVTGLLADAMAA
HEAARLSSFLTDGHEYKVFLAGAVAALILTGPGRYGFDAGRGWARRPFVG
SFIALLAGVGAGVAVWVLLNGGNPLG
375142957YP_005003606.1 acetolactate synthase large subunit [Mycobacterium rhodesiae NBB3]MSAPTTRPPEHSETATNGTHAVPEARPAASKRIAPHQLTGAQAVIRSLEE
LDVDTIFGIPGGAVLPVYDPLFDSQKLRHVLVRHEQGAGHAASGYAHATG
RVGVCMATSGPGATNLVTPLADAYMDSIPVVAVTGQVGRALIGTDAFQEA
DISGITMPITKHNFLVRKGDDIARVMAEAFHIARSGRPGPVLVDIPKDVL
QGQCTFSWPPQIDLPGYKPNTKPHSRQIREAAKLIAAARKPVLYVGGGVI
RGEASEQLLNLAELTGIPVVTTLMARGAFPDSHPQNMGMPGMHGTVAAVA
ALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNRHADV
PIVGDVKAVITDLTEVLRRDGGTGASKIEAWWEYLRGVQATYPLSYGAQS
DGSLSPEYVIETLGKMAGPDAVYVAGVGQHQMWAAQFISYEKPKTWLNSG
GLGTMGYAVPAAMGAKFGRPEAEVWAIDGDGCFQMTNQELATCAVEGAPI
KVAIINNGNLGMVRQWQTLFYEERYSQTDLATHSHRIPDFVKLAEALGCV
GLRCERAEDVEAVIAQAREINDRPVVIDFIVGADAQVWPMVAAGTSNDEI
QAARGIRPLFDDPEEGHA
375142955YP_005003604.1 ketol-acid reductoisomerase [Mycobacterium rhodesiae NBB3]MPVEMFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVKVGLKE
GSKSRAKVTEQGLEVDTPAEVAKWADVIMLLAPDTAQADIFKNDIEPNLE
DGNALFFGHGLNIHFDLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPC
LIAVDQDPKGEGQALALSYAKGIGGTRAGVIKTTFKDETETDLFGEQAVL
CGGTEELVKTGFDVMVEAGYEPELAYFEVLHELKLIVDLMYEGGIARMNY
SVSDTAEFGGYLSGPRVIDADTKKRMKQILAEIQDGTFVKRLVANVEGGN
KELEGLRKENAEHPIEVTGKKLRDLMSWVDRPITETA
375142953YP_005003602.1 putative phosphoribosyltransferase [Mycobacterium rhodesiae NBB3]MADREELTWDQFGAATRQLAAAVVADGFRPDLILAVARGGLFVAGALGYA
LDVKNLHMMNVEYYTGVDARLDAPVLLPPLPDVAELGGARVLIADDVADT
GATLRFVRDFCAEHVAEVRCAVVYQKPQSEVDCEYIWRRTDLWIEFPWSS
PELLRS
375142951YP_005003600.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPSEKSANSDVDEPLYTVRVVAERVGVPTATLRSWNQRYGVGPPEHSRG
QHRLYSETDIAVVRRMYELILEGASPRSAARTAVDSVRPARGDAAALLVA
AFDFDVFTAGHLLDRHLRHFGVLDTWDLLIRPAFDAIAERQAQGESCIDV
EHALSWTVTRSLQRYPIPAPAESAPIILACTPHETHTLALDALRAALVER
GRGALMLGADVPRSALIEAVERKGRPVATMLWSQTQDTADVDTVNDLAAR
ASVSVGGPGWDAVMDQIQAPRLKNLRAAVDYFVPD
375142949YP_005003598.1 phytoene dehydrogenase-like oxidoreductase [Mycobacterium rhodesiaeMGCNWVVDVTVVGSGPNGLAAAVICARAGLSVQVFEAQPTLGGGARTLPD
PEFGGVTHDVCSAVHPLALASPFLAAFDLPARGVTLQVPPVSYANPLPGM
PTAVGYHDLDRTCAELLDGDSWRRLLGPLVDRDGGVVNFLLGDKRSIPRD
PIAAAFIARNMLEQGTPLWGRLSGADARALFTGVAAHAINRMPSFVTTGA
GLMLATLAHTVGWPIPVGGSQAIPDALIADLRAHGGIISAGQQITEPPGG
VVLFDTAPTALLAIYRDRIPAKYAKALRRYRFGPGVAKVDFVLSDEIPWK
DSRAADAPTLHMGGGRDQMAHAEKEIAAGRHADWPMVLASLPHLADSSRI
DAHGRRPLWTYAHVPHGSTLDQAETVTSVFERFAPGFRDIVVGVRSVPAS
RLSEHNANLVGGDIGVGGNSLLHALAGPTPRFNPWATPIPKVYLCSSATP
PGGGVHGMAGLYAARTVLRREFGIKRLPPLSP
375142947YP_005003596.1 isocitrate/isopropylmalate dehydrogenase [Mycobacterium rhodesiae NMKLAIIAGDGIGPEVVGEAVKVLDAVLPGVDKTHYDLGAKRYHASGEVLP
ESVLEELRAHDVILLGAIGDPSVPSGVLERGLLLRIRFELDHHINLRPAR
LYPGVSSPLAGDPEIDFVVVREGTEGPYTGTGGAIRAGTPHEIATEVSVN
TAFGVRRVVHDAFRRAGRRRKQLTLVHKNNVLTYAGALWWRTVQEVGAEY
PDVEIAYQHVDSATIHLVTDPGRFDVIVTDNLFGDIVTDLAAAVCGGIGL
AASGNIDATRTNPSMFEPVHGSAPDIAGQGVADPTAAIMSVALLLSHEGH
VDAAARIDKAVEQHLATRGDQSRSTTEIGDRIASLL
375142945YP_005003594.1 sugar phosphate permease [Mycobacterium rhodesiae NBB3]METESISTARRWSMLVIALFATTSANVFINGAAFLIPTLHKERGLDLAAA
GLLSSMPSFGLVLTFIAWGYIVDRVGERIVLTLGSVLIAAAAFAAASVDS
LFAVGTFLFLGGMAAASSNSASGRLVVGWFPPDQRGLVMGIRQTATPLGV
GLGALVIPRLAESHGISVALLFPAVVCTVSAVVCAFGVIDPPRPPRSEAS
AEHLANPYRTSSVLTRIHAVSVLLVVPQGVLWTFALAWLMTDRGWSAAAA
GALITATQVFGAIGRIAAGRWSDVVGSRLRPIRSIALAAAAAMGLLALTD
WLNTPVSVVLMMIASVITVSDNGLAFTAIAEIAGPFWSGRALGTQNTSQH
LATAAAAPLFGGLIGVAGYPVAFAVSALLPLFAIPLVPVDQDR
375142943YP_005003592.1 glutamyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MTTGMRVRFCPSPTGTPHVGLIRTALFNWAYARHCGGAFVFRLEDTDAER
DSEESFLALLDALSWLGLNYDEGPDIGGPYAPYRQSERGDVYRDVLARLQ
ESGDAYEAFSTAEEVEARHVAAGRNPKLGYDNYDRDLTDAQRAAFLDEGR
RPVLRLRMPAEDITWNDLVRGETTFAAEVVPDFALTRASGDPLYTLVNPV
DDALMKITHVLRGEDLLPSTPRQIALYQALIRIGVAERVPEFAHLPSVLG
DGNKKLSKRDPQSNLFIHRDRGFIPEGLLNYLALLGWGIAEDRDVFSLGE
MVAAFDVVDVNSNPARFDQKKADALNAEHIRLLSEEDFTARLAAFFADHG
HDTGLDGAQFAEAARLVQTRIVVLGDAWDLLKFLDDGEFALDEKAAAKEL
RHDAVAVLDAALAALDEVGEWTTAAIENALKVSLLENLELKPRKAFGPIR
VAATGATVSPPLFESLELLGRDRSLNRLRAGRDHAAAAAAHA
375142941YP_005003590.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMTSATELGKTNHYGIIVGVDGSPASRVATDWAAREASMRGVPLTVVSVVP
TADFGSFVDVPYYTDEREEHAQKVVGDALGLVFDATADNPKMVVDQRVVS
GSAVSTLVDMSKDAELVVVGCRGLGGVTGLLLGSVSSGLVHHAHCPVAVI
HDEDPLMDYPSAAPVVVGVDGSPASELATAIAFDEASRRGVELVAVHTWM
NIADFPDDVARSDIATQADEELAQRLAGWCERYPDVVVRRVVAQDSPAHR
LLEESEKAQLTVVGSHGRGGFAGLLLGSVSSAVAQAARMPVIVARQK
375142939YP_005003588.1 acyltransferase- WS/DGAT/MGAT [Mycobacterium rhodesiae NBB3]MERLTTLDAGFLEAEDADQHISLAVGGVSVLEGPMPDFEELAADVLEKAA
AVPRMRQVLRTHLLDMQPPEWVDVPNVDLSHHIHHVALPQPGSDQELFRL
TADIMERRLDRERPLWECWMIEGLAGGHWAMLLKIHHCIADGITIMHMLS
QLTDGGAGDSFATDIRAAKEGSGQKNSPKIGLNPLNWARSGWRLAAAATT
SAELAFGGALRIAGGILSPADGSPLIGSVTTMRRYSAARVSLQDVAKVRD
TFGVTLNDVALAAVTASYRAALTRRGKSARRNSLRTLVPVSVRSNDAMGI
TDNRVSVMLPFLPVDREDPVDRLMTVHQRLNVAKSSGEREAGSAFIAAVN
VIPFPLTAWTVRALTRLPQRGVVALATNVPGPRHRLRIMDREVVRMMPIP
PIALGLRTGVAIVSYADELTFGITADYDAAPDVDELAAGIEHGVAELVAL
L
375142937YP_005003586.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMSKELGVVVAVDGSPSSDAATQWAAHDAELRGVPLTIVHATPPVVGTWPT
MAALPDVSSWQQDAGQRILEEAVAVATEAINIELRISTEMPPTATVPALV
ELTREAELVVVGNRGRGRLARALLGSVSMGLVHHSRCPVAVIRHEPSTAT
ALKSGPILLGFDGSPASETATALAFEEALRRRAELVVLHAWWGSGAFEFP
VEWDDLRIEVEESLARQMAVWQGRYPDVPMRTTVVRDQPALRLVDYPATP
QMIVVGSHGHGGITSTLLGSVSTAVVQAARVPVVVARS
375142935YP_005003584.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMSNLSPKYGILVGVDGSPESEAAIRWATHEAVMRNQPVTLMHAIPPVVVT
WPVAYLESSFAESQEANARDVIERAQKTVQASAGEAQPPAVRTEIRHIDA
ASALVSASRDAYMTVAGSRGLGAVGRAVLGSVSGGLVHHGHGPIAIIGPD
QAHTRDDTSPVLVGVDGSVASEDATALAFDEASRRRVDLVALHAWSDVGV
FPALGMDWHQYEDEGHEVLAERLAGWQEQYPDVHVRRRIVCDQAARWLIE
ESESAQLLVVGSHGRGGFAGMMLGSVSSKVAQASKAPVIVVRPRSDAK
375142933YP_005003582.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPTDPDRAKNAVRRFNKHVLNPVMLHLAGRKYWYAAVISHVGRRTGRQYA
TPVVAEPVPDGFLVPLPYGTQVDWLRNVQTAGKATITAKGRAYDVCDPEI
VDAATVSALLSSWRRQTFERFGIKSYLKVRTV
375142931YP_005003580.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTNGLRLAGLVAALYAARRYYRNWGTTKDECRMSLAGDELTVGPYVQTT
EAVWIDASSETVWPWLVQMGQDRAGIYTFEALENLIGLHYHNADEVHPEW
QNLAPGDTVRLARKGWLGLREGLTLQVESIVNGQSIVLRATSPQHLCDMV
WSFNLIPHWEDRCRLLIRVRTGLRHPGQVLITESMGPAVAFVTRGILLGV
KRRAQGQHQAELSAARASDDLHRVV
375142929YP_005003578.1 erythromycin esterase-like enzyme [Mycobacterium rhodesiae NBB3]MLASMLSAYRGREGLLVLGLPRGGIPVAWEVAAALGAPLDAFVVRKLGAP
GHEEFAVGALASGGRVVVNDDLLRALRMSPQQLRDVAEREGRELIRREAA
YRGGRPPLDLAGKTVILVDDGLATGASMFAALQALRDMEPAEIVIAVPAA
PESTCREFAQMVDDVVCASMPTPFLAVGESFWDFRQVSDDEVRELLATPT
TGLATATIRIAETSAEAIDRVAVDAPRGVPPFEALEEIIGEARIVLIGES
SHGTHEFYEARAEITKWLIETKGFCAVAAEADWPDAYRVNRYVHGRGADR
SSEEALAGFQRFPAWMWRNVVVRDFVDWLHDHNQRNESVGARGAGFYGLD
LYSLHRSIQEVIGYLDDIDPRAAARARTRYSCFDHTSADDGQAYGFAAAF
GAGLSCEREAIEQLVEMQKTALEYARRDGLIAEDEAFYAQQNAQVVSNAE
HYYRSMFGGRVTSWNLRDRHMAQTLQALLRHLDRHQDGPARIVVWAHNSH
VGDARATEVGGDGQLTLGQLARERYGDDCRLIGFTTYTGTVTAASEWGGI
AERKFVRPALNGSVEELFHETERPEFLVSPLISHAATEPLDTVRLGRAIG
VIYQPATERQSHYYHVRPSEQFDALIHIDRTRALEPLEITSHWETGETPD
TYPTGL
375142927YP_005003576.1 3-isopropylmalate dehydratase large subunit [Mycobacterium rhodesiaMTSEVKPRTLAEKVWDDHVVAHGAGEGDAREPDLIYIDLHLVHEVTSPQA
FDGLRLNNRPVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
QEFGIRLHSMGDAEQGIVHIIGPQLGLTQPGTTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGSLPAGVSAKDVILAVIAK
IGTGGGQGYVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMVAPDETTF
EFLRGRPHAPQGVDWDAAVAAWRELRTDEGAEFDTEVYIDASTLSPFVTW
GTNPGQGVPLSASVPDPELMFDEGERESAEKALAYMDLQPGTAMRDIPVD
TVFVGSCTNGRIEDLRVVADVLDGRTVADGVRMLIVPGSMRVRAQAESEG
LGEIFTAAGAEWRQAGCSMCLGMNPDQLSPGQRCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSSPADLSQ
375142925YP_005003574.1 nucleoid DNA-binding protein [Mycobacterium rhodesiae NBB3]MNKAELIDVLTEKLGSDRRSATEAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGP
AVKRGSSAGGARKAVKKTAAKKAAKKAPAKKAAAKKTAAKKSPAKKAVKR
TAAKKTVKKAAAKKSPAKKSPAKKTAAKKSPAKKAVKRTAAKKAVKRSPA
KKAAKRTPAKKGRR
375142923YP_005003572.1 polyphosphate kinase 1 [Mycobacterium rhodesiae NBB3]MTDAETETLTATSGSTTVRPPVPQSGGSAPEAPPAATSQAVDNALPEDRY
LNRELSWLDFNARVLALAADPSLPLLERAKFLAIFASNLDEFYMVRVAGL
KRRDEMGLSVRSADGLSPREQLRRINERTQQISNRHAHVFLDSVRPALAD
EGIVIVTWAEVDEGERTRLSTYFHEQVFPVLTPLAVDPAHPFPFVSGLSL
NLAVTVRQPEDGGQHFARIKVPDNVDRFVELARREGSSDVVRFLPMEELI
AAFLPVLFPGLEIVEHHAFRITRNADFEVEEDRDEDLLQALERELARRRF
GSPVRLEVSDDMTESMLELLLRELDVDTGDVIEVPGLLDLSSLWQIYDQD
RPALKDRPFVPATPPAFGERETPKSIFSTLRDGDVLVHHPYDSFSTTVQR
FIEQAAADPNVLAIKQTLYRTSGDSPIVNALIDAAAAGKQVVALVEIKAR
FDEQANIKWARALERAGVHVVYGLVGLKTHCKTCLVVRREGSTIRRYCHI
GTGNYNSKTARLYEDVGLLTAAPDIGADLTDLFNSLTGYSRKESYRNLLV
APYGVRRGIIERIEREIAAKQSGADAGIRLKANALVDEQVIDSLYRASQA
GVRVEVVVRGICALRPGVPGFSENITVRSILGRFLEHSRIIHFRAMDEFW
IGSADMMHRNLDRRVEVMAQVKDPRLSSQLNEVFDSALDPATRCWELDMD
GSWTASPREGETVRDHQVSLMESRRHP
375142921YP_005003570.1 glycerol-3-phosphate dehydrogenase [Mycobacterium rhodesiae NBB3]MVDAAVLGAGAWGTALAKVLADAGNEVRLWTRRAELAAEINDTHRNPVYL
GDAELPATIRATSDPAEALTGACTVLLAVPAQTLRANLVQWSPLIGDDAT
LVSLAKGIELDTLMRMSQVIVQVTGADPLRVAVISGPNLASEIADEQPAA
TVVACSDSGRAVALQRAFSTGYFRPYTNADVIGAEVGGACKNVIALASGM
AAGVGLGENTAAAIITRGLAEIMRLGIALGAKPATLAGLAGVGDLVATCT
SRHSRNRSFGERLGQGGTMESALRAAEGHIAEGVTSCQSILALADSYDVE
MPLTDAVHRVCHKGASVYEAVALLLGRTTKAE
375142919YP_005003568.1 D-alanine--D-alanine ligase [Mycobacterium rhodesiae NBB3]MNAHDEPDAALPAASDVGASGRIRVAVVYGGRSSEHAISCVSAGSIMRNL
DPQRFDVVAVGITPGGTWMLTDAEPDTLAIADRQLPQVTSASGRELALAV
DPGRGGELVSLSAGAGEVLGAVDVVFPVLHGPYGEDGTIQGLLELAGVPY
VGAGVLASASGMDKEFTKKLLAAEGLPIGDQVVLRPRQQTVSLEDRERLG
LPVFVKPSRGGSSIGVSRVTASDQLPAAIELARRNDPKVIVEAAIVGREL
ECGVLEFPDGRVEASTVGEIRVAGVRGREDSFYDFATKYLDDAAELDVPA
KIDDTIADEVRQLAIRAFQAIDCQGLARVDFFLTENGPIINEINTMPGFT
TISMYPRMWAASGVDYPTLLATMVETALKRGTGLR
375142917YP_005003566.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MVEAFMLIQTEVGRADVIAKQLADLPGVLSAEYVTGPYDVVVRVGADSLD
ELQAGVVPNVQQVVGVTRTLTCPIAGRVRP
375142915YP_005003564.1 uracil-DNA glycosylase [Mycobacterium rhodesiae NBB3]MGARPLTELVDDGWAHALEPVQAQVAQMGEFLRTELAEGRRYLPAGQNVL
RAFTFPFDRVRVLIVGQDPYPTPGHAVGLSFSVAPEVRPLPRSLANIFTE
YTDDLGHPQPATGDLTPWAERGVMLLNRVLTVAPGTPASHRGKGWEAVTE
CAIRALVARQQPMVAVLWGRDASTLKPMLDGASCVAIESPHPSPLSASRG
FFGSRPFSRANELLGKMGADPIDWRLP
375142913YP_005003562.1 DAK2 domain fusion protein YloV [Mycobacterium rhodesiae NBB3]MSVRRLDASALRDWAHTAVGDLITHTDEINRLNVFPVADADTGTNMLFTM
RAAWAQADAQASSDDVAEVAAALARGALQGARGNSGVILSQILRGLADVT
ASAAADRDGVLADVSGGLFGAALRHSVGLVVSSMGKAVPGTIVSVLQDAA
GAAEDAVADDSELAYVVSAAADAAAVALDKTTAQLDVLAEAGVVDAGGRG
LLVLLDAMSATLTGHVRPRDEYVPSPPHDHDIATAASVSPQFEVMYLLSD
CDAAGVETLRRGLEQLGDSIAIATTHGAAQYSVHVHADDAGAAVEAALPL
GTLSRIQITSLTGGPGARPTGGFARERAVLAVVDGSGAEELFEGEGAHVL
RLGARDPVSAKDLLHALVNTGAAQIMVLPNGYVAAEELVAGCTAAIGWGI
DVVPVPTASMVQGLAALAMHEADRQAVDDGYTMARAAAAARHGSVRVATE
EALTWAGTCEPGDGLGIAGDEVLIVGKDVATAGAGLIDLLLAAGGELVTV
LTGAGVDAAVGEALAEHVHREHIGTELVTYHTDHRGDALLIGVE
375142911YP_005003560.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNHKRLLWLVAIVAIAVLVAVQATNSSIDRSQFVASADIPTVAPGVDVLA
GIAVIPLRIRGYDYRRDAFGDSWADDNPAPGGYNGCDTRNDILDRDLVDK
SYVSIKRCPHAVATGLLHDPYTNTDIAFTRGEQTGAAVQIDHIVPLALAW
DLGARNWTDDLRLRFANDPANLLAVQGQANQDKGDREPASWMPPNLAFRC
QYAMQFIAVLRGYALPVDAPSAVALRDAASTCPTG
375142909YP_005003558.1 aldo/keto reductase- diketogulonate reductase [Mycobacterium rhodesMASPSITLNDGNAIPQVGFGVFQTPPDETERAVTIAFEAGYRHVDTAAAY
RNERGVGKAVAESGLPREDLYITTKLWNSEQGYDSTLKAFDASVDRLGLD
YVDLYLIHWPLPARNTFVDTFKAFSTLRDQGRVRSIGVSNFEPEHLRILI
DATGIVPAVNQVELHPRFPQDELREVHKQLGVATEAWAPLGQGALLDDPR
VTEVAERHGKTPAQVLIRWHIQLGNIVIPKSVTPERIVSNFDVFDLELSE
QDMASISSLGDGTRMGPDPRTFDFTG
375142907YP_005003556.1 protein-disulfide isomerase [Mycobacterium rhodesiae NBB3]MASKPKYDLRASDRKRNLAIQIGLTAIVVIFAVALVAYIVLSADEKPTAG
EAESIRVTSGQLIKKEGTDEPKAVLSLYEDFLCPACGNFEKQFGNTINKL
IDSGAVAADYYMVSILDRQGDGYSTRAANAAYCVAGDSTEAFRRFHAALY
AQQPEEGVGPFPDAARLTEVARQAGAGGEVPKCIQEETNADMVSGLAAAT
NVNSTPTIRINGEDYRPTTPDALIAKIEEIVGNVPALDSGAAPPAADPTP
VGPPPNAPAPAP
375142905YP_005003554.1 pyruvate carboxylase [Mycobacterium rhodesiae NBB3]MISKLLVANRGEIAIRAFRAAYEMGITTIAVYAHEDRNSQHRLKADESYE
IGDTGHPVRAYLSVDEIIRVAQQAGADAVYPGYGFLSENPQLAAACADAG
ITFIGPSADILELTGNKARAIAAARDAGLPVLNSSAPSSSVEELVAASAT
MEFPLFVKAVSGGGGRGMRRVTDASALQEAIEAASREAESAFGDPMVYLE
QAVLNPRHIEVQILADKHGSVMHLFERDCSLQRRHQKVIELAPAPNFPAE
LRDKICADAVAFARQIDYTYAGTVEFLLDERGHYVFIEMNPRIQVEHTVT
EEITDVDLVASQLRIADGETLEDLGLSQDTLQIRGAAMQCRITTEDPANG
FRPDTGRITSYRSPGGAGIRLDGATHLGAEIGAHFDSLLVKLTCRGRDYA
AAVARSRRALAEFRVRGVSTNIPFLLAVVNDPDFRAGRVTTSFIDDRPYL
LTAHTPADRGTKILNYLADVTVNQPHGPRPSTVYPHDKLPEVDLSEPPPA
GSKQRLTQLGPEGFASWMRESKAVGVTDTTFRDAHQSLLATRLRTTGLLM
VAPYIARMTPQLLSVECWGGATYDVALRFLKEDPWERLAALREAMPNICL
QMLLRGRNTVGYTPYPETVTKAFVEEATATGVDIYRIFDALNNVESMRPA
IDAVRETGVSIAEVAMSYTGDLADPGENLYTLDYYLKLAEQIVDAGAHVL
AIKDMAGLLRPHAATLLVSALRSRFDLPVHVHTHDTPGGQLATYLAAWQA
GANAVDGASAPLAGTTSQPALSSIVAAAAHTEYDTGLSLSAVCDLEPYFE
ALRKVYAPFDVVASGPPTPTGRVYHHEIPGGQLSNLRQQAIALGLGDRFE
EIEANYAAADRILGRLVKVTPSSKVVGDLALALVGAGISADEFASDPARF
DIPDSVIGFLRGELGDPPGGWPEPLRTKALAGRPPARPTQELSADDESAL
AQPGEVRQATLNRLLFPGPTKEFEAHRDLYGDTSSLSANQFFYGLRHGDE
HRVRLERGVELLIGLEAISDPDERGMRTVMCIFNGQLRPVVVRDNSIATE
VPAAEKADRANPDHVAAPFAGVVTVNVSVGEKVDAGQTIATIEAMKMEAA
ITAPKAGEVSRVAVSATAQVEGGDLLVVVS
375142903YP_005003552.1 pantetheine-phosphate adenylyltransferase [Mycobacterium rhodesiae MSGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAVLVNPNKKGMFSLDER
IAMIEESTAHLPNLRAESGEGLVVDFVKSRGLTAIVKGLRTGTDFEYELQ
MAQMNKHIAGVDTFFVATTPTYSFVSSSLAKEVAVLGGDVSALLPESVNV
RLQAKLEG
375142901YP_005003550.1 cell division initiation protein [Mycobacterium rhodesiae NBB3]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDTLLREAKEHSGSMVSSATAEADSLVNHARAEADRLLADAK
SQADRMVSEARQHSERMVAEARDEAARLAATAKREYEASTGRAKTEADRL
IENGNLAYEKAVQEGIKEQQRLVSQTEIVQTATAEATRLIDSAHAEADRL
RGECDIYVDSKLAEFEDFLNGTLRSVGRGRHQLRTAAGTHDYAAR
375142899YP_005003548.1 ribonuclease III [Mycobacterium rhodesiae NBB3]MPDRAPLLKALGVDLPDELLTISLTHRSYSYENGGLPTNERLEFLGDAVL
GLTITEELYHRHPDRTEGDLAKLRASIVNTHALADVGRELSDDGLGAYLL
LGKGEENSGGADKASILADGVESLLGAIYVEHGIGTAREVILRLFASLLD
TAPTLGAGLDWKSSLQELTASRGMGAPSYVVTSTGPDHDKEFTAAVVVAD
TEYGKGVGRTKKEAELKAAAAAWNALESASGVDA
375142897YP_005003546.1 putative redox protein- regulator of disulfide bond formation [MycoMGSMTELWVERTGARRYTGRSSRNAEVLVGSEDVDGVFTPGELMKIALAA
CSGMASDAPLQRRLGEEYATTIRVSGAADREQERYPLLEERMELDLSGLS
QDERARVLTVVERAIDQVCTVGRTLKSGTKVTFEVVDAGVS
375142895YP_005003544.1 chromosome segregation protein SMC [Mycobacterium rhodesiae NBB3]MWHVVHLKSLTLKGFKSFASPTTLRFEPGITCVVGPNGSGKSNVVDALTW
VMGEQGAKTLRGGKMEDVIFAGTSSRPPLGRAEVTVTIDNSDNSLPIEYS
EVSITRRMFRDGGSEYEINGASCRLMDVQELLSDSGIGREMHVIVGQGKL
SEILESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMSANLARLTDLTT
ELRRQLKPLGRQAEMARRAQTIQADLRDARLRLAADDLVSRKAEFEDTNH
TESTLRREHDELATRLEARTVELTAHESAVGSLSERAEASQQTWFSLSAL
AERVGATVRIASERAQHLDTEPVNSTGPDPDELEAQAEEVAAQERQLLEE
LTESRTRLEAARTELSEREAAAAEAERAHLAAVRAEADRREGLARLAGQV
DTMRTRVESIDETVARLTGGIEEAASKAQQTQAEFETVQSRVGELDAGEV
GLDDHHDRTVSALRLADERVAELQAAERGAERQVASLRARIEALSVGLDR
KDGAAWLQKHHGGAGLFGSIANLVKVRPGYEVAIAAVLGAAADAVAAENS
GAARSAVVALKQSDGGRAAIVLGDWPHPSVPNAGPPPDGAQWALDLVDAP
DRLQGAITALLSGVAVVSDLSAALDVVAARPHLKAVTADGDLVGAGWVTG
GSDRKPSTLEIASEVEKARGELVAAEKQTAELSAALAGALAEQAARQDAA
EQALAALNESDAAISAVYEQLGRLGQDARATDDEWQRLIKQRDELEAGRN
QTVQELTELEQRLHNAQQEPTFESEPVNRQESMAAAEVARAAEVEARLAV
RTAEERANAVRGQADSLRRAAAAERDARLRAQRAREARVHAAAVAAAVAE
SGRLVAQRLGAAVAVASRARDDVAAERQHRATALAKAREEVNELGAKIAS
LTDALHRDEIAKAQAALRIEQLEEHILESFGMAAADLVAEYGPDVTLPPS
ELEMAEYEQARERGEQVTAPAPLPFDRPTQERRAKKAERELNELGRVNPL
ALEEFAALEERYNFLSTQLEDVKAARKDLLDVIEDVDARILQVFAEAYAD
VEREFQEVFSTLFPGGEGRLLLTNPDDMLTTGIEVEARPPGKKIKRLSLL
SGGEKSLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLLGLFEQLR
SQSQLLVITHQKPTMEIADALYGVTMRDDGITAVISQRMRGEQLVGAAN
375142893YP_005003542.1 signal recognition particle-docking protein FtsY [Mycobacterium rhoMTDSVLWIAVAVIAVLLIAALVVGLVRYRRRRISLSSTDTATPVDRSGGY
TASSTIAFSQSAPPAEPVERIDTSGLPAVGDDATIPRDAPKRPIADVRLP
EPQVVEEPPAPPPADAPPPPTPAAPVLDEVAPAAPDVGAIAPPEGRLERL
RGRLAKSQNTLGRSMLGLLGGGDLDEDSWQDVEDTLLIADLGPVTTESVV
TSLRSRMASSQVRTEADAREVLRDVLVNELQPGLDRSIRALPHADKPSVL
LVVGVNGTGKTTTVGKLARVLVADGRRVVLGAADTFRAAAADQLQSWASR
VGAQVVRGPEGADPASVAFDAVDTGIEAGADVVVIDTAGRLHTKTGLMDE
LGKVKRVVEKRAEVDEVLLVLDATIGQNSLPQARVFAEVVNITGVVLTKL
DGTAKGGIVFRVQQELGVPVKLVGLGEGPDDLAPFEPAAFVDALLG
375142891YP_005003540.1 nitrogen regulatory protein PII [Mycobacterium rhodesiae NBB3]MKLITAIIKPFTLEDVKTGLEQTGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVVVDDSAVDKVVDVIVQAARTGKIGDGKVWVSPVDTVV
RVRTGERGTDAL
375142889YP_005003538.1 signal recognition particle protein [Mycobacterium rhodesiae NBB3]MFESLSDRLTGALQGLRGKGRLSDADIDATAREIRLALLEADVSLPVVRE
FVARIKDRAKGAEVSGALNPAQQVVKIVNEELITILGGETRRLAFAKTPP
TVIMLAGLQGSGKTTLAGKLAKWLKGQGNTPLLVACDLQRPGAVNQLQIV
GQRAGVEVFAPHAGTIEGSDDASPGDPVAVASAGLAEARSKHFDVVIVDT
AGRLGIDDDLMGQAAAIRDAVNPDEVIFVLDAMIGQDAVTTAEAFREGVG
FTGVVLTKLDGDARGGAALSVREITGVPILFASAGEKLEDFDVFHPDRMA
SRILGMGDVLTLIEQAEQVFDAERAEEAAAKIGSGELTLEDFLEQMLAIR
KMGPIGNLLGMLPGAGQMKDALAAVDDKSLDRLQAIIRGMTPAERADPKI
INGSRRLRIANGSGVTVGEVNQLVERFFEARKMMSSMAGQMGMPFGRKNS
NRKSGKNKKNKNKKQGRGPTPPKVRNPLGAGLPAGFPDLSDMPKGLDELP
PGLADIDLSKLKFPKN
375142887YP_005003536.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium rhodesiae NBB3]MRKLLAALAITLCSVSVIAPPATAQPVMEPSGAVALPDGPAQAWLVADLD
TGAILASRNPNEAHAPASTIKPLLAMVVLDHLRPDNFARANSSHTEVECS
CVGLKPGQPYTVLQLLSALLMVSGNDAANMLADMLGGQGVAVPAMNRKAA
ALGARSTKASSPSGLDGPGWESTTTPLDLALIYRAALKYPLIAQIMQSQS
AQFPGKTLTNQNELLTRYPGTFAGKTGFTNLARETFVAAAQRGDRRLVVV
EMYGSGDLYGQAINLFDWGFSQPR
375142885YP_005003534.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLSLEEISDRLEIQQLMIDYSNAIDQKQFDDLDRVFTPDAYIDYRVTGGI
DGRFPEVKAWLKEVLPNFPAYYHMLGNVDVRITGDTAASRTICFNPMVFN
AEEKQILFVGIWYVDEFIRTAEGWRMNKRVEEKCFDKLL
375142883YP_005003532.1 30S ribosomal protein S16 [Mycobacterium rhodesiae NBB3]MAVKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEVIGRYHPKEDPSLIE
IDSERAQYWLGVGAQPTEPVLQLLKITGDWQKFKGLPGAEGTLKVKEPKP
SKLDLFNAALAEAEGGPSGEATQAKKKKAPAKKAADKAEKADDAVATETA
AVKDESEPAAEGADATVDGATES
375142881YP_005003530.1 16S rRNA processing protein RimM [Mycobacterium rhodesiae NBB3]MDLVVGRVVKAHGITGEVVVDVRTDDPDIRFAPGADLRGRARGGTERRFV
VESARPHGGRLLVRLDGVADRAGADALRGTLFLVDSSDLPPIEDPDEFYD
HQLEGLRVVTTQGRLVGNVAEVLHTAAGELLSVTSETGAEVLVPFVGAIV
TSVSLADQTIEIDPPEGLLDLE
375142879YP_005003528.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTLTKGHCPMTQFNCQITRRAMLGGLGVGVAAMATAPQASAVLDKDFEAM
LMKCIDPRFTTNSWNYMTNRGWQNQYSEFAFAGGPIGAVAPVFAGWHETF
WDNLAITVQLHWVERVIGMAHRDCGAAAVAYGDRVLTDRAYETEMLSSAL
RDFRTQVQQRQPMLAVELGIMDFDGNMELVV
375142877YP_005003526.1 50S ribosomal protein L19 [Mycobacterium rhodesiae NBB3]MNTLDFVDQTSLRDDIPDFSPGDTVNVHVKVIEGSKERIQVFKGVVLRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIDVVTRGDVRRAKLYYLR
ELRGKKAKIKEKR
375142875YP_005003524.1 ribonuclease HII [Mycobacterium rhodesiae NBB3]MIRRSSGLRTLESALYRSGLGPVAGVDEVGRGACAGPLVVAACVLGPNRL
DSLAALDDSKKLNEKERERLFPIIRRYALAYHVVFIPSEEVDRRGVHVAN
IEGMRRAVAGLSVRPGYVLSDGFRVPGLSVPSLPVVGGDAAAACIAAASV
LAKVSRDRLMVKMEAEHPGYGFAEHKGYSTPAHSAALADLGPCSQHRYSF
INVRRLVSVDGTSPEMGPVWVPDFALDTEPEQQSRFG
375142873YP_005003522.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAERKDRVVVWATGGIGSIAIRAIHERPNLELVGVWVHSPEKDGMDAGEL
ANGEPIGVAATTDADALIALKPDCVIYAASGPERDALAIPDYVKLLSAGL
NVVTTSTTRLVNPHAYEPVEWRDQLVTAAKAGQASLYASGIEPGFAADYL
ALVLATQSSQIEKIHAYEIGLYDDYGVPDIMSDAMGFGRPLDYQPWIAMP
GAIEGEWQGQIRMVADALGVEVSEMRSTFDRAVTERTLEVAMGTVEAGTC
GALRMQAIGVVDGREAIVIEHVTRLAPDVAPDWPTLPNALGYRVVITGTP
DIDCTFDVTLRDRKKAGIESMTSGAGAMVATAMRVVNAVPYVVDAQPGLL
SSVDLPLTIPKGAFNPA
375142871YP_005003520.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTGASTTDLYYDPFDFDIDDDPYPIWRRMRDEAPLYHNEKYGFYALSRYD
DVARELHNWETYRSGKGTTMDIIMSDIPVPPGVILFEDPPLHDLHRRLLS
KVFTPRRMEAIEPLVRQYCVRALDALAGTSRFDLIADFGALIPMRTIGYL
LGIPEEGQQQIRDNTDESIGLKEGSFQSVSAAAFENAYQLFADYTDWRAE
HPSDDLMTQLLNAEVEENGALRPLTRVEVLTYTSMIAGAGNETTTRLIGF
IGQLLDQHPDQRRELVEDFSLIPRAIEEVLRFEAPSPVQARHVARDTEAH
GQTVPEGSVMLLLNGSANRDERHFPKGESFDIHRTGPHLSFGQGLHFCLG
SSLARMQARVALEEILTRWPEWRIDYDDAAMAHTSSVRGWGRLPMVTG
375142869YP_005003518.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIVRTSAVEREQIFRAVAIERRRIADFVDTLDDDALTSASLCAGWDVKTV
AAHLVSVFADGFWTFQRTAIRHRGFDRAIDVLARRRAHAPTAEITATLRE
HADHRLSPPITGPLSGLTDVLVHSGDIRIPLGLEFKPDDEMVGWALDFLT
GPHPLGFVPRGRLRGIALHSTDTARSWGEGAEIRGPAAVLMMVATGRTAT
LDMVEGPGVPVLRGRLT
375142867YP_005003516.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTADAELQERLARLEARAEIRDCIERYARGMDRRDRAILRSAYHDGAVDD
HVGFVGEVDDFIDWAFAYHSTQTRYQHYLLNHTADIDGDEAHAETYYLFV
GTDKEPANHMTLSGGRYVDRLERRDGRWAIVDRVCVVEWNAESTSFITDE
VIAMMAGTMKVATHDTSDPSYDRPLAAARPATQA
375142865YP_005003514.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMNMNDMVLVSVDDHMVEPPGLFDKHIPAKYKDDVPKLIQREDGTDAWVFE
GAEATNVGLNAVAGRPPDEYGAEPTKLSEIREGCYNIDERIRDMNANGVA
AALNFPSFPQFCGQYFARAKDKELGLAVLRAYNDWHIDEWCGAYPGRMIP
QALPPIWDPQLMADEVRRVAKKGCHAVSFSENPTKIEHPSLHDPHWDPFW
QACSDEGTIVNLHIGSSSSVVITSLDAPVDTMITLQPMSIVQAAADLVWS
PMLRKFPDLRFALSEGGIGWVPYFLERIDRVYKMHRAWTHQDFGDKTPSE
VFLERVALCFIDDEFGVANRDKLNMDMVTWECDYPHSDSTWPLAPETLDI
YLDGLDDDEVDKITHENALRLYNFDMFSHIPKEQLTVGALRAQATDVDLG
FRSSERLKKDGTDTVSVLDLASKIAT
375142863YP_005003512.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSYPQEAEQFRKELQAWLSAHLTDTVIAASARRGSDEDAFETLRAWNA
TIADAGWAAVSWPQQYGGRGASAIEQLVYAEEATRARVPHPLNTIGINNI
APAIMQYGSDEQKAALLSRMLRADDIWCQGMSEPEAGSDLASLRTKAVRD
GDDFVVSGQKIWTSLGHRADWCQLYVRTDPEAPKHKGISCLIVDMSLPGI
EARPLVTLSGDADFAEVFFNGVRIPVDALLGPLNKGWQVATTTLSHERAG
AARLYAEMQLRLRDLVADLVADDSSAVDDPSTVRRLGELDTRIKNLEILC
QRSISAGMHGGDAFATAGLAKSVWGEIGKDLAALAFDTLGPGAGDGRWDE
FRLTSHALTIAGGTTQINKNITAQRVLGLPRS
375142861YP_005003510.1 ATPase family protein associated with various cellular activities (MANEAGLAYQNGAMPQTDSARPYYQALSNEEAVFKAAYRQGLSLVLKGPT
GCGKTRFVEAMAHDLGRPLITVSCHDDLTTADLVGRYLLRGDETVWTDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLGDHRRQLPIERLGITLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGYPVPEVEEGIVVHESGV
DAATAAELVKFGQAIRRLETGGLREVASTRVLIAAGQLISEGLSISDAAR
AAIAGPLTDDPTVTRGLNEMIDVYLGNQHVSSGD
375142859YP_005003508.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTQESLPPDTTTDSSKPARTGPNWGRVIALIGWLGFWAMFLAVARTDVD
PRVANPNVEGRPRPVEFLTAFDHWQIVPQVGALLMVVVLTIVFIRAWRRN
PGSPVLLMVLVTTVIVWQDPIMNWAPYAVYNPALVHWPENWPLVMMSPTV
EPFIVFGYVTFYFGPYFPAIWILRKLQAKWGPEAFVSRHPLLSLGGLVLV
IGFIFDAILEVSLVRTGLYIYSQAIPFGTLFPGSTFQFPLIWESLAVTFV
MVPAAILVYRDDTGKSVAEKLAAKARLFPTKPVLGTFIVMFVIVNVAYFA
YGSWFWAIKASGLATSVACPWPYPEAKIYDPQGYYRANGAEGPYSVGKWA
TWQQGPSRNVDVELGSKSNRCASEDANE
375142857YP_005003506.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTEATKVKFESKMMIDGKLVDGESGTFTNINPANEDVLGEVADASKADMN
RAIDAARRSFDETDWSTNRELRKRCLLQLHDAIESELEELREELILEVGA
PRAVTHGPHLDAPLEDGLKYPARLIDSFEWEADLGDKVVSVTGVNTRRKV
WHEPVGVVGAIVPWNFPFEVTINKLGQALATGNTVVLKPAPNTPFNATRL
GRLIAEKTDIPAGVVSVVTASDHFVGEELTLSPKVDMISFTGSTVVGKRI
MEKGAATMKRLFLELGGKSATIVLEDADFNTACLIGIGPLMHAGQGCAAP
TRMLLPRSRYDEGVAILKGIYENIKAGDPQDPGTICGPVISAKQQQRILG
YIRKGVDEGATMLVGSPEPPKEFDKGFWVNPTLFTDVDNSMTIAQEEIFG
PVLVVIPYEDEEDAIRIANDSVYGLAGNVMSSSLDHSLAVARRLRAGFIG
LNGTAGYGADTPFGGYKDSGVGRQNGLVGFSQYTEVKSVAYPAT
375142855YP_005003504.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTNFDSVDYFTDMSLVPDPYAYYDHLRSKCPVQHATPYGVVAVTGHAEAL
AAYKDPAMSSCVAVAGPFPPLPFTPEGDDISAQIEAHRAAIPMAEHVVTM
DADAHQKTRGLLSKLITPKRLSENEDFMWRLVDQQLDKIVDRGSCEFMED
FAKPLAMLVIADLLGVPAEDHDEFRSIFGSEPLGEIEGNEGETVAHNPLM
FLDEKFTAYISDRRREPRQDVLTELAAATYPDGSVPEVDEVVKLATFLFA
AGTDTTTKLVSTAMRVIGERPDIQQSLRDNRSQIPAFLEECLRMESPVKS
HFRLARTSTKIGDVDVPAGTILMMLPGASNRDPRKFEDPNEFKHDRSNVR
EHVAFGRGPHSCPGSPLARSEARIAMNRILDRMANIRISTEMHGPVEDRK
YEYEPTFIMRGLTALHVEYDAIPDA
375142853YP_005003502.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MPGRLEGKVAFITGAARGQGRAHAIAMAREGADIIAVDICRDIPSNPYPL
ATPDDLAETERSVKEIGRRVVARVGDVRERHELREAVEAGLADLGKIDIV
VANAGILPMAMGRPHDPMSFVDASDVDLLGVMNTVAVTVPHLSDGASVII
TGSTAGMIRGTTDNPNMGPGGRGYGWSKRVIIEYVEEMSMALAPKMIRVN
AIHPTNCNTHLLQNDGMYSMFRPDLTQQGKQATREDAEPLFTLFQAMPIP
YIEPDDMANLGVFLASEESRYITGQQIRVDGGSLLKWPNGPGG
375142851YP_005003500.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MVTESVAEFDSRARSWLAENMPTVEMDNPPALARDTDAAWQRARELQRRL
HDGGLAGICFPREYGGLGLGYEYKKAFDAACVGYEMPVMLNIPCFAICCA
TLLDVGSEEQKRQHISAALRGDEVLVQLLSEPSGGSDLAGVITRAERRGD
RWVLNGAKTWSTFAFAADYGLCLARTDWNVPKHEGLTMFLVPIHSPGVTM
NRIKQVDGTIDFCEEFFDDVELGDDAVVGEPGKGWEVASRQLYHERRTMG
DGSEFTVGAGLEASQDLSVDFFRLLEMTDQADDESARRLAGRALAHRVVN
QQLSEHVFHSVADGSLPLTAGAIARASLADSHNLDTDTALAIASTSSVVG
DDEGLEIGVRYLGRQIINIGGGTTEMARNVIAERVLNFPREYAADRGVPF
NQVRRNKQEGTRS
375142849YP_005003498.1 dihydrodipicolinate synthase/N-acetylneuraminate lyase [MycobacteriMAKAKDARQWARTALHGIGNSLYTPFSGRDGDDIDWDAYRTLVRYCVGAL
GHPMLWVTSGLAEFWSLTTGERKQLLEVAVTESRAVNPDVVIQACTAALS
AKECLELTRHAQDSGADIVYIQTPMMELHGGEGVLNYFRYIADRTDIALG
LFNSPSSGYVLSAQEAARIVEEIPAVCATKEGAFRPHQSRMLHELAPELV
IWECDTTVYRAGWLKAGIVGPGQLGTAGYLFETPEKRVFSEYWDLVWNDK
LLEAMDYAQESGLDQFELDMRGWFTRYPGRPDYFTHWGGAYKYAASVLGL
PIGDYPESRPPQVALPDQARDDIRAAYRKFGLVAS
375142847YP_005003496.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPQPSSAKKAAATESARRPRGEARRLLLDAARELFARQDYRGTTTREIAE
AAGVTEYLLFRHFGSKAGLFREALVLPFTNFVDDFGATWQAVVPEETEED
ELAKQFVGRLYDVLVQHQGLLLTLIASDGLSDEEIDSAGIADIRRALTVL
GQISAEGMSIRGMRSTQPDLPAHSTVAMIVGMVALRSTFYGSEPPPREAI
VDELVQATLHGFLHRP
375142845YP_005003494.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPLLVAANAFGWLSGILFTIAGIYLSVRRGRLHPLLLLCISAISFSWIE
APYDWAMYAQFPPALPRMPSWWPLNMTWGGLPSSVPLGYIGYFCIPAVTG
AWLGRRLVARFNWRAPITLLITGLVVGFCWALVFNAGLGARLGVFHYAYV
LPGLAIFEGTLNQYPIYDAIAMGIQMMVFTYLLGRTDSEGRNVIEMWSDK
LSKTKVQSAVLSIVAVIVIGNVLYGAVFAPHLVTMKLGYVTSGPDVQLFP
GVENQPR
375142843YP_005003492.1 citrate lyase subunit beta [Mycobacterium rhodesiae NBB3]MSQPSRLRRSELATPASNEHMCEVAARAGADLVFLDLEDACAPAAKESAR
ATAVAALTDLDWGRTVRAVRINGLDTQWCHDDIIEVVSGARDALDVIIIP
KVLSARDVWWVDVLLTQLETKLRLTRRIAVEALIEEAEGLLNAQEIARAS
ARLEAIIFGAGDLSASLHARVDGNFQPAGDYPGDYWHAVRVQVLAAARAA
GIAAIDAPYPGYRDADGYRRAAAQASMLGYDGKWAIHPDQVPIANAVFTP
TDEAVAEARAIMDDYRRAESEGIGAVGRNGKLVDAALMRHAANVLRRAND
375142841YP_005003490.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGSQLPEGFSEIEEWVDDWALPTRAERYRARLDRPYDDLVAFYDGMAPHA
ERAIAYLDERDINALRPEEKRLMNLLFSMILVSYAVNIFKQNRIPDSGAA
FFEMVAEPAL
375142839YP_005003488.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMAKRTRFSEYQNSYANYKFELTDDGILFMQCHTDGDSLVWSWKAHDEMSD
AFADIAGDREIKVLIHTGTGENYNANWGRLPNGEPPEKPIYQAMPDDRGT
HKLDEKAWYARHLIFNVLDVDVPMISAVNGPCNMHSEVPIMGDIVLASED
AYFQDASHFPRGQVPGDGQHVIWSVLAGHNRARYFLLTGQKLSAQEAKEW
GVVNEVLPKDKLLDRAWEHARELIKRPPLTLRYTRQLFTNPLKRAFVNEL
GHGLGRETYAQRVFFPFGGEMEPLDRPWDQQPWSNANGQPVDEGARQ
375142837YP_005003486.1 putative taurine catabolism dioxygenase [Mycobacterium rhodesiae NBMAETRALSAEFGAELVGITDTDDLLDDTVIAACREALKWRGVLLIRGAHF
DDDGQLAFSRKFGGEGGTPGGKELSTISMDKKVNRLAEYLKGAFHWHLDD
TTSEVPSRATMLTARRLSAEGGGTEFANTYAAYENLSDVERKHYDGLRVV
HSFEAAQRKVNPDPTDEELAIWRGVPSHESSLVWQRRDGRRSLVIGATAD
HIVGMPADESRALLDELLDWATQPRFCYAHEWCVGDAVLWDNTAVLHRAL
PYDLSSDRMLRRTHIRGLEAWA
375142835YP_005003484.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MATRRGRPTQAEAKKLDLAVREAAVATFLEMGYAGASMEAIARAAGITKR
SLYARYPDKRAVFADVIPWALARYTDDGSIDEIDDDDLETALLAVGRAAL
TRATHPENVRLKRIAFNEAAQFPEFNVSAESMMWAGRQRAVTELLRRYEQ
RGTIKVDDLELAAEHFLAMVEAVPARMADFGVFRSKKQQERHLQFAVRLF
LRGVMPR
375142833YP_005003482.1 putative iron-dependent peroxidase [Mycobacterium rhodesiae NBB3]MTLELDDIQHILLTRTPAITGRYEFLTFDTPHGGRAWLSELLPKTQSATE
ATATMDESDRWVTLAFTWTGLRALGVPEESLATFPEEFRAGMASRADILG
DTGAAAPEQWVGGLAGDDLHAIAILFSRTDEQCARSIEEHDKLLARTDGV
RSLSYLDLNATPPFNYAHDHFGFRDRLSQPVMKGSGEEPTPGSGAALEPG
EFILGYPDENGPVPTLPEPEVLSRNGSYMAYRRLQEHVALFRDYLRENAE
TPDQQELLAAKFMGRWRSGAPLVLAPDEDDPELGADPMRNNDFNYKEMDP
FGYACPLGSHARRLNPRDTAHYMNRRRMIRRGATYGPALADNAPDDGIDR
GIAAFIICADLIRQFEFAQNVWINDKTFHELGNEHDPICGTQDGTLDFTV
PKRPIRKVHKGIPAFTTLRGGAYFFLPGMNAMRYLVSLGD
375142831YP_005003480.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKLTKRYAYLAVVLTLTPVGIVAAAPPAFADCTNAGYATVCAQGEVRGGG
PTPPSGPAYPGYCADPWYCSDDWGIDINLGRPGFGGGGGGGNRPSVGPR
375142829YP_005003478.1 putative HAD superfamily sugar phosphatase [Mycobacterium rhodesiaeMRSTPQCWLTDMDGVLVREEHALPGAAEFLQRLVDKERPFLVLTNNSIFT
PRDLSARLLRSGLSVPEASIWTSALATAAFLADQLPGGSAYTIGEAGLTT
ALHAVGYTLTDVDPDFVVLGETRTYSFEAITKAVRLIIGGARFIATNPDV
TGPSAEGPLPATGSVAAMITKATGRDPYFVGKPNPMMFRSALNRIEAHSE
NTFMVGDRMDTDVVAGIEAGLETILVLTGSTTVEDIERYPFRPSRVLPSI
AEAIDLV
375142827YP_005003476.1 arginase family hydrolase [Mycobacterium rhodesiae NBB3]MRVADIELIGVPFDGYGRPGHQANAAAALHAAGLADAFDHHHVTHHHLEL
PPPDPARGASTSLINEPALLAMTDALNILVGEAITAGRFPFVYGGDCSAL
FGIMTGLRDHVGDAGLVFVDGHEDTMPLDVSEDGEAANTEIGLLLGLTGR
LLTGALGDRLPALEPEQLVVLGPRDDAWRRRFNVGTLAEAGVWVAPLAEV
ADDPAAVGRAAVDELADHVGRWWLHVDLDVLDPAEFSAQGLPGVEDEPGG
LTWDQLTDLVVSLFGSPAHCVGASLAIYDPDQDDGNADADKIVAFVRNAL
ARTTISP
375142825YP_005003474.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSSDPLRPLAGVRIVEISSFVAVPLAGMTLAQLGAEVIRVDPIGGAADYR
RWPLTAEGESIYWAGLNKGKRSVAADMRSPDGQDLVQRLIAGSDVLITNV
AGREWHSYDVLTRLRPDLIHVEVSGRSDGGTGVDYTVNASIGFPMVTGPA
ELATPVNHVLPAWDVTCGIYTALSVTTALRHRDATGQGQRISIPLENVAL
ATAGNLGFFTEVMINGTSRQRIGNAVFGQYGQDFTSSDGASFMIVALTNR
HFRDLTELTGTTKAVAALAETLGADFTDEGQRYEHRGALFGLFNEWFSQH
TAQEVTDALSASSVLWDRYRTFAEAARGDRVTANPLFTSLDQPRIGEYLA
PGLPMSIGGVYPAAEVSPALGDDTAAVLGEWLGLGPDEIARLTDAGTVE
375142823YP_005003472.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MYVRIMLATPVQVAIAALRAAHESLAACDLESLTHRELLGVLDELETLTC
QLPVQWHRALARLQAETTAKELGAKNWKDVLRIRWRISATEANKRLAEAE
VLGPRRALTGEPLEPVLAATAAAQVAGLINGEHVDKIRDAMGRLPGFVDT
VTREQIEADLVRLAAGVGPKELGKAAETMLFLLDQDGPEPDDAERHRKRG
VVVGPQQRDGMVPIKGYLTPEAWAIYEAIFAKWAAPGMCNPDDDEPCISG
TPSQAQIDGDHRSLAQRQHDALIAVGRNTLESGQLGQHNGLPTSIIIRTT
LQDLESRAGVGTTGGGTIIPIKDVIRMAAHAHHHLAVFDGATGSALDLFR
AKRVASPAQRIMLIARDGGCTKPGCTVPAYGSQVHHAACDWADDGQTNID
DLALACGPDNRMVAPNGWTTRINADNDVEWIPPEHLDTGQTRINYCHRPE
LLLRPPEQPDGNSERGP
375142821YP_005003470.1 spermidine/putrescine ABC transporter ATPase [Mycobacterium rhodesiMTEAMVDISGLTKSFNGHVVLDHIDLQLQRGTTTAVVGASGCGKTTLLRL
IAGFETPGEGTVTIDGREVASPQRAVPPHRRSVGYVAQDGALFPHLTVGQ
NIAYGIRGEGRDTVRRRVGELLETVSLDPSFADRRPDQLSGGQQQRVALA
RALARQPVLMLLDEPFSALDTGLRATTRKVVAGLLADAGVTSLLVTHDQE
EALSIADQVAVMRDGRFTQVGSPQHVYREPHDRFTAEFLGDSITMPCVVA
SGIAECAIGRVPVRADDGPGTLLLRPEQLVAKVVTDDGELDRVGKVLAVE
FLGHDVLLTIDPAGEIEPIIVRQNSLEPPAIDAKVRIEVVGNGVVFT
375142819YP_005003468.1 Fe3+ ABC transporter periplasmic protein [Mycobacterium rhodesiae NMRPRWSRIAALVSTVAVVLGATSCSSSSESDELLIYNAQHESLTREWIDA
FTEETGIKVTYRQGGDTELGNQLVAEGDASPADVFLTENSPAMAAVERAG
LFADLDSATLDQVPAQYRPATGKWTGVAARSTVFVYNTSKLRPDQLPQSL
LDLQKPEWKGRWGAPPTKADFQAIVAALLQLKGEAETSKWLAAMKSGATL
YSDNIATLKAVNAGEVDGGVIYHYYWFRDQAKTKEMSANTALHYFKNSDP
GAFVSLSGGGVLESSKKKDQAQQFIQFITGKKGQEVLENGTSFEYPVASG
VPANSALPPLDSLQAPPVDPSTLNSAQATELMTKAGLL
375142817YP_005003466.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTEVTTAGKPPVVDNETWRAALDDLRVREKAATRELDAIAAARRRLPMV
EMDDYTLTGADGPIRLVDVFDGRSQLIVYNHMWQDGAEWQCGGCTGFTSQ
FTRLEFLDNYDARFVIVTNGPIDEALAYREKVGNRMDWYSAAGTSFGADV
DAAPGEGFGVNVFLRDGDAVYRTWHTNGRGTEQLSHSFALIDLLPYGRQE
EWQDSPEGWPSRPTYSGWLDSPDIARAYGRGD
375142815YP_005003464.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTFPKTSWTRAEIGALGERLAVEHLQSSGLRVLARNWRCRYGELDVIAAD
DTARIVVFVEVKTRTTDRFGGVEHAVTPEKLRRLRRLAGLWLARQDTRWA
SVRIDVIGVRIGRRPIPEITHLRGVG
375142813YP_005003462.1 DNA protecting protein DprA [Mycobacterium rhodesiae NBB3]MTDQISRAWAYLSRVAEPPCPELRALTRRVGPVEAAERVRTGDVDDVIAR
RTEARRQIDCAANDLETLDRMGGRLINADDAEWPLLAFNSFCGVSGRPQA
HEPMVLWVVGPAYLAGIAERAAAIVGTRAATAYGEFVAADLAAGLAARDA
AVVSGGAFGIDGAAHRAALAADGVTVAVLAGGIDVPYPAAHAAMLRRVRG
EGLVISEYPPGERPARHRFLTRNRLVAALAGATVVVEAGARSGAANTAAW
AGALGRPVCAVPGPVTSSASVGCHALLRAGANVITRTEDLVELIGRAGEL
APEEPRPASPLDELADAERHVYDALPARGSRTADEVAVAAGLPPMQVLGP
LAVLELSGLVVRSEGRWKLARRT
375142811YP_005003460.1 alpha-hydroxyacid dehydrogenase- FMN-dependent L-lactate dehydrogenMAFSDYEFEIYLQGLSGVLPLLPMSFAELEAKAQAAMSPGIWSYVAGGAG
DERTQRVNVTAFENWGLMPRMFVGAAERDLSVDFLGLNLPSPAMLAPVGV
IALCAQDGRGDLATARAAARTGVPMIASTMSADPMEDVAAELGDTPGFFQ
LYTPKDRDVAASFVHRAEAAGFKGIVVTLDTWIPGWRPRDLTTSNFPFLR
GHCLANYTSDPVFLDSLAQPFEENPQAAIMQWISIFGNPLTWDDLPWLRS
LTTLPILLKGICHPDDVRRAKDGGVDAIYCSNHGGRQANGGIPAIDCLPG
VVEAADGIPVLFDSGIRSGVDIVKAIALGASAVAIGRPYTYGLALGGEDG
IVHVLRSLLAEADLTMAVDGYRSLKELTPDTLRRVT
375142809YP_005003458.1 metalloendopeptidase-like membrane protein [Mycobacterium rhodesiaeMRFFALLLTVAIALGAPASADGERLEWPLRPRPAVMRMFDAPSPNWQPGH
RGVDLAGTPGQRVYAAAPGTVVFAGELAGRPVVSVAHRGGLRTSYEPVVA
AVRAGQRIDAGTMLGELQAGHAGCAAPACLHWGAMWGPASRADYVDPLGL
LASTPIRLKPVR
375142807YP_005003456.1 translation elongation factor Ts [Mycobacterium rhodesiae NBB3]MANYTAADVKRLRELTGAGMLDSKNALVESEGDFDKAVELLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNSETDFVAKNAEFQAAADQIVAAAAAAK
ATDVDALKAAKVGDTTVEQLIADLSAKIGEKLELRRVAYFDGNVETYLHK
RSADLPPGVGVLVEYESGDNEKGTAAAHAVALQIAALKAKYLTREDVPED
IVANERRIAEETAKEEGKPEQALPKIVEGRVTGFYKDVVLLDQPSVSDNK
KTVKALLDEAGVTVTRFVRFEVGQA
375142805YP_005003454.1 glycerate kinase [Mycobacterium rhodesiae NBB3]MKIVLAPDSFKESMSATEAVAAMRAGVLEVIPDAECIGVPMADGGEGTVD
AVVDALHGQHVETEVADPFGRTITARYGYIPLRQLAVIEMAAASGLELIP
PDQRDIRRASTFGVGQLIRSALDRGAEELLIGLGGSATNDGGAGMLTALG
ASFVDVDGTPLEPGGAALRHLDHIDVAGLDPRLRDVRIRVASDVTAPLLG
PTGASAVFGPQKGATPADVEILEAALTQLATVSYKTLGNVNPQRPGVGAA
GGLGFALVEFLGAETKPGVDEVAETVGLERAVSGADWVLTGEGSVDAQTV
MGKTPFGVAQVAVRAGARVAIFAGRVAPDASVLLGHGVERLIAITADGTP
LEQALREGAQSLTRATVDFCREITG
375142803YP_005003452.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MELICVKIIDMKDMLEDQPLGYLLSRVANALRAEVTATVLDPMGLAFPQY
ICMRILSKNPGRSNADLARDTNVTPQAMNMVLRRLEGRGLVTRPASVESG
RSLPARLTREGEDLLKRTDAGVRAADRKLMSGLSAEQRREFKRILITLGS
D
375142801YP_005003450.1 uridylate kinase [Mycobacterium rhodesiae NBB3]MAEPDSQPTSPNGADPVSPGDASMRPVYTRVVLKLGGEMFGGGQVGLDPD
VVHLVARQIAEVVRSGVQVAVVIGGGNFFRGAQLQHRGMERTRSDYMGML
GTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYIPLRARRHLEKGRVV
IFGAGMGLPYFSTDTTAAQRALEIGAEVVLMAKAVDGVFTADPREDPGAE
LLTAISHREVIDRGLKVADATAFSLCMDNGMPILVFNLLTDGNIARAVAG
EKIGTLVTT
375142799YP_005003448.1 CDP-diglyceride synthetase [Mycobacterium rhodesiae NBB3]MTDQHITPVTDTPVEEPPKKSSRAGRNLPAAIGVGVVLGGLAIGVLLFAP
IWWLLMLAVAIPIGMHEVIRRLGEAGYALPAIPLLVGSQAMIWLTWPFGP
AGLLGAYAGTIVVCMVWRLVGQGIREQPVNYLRDISAAVLLATWVPLFAS
FSALLIFQDDGGFRTFIVIASVVFADIGGYVAGVLFGRHLMVPAISPKKS
WEGLGGSLVFGVAASVLAVVFLLGKPWWVGIPLGLLLVVTGVLGDLVESQ
VKRDLGIKDMGKLLPGHGGIMDRIDAMLPAAVAGWIVLTLLA
375142797YP_005003446.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNPAGASDDAEIARLLYRYARAVDTKDWELYRSVFTDDAHIDYSSAGAIV
GTRDEVVDWFAANFGVIGWSMHYITNIESDISGDTATVRAMFYNPMQLPG
MTAMSTCGGYYHHELVRTPDGWRSRRLREENVWFDNAPGAPTA
375142795YP_005003444.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MNEPLHAPYGTAEDTSTRHRILVATAEVLARSGQTKLSLSEVALQAGVSR
PTLYRWFASKQELLDAFGVHEREMFDNGISRATAGLRGTEKLDAALRFIV
EYQHSYSGVRLIDIEPEVVIGQLGRILPIMRARLEKLLSGPNGAVKAATA
IRVAISHYIVRSDDDDQFLAQLRHAAGIKQ
375142793YP_005003442.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGYSAADESFTHQLPRPFDEVHHPDATWSDRCYFFAASPDGDLLLASGYG
NNPNTKTGLGYVKVTFADGRHYDLLAGRPVDGAGRTEVGAGPMRWTCVEP
LKKWKLDVEPNNSGIAWELYYEPTAPMWELLPLKVTGKDGRIIADMYHMK
EPGVWTGWVEVEGQRISVDGFHGGRDRTFGVRVADEIDFWLWLDAGFEDR
AIEAWVFETSDGTVTYVDGGITHNDGTLSKRFVNIVHDIEFDGDRKRAAR
AVLIFTDEDGAKYRVTADSPHQHVNAYYGLPMSKCTYEDLGAGAYFIHFL
WDSNSHDELVENEDKAMAVDQLMRFDFEGRTGWGIFEILMGGDAYPRYPN
WRPLDMSKFKQDRKAVDRKPGGDRR
375142791YP_005003440.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTIPAAVNELTPEWFTDVFTTPVDAVHVLDAHSGTTGRARVGLTASSSDV
PETVFVKLQPFGEDQRKFLRQIGLGVAEARLYAEVGDDLPVRAPRVWHSD
YDSSDGSFVMVLEDLTASGCRFPTPSDDDIVDVAASAMDELAVLHAGFHG
RDLDWLRTPSGMRRKPSDSETASRRAQFIVSALEQFADDMPAVFRRLGDL
YSARSLDIVALFAEGERTLIHGDTHSGNLFVDGGRTGFYDWAVASRGPGV
RDVGYFLCNSLPIETRRAEEESLLARYRSALARNGVELDAETAYTQYRLF
AVYSWIAAASTAAMGSQWQPIDVSLAAMASTTQAIEDLDSVGLLEERLSG
375142789YP_005003438.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MQAREYSRFDITSRDFWSRTFDGREEIFAQLRASDGLTWHRPFDSLFGME
EPGFWALTRRADIVYVSQHPELFTSAQGVALNPMPAEIQRFASFFLSMDP
PQHTVYRRLISSAFTPRNVRQIEEQIHRNAIAIVDDLVGAGEVDFVAACS
ARLPMLTIMDMLGVPTADQPAVAYAAEKLFGMSDDEYATPEERAEDPIAQ
ITLLSTTGVELAQFRRKNPGDDLMTAIVNAEVDGHRLTDEEIGAFLILLA
SAGNDTTKQSTTHAMMALAENPAQREWLMEDFENRISSAVEEFVRWSSPV
LQFARFATEDTEINGAPVQAGDKVGLFYCSANRDEAAFAEPGVFDLSRSP
NPHLGFGGGGPHFCLGNQLAKAELRNLFRELLTRLTTVEFGEPDLLYSNF
VHGVKRLPAFVR
375142787YP_005003436.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMSCLGVAPRRLSNPPSDGIWVYCLPMRWIQLGFALLFVTLGLGALAGRTA
TTETVEEIAQVAESAPAPTVANVPRPDASLARDSVVSDVAHSVVKISSVA
YSCQKVMAGSGFVIAPGRVMTSAHVVAGADDFIVSVDGHEHDATVVMFDS
TEDIAILEVPGLQAPALNFAQDTAWQGTDAVVLGYPGGGPFVAYPARVRE
VLDFKGPDLYRALLVRREVYSIRGLVRSGDSGGPLIDRSGRVLGMNFAAA
THDPEVGFVLTAKQIYPHVVGSPRSGPVSTGPCIG
375142785YP_005003434.1 gluconolactonase [Mycobacterium rhodesiae NBB3]MICKGADTLTTLTGGFCFGEGPRWFEGLLWFSDMLGEAVHTVNLQGDLTT
LSLPGHQPSGLGFRPDGTLLISSAEQRRVLRYDGYTVEPIADLSGLVPAA
LGDMVIDDAGRAYVGSQARDGGVIARVDADGSVAVVAENLDFPNGMAITE
DRATMIVAESTGRRLSAFTIGADGSLFDRRIFADGLDGPPDGICLDAEGG
VWVAMTLAHTFERIVEGGTVTERIDMDDRTAIACTLGGPERRTLFLVSST
DAYPQRLVGTKQSRVDATTVDVAGAGLP
375142783YP_005003432.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MNAPVTQHFSYDPFDPAVMADPPSYYRVLRDDHPVYYIDKWDTYALSRFD
DIWEVLGVNDGTFVASEGTLPAATVLAARNEGAVPDPPLHPLPFHANFDA
PIYDSVRRCTSSQFRPKSVAGLSDRIRILANERLDELLPRGTFDLTQDYG
GIVAASVVCELVGLPVGLASDVLATVNAGSLAQPGSGVEVANARPGYLEY
LVPIIQRRRAGDGEALPIADNLIGYRLPDGSALSDSEAAVQMLGVFIGGT
ETVPKIVAHGLWELGKRSDQLAGVRSDLDANVPVAREEMIRYCAPAQWFA
RTLRKPFTIHGTTMNPGQRVITLLASASRDEREYLDPDEFVWDRRIDRLL
AFGRGQHFCLGVHLARLEIGIMVTEWLKRVPDWRIIAEGATRPPSSFQWG
WNNLPVEV
375142781YP_005003430.1 2-4-dihydroxyhept-2-ene-1-7-dioic acid aldolase [Mycobacterium rhodMRLQEALSAKPRVWGGWVVGPTIIGPEEFARAGYDYVGFDLQHGYLDDAD
VALLLRRLEHVPIATAVRLPSAHPAPIGRVLDAGADAVILAMVESAETAA
AAVAATRYAPAGVRSFGPLRADIGLDPAEHEARAGVFAMIETARGLAALD
EICAVEGLSGVYVGPADLAISLGENPITALDAPAVLDAVTRIHSVASGAE
LIPGIHANAGKPGKAMAELGFRMITLASESQALRRGAAAHLEEAQ
375142779YP_005003428.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMPADRMSPSVGIIGAGPGGLALAIFLKKNGFRDFTIFDREDGVGGTWRIN
TYPGLACDVKSHLYSYSFDLNAGWSRLWSGQPEILEYFERCAQKYQLARH
LKLCTEIASASWDAETKTWLLTTTSGEQHSFDVVVSAIGLFTQPVLPDLV
EEDPFTGTLMHTARWDHSVDLTDARVAVLGTGSTAAQLIPEVAKVAEKVY
SVQRSPTWILPKPDRSYTEREKWLFAHVPFAKRIYRTRLWLRSESNIGVI
ENGSDKTQEFRDIALRTLEAAVPDEQLRSKLTPEHPFGCKRLVFATDYLQ
TLSAPHVEVVSSPARALRARSLVTADGRELEVDVVLCATGYAAADYLGEI
EVVGEDLTTLRETWSDGAFAYLGMAVPGFPNFFMLYGPNTNVGSNSVIFM
LEAQAHYIVRALKYMRRKRKSYVAVRTETMTEFIARIDEWMEGTVWLTRC
SNYFRAPNGRVVTQWPRSARAFWEMTRRFRPAEYTFEPQAQRSVVQVGSH
TRADE
375142777YP_005003426.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMILGIVTTSSETAFDVPPEAIYDFVTNPANWTKTYPGGPDIRNLPDRLPL
QVGDTWDEAHPDPSKDRVFTWQLSMAVRPSLFVFSSVGRLGHDSQGNGGL
EGRMTIEYHFTRPGDGVTLFGRTMTIEAYRHAPLTDGFFRMVNPSHIDAY
HAAVARELSAT
375142775YP_005003424.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSRVELSPEDQAFRDELRALLKTLVTDEVIARDRETGENFDEGVHLAL
GERGYLAAEFTDEADGGFSRLRRRLWNLEIGRAHTPWFHWGTTAMVARAV
RDFGSDELKAEVMERALSGRIRLCLGYTEPEGGSDVATCKTRAVRDGDGW
IINGSKMFTSNAQNAAYVFLITNTDPNAPKHQSLTMFLVPLDSEGVEIQP
LRTVDGDRTNITYYSDVRVDDRYRIGEVNGGWTVLRDALNDEHGTVERGA
DGLQKVAAMAEHLVLLAEAIDKVAALGPDDDAVKYRLGRGIARMEAAMST
PDMFGRVANAQTMRDVSLELMDIQGAVATLPVDAQGAQADGGAEYVFRLA
GPTGIYGGTLEVFRNMIAQHALGLGRPAYAPPAKR
375142773YP_005003422.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MSETVIAGRHGPFGGHLDPTMIARYAAATGDRTASVLDGRATPSVFPVVL
VFTPNEAARSDLPESVWERVRGGVHGAHDIVVHRPLIPGEPLQTWSQISA
VRTSRSGTQVVMRFEQVDVDGAIAVEQWWTMVLLGLHGIADLGSTPAEHR
FPDDARARPVGSAVHHIDGDVAQRYAEVSGDWSAHHFDIAAARAAGFDFV
FTHGLCTMAICAHRMLELVGIDDPGRVRRIAARFATPTPLDCDLTVNAFA
ISENSYAFEAHTDSTTTITHGRLELRS
375142771YP_005003420.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MLRRRSDVATHGSNLYTTEVIVNPYPHYKTLRTLGPVVWLSRHRVYALPR
YAECKAVLRDDKTFVSGKGVALNALTNRLSRGTTLSSDGAEHDQRRKLVA
HRLLPRALRAIDDDVRVQAARVVETALTRGEVDGVEDLAYALPMAVVPDL
IGWPREQRAHLLPWGAATFDVLGPINRHAVKALPASLRMLAYARRVVRER
SLIEGSIGHEVLIAADDGKVDLAECAPLMIDYIAPSLDTTISAISNALHL
FACHPDQWQLLKADPGLIPNAVNEIVRYESPLRAFTRKVRTSTEVAGQSI
PEGARVLVLYSSANRDEREWDAPDTFDITRDATRHLGFGHGAHACAGQGL
ARMETQAMLSALVERVERIEPAGTPTWAINNIIRRHERLPLKLIAS
375142769YP_005003418.1 2-keto-4-pentenoate hydratase [Mycobacterium rhodesiae NBB3]MTTSVLRTADAWWVQTPTGAARIATAATTTGELLADRDAIERAAHSTDTV
PVDSLTLLSPVTRPCRVVAQMTNFASHVKDAGMNPASIPLTFFRKSSASI
SGPFDDIVKPGHVKFLDYEVEIGLVIGRDIPVGTAISESALSDYIAGLVV
TNDVSARDIQLPQTQFYEAKSYPTFTPVGPALVLLDADELKRFTDLRLRL
RVNGEIRQDMVVGDDMIYRPMQALESLARFQDLAAGDLVMTGTPAGTALS
APPKPIEIIGSLLPPAVKWKAFFNRQAKNTKYLKHGDLVELSVATDDGVI
DLGVQRTAVRYA
375142767YP_005003416.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSDQPEAPINRLERRKQRTRAALIKAAQSFIAAGKVNAPVLEITQAADVG
MGSFYNHFDNKEQLFDAAVAEVLDAHGALLDELTSSIDDPAETFACSYRL
TVRMFRRRPQESQILLATGMTLLASDKGLAPRALRDIEEATRAGRFSVDD
PELALAMAGGALLGLGNLLRNQPKRDDAEAADAVTADILRLFGVPAEEAR
EICSRPLPDLDGLTKPDSAA
375142765YP_005003414.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLMSLVTGRGPLSKDPAGWFSPPVAAGTVYVEPHPRRVQALRGEHAVIDT
EQALLVHRPDRPLSYAFPVDEIGDLPGEPVPEAPGYVRVPWDAVDVWVEE
GRRLVHYPPNPYHRVDCRPTARALRVALGDEILVDTTDTTIVFETALEPR
LYVAPSLVRTDLLQRSQTSSYCNYKGYATYWSAGAVGDVAWSYEDPLPET
SPVRGFFSFDPGLADVTADLPRA
375142763YP_005003412.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPLPLDESNPISSRRYQLTVVANSIADLVGSAGGWMCDKARAGWDVKVVL
TGDGDTRPVAILGASHLDAELSDVMKMATRGGALAVSAAALTDERIRAGV
LGIVKRGLTQVTVWGQDWPTEFSRKADPIEHRLSAAARAFKAHALGAATV
SVAGTETLYNLGPDALRPLHSV
375142761YP_005003410.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MAGQFSGKVAFITGAARGQGRAHAVRFAEEGADIIAVDLCDQLDTVAYPM
ATPEDLDETVNLVEKTGRRIVAEHADVRDLEQLKAVVAKGTDEFGRIDFV
LANAGILPAAGEQGAQIGAFVDAVDVMLNGVYYTIVAALSSMLSHGDGGA
IVITSSAAGFRPVTVDFGTASHGAAGYTAAKHGVIGLMRHFAIALAEKNI
RVNTVHPGGVATPMIYNEAMAEWSAEHPSFSPSQQPLLDNPPVEPEVISD
TMVYLCGESGRYLTGVTLPVDGGQIIK
375142759YP_005003408.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMQFWSGTPFMKTSEILPLARMLDEAGYDGMITADHLIYPRKLSSPYPDHP
SGKPPWPPETSWPDCWVQIGAMAAVTSRLRFSNAVYIAPARPLLEVAKQV
ATASALSEGRVQLAVGVGWMREEYDMLGQDFTTRGKRLNEMIPALRALWG
GGWVSWSGEHYQVPEMMIEPHPEAPVPIHCGGESDAALRRAAKLCEGWVG
YAYGWDDAVSYANKLTKLRHEYGRASEPFDITLALLEPPSPDLYKRAEDA
GITSVMCAPWMGADLPGDDVERYREPIERFAEDIIARVRS
375142757YP_005003406.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MSNPKPPWYLKPMNRFVRAIQRLGIPAGPSQILTVPGRKSGKLRSTPMTP
FSHDGGLYTVAGYPGADWAANARAAGAGTLTRGRKSRRVRIVELDPAQAR
PVLRSFATEVPVGVGFAKRSGLVREGTPDEFEALAGELAVFRFDPQD
375142755YP_005003404.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMSSSHGVEAAWREHRAYLVNLAYQMLGDVGGAEDVAQEAFLRLARTDAAQ
IDDLRAWLTVVAGRLCLDQIRSASARHEFADESGVLDVVVSRDLEPADRV
TLDDDVRTALLEVLRRLTPGERVAFVLHDVFGLPFDEIAETVGRPVGTCR
QLARRARAKFSAAAPRLADIGNREHQLVSDTFITACANGDLQALTATLDP
TVWGVGTILGEGAPPPQINHGPHDVAVNLLRYLGHGATLVSGPAGQPVLL
AFMNRRLFAVLVLTLRDSLIHKIEASVDPSAIGLG
375142753YP_005003402.1 cytochrome c biogenesis protein [Mycobacterium rhodesiae NBB3]MFTLALIGFLGGLITGISPCILPVLPVIFFSGTQSARASANGTGVAVATE
PTLSDRPRPYRVIAGLVLSFSAVTLAGSALLSLLHLPQDAIRWIALIALV
AIGIGLIFPKFEALLEKPFSKLPQKQFGSGSSGFGLGLALGVLYVPCAGP
VLAAIVLAGATGTIGVPTIVLTLSFAIGAALPLLFFALAGRRVAERVAAF
RRRQREIRIAAGVVTILLAVALAFNLPAALQRAIPDYTGSLQESVGGDEQ
IREKLNLAGLVNDQNRELSNCTDGAPELESCGTAPDIKNIAAWLNTPNGS
AVDLKSLRGKVVLVDFWAYSCINCQRATPHIVDWYDTYRGLGFEVIGVHT
PEYAFERVEGNVASGARDLGITYPVALDNGYSTWTNYRNRYWPAKYLIDA
NGTVRHIKFGEGDYDTTERLIRQLITDAAPSAQLPPPVDADDATPQDETT
PETYLSVGKVINYGGSGPYDEGSFNFSYPQQLPDDSFALRGDWALDYQGA
TSRGQDSSIALNYHARHVYIVAGGEGTVTVTRNGVTSMVPISGPPTLHQI
IDDDGVSRGRLDVAVPPGLQVFSFTYG
375142751YP_005003400.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium rhodMRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNPGLLARQLAETG
VTNVAVADSEAAAKVPDVTYSGPDAVTHLVENTPADVVLNALVGALGLNP
TLAALASGARLALANKESLVAGGPLVLKAAAPGQIVPVDSEHSAMAQCLR
GGTADEVAKIVLTASGGPFLGWSAADLDSVTPEQAGKHPTWSMGPMNTLN
SATLVNKGLELIETHLLFGIDYDRIEVVVHPQSIVHSMVTFTDGSTLAQA
SPPDMKLPIALALGWPARVPAAALACDFTTASTWEFLPLDAEVFGAVDLA
RQAGQGGGCLTAVYNAANEEAAAAFLDGSIGFPAIVRTIAEVLRAADQWA
AEPATVEDVLDAQRWARDRAKREVEREISRKGLLTT
375142749YP_005003398.1 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [MycobacterMTSIGLGIPTPPAPTLAPRRKTRQLMVRDVGIGSDHPIAVQSMCTTKTHD
INSTLQQIAELTASGCDIVRVACPRQEDADALPAIAKKSKIPVIADIHFQ
PKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGAAGIPIRIGVNAG
SLDKRFMEKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMV
AAYELLASKSDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTIRVS
LSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANEVTA
GLEGMEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVIKTV
PEAQIVETLIEEALRLAEEMGAAPGSDASGSPIVTVS
375142747YP_005003396.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDKDPRVARREIADTLMRALERRHELLDVIVKSEDYDAAIEAIANQLGT
SAVAAEAVLRMSFDRLTKVSRRRIAAELEDLNNQLSFTMGQPASSVDNIV
LRPFAADTDRDIFAARTADVQEAGDGSRAPAGDLEDEIRAGLRRVDVEEA
AWLVAVHGPQKVGMVFGDLISGEVNVRIWIHPDYRKQGYGTAVLRKSRSE
MAAYFPAVPLVVRAPAAGT
375142745YP_005003394.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEINHDAMRVSDAQAAMRISDAQAGMRVSDADRNGTLRRLHNAVALGLI
DIEEFEERSARVSSARLHTDLDTLVGDLPGPGAIVTSATDRVELRGVLGS
LKRQGEWIVPTRLALHRRMGSVDLDLTKARFAGAIVVVELDLKFGGLDLR
LPDGASASIDDVEVVVGSARDHRRDAPAEGRPHVILTGKVMCGSVDIRGP
RKGLRFGRIT
375142743YP_005003392.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDTDGNAAAPKTLESWRLVQQMLADLTKSVIEDAIDERELIEGLQVVAKV
TGLCAELSVQADTERPEFFDMCPDTRMIGGPNPDGRYLLAMIRGDRAYRV
IGTRGSTAYLGYQVLAGTGLTPRRMSGYVSDSDLVLGSGAFELLFSATEP
PPAVLGSAQWVSIPEDASSIVVREYVGDFATEVPATMRIEALDPAPLQPI
TDEVAAEQFTAMAWTIVKLATMHRTIKPELLTHPNELVTASAAELGGADT
TPDNLYMIGTFALESDESLVLEIRPPGTRYWNVTLESIWHECLEPRHRHS
SVTNKAVAPDADGIVRIAIGGRDFGHGHWLDTGGRRRGFVVLRWLDNPDP
HKVQTTVRRGGAAS
375142741YP_005003390.1 methionine aminopeptidase [Mycobacterium rhodesiae NBB3]MAADYPDVMAVRTALRPGVVSPTLPVPRSIARPEYVGKATAQEGSEPWVQ
TPEVIEKMRVAGRIAANALAEAGKAVAPGVTTDELDRIAHEYMIDHGAYP
STLGYKGYPKSCCTSLNEIICHGIPDSTVVEDGDIVNIDVTAYIDGVHGD
TNATFLAGNVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIESYAN
RFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVQTVLEPGMTFTIEPMIN
LGALDYEIWDDDWTVATKDKKWTAQFEHTLVVTDDGAEILTQV
375142739YP_005003388.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTWRNVLVLCAVALLAGGCAQPIAGTATWPGARLEKVLLTPADFPDGVQY
DLINQEPGQADGAGAPPAMLSRPEGCSDGLTRVIADSAERGPGSAAEYLV
AYDGARMVITVLTWRLDLEKLAAVADRCAEFQTFFDPSTPGIPITTTRLQ
TPRPDALVYEQTMRLGDTSDSVYFSFENIGDTAVFGVAFPTPNPSIGVKG
SLPQTFLDITAKQADRARTA
375142737YP_005003386.1 GNAT family acetyltransferase [Mycobacterium rhodesiae NBB3]MDPDHTEAITLGLHDASPQHLVDAMADDVAVEMGWGRLIFGQTFADPAKL
AEVLRQEGHGRRDICIYAREPHVLVSMAPAELFIDPSHTYRLRFTEGDEP
PAAPTGFTVRPLERAEETDEINRVYMRCGMVPAPVDVLWDNSEHRDAVDY
LVAVRDDDGSLIGTVTGVDHERLFNDPENGSSLWTLAVDPTTSLPGVGAA
LTRALAALYRERGRAYMDLSVAHDNEAAIGLYEKLGFERVPVMAVKRKNA
INEPLFTHPPETVDDLNPYARIIADEAMRRGIWVEILDAGAGEMRLSHGG
RSVITRESLSEYTSAVAMARCDDKRLTRRLVSEAGIQVPKGRLATFDEQD
HAFLEEVGDVVVKPTRGEQGKGITVGVSSTQELDAALARAREEHPNVLIE
QRAAGDDLRLVVIDGKVVAAALRKPAEIVGTGHHTVRELIEAQSRRRAAA
TGGESRIPMDEVTESTVAEAGFTFDDVLPEGQKLRVRRTANLHQGGTIHD
VTAKVNPHLSEVAVTAADAIGIPVTGIDLLVPDVTAADYVFIEANERPGL
ANHEPQPTAKAFVDFLFPGSPALPQAWTPDEPPTS
375142735YP_005003384.1 amino acid transporter [Mycobacterium rhodesiae NBB3]MPEGHEHLDEDERHLASLGYTQELNRSWSGFSNFAISFSIISILAGCFTS
FGLGWNNGGPAAIAWGWPIVSVFILIIGLCMSELVSAYPTSGGIYWWAAK
LGGAKAGFYTGWLNLIGLIAILASVAYGCATFLDLTLGTFSETWVEGYSL
TRTFIIFLIILVLVATINIFSSHLLAVINNISVWWHVAGAMVVVAILWLL
PEQHASFSTVFATTVNNTGFFGGETGIAFIFFVLPISAILTQYTITGYDA
SAHLSEETKSAADGAAKGIWRSIFYSAIGGWILLLTFLFAVQDVDEVTAG
GGAVAVIFGQALDSSWMGIVLLISTAGQFFCTTACQTSASRMLFAFSRDR
AVPGHQLWSKVSKSRIPANAVIVTAAIAALITLPALVEVDINGAPVPVAF
FAVVSIGVVGLYLCFAVPIYYRWKLGDEFQVGRWNLRGHHKWMAPVALME
ILLTSFIALWPTSNLGAPWDPGFEWKYVNYTPLLVGGVLILLYIYWHVSV
KKWFTGPVRQIDETGEALEGVS
375142733YP_005003382.1 putative glutamine amidotransferase [Mycobacterium rhodesiae NBB3]MSGFDASSEGGSRGLRPVIGLTTYLQKAQTGVWDVRASFLPAIYFEAVAL
AGGISTLLPPQPVDADIAERVLDGLDGLVITGGRDVDPGTYGQQRHPATD
DPVEDNRLRDAFEFALFAGAVRRGMPVLGICRGAQVVNVAMGGTLHQHLP
DVLGHPRHQQGNAVFSTSSVRTVPGTRLAALIGESSDAQCYHHQAIDRLG
AGLIVSAQDTDGVIEAVELDPATEPDKWVVAVQWHPEERLDDLRLFAGVV
EAAAAYRRGRVNA
375142731YP_005003380.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MDLTQRLAGKVAVITGGASGIGLASAKRMAAEGATIVIGDIDPKTGKTVA
DDLNGTFVPVDVSDQVAVDALFDTAAQTHGSVDIAFNNAGISPPEDDLIE
DTGIDAWQRVQDINLKSVFFCCKAALRYMVPQQKGSIINTASFVAVMGSA
TSQISYTASKGGVLAMSRELGVQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPVGRFAEPEELAAAVAFLASDDASFITASTFLVDGGIS
GHYVTPL
375142729YP_005003378.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVEAGGHAEVEAVVQRASSALADVDTAGWAQRFDLLSDPHRLEILLVLHR
APGINVGDLASVLGRSENAVSQALRVLRQQGWVSSTRVGRAVSYRLEDEI
VHDLLHWIGARHG
375142727YP_005003376.1 glycine cleavage system T protein (aminomethyltransferase) [MycobacMTTELPQRAHTVIIGGGVIGTSVAYHLTKLGVSDVVLLEQGQLSSGTTWH
AAGLVGQLRASESATRLVQYSTQLYAELESEVGLSAGYKQCGGVTVARTE
DRMIQLRRTAANAEAFDMECELLSPRQALERYPVMRVDDLVGAIWLPGDG
KANPTDLTFALAKGARMRGARIVEKVRVTDILSDGGRVRGVRTDKGDVEA
EVVVNCAGQWAKQIGALAGVNVPLHSAEHFYVVSEAIDGVHTDLPILRDP
DGYTYFKEEVGGLVIGGFEPEAKPWVSPDKIPYPFEFQLLEEDWEHFEIL
MNSALLRIPALETTGIKKFYNGPESFTPDNQFILGEAPELANFFVGAGFN
SVGIATAGGAGRALAEWIVNGAPTSDMTGVDIRRFAPFNGNTRWLHDRVA
EVLGLHYEIPWPNREMATARPFRRSPVHHLLQAANANFGSRMGWERANFF
APPDTDPTIEYTWGKPNWLAWSAAEQTATRTNVTVFDQTSFSKYMVVGRD
AESALQWLCTADVAVPVGRSVYTGMLNERGTYESDVTVTRTGPDEFLIVS
SAATTERDKDHIRKNLPSGVDASLVDVTSAYAVFGVMGPRSRDLLARLTT
ADLSDGAFGFGTSRLISLGYATVRATRITYVGELGWELYVPAEFAVGVYE
DLMSAGAEFGVRRGGYYAIESLRLEKGYRAFGRELTPSENPVEAGLLFAC
KLKTDIAFLGREAVEKAKAEGQRRKLVGFAVESPEAMLWGGELVLRDGAV
AGQVTSAAWGETTGSCVGLAYLRATDNAIVSADWVRAGRYEVNVGGRLYP
ISVSLRPLYDAANTRIRP
375142725YP_005003374.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGHHTTLKRAIAAGLLSATFATPAAALLTAGTAAARPIESPNCRNIAKAI
DSSMHMANVARDQGDTKAAREHMRDAARASANFQRHSVT
375142723YP_005003372.1 high-affinity nickel-transporter- HoxN/HupN/NixA family [MycobacterMSVATHSEGRAVTKFDRTDWTTIAAMSSVVLALHLFGWGVLVFGVAPQHI
TLGSAGVFGVGLGVTAYLLGVRHAFDADHIAVIDNTTRKLVGEGTRSLSA
GFWFSLGHSSVVFGLAFLLAIGVRAVVGPVQDEGSPMLQTLGLIGSLVAG
TFLILIGLSNLFAAVGIAKVYRRMRSGDFDEAELERLLQQRGFLARLFAR
VMRRVSKPWHLYPVGLLMGLGFDTATQVALLVLAAGTAAFTLPWYAILVL
PVLFAAGMSLFDAADGVFMSRAYGWAFLKPIRKVYYNLTVTVLSVVVALL
IGVIVLAGLVADRLGLESGPLAAVGSLDLEFVGFMIVGLFLAAWLIALAV
WRLGNVEDRWAPAVD
375142721YP_005003370.1 lysophospholipase [Mycobacterium rhodesiae NBB3]MTEWEPDVLAGYRQQTIELGPDPDGEGHLVATLVRRGAVQPSATRAVLVV
HGFTDYFFHTELADHLASRGFAFYALDLHKCGRSWREGQTPHFTTDLTRY
DDELSRALDIINAECPADVLVYGHSAGGLIVSLYLDRLHSGGLTRRKRVT
GLVLNSPWLDLQGPSFLRTAPTGAAIAALSRMRKLSVVRSPTPGGYGTTL
HRDYAGEFDYDLKWKPIGGFPVTFGWIHAIRRGHARLHRGLDVGVPNLIL
RSDHSVREVNDPDTIQRGDAVLDVKQIARWAGCIGNRTAVVPITDAKHDV
FLSVADVREVAYDELDRWLTDYTADGAEPPSQTTETIAQQHNPHKG
375142719YP_005003368.1 Mg-chelatase subunit ChlI [Mycobacterium rhodesiae NBB3]MTTYPFNAIVGHDRLRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAE
VLAAVDGAALVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGG
VLYVDEVNLLHDHLVDVLLDAAAMGRVHVERDGVSHSHDARFVLVGTMNP
EEGELRPQLLDRFGLTVDVHASRDVDVRVEVVRQRMAFEADPAGFAQRYA
AADAELVDRIAAARQKVAAVTLPDSELRRIAALCAAFDVDGMRADLVVAR
TAVAHAAWRGDDTVTEDDVRVAAELALPHRRRRDPFDDPGLDPDQLDQAM
QQAGESADPDPEPDPPGGGESASDQTSEPAAPQRNSSSATRPSAPPSAVF
RTRALVVPGVGDGAPGRRSRARNRTGTVVSSTTHAAEGHGVHVFGTLLAA
AGHQQAPGRPRPVLEDVRHAVREGREGNLVIFVVDASGSMAARDRMSAVS
GAALSLLRDAYQRRDKVAVITFRQSGARLLLPPTSSVHIASRRLARFDTG
GKTPLAQGLLAARDVVVREKARDRARRSLVVVLTDGRATGGPDPLGRTRE
AAARLMAEGAAAVVVDCETSYVRLGLAEQLARQLGAPAVRLAQLRADSLT
DVVRTAA
375142717YP_005003366.1 cobyrinic acid a-c-diamide synthase [Mycobacterium rhodesiae NBB3]MTASTPAVVIAAPSSGSGKTTVATGLMGALRRAGTTVAPFKVGPDYIDPG
YHALAARRVGRNLDPVLVGESLIGPLYRHGSAAADIAVVEGVMGLFDGRI
ADGFTGTAQGSTAQVAAILGVPVVLVVDGRGQSHSVAALLHGFSTFDTRI
RIAGVILNRVGSPRHEEVLRQACEHAGVTVFGAIPRVDELSVPSRHLGLI
TAAEHGAQAGAAVDAMIGQVSRHVDLAGIAGIAASRVDGEPWNPAPAQPV
AGHVVVALAAGRAFTFGYAEHRELLCATGAEVVEFDPLIDPLPPRAAALV
LPGGFPEQFSTELSGNDVVRQQINALAASGAPVHAECAGLTYLVDDLDGH
PMCGVLPGSAHFTDRLTLGYRTAVAVTESPLYALGERAVGHEFHRTAVNL
REGCSPAWAYNGRGVDAVRDGVVAGGVHASYLHTHPAAHPQAIARFVSAA
ESRFYSSPRNL
375142715YP_005003364.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMTALNDAERAAMYRDAEGGAKRSLSSRLGNPVKERTGSYPAWLPSRRFIA
AVIAIGGMQLLATMDSTVAIVALPKIQDELSLSDAGRSWVITAYVLTFGG
LMLLGGRLGDVIGRKRTFIVGVALFTIASVLCGLAWNEATLVTARLLQGV
GAAIASPTALALIATTFPKGPARNAATAIFAAMTGVGSVMGLIVGGALTE
VSWRWAFLINIPIGLLMIHLARRTLRETHRERLKLDAAGAILATLGCTAA
VFAFSMGPEQGWISPVTIGSGLAAGAFLLAFLYVERTADNPVMPLDLFRD
RNRVATFAAVFLAGGVMFTLTVLIGLYVQDIMGYSALRAGIGFIPFVIAL
GIGLGVSSALVSRFPPRVLVIAGGVLVLAAMLYGSTLNGGIPYFPNLVIP
ITVGGFGIGMIVVPLTVSAIAGVGFDQIGPVSAIALMLQNLGGPVVLAVI
QAVITSRTLYLGGTNGPVKDMNAAQLHALDQGYTYGLLWVAAVAVIVGAV
SLFIGYTAAQVAHAQEVKDAIDQGEL
375142713YP_005003362.1 prolyl-tRNA synthetase- family II [Mycobacterium rhodesiae NBB3]MITRMSELFLRTLRDDPADAEVPSHRLLIRAGYVRPVGPGLYSWLPLGLR
VLRKIEHIVRSEMNAIGGQEILFPALLPRAPYETSNRWTEYGDGVFRLQD
RRGNDYMLGPTHEEFFTLTVKGEYSSYKDFPLRLYQIQTKYRDEARPRAG
ILRGREFIMKDSYSFDVDDDGLKKAYHAHREAYQRIFEKLEVSYVIVAAT
SGAMGGSASEEFLAESDIGEDTYVRCPASGYAANVEAVITAVPESIPFDG
LPEAQVYDTGDTPTIATLVEWANGADLGREIVAADTLKNVLLKVREPGGE
WELLAVGVPGDREVDDKRLGAALEPAEYAMLDDADFGRYPFLKRGYIGPK
GLLANGVRYLVDPRIVDGTSWITGADEKGKHVVNLVAGRDFTPDGTIEAA
EVREGDPSPDGRGPLVAARGIEIGHVFQLGRKYADAFEADVLGENGKPVR
LTMGSYGIGVSRLVAVIAEQHHDDLGLRWPASVSPFDVHVVIANKDDAAR
AGATELAGELDRQGFEVLLDDRKASPGIKFKDAELLGVPSIVVVGRGWAD
GVVELRNRFSGETQEVPVANAATDIATALRA
375142711YP_005003360.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLHVPSLNPTVSRRRVLVGAAALALLSAPVVACGSSPPPPEVDELVAQLE
RARSDSQLASDAAAAARGEIAEALSAVASERSAHAQALSDELVRIQRTTA
STTSPSEPTSTTAEAAKAPTVGDVIGALKMSAQSAAGLAATSSGYRAGLL
GSIAAACTAAYTVALVPPEKPQ
375142709YP_005003358.1 transcription termination factor NusA [Mycobacterium rhodesiae NBB3MNIDMAALHAIEADKGISVDVVVETIKSALLTAYRHTEGHEADARIEIDR
KTGVVQVLARETDEDGNVISEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVGGVIQRDARANARGLVVVRMGSETKGSEGVIPAAE
QVPGERYEHGDRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
AEGSVEIAAVAREAGHRSKIAVTSRVPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDFDPDPAKFVANALSPAKVVSVSVIDEAARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDAEAVPTA
375142707YP_005003356.1 translation initiation factor IF-2 [Mycobacterium rhodesiae NBB3]MAGKARVHELAKELGVTSKEVLARLSDQGEFVKSASSTVEAPVARRLRES
FGGAKPAADTVKAGGNGSAAAAPATPAAKTSAKPAAPKPAPPPEPTAPAP
PPAAAAAPPAPPAAPPAQPGPTPGPRPGPAPGGAPKPAARAPRVGNNPFS
SQQPVDRPIPRPQAPRPGAPRPGAPRPGMSPGNMPPRPAGPRPGVPAGGG
RPGGPRPGPGGRGPGGGGGRPGGPGGGGGGGNYRGGGTGGGGAGGGAPAG
GGYRGRPGGGGRPGQRGGAAGAFGRPGGAPKRGRKSKRAKRAEYENMQAP
VVGGVRLPHGNGETIRLARGASLSDFAEKIDANPASLVQALFNLGEMVTA
TQSVGDETLELLGGEMNYVVQVVSPEDEDRELLESFDLTYGEDEGSEDDL
EVRPPVVTVMGHVDHGKTRLLDTIRNATVREGEAGGITQHIGAYQVEVDL
DGTPRPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAL
NHAQAAEVPIVVAVNKIDKEGADPSKIRGQLTEYGLIPEEYGGDTMFVDI
SAKAGTNIESLLEAVVLTADASLDLRANPDMEAQGVAIEAHLDRGRGPVA
TVLITRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFT
SVPGAGDNFLVVDEDRIARQIADRRSARKRNAMAARARKRISLEDLDSAL
KETSQLNLILKGDNAGTVEALEEALLGIQIDDEVELRVIDRGVGGVTETN
VNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIESAL
KGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVTSGVIRRNAKARLLR
DNVVVAQTVTISSLRREKDDVTEVRDGYECGLTLTYSDIKEGDVIEAYEL
VEKERT
375142705YP_005003354.1 exopolyphosphatase-like protein [Mycobacterium rhodesiae NBB3]MTAIDKATDVPLEGTAGERVDARTAADLLSAAGTVSVVCHVYPDADTLGA
GLALALVLDNAGKSVQVSFAAPAELPESLQSLPGAHLLVAPDAMRRDTDL
VVTVDIPSVNRLGALRELADPEREVLVIDHHASNLLFGSANFVDPSADST
TMLVADLLDAWGKPIDLGVAHCLYAGLTTDTGSFRWASARAHRLAARLVE
LGVDNASISRTLLDTHPFAWLPMLSRVLGSAQLLPDAAGGRGLVYAVVGH
DEWATARPEEVESIVDIVRTTQQAEVAAVFKEIEPGHWSVSMRAKSYDLA
TLASTFGGGGHRLAAGYSATGSADEVVAALRQALH
375142703YP_005003352.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKPLAYGLVMATASLVAAPQAVAQPSVGTAVYVQIRQSFTPVDGDDQCVG
TAALGPVRRGSSVVLSEGATATDSPKVAVGQFFRSRLRDGVCEALYITSA
PVMPTFNVQFAGPGGEVSPTFGPTPSEPVTYQPGIEQVVRVDI
375142701YP_005003350.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MCRNITELRGLEPAATAEEIEAASRQYVRKVSGITRPSGANVEAFEEAVA
EVTAITTRLLDGLAPRRQPPKTVPPLRRPEVRARIEARAAGTG
375142699YP_005003348.1 putative hydrolase- CocE/NonD family [Mycobacterium rhodesiae NBB3]MTAVSDAATALPAKGKIKAFTGRTLSRLLHLPPQTSDHTVHHRVRVPMRD
GVELLADHYEPTTATPVGTLLVRCPYGRGFPFSTLFGSVYATRGYHVVFQ
SVRGTFGSGGDFDPMVNEIADGADTVEWLRHQPWFTGSFATIGLSYLGFT
QWALLADPPPEMKAAVITVGPHDVSGPRWGPGSFGLHDFLGWSALVARQE
DRNRLRLLIRQARSRRALARATTGLPAGQAGRKLLGDGATWWEDWLSHPE
PDDPFWANTNIRDALKRTDIPVLLIGGWQDLFLEQTLAQYSALKERGVDV
ATTVGSWTHTQVMSKGAPTVIRETLDWLDAHLGGRGTTRRPVRIEMKGEG
WIDLSDWPPTMPERVLYLQPTGRLGDTAPPDTAAPMRFTYNPVDPTPTIG
GRLLSPEAGYRRDTKLAERPDVLCFTGDRLPTDLYVVGTPFIELSHSCDN
PYHDLFVRISEVDAKDVSRNVSDGYRRSPTVSKGAGTIRIDLDSVAHRFR
AGSRIRVLVAGGSHPRFARNLGTSEPLLSGRELMVSTHTIHLGEGGVSRL
VLPAGSQPPSGH
375142697YP_005003346.1 sulfotransferase family protein [Mycobacterium rhodesiae NBB3]MPSPDELMTAAVERTGLADFGDDSFREGLEILVRALDEEARLNARGEAFI
YDRLRLHLCQRLQVEDWYRRHPEIDDETIEAPLFGLGLPRTGSTALSFLL
SRDPGVRYLRSWESTRPCPPPSTVQGDDPRIPPEERPVVVGTRHHVPNDI
QGPMECLDLMALDFTSQMFQAFAQIPSYSDWLLDRADFTSTYRYERRVLK
LLQWGEPARPWRLKSPAHVISLGYLDRVFPDARFVMTHRDPTDVMLSVAD
VYADIAGGFSDHVDRRYLGELNVKQWSTGMHRTMEFRTNGAEDRFYDIDF
RAMQDDPIGEVRRLYAWLGEPVTGEFEDAMRRWWADNAQKREPHPKANPQ
VFGLDLDTIRPLFATYVDTYIGDSHGN
375142695YP_005003344.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVAKLRVLAALCALVAAVVVVSQSHPGGPLQVRATDIPMTNVTTSIKYPV
IETTDPDPFNPCRDIPLDAVAAMGLAFTPPQPEEALRCKYDAGNYQMAIE
AFVWKTYEEALPTDAIELDIDGHRAAQWWVMKPTDWNNRWWITCAIGLKT
SYGLIQQTMFFSPIYSNPPPDCMQTNLQRAHDLIPYYKFQGDSSE
375142693YP_005003342.1 phosphopantetheinyl transferase component of siderophore synthetaseMTVIAALLSGVLPDDARRLAAAEMYTDPTELAPLPEEEPLIAKSVAKRRN
EFITVRYCAREALGELGIAPVPILKGEKGEPCWPDGIVGSLTHCEGFRGA
AVARHDEVRSVGIDAEPHDVLPKGVLEAVSLPGERVELAALPAGLHWDRI
LFCAKEATYKAWFPVTRRWLGFEDAHITFDVDGSGTAGGFQSRILIDPSA
PTGPPLQTLSGRWSVRDGLALTAIVL
375142691YP_005003340.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MTRSVPVIGRSASSRASGAGFSALLGFAVSNPSLLVRLRPSLDAAIARMS
PVVPGTEVVPARLPLGGEWVRGPGVPVPVRGEGPVILVLHGSGYVACSAR
THRGFASHLSAHSGILALTVNYRLAPESPFPAAEDDSFAAYRWLLDRGYD
PAKVVIAGDSAGGHLAVAVALRAKREGVPGPAALSLFGPLIDPAFRASSA
DPRSRKQPLHPKLAARALAIYVGGHDVDDPRLCLLNADLSELPPIDLHYG
SRELMRADAEAFAAKVIAAGGRCDTRMWPGLMHGYWLRPLDERRGLTSLM
TAGQFLGATVA
375142689YP_005003338.1 riboflavin kinase/FMN adenylyltransferase [Mycobacterium rhodesiae MQRWRGQDEIPTDWGRCVVTIGVFDGVHRGHQELINHAVKAGRSRGVPTV
LMTFDPHPMEVVFPGSHPAQLTTLTRRAELVEEMGIDVFLVMPFTSDFMK
LTPERYVHELLVERLHVVEVVVGENFTFGKKAAGNVGLLRKAGERFGFAV
EGMSLVSEAATNGDETVTFSSTYIRSCVDAGDMVAATEALGRPHRVEGVV
VRGDGRGKVLGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPIAGAVVPG
ERYQAAVSVGTNPTFSGRTRTVEAFVLDASADLYGQHVAVDFVARIRGQE
KFGKVEDLVTAMGVDTEKARGILAAQ
375142687YP_005003336.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MANLPAVAVTAVVAIGGVAGCSSSSAANLAVGDCLKTGGTPERPEVTKVA
CGSPESNFKVAATVENSEQCPADVDSYYSMRTAFSDTSTTICMDIAWVVG
NCMSVDPTNDKDPLQVACDDSSVPNRQRATQILDDVANVDQCASGVGYAY
DERGFTVCVEDVA
375142685YP_005003334.1 putative Zn-dependent peptidase [Mycobacterium rhodesiae NBB3]MPQRRPARALRRGANTAESSTRDISTVRRTVLPGGLRVVTEYIPSVHSAS
VGVWVDVGSRDEGPTVAGAAHFLEHLLFKSTPTRTAVEIAQAVDAVGGEL
NAFTTREHTCYYAHVLDTDLELAVDLVADVVLRGRCAADDVEIERDVVLE
EIAMRDDDPEDTLGDVFLSAMFGSHPVGRPVIGSSESIAAMTRTQLHSFH
MRRYTPERMVVAVAGNVDHDDVMALVREHFGARLVRGRKPVPPRKGKGRV
TGRPTFELVNRDAEQTHLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRL
FQQIRETRGLAYSVYSTVDTFADSGALSIYAACLPERFGEVTRVTSDVLE
AVARDGITETEYRIAKGSMRGGLVLGLEDSGSRMNRIGRSELNFGTHRSI
ADTLAKIEAVTLDEVNTVARKLLTGPYGGAVLGPQTSKRALPQPLRAMTH
375142683YP_005003332.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTMPATALCPCGSDEPYGRCCLPLHLGERQADTAEQLMRARFSAYAAGNL
DYVWQTWHPTTRPSELADTGLTWTGLEIIETVDGRRGDESGEVEFRAHYL
QDRRSGYLHERSRFAVRARRWFYVDGEMFR
375142681YP_005003330.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSEETSLPSARLQRSPKDFRAIDLDEVDRRILLTLHADARISNSALADSV
GIAASTCHARLKRLQDLGVIRGFYTDIDPAAIGLHLQAMISVSLQSNARG
KIHSFINQIRRKPQVMDVYFLAGAEDFILHVAARDTDDLRSFVVENLNAD
ADVAGTQTSLIFEHLRGASPL
375142679YP_005003328.1 tetratricopeptide repeat protein [Mycobacterium rhodesiae NBB3]MSERSRALRIQLLIGFMCAALVVYFVLLGRIALAFISSGEPAAIGLGLAL
MIMPLIGVWVMVSTLRAGLAHQRLGRMAKAEGLELDVSALPRMASGRIER
DAADALFATVRGELEDDPDNWRRWYRLARAYDYAGDRSRAREAMKKAVEM
EERS
375142677YP_005003326.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MVAATNFALLHGGGQGSWVWDDVIGELSASGDCITLDVPGCGRKRERDTS
AIEFDDIVAELISDIETSGMRDVVLVGHSQAGMPMSQMVEVAPELFSRLV
YVTCSAPPPGTSLLELIGNCRHGEHEDQVGYPLDPKTTSFEERFAVMFCN
DMSAPEREAFLAKLGRDMWPASSYMYLDWRYDHLGTVASTYVVCERDMSL
PTLWQKRFAETLRVDRVVRIDAGHQVMNTQPEALAAILLAEAQSTEEDHA
CRV
375142675YP_005003324.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAAGVVIRPKDRVEMLFDELAELAGQRNAIDGRIVEIVAEFDHDELVGI
TGARSVAALVAWKLGMSSANAGTIAAVAHRLPEFPRCAAGMTEGRLSLDQ
VGVIAKKAADGSDDHYATFAEVATVSQLNTAVKLEPRPTPDPAPWSVPQR
SITKTSDEQCVRYRMTLTHDDAATFDAALASHQDALVAEWKRDHDDDSAQ
APPFPTAPDAFMSLVTAGWDADVARRPHGQHTTVVVHLDVKDRIASLHLG
PLLTAAERQYLSCDATCEVWFERSGQVIGAGRTTRTINRRLRRALEHRHP
TCAVPGCGATRGLHAHHIQHWEDGGTTELDNLVLVCPYHHRLHHRGGITI
TGPAPNITVTDSDGRQLHSSSLARPPNRPPPDVAPYRGPTGERADWWWYT
PFEPPPPTDN
375142673YP_005003322.1 dienelactone hydrolase-like enzyme [Mycobacterium rhodesiae NBB3]MPTITDSITTADGTCRVSLHTPDGDGPWPGIVMYPDAGGARQTFRDMGDQ
LAAYGYAVLVPDVYYRDGDWAPFEMASVFTDENERKRLFSMISKVTPDMM
AADAGAFFDYLVSRPEVSGEVFGTTGYCMGGRTSLVVAGRVPDRVAAAMS
FHGGGLAADDPGSPHLLADQMQAAVYVGGAENDASFTTDAAETLAKALTA
ANVEYLIEWYAAGHGFAVPDNAPYDQAAAQRHWDAMESFFGVHLG
375142671YP_005003320.1 dihydrofolate reductase [Mycobacterium rhodesiae NBB3]MTTVGLIWAQSSTGVIGRDGGIPWRLPEDQARFKELTMGRTVVMGRLTWE
SLPAKVRPLPGRKNVVLTRQADYMADGAHVVPLLQDALTDDITWVIGGEQ
IYALALPLATRCEVTEVEIDLPRDDGDVVAPTLDETWIGTAGEWLTSSTG
LRYRFFSYVRP
375142669YP_005003318.1 cytosine/adenosine deaminase [Mycobacterium rhodesiae NBB3]MAAQGVASRLLDIMEFDVLPMTERGVAAGNKVFGAALLRKSDMSLVVAGT
NSETDNPLLHGEISTLNQFYAMPDRPTTQDLMFLSSHEPCPLCLSAITWA
GFDNFYYFFTFEDSRDAFGIPHDLKILEEVFGVEDGEYRHTNAFWTAHSI
GDLVEAEPEPLRTQLRTQDQRIRDVYAGLSQQYQDSKGNNDIPFN
375142667YP_005003316.1 thymidylate synthase- flavin-dependent [Mycobacterium rhodesiae NBBMADIAPLRVQLIAKTDFLPPSDVPWSTDAEGGPALVEFAGRACYQSWSKP
NPRTATNESFVRHIIDVGHFSVLEHASVSFYITGISRSATHELIRHRHFS
YSQLSQRYVPEHDSEVVLPPGMEDEPELAEIFAAAADASRAAYTELLAKL
EAKYMGDEPGDSKAVLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFI
AMRASEHADLEIRRLAVECLRQLIDVAPQAFSDFEIYALADGTEVATSPL
ATEA
375142665YP_005003314.1 putative metallo-beta-lactamase superfamily hydrolase [MycobacteriuMNEELAPPGPLVPGGLRVTALGGVSEIGRNMTVFEHLGKLLIVDCGVLFP
THDEPGVDLILPDLRLVQDRLDDVEALVLTHAHEDHIGAIPFLLKLRPDI
PVVGSKFTLALVAEKCREHRIKPVFEEVDEGQSSTHGVFECEYFAVNHSI
PGCLAIAIHTGAGTVLHTGDIKLDQSPPDGKPTDLPGMSRLGDAGVDLFL
CDSTNSEIPGVGPSESEIGPNIHRLMRGAQGRVIVACFASNVGRVQQIID
AAVALDRKVAFVGRSMVRNMGIAKELGYLTLTNNDDIIDIGAAEMMPPER
VVLVTTGTQGETMAALSRMSRGEHRSITLTPGDLIIMSSSQIPGNEEAIF
GVLDALAKIGARVVTNAHVRVHVSGHAYAGELLFLYNGVRPRNVMPVHGT
WRMLRANAALAARTGVPEENIVLAENGVSVDLVAGRASIAGAVSTGKMFV
DGLVHGDVGETVVGERLTLSSGFIGVTVVLRSGTGKLAAAPQLHSRGFSE
DPKALEPATRKVQEALETLAAEQVTDVARIAQAVRRAVGKWVGEAYRRQP
MIVPTVIEV
375142663YP_005003312.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPIVVVATMKAKPESVDAVRDACKQAIEAVHSEPGCDLYALHEADGTFVF
VEQWTDADALTAHSQAPAVATLFGTVGELLDGAPDIKMLQPVVGGDPAKG
ALRP
375142661YP_005003310.1 acetyltransferase- N-acetylglutamate synthase [Mycobacterium rhodesMSADPERVLIRRARTSDVPAMKALVDIYSGKILLEKNLVTLYEAVQEFWV
AELDGELIGCGALHVLWSDLGEVRTVAVHPKVRGQGVGHAIVDRLLDVAR
DLHLERIFVLTFEVDFFSRHGFTEIDGTPVTAEVYEEMCRSYDTGVAEFL
DLSYVKPNILGNTRMLLTL
375142659YP_005003308.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVAALPLYKAQRTTAWKGSTMTALLREVIGDVLRRARTEQGRTLREVSDS
ARVSLGYLSEVERGRKEASSELLSAICSALDVPLSRVLFEAGDEMGRKEF
AAIERESVGAANIDAATKVVIPQVVSMAVA
375142657YP_005003306.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNSRASRPEAWRSLAQRGVDTAAEWSDVLAEKLNAAADPRAKLLRKRRWA
FRLGVFFTVSTLFWIGVTGLLSAWETPFWALFIPAPIAVGAAFLATLSFL
RYRWLRGEPLPPQRSRSSRRLPAWGSAARQPMAALAASERGLFSLLGVME
RGRMLPPDELRELTAAANQTAATMTATANEVVSMERAIGSAPQSRAHLAP
TIQAFTAQLEQGSRQYNEMVTAAAQLVSAANTGSMSSSPMAQQRYRNELS
NATDRLLGWAQAFDELGHLRRA
375142655YP_005003304.1 limonene-1-2-epoxide hydrolase [Mycobacterium rhodesiae NBB3]MTDQAAPTRPDLDNVRAVETFLYAMQDEDFDTVDRLMADNIEWQNVGFPT
IRGRQRIVGMMRRGEGRLGFEVKIHRIAAEGNAVLTERTDALVFGPLRLQ
FWVCGVFEVHAGRITLWRDYFDALDFVKATVRGIAATVFPSLRATM
375142653YP_005003302.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLTEFHDLVEGQFGSVRGGSLLVDHVLTRLDGRTAVQAIEDGVDPRDVW
RALCADFDVPRDQW
375142651YP_005003300.1 hydrogenase expression/formation protein HypE [Mycobacterium rhodesMPDTPAEADTAIDMESWVCPAPLRDSPNIVMGHGGGGAMSAELIEHLFLP
AFGRAAEAGMGDSAVLDVGNVRLAFSTDSFVVKPLSFPGGTIGDLAVNGT
VNDLAMAGARPLVMSTAFILEEGTSLDDLARVAQAVGTAAMAAGVKLVTG
DTKVVDAGHGDGVYINTAGIGLIDERADIRPQRATEGDVVIVSGDIGVHG
VAVMSCREGLEFGTTVASDTAPLHGLVAAMIDTGADIHALRDPTRGGVAA
TLNEIAKTADVGISLDERTFPIPAEVRDACGLLGLDPLYVANEGKLLAFV
APTEADRVLTAMRAHPLGAHATVIGRCVAEHPKMVSAKTALGGTRVVDLP
IGEQLPRIC
375142649YP_005003298.1 hydrogenase assembly chaperone HypC/HupF [Mycobacterium rhodesiae NMCLAVPGKIVSIDDRDGTLMSVVDFGGIRKDVCLEYLPDAEVGQYVVVHV
GFALQRLDEESAMRTLAEFEHLGILEEEFSDGFEVAAQRSGLDNPDEPRR
SEVTS
375142647YP_005003296.1 hydrogenase assembly chaperone HypC/HupF [Mycobacterium rhodesiae NMCLGIPGQVVRMLEGYGDQLALVNVAGENRKVNIGMLPEETFCAGDWVII
HMGFVVEKTDEAGADAAMAGLQMMGRGADPEESP
375142645YP_005003294.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MEVIGWIATGVVAVVVVGGVVVGLRSIPDVRRYMKIRNM
375142643YP_005003292.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSLAFTVADVAAEQFSVTPRLIARIGIVAGDDQPIQAIALRCQIRIEPL
RRPYSDDEAAGLIDLFGPRERWVNTQRTFLWQHSTAMVQGFTGVTEVSLP
LECTYDFEVAASKYLHALRDGAVPLLFLFSGTVFMPGGRGFSVRQVPWEC
EAQYEMPVSVWDSLVRTHYPNSGWVRLGHDTLRALAAYKSARGMLDFEDA
VTTLLAEAPAATQPTHQPEEVR
375142641YP_005003290.1 thioredoxin-like protein [Mycobacterium rhodesiae NBB3]MASTGPQDPEALDDETRWRSAGDRIQTLLDASAGSGTVVRERTEQLAAEL
TDLYGAALERMIAITAGSAPELVDQFAKDELVASLMLVHGLHPHGVERRI
EDALDGVRPYLGSHGGDVALLEVVERQDGPVVRLQFAGSCKSCPSSAVTL
EYAVEDAVRAAAPEIVSIEVVAAQPDSPESPSLISVDSVLSRLRDHNDRA
GATWHPVPDIGDLGQGEIAGFLVAGVPILACRVADDVFAYHDRCGRCHES
LAGAALHRPLGAAIGQAVLRCPRCHAHFDVVHAGVGVDDTAETAEHLDPI
PLLRRDGVPSVSVIAEASGVM
375142639YP_005003288.1 Ni-Fe-hydrogenase I small subunit [Mycobacterium rhodesiae NBB3]MLTEAAKKAEETLIHVLWINAGLSCDGDSVALTGATQPSIEEIALGALPG
LPQIAVHWPLIDFECGPTGGADDFLEWFFKADRGELEPFVLVVEGSIPNE
NLHQEGYWCGFGNDPATDQPITTSEWLDRLAPKATAIVAVGTCATYGGIH
AMAGNPTGAMGVPDYLGWEWKSKAGIPIVCVPGCPIQGDNLSETLTYLLY
MATGQAPMIPLDDALRPQWLFGNTVHEGCDRAGYYEQGDFATEYGSPKCI
VKLGCWGPVVKCNVPKRGWINGVGGCPNVGGICIGCTMPGFPDKFMPFMD
EPPGGKISTAASGLYGSVIRNLRHITGKTVDKEPSWRHRGKELTTGAKRT
W
375142637YP_005003286.1 Zn finger protein HypA/HybF (possibly regulating hydrogenase expresMALTQSVVDAVCEHAAGRRVHSVRLEIGALCAVVPDAMTFCFELATEGTL
ADGARLEVDMRPGEARCRSCDTIFAVNDLILLCHCGSADVEVTAGRDLKI
LSMEVS
375142635YP_005003284.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTYCPPQSTSEVSREEQARALCLRLLTARARTRSELEGQLTKRGYPDDVS
AKVLDRLAHVGLVDDADFAEQWVRSRRINAGKGKRALAAELRNKGVDNEV
ITAALADIDAGAERQRAEQLVRDKLRREKLQDGDDTKVARRLVGMLARRG
YHQSMALDVVSVELASERARRSV
375142633YP_005003282.1 amine acid ABC transporter permease [Mycobacterium rhodesiae NBB3]MSTASVLFDAPGPRARVRNRIVTVVTLVVAAAVVWVLYSRLQARGQLDAA
KWEPFLTANLWKTYILPGVQGTLTAAAVSIVLAMVLGFALGVGRMSAHRA
IRVPSAIFVEFFRAVPVLIMMIFAYFLFAMYDVFPSKHLALAGVITGLTL
YNGAVIAEIVRAGVNALPRGQAEAASALGLRWGQTMRAILLPQAITSMLP
VLISQLVVVLKDTAIGYQITFLEMVRQGTQVGAAYGNYIPALIVIAILMI
AVNFSLGHFATWLEGRLRRSRRGPAPMHADEPVNQGAFGAGAGGTI
375142631YP_005003280.1 periplasmic component of amino acid ABC-type transporter/signal traMPFISKRVLGAVVLALALPLAATACGGGSGGGDTIVIGTKFDQPGLGLKN
PDGTMSGFDVDVAKYVAQQLGYSEDKIEWKESPSAQRETLIQNGQVEFIA
ATYSITDSRKEKISFAGPYLVTGQSLLVREDNTDITGEASLQNNKKLCSV
SGSTPAQRIKDKYPGVQLQQYDTYSACVEALKNGAVDAVTTDEVILAGYA
AQTPGAFKLVGGTFSEERYGIGLKKGDTELQKKINDAIVKMETDGAWKAA
WDKNLGPAGLPAPTPPKIDQT
375142629YP_005003278.1 tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB [MyMRTYQVRTYGCQMNVHDSERLAGLLEAAGYRKAADDTDADIVVFNTCAVR
ENADNKLYGNLSHLVPRKQANPDMQIAVGGCLAQKDRDTVLKRAPWVDVV
FGTHNIGSLPALLDRARHNRAAQVEIVEALEEFPSALPAARESAYAAWVS
VSVGCNNTCTFCIVPALRGKEVDRRPGDVLAEVTSLVDQGVLEVTLLGQN
VNAYGVSFADKGEPRDRGAFAKLLRACGRIDGLERVRFTSPHPAEFTDDV
IEAMAQTPNVCPTLHMPLQSGSDRILRAMRRSYRAERYLAIIDRVRAAIP
HAAITTDLIVGFPGETEEDFQATLDVVERARFASAFTFQYSKRPGTPAAE
LADQIPKDVVAERYKRLIDLQERVSLEENTALIGHTVELLVATGEGRKDA
ATARMSGRARDGRLVHFNPGGLQIRPGDVVTTTVTDAAPHHLIADAAIGS
HRRTRAGDAHAAGKTPHTGVGLGMPGVGVPAEPQSSTGCGR
375142627YP_005003276.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTISEPGGPASSLEPAAGSLPPRPTPRPGPPRPAPRPGRPAATIAAPPSS
DPHRFGRVDPDGTVWLITGSGERNIGSWQAGDTEAAFAHFGRRFDDLATE
VALMESRLESGTGDARKIKAAAAALAETLADAHVLGDVDALAARLTTIVE
HADETAQADKAKREEHRAAQIARKEALAAEAEELAANSTQWKVAGDRLRE
ILDEWRTITGLDRKSDDALWKRYSAAREAFNRRRGSHFADLDRERAGARQ
AKEAICERAEALADSTDWGPTAAAFRDLLTEWKAAGRAAKDVDDALWQRL
KAAQDTFFSARNAATAERDTEFRANAEAKEKLLAEAERLDTGDLDAARAA
LRTIGDKWDAIGKVPRERSAELERRLRAVEKKVRDAPTSGVDPEAQARAD
QFRSRAEQYERQAEKAAAAGREKDAAEARANAEQWRQWADAAAESLGKR
375142625YP_005003274.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLSSIAIVPSAPVMVPELASGAAAELADLREAAFTAVGSLPGRWVAVGRG
PADSVVGPGQTGTFAGYGVDVPIALAPGQSAAPTELPLAALVTGWLRGRV
NPDAHAEVRMYADEHDADAAIERGRRLRAEIDEVDGPVGVLIVADGVHTL
TQSAPGGYDPDSIPVQAALDDALASGDAAALTRLPEAVVGRVAFQVLAGL
TEQPRAAKELYRGAPYGVGYFVGVWLPAGGSEVTGESV
375142623YP_005003272.1 diaminopimelate epimerase [Mycobacterium rhodesiae NBB3]MKFAKGHGTQNDFVLLPDPEGRLTLTPAAVAALCDRRRGLGADGVLRVTT
AAAAHAAGVFDRIPEGVAPGDWYMDYRNADGSIAQMCGNGVRVFAHYLRA
SGMESRDEFIVGSLAGPRPVVLHAWDSTGADVTVEMGKANHFGTGEATVG
GRPFAGLAIDVGNPHLACVDPGMTLDDLAALDVAAPVSFDRAQFPDGVNV
EVLTAPADGVVAMRVHERGVGETRSCGTGTVAAAVAALAFEGATTGTLRV
HIPGGDVTVTVTDASSYLRGPSVLVAEGDLSEEWWRAVQR
375142621YP_005003270.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRQKSRRRMVMPRVVIGLLAVSTTVLLAPVTAAQPEADANGAITAAWEA
SGGDGGALGPRNGDVYPIGEGFGQNFAGGKMFFTPATGAHFVQGAILEKY
ESLGGPADSDLGFPTIDEGPGRAPDSRNVTFSATDKPVIFFTPATGARVV
RGPINAAWDTLGGSAGELGVPAEDEVYRGSVVSQKFTGGELSYDLRKKTF
TTVPPELAARLGDLKIPDDPEAAINAARRAAGGALGPLGAAEGEATPIGK
DGLRQNFAGGAIFYTPATGANVVTGQVLAKYESVGGPEGDLGFPISSEVD
GGLATESRMSSFAAEDKPVIFWTPEYGAVIVRGAMAAAWDRLEGAKGALG
APMADQTEAGDVVTQRFSGGVVSWDRSKNQFTTEPANLASELSGLEVPGQ
KSPEAPNGSQASDDSGGKNWFKFSWWWLLALVPLVILVGAVLLATLLRRR
KGEDPFAPDGYPMADNRFGGESESAYGTGGSPERMTTDDEYAAAMFGDRY
ASEGLGSAPHGVDEPHGHDLPHGEEAPPHDDDRSHVEEWLRSDEVHAPDD
DVWGAPPPDVQEEPPAPFDEPDQPVESVEPAEDEDSDAVDTAPTAVITVP
PVIARDPLTDTGRHARIEVDEPEPRIAFLMPLDDPNQAPDGYPVKANTKT
GVYWAPGSTMYEDASAEIWFASEELARVNGFVADDDVR
375142619YP_005003268.1 LysM domain-containing protein [Mycobacterium rhodesiae NBB3]MFEHKSERLEPEGRKMTILETRENRAIPVVRPGIRPAGARRRPVSRRPGG
APVRYRNSGVLVSRASHRRKPITPVTTVLLALVAAGITVWLGLVAQFGGV
VGESAPVPDRLAVVQVQTGETLQQVAGRVAPDAPVGPVVDRIRELNHLDS
VSVHAGQTLIAPIS
375142617YP_005003266.1 putative epimerase- PhzC/PhzF [Mycobacterium rhodesiae NBB3]MAIDVTVLRVFTDPEGNYGNPLGVVDNSTVDPADRQRIATELGYSETIFI
DFPEGGASTAHARIFTPAVELPFAGHPTVGASWWLREQGYAIKTLQVPAG
IVQVIYDGDLTAVSARAEWAPDFAIYDLGSVDELMAADPADYSDDVEHYL
WTWLDRSAGKIRSRMFATHLGVPEDEATGAAAVRITDYLSRDLDIVQGKG
SMISTEWSPEGWVRVAGRVVSDGTKHID
375142615YP_005003264.1 ATP-grasp superfamily enzyme [Mycobacterium rhodesiae NBB3]MADQADQPEQHYQPDQTGMYELEFPAPQLTSPDGRGPVMIHALEGFSDAG
HAIKLASQHLKNTLDTELVASFAIDELLDYRSRRPLMTFKTDHFTHYEDP
ELSLYAMHDSVGTPFLLLAGMEPDLRWERFLTAVRLLAERLGVRRVIGLG
AIPMAVPHTRPITLTAHSNDKELIAEHQPWVGEVQVPGSVSNLLEFRMSQ
HGYEVVGFTVHVPHYLAQTDYPAAAEVLLAEVAKSASLQIPLEALDAAGA
EIQAKINEQVEGSSEVAQVVTALEHQYDAFAAAQENRSLLAHDENLPSGD
ELGAEFERFLRQQDRGRDDDAK
375142613YP_005003262.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAVLLGACSRVVVGSSQPVEAAAERPPVPVAQLLIEPARFPPQYSAAVL
DVAGVDRAVRDVDGVPIGAVVTPAACTPPVLWHSEVVGVEGVDAATASRL
IVVLTRPVPPLSDRLAQLRACPTFEVGESTVTVTELPAPPVDADASYAVE
QVVTTPDSERTTLTFAAEIGDARVSVTWLQDPASGEADTASLDALFRDSV
LKLRRES
375142611YP_005003260.1 Mn-dependent transcriptional regulator [Mycobacterium rhodesiae NBBMNDLVDTTEMYLRTIYDLEEEGVVPLRARIAERLDQSGPTVSQTVSRMER
DGLLHVAGDRHLQLTDKGRGLAVAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVRVLDNPTTSPFGNPIPGLSELGLASSDPGAEIN
LVRLTELPAGMPVAVVVRQLTEHVQGDVELIGRLKDAGVVPNARVTVEVN
DHGGVMIVIPGHEQVELPHHMAHAVKVEKV
375142609YP_005003258.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKQSPELSFDDDGQPVLITRAAPAYEEQHRERVRRYLKLMFWRVPALIGA
AVAYGIWQNGLISLVILVASIPLPWMAVLIANDRPPRRAEEPRRYESTRR
IPLFPTAERPALEYRAYSSRQADETEPPRDVAG
375142607YP_005003256.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDQSQPLPRPPSRHHIRHIVRRTLSKSWDDSIFSESAQAAFWCALSLPP
LLLGMLGSLSYIAPLFGPETLPAIQDQLISTAERFFSSSVVNEIIAPTVR
DIVKNARGEVVSIGFVISLWAGSSAISSFVDSVVEAHDQTPLRHPVRQRF
FALGLYVVMLVAAIASAPFVALGPRKISAHLPEGLDNALASGYYPLLFVI
LVVSVNILYRVSLPEPLPSHRLILGSVLATVVFLIATLGLRFYLTWITST
GYTYGALATPIAFLLFAFFLGFAIMLGAELNAAIQEEWPASTTHANRVRA
WLKRKAEAKLNGGGKPAADATSDAATS
375142605YP_005003254.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRPLPAVLVHVCGAEDWRSAQTDGELRPESLTAHGFVHLSTPEQVHLPAN
RLYAGRTDLVLLRVDPARLSSPIRWEPGVPTDPAAMVFPHLYGPLPVTAV
ISVTSYEPDGNGRFGPVSP
375142603YP_005003252.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGILFGFAPWIVYWVLVGNVPFAAAVLVALAVAVGSFVIGRMRGAAGRTL
EIGAVATFLILAVLTFTLSQSFMEQWLQPLSSAGIFLVALGSVLLGKPFV
REFAEVGQPKEVIETDLFKKITNVLTWIWVAAFAGMTVSSAIPPIVYGEA
TILDTKTPLSFVCYWVLPFSLLGLAALASRILPERMAPPDEEIVRNTTFV
AFAEAEIDQLIYLATEHANREVGAGKEAFDIRIGSKGVPLVGDETRESWP
STYKVREKKR
375142601YP_005003250.1 excisionase family DNA-binding [Mycobacterium rhodesiae NBB3]MVGTLSAVPEIRIREAAELLGISDDTVRRWVDDGALDAHLDASGRKVIDG
AALAAFARANAGSAPKDPLTVASSARNRFAGLVTKVVTDTVMAQVEMQCG
PFTVVSLMSADAVRELQLEPGSVAVAVVKATTVIVETRGGQS
375142599YP_005003248.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMVHDPLPASGTPAPTGTQRDERVYVAATKASPATDEPVKRTAAKKASAAK
STNGSAPAKRAAKATATKAAKATSATATKAKPAKAAAKSASAKAAPAKKA
AKAAGPRGRGKKATSPEADATTTDVEAEGLETEELEGEPDGDIDDAEIDL
TDIEVDDAESSEGDATEEAEGDKPAAKVAPAAPVEDDEIAEPSEKDKASG
DFVWDEEESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELA
KRIEAGLYATQLMLELADKGEKLPAAQRRDMSWICRDGDRAKNHLLEANL
RLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWW
IRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDA
VSFTLLQDQLQSVLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTR
ERIRQIESKTMSKLRHPSRSQVLRDYLD
375142597YP_005003246.1 inositol monophosphatase/fructose-1-6-bisphosphatase family proteinMVENDTHPVQLRLVAERLATEAAAFVRTRRAEVFGAAPDAPTTASPVRSK
STPTDPVTVVDTETEALLRDRLAVLRPGEPVMGEEQGGSLAGAGRLTWVL
DPIDGTVNFVYDIETYAVSVGVQRDGVSVAGAVANVPTGALYSAAKGHGA
QVQRGGVTTMIRASGASELSMSLVGTGFSYRAERRRRQAEILAALIPAVR
DIRRIGSCALDLCMVAAGRLDAYYEDGVHVWDWAAGALIAAEAGAVLRLP
PADGAPGFIVASAPGIADAMNDALSQSGAP
375142595YP_005003244.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATDYDAPRRTESDDVSEDSLEELKARRNEAQSAVVDVDESESAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVHHRSRLASEKNGVMICTDCAA
375142593YP_005003242.1 deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [MycobacteriumMSSTLAVVRLDPDLPMPSRAHDGDAGVDLFSALDVELAPGQRALVPTGIA
VAIPHGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEVKVSLINLDPA
EPIVVNRGDRIAQLLVQRVELPDLVEVTSFDEAGLADTTRGDGGHGSSGG
HASL
375142591YP_005003240.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPVDLRGVTTVLLPGTGSDDDFVYRAFSAALHAEGAIVVTPKPQPQRLVD
GYRDALDNAACTAPIVVGGVSIGAAVATAWALAHPDRAVAVLAALPAWTG
APDSAPAAIAARYSANVLRRDGIASATAQMRASSPPWLGDELTRSWVGQW
PSLPDAMEAAASYVAPACSELERLEVPMGIAAATDDPVHPVEVGIEWMTA
APRAALRTVTLAEMGADPAVLGAACVSALLEL
375142589YP_005003238.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDPGANPGKRSTKAHAVLEQMGGISGLIYSSLPVLAFVPVSQLFGLTPA
IVSAMGIAAVILVWRLVRRESAQPAISGFIGVGICALIAYVMGESKGYFL
LGIWSSLVWAAVFALSVLIRRPVVGYVWGWVNDHDRDWRTVRKAVRAFDI
ATLVWVLVFASRFVVQHHLYDADQTGWLGVARISMGWPLTAVAALVTYLA
IRSAQRALHAHDALPDAQSENPGMAQPDAR
375142587YP_005003236.1 K+ transport system- NAD-binding component [Mycobacterium rhodesiaeMRVAIAGAGAVGRSIARELVDSHEVTLLERNPDHIDVDAIPAARWTLGDA
CELVVLESVQLHEFDVVIAATGDDKVNVVLSLLAKTEFAVPRVVARVNDP
RNEWLFDENWGVDVAVSTPRMLASLVEEAVAVGDLVRLMEFRKGQANLVE
ITLPDDTPWGGKPVKRLDLPRDATLVTILRGPRVIVPEGDEPLEGGDELL
FVAVTEVEDQLQELLLNPESR
375142585YP_005003234.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSKLSTVTRRLFLGKPFRSDKLAHTLLPKRIALPVFASDALSSVAYAPEE
IFLVLSVAGLTAYSMAPWIGLAVAAVMLIVIASYRQNVHAYPSGGGDYEV
VTTNLGPTAGLTVASALLVDYVLTVAVSMSSAMSNIGSAVPFINQHKVLF
AVIAILLLASINLRGIRESGTAFAIPTYAFMIGMYVMLAWGFFQIYFLGT
PLKAESAGFEMHSDHGEILGFALVFLVARAFSSGSAALTGVEAISNGVPA
FRKPKSRNAATTLALLGGIAISLFMGIIMLAKETGVQIAEHPHEQLIGAP
PNYHQKTLVAQLADAVFHDFTLGLYLIAGVTALILVLAANTAFNGFPVLG
SILAQDSYLPRQLHTRGDRLAFSNGILFLAFAAIAFVVAFRAEVTALIQL
YIVGVFVSFTLSQVGMVRHWTRLLRTETEPAVRSKMKRSRVINGIGCVCT
ATVLVIVVITKFMAGAWIAILAMGALFVIMKSIHKHYNTVARELEEQAAA
EADSMVLPSRNHAIVLVSKLHLPTMRALAYARATRPDVLEAITVSVDDGE
TKALVHRWEDSDISVPLKVVASPYREITRPILDYVKRVSRESPRTVVTVF
IPEYVVGHWWEQVLHNQSALRLKGRLLFEPNVMVTSVPWQLSSSERLKKL
QPQSAPGDARRGFLD
375142583YP_005003232.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQTLLPHPDFVVWCAAGKADTCAVTLVADLAQTIGMTTPGSQEQLAAAHE
LPPWLGDEALHRSHQSALSRKDPAHYGPLFPGVPDDLPYVWPAADRDRRV
PLS
375142581YP_005003230.1 Na+/H+ antiporter NhaA [Mycobacterium rhodesiae NBB3]MSNPLSRRLLTRSTWPEAKRLSEILRQETVGGVLLLIAAGAALLWANSPW
SDGYHALSDFMFGPEPVHLHLSVSAWAADGLLAIFFFVVGVELKREFVAG
DLRDPRRAALPILAAVGGMVVPAAIFVTINVTSGHPENVVGWAVPTATDI
AFAVAVLAVLSTHLPSALRTFLLTLAVVDDLLAIIVIAFFYTDDLSPSAL
ALALLPAGLFALCIQRGVRHWWLLVPLAVATWALVHASGVHATVAGVLLG
FTVPVLGRHACAENVERRLRPVSAGFAVPVFAFFAAGVTVGGWSGFVTDL
VSPVTLGIIAGLVIGKPLGVLCTSYLLARFTRADLDDDLAWRDVLGVSLL
AGIGFTVSLLIGELAFGHGTAAGDNVKIGVLVGSVVAGVLASVVLLSRNA
AYRRICELETVDADHDGVPDIYDARQD
375142579YP_005003228.1 phosphodiesterase/alkaline phosphatase D [Mycobacterium rhodesiae NMTLLLGPALRHVSDTTALIWVQTESAGVVEVLGCSAPTFEVQGYHFALVE
VTGLEPDSVSEYQVRFEGATVWPLADPSFAKFPPSVIRTRGPASAHRLRA
IFGSCRYPKTQVKKVEKKLKHDALDSYATRMRDLPIDKWPDALILLGDQL
YADELPPDEVRRVAGRRRNRNGDRPPDEVVSFAEYERLYRHSWGDPEIRW
LMSTVPTAMIFDDHDIRDDWNTSKVWRAQMADLDWWHDRIRAGLASYWVY
QHLGNLSPDELADNEDYQQLLAVDGDTWPHLAEVADRADREVDSNKGVRF
SYRWDLGRTRLIMIDSRNGRILDSGERMMIGEKEFRWVEAKAEENPETLN
HLLLASSVPWLMPPAIGDLETLNEQAAERAGWRGKLGEKLRQAGDFEHWP
AFYKSLVRLGEMIARIANHPDGPATISILSGDVHHSYAARAEVDGVSPDG
STVHQLVCSPVHNYVPLFVKPAFLLGWTKPAAAVTRWWVRRSGVQSPPVA
WTNVCGPLFGNTIATVEVDGRNAEVFFEQPRKTEALQEAGRVPLNRAGG
375142577YP_005003226.1 ribonuclease D [Mycobacterium rhodesiae NBB3]MTDPHEADPESGPEDEPEATPLLAPRDGVPDLAVSADEIKSAAELLASGS
GPFAVDAERASGFRYSNRAYLVQIRRAGSGTVLIDPVNHGGDPVDTLAPI
AEVLATGEWVLHAADQDLPCLAEVGLRPTTLYDTELAGRLAGYDKVNLAA
MVQRLLGLQLMKGHGAADWSKRPLPHDWLNYAALDVEVLLDLRHAIAAVL
DAQNKSDWAAQEFEHLRMFEGAPTRRDRWRRTSGIHKIRDPRALAAVREL
WITRDRIAQRRDIAPGRILPDAAIVNAATADPDTVEKLTTLPVFGGSRQR
RQAHVWLEALARARTTDDPPTPQEPSTGPPPASRWARRKPEAAVRLEAAR
SGIAELSQRVSVPTENVVTPEIVRRLCWDWQPLPTAEQTASAIDEFLRDA
GARQWQRDLAVPVLADALYPDPTQANSD
375142575YP_005003224.1 uroporphyrinogen decarboxylase [Mycobacterium rhodesiae NBB3]MRPDRELGRYRVGMAALEPMTTRRELPDSPYLAAARGRKPSRVPVWFMRQ
AGRSLPEYRALRAKNTMMQACFDAELITEITLQPIRRHGVDAAILFSDIV
VPLRAAGIELDIVPDVGPVIDHPVRTVADVNAIKPLEPQQVAPVADAVTN
LVSELGDVPLIGFAGAPFTLASYLVEGGPSRNHERTKAMMLGESDTWHAL
MTTLTDVTIAFLQTQLTAGVDAIQLFDSWAGTLSLADYRTYVLPHSSRVF
STLKDAGVPMTHFGVGTAELLGAMGEAGASVVGVDWRTSLTDAATRVAPG
TALQGNLDPVVLLAGWPVVERAARAVVEDARRAVDAGAAGHIFNLGHGVL
PGTDPDVITELVALVHSL
375142573YP_005003222.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAKLDYDALNAEVRYLMFSVFSVEPGELGEDRSAVVDETATFLKQQEDKG
VVVRGIYDIAGMRADADFMFWTHAETVEALQATYSDFRRTTALGRVSDPV
WSSVALHRPAEFNKSHIPAFLAGEEPGNYVCVYPFVRSLEWYLLPDDERR
KMLAEHGMAAREYKDVRANTVPAFALGDYEWILAFEAPELYRIVDLMREL
RATDARRHTREETPFFTGPRVSPEQLIASLP
375142571YP_005003220.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSLKALITTTLPLVALAMAPSAVAQPPGGSHCPPRDGQSVVITVGDIDCV
TAADFAAQYDPNGDKYQQIGPFTCYSGNAMTAPLIFQCVADTEDHAEFGV
YPG
375142569YP_005003218.1 adenylate/guanylate cyclase family protein [Mycobacterium rhodesiaeMAENRRACASCGAPNEEDARFCEGCGGSLARICVTCGVEASATARFCRGC
GAPLNDQTTQPRMPVAGPVRKTVTVMFADLAGSTTFEERVDPETAREVIG
RYHELLRSTAERHRAGVTKYIGDGFMAVWGVPEIGADDAVHAVDAAVELQ
ERFVGLAAQIDESHGVELALRVSVNTGEVVVGADDADLVGDALNVGARLE
SECPRGRVVVGEETWRATRGHYGYESLGKVHVKGRTAPVAVYQWVARQSE
TTDTAPFVGRGDEVRRLQAAMDDAVSACAARLVTVIGDPGVGKSRLAAEF
TRSQVDARVIEARCVLEGTVALSPLVEVLRALDLENDIPASTPERDRLLR
DLHGLADGVPGSVEENFWALRRFVEVLATRTPVVLVLDDIQWADTLLLDF
IEHLLEWVKDVPVLVLSLARPELRDIRPELVTVSRWGSEAVHLGGLDAGA
TAELAARVLGATRLPDELLNRLPSSTGGNPLFVRELIGMLAHDGVLIEES
HGWRLTIDVDAITIPPTIHALLASRLERLDATDRRVLEIASVVGSDFSLG
PVRALADKGTEGIKLSLNRLRRLELAQPSGAYVGDEPVWRFHHVLIRDVA
YRRLLKSDRANLHERLADWVASGGQSVAFDADEMIARHLEAAHSYRRELG
TADEHTGDLALRSARHYTTSARRALDRDELVSAGTQAARGAAVAAADGAL
HAELLLIGCEAYLSAGDVAAGAPLVDDLDRIADESLAPWATCYRCQFVVY
TEPERLPDVDTRLQGAIDEFTRRKDSAGLAKAHRVRASARSRLGRIGDCE
ADLFEALIAARHSGDHRQITAALGAAPGAALWGPSPVPKAGGRCLDVVRM
QRMTTAAPSLEATSLRHLAVLELLRGRPDKARKMLADARQVVADLGLRHG
LMETELFAGIIESMEGDAVAAEPHFRTALDGFKALGVSADAGQAAALLAR
MVLAQGRIDEADCYAAESERLAGRNLKTAIGWRAVRAEILAAQERYEEAV
ALARDAVAVAAGTDLVLDHADACLALRRVLDAAGDTEGANAARAKAEMLY
AAKEVTARIGRVPPAASPTPTVTPSETTSSPSRLQVTNQSCAFLPAFVRA
LHAFDVDGALSAFSDRFVYDDHRRLSGDPITGLVEMRRAIERIFEQYSQF
EFRVLAVRGQSLNLLWSRWSDTHGNQTSTLYVNEADDDGRVLYHGRFDED
DFEKAYRELDRRYYAGEGVVFAESGALTTECLSAVNQGDFDRLFGELSRS
DLRFEPRSRNAFPARSAEDLRASFESLAAMVASSRTWLATVAWVSPEWAV
SRFERTAIGLDDERYSWTRILVIGVRGGLLAALCQFEIDDEAAAFAYAEE
QSRGFTSRLAVANLASNTFDIVCLAMRDHDAKGAVRVYSKTFAYDDHRRV
SGGPVVGIDAMRTGIAMLCEQYPQLEWRTMAVRGELLELRWARQWDDAGN
ETSGLMVIEVNRSGQIVYQGRFDEDDFDSAIQELDRRYFAGEGAAFAENG
IPSSEAPRAMDRNDFGLLFGELCAPDLIVESRSSRAFPHRSAAELRRGFE
ELNKFVASKRTWNSACAWLSPTVSVIRLEREAIGHDGETYEWAMLLAAEH
ADGRLITLCEFDPDDEASAFEYAEVKVRAQAGRLVVANKASETLHTLQRA
MQAHDIETSTSCYSEIYDYDDHRTISGGAIDSREAMRAAILHVFDQYTDF
EHRVLAVRGERAVLFWSKWSDANGNETVGLFVHECEYDGRITHTARFDEN
DFDAAYRELDQRYYAGEGAEFAEWGNLATEWVAAVNRGDFEKAFGELTAP
GAQMESRSRSPFPDPTVSDLGVSYQDLTTMVASMRTWLSIGHWLSHNLWI
ARFEREAIGHHGEQYSWTWIVVGEARNGQFVSSCIFDIEDEDAAFAYAEE
RMRTPASRIGVTNRSVQTADMLYRALNAHDIDEVLKHCAEPFTYDDRRRL
TGDPIDGRAEVRAAFERVLAQYSHFESRILAVRGDRLHLHWGRWSDDSGN
ESAALHVFETDGNGRQVYEGRFDEDDFEGAYCELEKRFIAGEGAAYATPI
TVSMNWITALNRGEVDRMLTEFCTPDVRFQSRSRSAFPERSGAELGASLR
ELGAMVSSVRTWNSAVHWMSPDCAVVRMQREAQGLDDERYNWTRIYVAEF
RSGLLASLCEFELEDEEAAFAYAEERRRASTSRLAVTNRSSDVVRAIVGA
ATAQDIDAILAHYSERFEYGDHRRLLGHPVHGLSALREAFERILLQYTHS
EWRTLAVRGDTLSFHWSRWSDDSGNETAYLHVFEIGDDGLIVYEGRFDEE
DFEGACRELERRYYAGEGAAFAVPGVTATEFEMALNARDYDRMFDELAAP
DMRLVNRSRSVFGDRSSAEFRASIEELDSMISSVRTWNSAARWLSPNWSI
ARQEREAVGIDGEQFAWTRIYVAEIRDGRMASLCQFEPDDEAAAFAYAEE
RIRASTSRLAVTNRSCESAVAMTSAMHDQDIDGIMSLLSEHLEYDDRRQL
SGGPIVSRGEFRAAFERILQQYSRFEARILAVRGDRLNLNWSSWSDISGN
ETSYLHVFEIGDDGRQIYEGRFDEENFEGAYRELEERFYAGEGAEFAEAG
NMLTDFTIAANQGDFDRIFGDLSSPDFHVDNRTRSGFPDRPSAQFRASLD
ELRNMVTSLRTWSSAVCWVSSSWLVFRLEREALGRDGERFSWTRVVASEI
NDGRVASMCAFEPEDEDQAFAYAEERAQAAASRLAVTNRASERSHAARQA
AQARDVDAMVDCYVESFVYDDRRRLSGNPLGDRRSAAEGILAQYAQFDGR
TLAVRGDRLCLSWSRWRNDEGFETEYLIVHEVDDSGRFVYEGRFDEDDFE
GAYRELTRRHYEGEGAGIAETGRLADDLTTAMDRGEFDRILTELALPEFR
LENRSRSIFPDRSAPEMIAGFEEIGRMVVSTRTWNSAVCWLSPSVLIGGF
EREAIGADGERYAWGGINVAVQRDGRFASVCLFDAGDEAAAFAYAEECVR
QEQQR
375142567YP_005003216.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMRDLVLAAFRPRTSAPNAATVLRSILWPLAILFIIHRSYVLATNGYITDD
YGPVYRAVVNFKMGWDIYNEHFNHVDPHYLYPPGGTLIMAPFGYLPVDAS
RYWFITFNTIAIILAAYFLIRLFGFKFDSVALPALLAAMFISESVVNTLV
FGNINGCILLLEVLFFRWLLDGNRNHEWLAGISIGLTLVVKPLLAPLLLI
PLLNRQWRALVPAFLVPLAFNAVAWPLVKDPMNFVTRTSAYIFTTRDYFN
SSIAGNGLYYGLPTWLIILLRLAFIVLAVLSLWLLYKYYRTRDPLFWMTT
SSGVLLIVSFLVSSLGQGYYSMMLFPFLMTVVLKNSVLRNWPAWLAIYGF
MSADRWLLGHWPTTGRFLEYMKFTYGWCLMLIVVFVVLYFRYLDAKSENR
LDAGIDPVWMKDATKTPTPAQTE
375142565YP_005003214.1 pyrimidine reductase [Mycobacterium rhodesiae NBB3]MLFMADTAAGVQFTVLGPDGSAIDGADGRLSDFYTYPEGLQQCWVRANMI
ASLDGGATSDGKAGGLAGPGDRSMFALMRHAADVILVGAATVRVENYSGA
QVPLAQRSARQQRGQAEVPPIAVVTRSGNLDPDALFFTRTEVPPLILTSA
DSFDDAKQRLGAVSEVLNASGPQSDSVDNATALQLLAERGLFRVLAEGGP
LLLSQLISDDLLDELCLTVAPILVGGQGRRIAAGAGEVHSTMRAAHLLSD
GEGYLYTRYVRAR
375142563YP_005003212.1 acetyltransferase [Mycobacterium rhodesiae NBB3]MTAAVAADLHELADVAAQTFPLACPASVSADNVAAFIDENLSEDRFRDYL
ADPDRLVLAARHDGRMVGYAMLIRGVSDDDDVRRAVSVLPAIELSKMYVL
SDSHGAGVSAALMSAALERAAKLQAGSVWLGVNQKNQRAQKFYAKHGFAI
RGTKTFQLGDATENDYVMVRPA
375142561YP_005003210.1 PPOX class F420-dependent protein [Mycobacterium rhodesiae NBB3]MELNDAARDLIGEGTDAILVTLNADGSPQVSTIWMELQSTPDGDELVSAH
LNEYRKTRNIRRDPRVAVTILAGEKPRQLRDYLSITGTARIVEGGAPDLL
KRLARVMLGSDEHFPPPNAPEGLLTRVRIDKIGGSGPWVSEKRL
375142559YP_005003208.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMRVRPFEEVVAEHGATVLRVCRAVVGPIDAEDAWSETFLSALRAYPTLPA
DANVEAWLVTIAHRRALDVGRARTRRPVPTDTLPDRATPNADPATRDPDL
WTALQRLPTKQRQAVAYHHIAGLPFAEIAILLDNSPDAARRAAADGIKSL
RKTYQKDERS
375142557YP_005003206.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMTERIEVARTIAAPAADIFAVLCDPQGHVAIDATGMLQDADGDPARAVGD
TFVVHMDRESLNDYPLGKYDVTVSITQYEQDKLIAWTIFGQLKPDIGHVY
GYRLEPTDGGTLVTSFYDWSDIDQHWRDANIFPIVSELALRATLGILDRT
VRRGYPQASTNG
375142555YP_005003204.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRELIGAIAIAGAAISAAPVAAADDLMYPDTSGRYPSDVPGMNYEAHLT
APCTNMERFTFGRGPGGEVLQCRWIANQWPPVYTGFWVATYELFGVQEQG
APCPKPQATAQHPDGRPMLCLGAQGWQPGIFTRDGFFPR
375142553YP_005003202.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNTTNLKKIAVAGAVSGALGLAAIGLGTGTASADPLDDIAPMIPSDVTDE
VVNYLPLIESVSEIGSNAGLGELGNVPVLGDIGNLGNLPDLLALAGGF
375142551YP_005003200.1 response regulator with putative antiterminator output domain [MycoMSADLFAPLARLQTTAEAIEGLRDLFAAEEVLDVVAERVAKTALAAIPNA
DIISIAVLSWPDARTAACTHEEALELDYQQYASGRGPCLEAAMQRTPLRA
VIDEEHQRWPEFVEAAQRNGVRASLSVPLLMVGMDYEQELVGSLNIYSHA
ATAFDSFDAELMRLYSVAAGQAISNSSRWQSARETVNQLETALISRSDID
MAKGALIALHGCSPSEAFDKLADESQRRNIKLRDIAGEMLTRMQTRV
375142549YP_005003198.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNKTLVVGATTLTLLFGGTGVAAASTFEAPASTTTTVAQAQETPEDDGGD
NGLWGLAGLLGLVGLVGLKRRKDADYPANRAGGTITNNPRV
375142547YP_005003196.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAQVIRRSATVVAGFATALATLTACGGSPAPQPTSPSSAETVASAKSPAR
TSSTGEPKPVDREVSAYTGFISPTGNVSCAIDVDLARCDIIDRDWSPPPR
PADCEFDYGQGIQLVPSEPASFVCAGDTTFGAEEVLPYGEAITAGPLRCE
SAESGITCRDAGSRHSFTISREAYDLS
375142545YP_005003194.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDASDQWQISGYARRQTKAPTARTLTGTSAAIGTGIDHDTRRAVRVRRRR
RASTYDRQMREPAITDDGRYIVVNGRRWRATDPLIPEERRVELVRILMAW
RREVRRAKGTAKESEARAGVHAAKVALGERGDPPWWDQNEAHRRARWQVE
VAEPR
375142543YP_005003192.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAVESKPAADASIGELLSQMSTQTSRLVRDELRLAQKEFQQSAKHAGLGA
GLFSAAGLLAVLGLATLIGAAVAALSLVLPVWAAAVIVAAVLFLVAGGAA
LIGRRQTEEVTPAAPKTVETVKADLQEVKDARHGNA
375142541YP_005003190.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALPGPPLAPPIVPPPLVPPIVPPPLVPPLVPPLVPPIVPPLAGPVPIGA
PVAGLPLTTMGGAPAGKGDPVGPAPSGAPVAGQPIAPGPGASGH
375142539YP_005003188.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRVVVRCVLAAIVIAGGLVAGPTGPSTAAASRSYQPAITSVLPTQGAVVG
VAHPVVVTFRSPVADRRAVERALDITSVPAMTGTFDWVENNVVQWVPDQF
WPAHSTVALSVRNMPLTNFETSAAVVGVADIAAKTFTVTIDGVPPSDLPA
PHHRANWGKPGVFPASMGRPEYPTPVGTYTVLSKEHDVMMDSSTVGIPVT
APDGYQLDVEYAVRFTQRGLFVHSAPWSVNQMGYENVSHGCIGLSTEDAE
WYMNTVKVGDPIIVRENGIEVPRTVSG
375142537YP_005003186.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKLSDIADLPLTYSDVGATASTLPAGYHHVQKSAVIGRGRQRFEEAAAAG
MRWGMLRGAGVKVRATTALAAVGSEVIVHLGPVQAPCRVVYVVEEPDRGG
FAYGTLPGHPESGEELFLVRYDPATEDVFAEVTAFSRHATWWSRLASPFT
SLVQRVVTTRYLKAL
375142535YP_005003184.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTDEPSGAHPGGGFNPPVPTTRGGPDYGRFVEAVRTLQDHARAADAPDE
VIAEAADLVDKVTHLLAPYYADEWASPSGRRMDLPNRGNLLAIPLDLHTT
PDGRIEGTAMFRRFHLGRNGAAHGGAVAQLFDGLLGYTAFTLSGSRAQRT
AFLHVDYRRIAVVEKQFQVDGRIDSIEDRKIFVSGRLMDGDDVVAESHAL
FVKLKPGQP
375142533YP_005003182.1 threonyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MSAVVSPASAAPIRVAAGTTAGEAVREAGLPGRGDPQAIVVVRDAEGRLR
DLSWVPDTDVDVAPVAADTEDGRSVIRHSAAHVLAQAVQEIFPEAKLGIG
PPIADGFYYDFDVARAFTPEDLEALEKRMRQIVKEGQLFSRRVYESKEQA
REELANEPYKLELVDDKSGDPDVMEVGGDELTAYDNLNPRTREREWGDLC
RGPHIPTTRYIPAFKLTRSSAAYWRGNQDNASLQRIYGTAWESQEALDRH
LEFLEEAQKRDHRRLGAELDLFSFPDEIGSGLAVFHPKGGIIRRELEEYS
RRKHIEAGYEFVNTPHITKEQLYITSGHLEWYADGMYPPMHMDAEFDEDG
ALRKPGQDYYLKPMNCPMHHLIFRSRGRSYRELPLRLFEFGSVYRYEKSG
VVHGLTRVRGMTQDDAHIYTTREQMRDELASLLRFVLDLLADYGLNDFYL
ELSTKDPQKYVGSDEDWDEATETLREVAEASGLHLVPDPGGAAFYGPKIS
VQVKDALGRSWQMSTIQLDFNMPDRFELEYTAADGTRQRPVLIHRALFGS
IERFFGVLTEHYAGAFPAWLAPVQVVGIPVADDHIPYLNGLVAQLKTAGI
RAEVDISDDRMAKKIVNHTNQKVPFMLVAGDRDIEAGAVSFRFGDRTQLN
GVPRDEAVAAIANWVASRENATPTAELVNVGAKP
375142531YP_005003180.1 phosphatidylglycerophosphate synthase [Mycobacterium rhodesiae NBB3MSDLYLMTRAAYEKLSRPLAKAALRAGLTPDSITILGTAGTVLSALTLFP
IGVLWWGGFAVFIFVLADMLDGAMARQRGGGTRFGAVLDATCDRIGDGAI
FCGLLWWAAFGMRSTSLVVATLICLVTSQVISYIKARAEASGLSAEGGMI
ERPERLIIVLMGAGLSGLFGLPWLLHVAMWLLAVTSLITLGQRVHSVRTS
PGAMDRLVKPENTGGETPEAPAAQGDES
375142529YP_005003178.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MRIGMVCPYSFDVPGGVQSHVLQLAEVMHGRGHVVSVLAPTSSDAHGSLP
EYVVSGGKAVPIPYNGSVARLRFGPATHRMVKRWLAEGEFDVLHLHEPNA
PSLSMLALNIAEGPIVATFHTSTTKSLTLSVFEPLLRPMHEKIVGRIAVS
DLARRWQVESLGSDAVEIPNGVDVDAFASAPVMDGYPRAGKSVLFLGRYD
EPRKGMAVLLRALPRLVERFADVEVLIVGRGDEDELRRSAGKLAKHLRFL
GQVDDAAKASALRSVDVYCAPHTGGESFGIVLVEAMAAGTAVVASDLDAF
RRVLMDGAAGRLVPVDDAGQLADALIEVLDSDKVRKRYIEAASDAVRRYD
WSVVAGQIMRVYETVASAGAKVRVAGTAGAAGSFRAKARGLS
375142527YP_005003176.1 pyridoxal 5''-phosphate synthase- synthase subunit Pdx1 [MycobacterMDTAPNGVQTGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMA
LERVPADIRAQGGVARMSDPDLIEGIIEAVTIPVMAKVRIGHFVEAQILQ
SLGVDYIDESEVLTPADYTHHVDKWKFTVPFVCGATNLGEALRRITEGAA
MIRSKGEAGTGDVSNATTHMRKIGGEIRRLTSLSEDELFVAAKELQAPYE
LVVEVAQAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGDP
AGRAAAIVKATTFYDDPDVLAKVSRGLGEAMVGINVEDVAAPHRLAERGW
375142525YP_005003174.1 pyridoxal 5''-phosphate synthase- glutaminase subunit Pdx2 [MycobacMSAPHVGVLALQGDTREHLAALREAGAEASTVRRLRELEAVDALVIPGGE
STTMSHLLRELELLEPLRARLADGMPAYGSCAGMILLASEILDAGTAGRD
ATPLKGIDMTVRRNAFGRQVDSFEDDIDFTGLDTPVHAVFIRAPWVERVG
PDVEVLGEAAGHIVAVRQGKMLATSFHPEMTGDRRIHKLFVDLL
375142523YP_005003172.1 putative hydrolase- CocE/NonD family [Mycobacterium rhodesiae NBB3]MKAERTLNGPQTTGRDYRNLSRPRFSIRSDDNIHVPMRDGVSLLADVHRP
DADGRYPALIAASPYPRQMQDFGAPAGFIEAGATDFWVTRGYVHVIANVR
GTSGSEGTFAFFDPQEREDMYDLVEWAAAQPWCDGNVGMIGISYFAMTQL
EAAVEKPPHLKAIFPVAVTADLYDAATHHGLASTSFITPFLSMMGLTSDR
SDEFWRHNPFIVTARKILNAPPVHRRFATMNGEAAVTMMHGLLRLPHNPH
PWDDLWFDTVVKHPMRDDWWEARNLLPLLKNIDIPVYLGCDWENVPLHLP
STFTAWEALADNPNVRMALLGRFGLTWPWESLHHEALAWYDHWLKGFDTG
IMDGPPIRYVLPGADGWHTADEWPPAATTLSTFALRADGTLGADEGSPGS
REYLTLGGGLNRAKPSPIDPPSLLSWTTAPLTESIDMVGDIELRLVASAT
APDTAWMATLEHIAADGTATEVTAGWLRASLREVDETVSRIGAPVLPCRR
FAAVPVGEDVEYRIPLVPNARRFAVGDRIRLTLTSDDQDPRTPAIMNFRH
ASVDSSSLNTVRSSSRLLLPVQPLT
375142521YP_005003170.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTMVEVEPQPCIDTLVRLPGGGEARRTEYVGTAWFDGKPQVSGLTLRRPP
TAPRGIRTPNFSTSFFLPNSLAYDRAALGDSTLTVSVVLQAAGEVSAIVD
AVATFTDDPSGAPTWIQLHLGGHLGWPAGIGYRIVALTPPDAVR
375142519YP_005003168.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMPDDTELETATNLAVTLAWAAGAMTAALLLGVLLTWALGRIGRRSAMLCD
VAELTRMPVRATLMVVAATISVQRTSDPADSWRRLVDHSLLILLIVGVTW
LLTSLVRVAERRMIARFGGGGEEISDADRRWRRVRTQVTVLRRLAIAVVV
IFGGAAILMTFPAFSDIGTTVFASAGVLSVVAGLAAQTSLGAVFAGMQIA
FSGAIRVGDVVQLENGQWWGRVEEITLSYVVVRLWDERRLVLPSTYFTTE
PFENWTRSDTEIMGSVEFDVDFSVPFHDMRAELDRLLVNSELWDGRKGVL
QVTDAVGGVVRVRIVVSAPNAGALFDLRCAVREGMVNWVNSRRVLPIQRL
ENADFTPESTAPSAPSRTTDETPRAAEGMFSGSPEAEKRARAFDEHADYE
DDYVSSSNGSR
375142517YP_005003166.1 crossover junction endodeoxyribonuclease RuvC [Mycobacterium rhodesMRVMGVDPGLTRCGLSVIEGGTGRQVIALDVDVVRTPSDEPLHRRLLTIS
DAVEYWMDTHRPDVIAIERVFANQNANTAMGTAQAGGVIALAAAKRNIDV
HFHTPSEVKAAVTGNGRADKTQVTTMVTKILALQAKPTPADAADALALAI
CHCWRAPMIARMAAAEAMAAEQKRKYQATIKAKAKAAR
375142515YP_005003164.1 Holliday junction DNA helicase subunit RuvB [Mycobacterium rhodesiaMNRFEDEAPEDREVTPALTVGEGDIDASLRPRSLGEFIGQPRVREQLQLV
LEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGTSLRVTSGPALERA
GDLAAMLSNLVEHDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPG
ATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAELERVLT
RSAGILGIELQSDAGAEVARRSRGTPRIANRLLRRVRDFAEVRADGVITR
DIAKSALAVYDVDELGLDRLDRAVLSALTRSFGGGPVGVSTLAVAVGEEA
TTVEEVCEPFLVRAGMIARTPRGRVATAAAWTHLGMTPPAGATGFGQPGL
FE
375142513YP_005003162.1 thioester reductase-like protein [Mycobacterium rhodesiae NBB3]MSADTREERLARRIADLYENDQQFADARPDTAISRAISEPQQPLAEIIRG
AMDGYADRPAVGTRAVDFVTDPQTGRTTVRLLPRFDTITYGELWNRVEAL
ASALATDVDAGDRIAILGFTSVDYTVADLAAFRLGAVSVPLQTSAPVTQL
RPIVTETEPTAIASSVDFLDDAVDLVLTGHAPRRLVMFDIHPEVDDHRDA
LESARARLADAGSSVAIETLADAVTRGGALPSAPTYTPNADALALLIYTS
GSTGAPKGAIYTRFLVGQTWRPASWGWNDSPDPFITLSFMPMSHVMGRSG
LYATLAHGGTAYFAAKSDLSTLLDDLALVRPTQLTFVPRVWDMLAAEARR
EIEARLSPAADADTEAQVRAEVRTLMLGNRYLTAMTGSAPLSPDLRAWVE
DFLDMHLSDGYGSTEAGGVFHDGKVVRPPVIDYKLVDVPELGYFHTDRPH
PRGELLLKTTNMFPGYYKRPEVTAEVFDVEGFYKTGDIVAEIGPDQLQYL
DRRNFVLKLSQGEFVTASKIESVFETSPLVRQIYIYGNSARSYLLAVVVP
TVEALEALDGEALPKAINESLQDVAKTAGLQSFEIPRDFIVETTPFTLEN
GLLTGIRKLARPKLKEFYGPRLEELYTEMADGQAAELRELRQNGAQRPVV
ETISRAAGALLSAATADIGPEAHFTDLGGDSLSALTFANLLKDIFDIDVP
VGVIVSPANDIQALADYVETERTGSKRPTFAAVHGPDATAIHAGDLTLDK
FLDEQTVAAASSLPGPASEIRTVLLTGATGFLGRYLALEWLERMSLVGGK
VICVVRAKDDAAARRRLDATFDSGDPELLEHYHSMAADHLEVLAGDKGDA
DLGLDAATWQRLADTVDLIVDPAALVNHVLPYDQLFGPNVVGTAELIRIA
LTTKIKPYIYVSTVGVGDQIDPPAFVEDADVRVMSATRRVNDTYANGYGN
SKWAGEVLLREAHDLSGLPVAVFRCDMILAEPRYAGQLNVPDMFTRLMLS
LVATGIAPGSFYELDTAGNKQRAHYDGLPVDFIAEAISILGVHHAGAFET
YHVMNPYDDGIGLDEYVDWLIEAGYALDRVPDYRQWLQRFETSMRSLPDR
QRQASLLPLLHNYQQPSTPMRGSFAPTDRFRAAVQEAKIGPDKDIPHITA
DIIAKYITDLQLIGLL
375142511YP_005003160.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAPSRDLPTDRLAIGQLLVRLLREFRDDLAVPRADAGYGDVREVHFQIFG
NIRMGGIRLTELADRAQLSLAAASELVNDLVDLGYLTRRPDPADGRAKLI
DLTQRGQALMADAGGRVIDIERRWSAAVGERNFAQMVRTMQRLLDELDPK
DSRS
375142509YP_005003158.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTKVQNFIGGELVDSVSGATMVLVDPSTGEEYATAPVSNEADIDNAYAAA
SKAFKDWKRTTPSTRQKALLDFADEVERNAAALVEAEGRNTGKPNHVTTA
EEIPPMLDQIRFFAGAARVLEGKSAGEYMENHTSWIRREPVGVIGQVSPW
NYPMMMAIWKFCPAIAAGNTVVIKPSDTTPVTTVMLAEIAAKHFPPGVLN
VVCGDRNTGAAVVAHPTPEMVSITGSVAAGRAVAVSAGGHLKRTHLELGG
KAPVIVFDDSDIAAAAEGIATAGYFNAGQDCTAATRVLATAKVASDLTEA
LAEQARGATTTFGKAADDEDAWVPPVNNVNQMERVLSFFDDVPSHATVAA
GGERQGDKGFYVAPTVVGGLRQDDRLVQQEIFGPVITVQSFSDEDEAIAW
ANGTEYGLASSVWTKDVSRALRVSAALDFGCVWINTHIPLVAEMPHGGYK
SSGHGKDLSMYGLEDYTRIKHVMAFTG
375142507YP_005003156.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLGHLGINVDDLTAAKNYYDAVMPMLGFDEFFTAEDEFSYRPADGKPGTY
LFFYPSAEPSQYSRHQTGLQHLAFRVRTRSLVRDVHGLVTATLIPQFGGE
VLHRPQVFPQYPQPYFATFWLDPRGLMLEAVCHHDRD
375142505YP_005003154.1 protein-export membrane protein- SecD/SecF family [Mycobacterium rhMASSSTPVHPARYLAFFLVLLVGAYLLVFLTGDKKAEPKLGIDLQGGTRV
TLTARTPDGSRPTRDALNQAQTIISDRVNGLGVSGSEVIIDGDNLVITVP
GNESSEARNLGQTARLYIRPVIHAMPAAGQGQQPPTEAPQGAPPGAPGAI
PGVPGAEPGAPAPGGAGTPPAAPPQTPAPQPRPYPEQPPTQPTPSPSPSQ
PAPPPGTAQQPPPPGQQPPPPNPNDIPLSQRIADEKELRQSADQQIQILA
LQFQATRCGQDDVLAGNDDPNLPLVTCSQNGQEVYLLDKSIISGEQIENA
SSGLDQQQGQYIVDLQFKSDATKIWSDFTAANVGTQTAFVLDSQVVSAPE
IREPIPGGRTQISGQFTEQTARELANVLKYGSLPLSFESSEAETVSATLG
LTSLRAGLIAGAVGLALVLLYSLLYYRILGVLIGLSLVASGAMVYAILVL
LGRYIGYTLDLAGIAGLIIGIGMTADSFVVFFERIKDEIRDGRSFRSAVP
RGWNRARKTILSGNAVTFLAAAVLYVLAVGQVKGFAFTLGLTTILDVVVV
FLVTWPIVYIASKSPTMAKPRLNGLGAVQQIARERRAAAHVTGRG
375142503YP_005003152.1 dipeptide ABC transporter periplasmic protein [Mycobacterium rhodesMAMAWSRRGGALAAAMMVGAAGLSSCSSGPAESIDFAVDGLLTTYNTNTV
AGAASGGPQAFARVLTGFNYHGPDGQIVGDHDFGKVSVVGRAPLILDYEI
NADAVYSDGKPITCDDMVLAWASQSGRFPGFDAASRAGYVDVASVDCAPG
QKRARVSFAQDRAFVDYGQLFAATSMMPSHVIADELGLPDGGVVNAITKN
DGPAVERIAQAWNTTWNLKRDVDIKKFPSSGPYKLESVTEGGAVVLVAND
KWWGAPPVTSKVTVWPRGADIQDRINQRAYDVVDVAAGSSGTLNLPDDYV
RTDSPSAGIEQLIFASQGPMSTTPERRALAQCTPRDVIARNAAVPIANAR
LNPVTEDAYSAAENTVEAGKFSVADPVAARASINNRPLTVRIGYQSPNAR
LAATVGAIAKACAPAGITVQDVATEETGPLTLRDNKIDVLLASTGGAAGS
GSSGSNAMDAYDLHSANGNNLSRYNNERVDGIISTIAVTTDPKELSRLLG
EGATILWTDMPTLPLYRQQRTVLTSKQMYAVSSSPTRWGAGWNMDRWALG
Q
375142501YP_005003150.1 RelA/SpoT family (p)ppGpp synthetase [Mycobacterium rhodesiae NBB3]MAEDPGTGQAVQSPPSAQMPETQPLEIPKTDSSKAATSASRRVRARLARR
MTAQRSLVNPVLEPLVAVHKQFYPKANLTLLQRAYEVAEERHAGQLRRSG
DPYITHPLAVANILAELEMDTTTLIAALLHDTVEDTGYTLEALTEEFGTE
VGHLVDGVTKLDKVALGTAAEGETIRKMILAMARDPRVLVIKVADRLHNM
RTMRFLPPEKQAAKSRETLEVIAPLAHRLGMATVKWELEDLSFAILHPKK
YEEIVRLVADRAPSRDIYLAKVRAEITATLNASKINAVVEGRPKHYWSIY
QKMIVKGRDFDDIHDLVGVRILCDDVRDCYAAVGVVHSLWQPIAGRFKDY
IAQPRFGVYQSLHTTVVGPEGKPLEVQIRTVDMHKTAEYGIAAHWRYKEA
KGRNGAPANHAAAEIDDMAWMRQLLDWQREAADPGEFLESLRYDLAVQEI
FVFTPKGDLITLPTGSTPVDFAYAVHTEVGHRCIGSRVNGRLVALERKLE
NGDQVEVFTSKAPNAGPSRDWQTFVVSPRAKAKIRQWFAKERREEALESG
KDAIAREVRRAGIPLQRLMNAEQVAALARELRYVDVSALYTAVGEGHVSA
RHVVQRLVAQLGGDEDATDEIAERATPSTMPVRQRHTDDVGVAVPGAPGV
LSKLAKCCTPVPGDIIMGFVTRGGGVSVHRTDCTNAASLQEQSERIIDVQ
WAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSDDRV
AISRFTFEMGDPKHLGHLLNVVRNVEGVYDVYRVTSAA
375142499YP_005003148.1 peptidyl-prolyl cis-trans isomerase [Mycobacterium rhodesiae NBB3]MTNPPPPYGAYPPPYGAYPPYGGYPSGYPGYPPPQPTNTLAIASLVCAFV
FAPLGIVFGHISLSQIKKTGEEGRGLALAGLIISYLITALTILVVVLSVL
FVIAVGRSLEDLDGMTTDYTATPTRPINAPPLPEFKRPATLGSNCQYPTT
TEPASKPAKPPRTGRVPTEPALISAGIKTNRGAIGLQLDNAKAPCTVNNF
ASLAQQGFFDDTTCHRLTTTPTLGVLQCGDPSGSGTGGPGYRFPNEYPTN
QFRLTDPSLKTPMRYPRGTLAMANAGIGTNGSQFFLVYEDSALPPTYTVF
GTIDKTGLATLDKIAAGGVADSSGDGEPNQTVKIESVRVD
375142497YP_005003146.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MLITGFPAGMLACNCYVLAQRTGADAIIVDPGQRAMVPLRRILDENHLTP
AAVLLTHGHIDHIWSAQKVADMYGCPAYIHPDDRFMLTDPIKDFGPRLAQ
LAFGALFREPKQVVELDKDGDKVELGGVTVTVDHTPGHTRGSVVFRVSEG
TEEIVFTGDTLFRQSVGRTDLPGGSGRDLLGSIVTKLLVLGDDTVVLPGH
GEKTTIGYERRTNPFLEGLNQ
375142495YP_005003144.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMAAIQFVTDPMPNRDQVRAPRTEDYFRSVVDSLATGLVVFKHDGHIECVN
PAAQRILGVAADDLIHGCGAGTISGRMVDAAGRRIGADRWSMTCSVRASR
RAVGRVVGVDRPDGKRVWLSTSWCLLDPVDSTRSPLLVSFTDITAERATS
QRLAHQANHDALTGLPNRAHVLTKVTEALRASGENALGAILFIDLDNLKV
INDTLGHEAGDAALKIVADRLRTAVRPDDLVARLGGDEFVAVLGGSISGV
AVDRLSERLHTLLSEPAIIGGTTVRLGASVGIAEVGPDDHRDAAELLRDA
DQAMYHAKKSGRGRTCRFAEQMHRDAESIAK
375142493YP_005003142.1 dihydrofolate reductase [Mycobacterium rhodesiae NBB3]MGKLIYGFNVSVDGYIADAQGNIDWSDPSEELHQYWNDFAAEVAVSCYGR
RLYDLMSSYWPTADEAPDATPFIVDFARTWRDMPKVVFSRTLESVDWNSR
LERGDPVEVVTKLKAETDGTLELAGATLAAPIVQAGLVDEYRIVVTPTAV
GGGTPFFPPLPSWISLRLLENRSFPEGTVLLRYEPRHD
375142491YP_005003140.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAPTEAKVLIDTGGLVVTDDGRRVNIFDRCTGALAITAFVLGIATLVVG
GFGLVAMVTNVPSVELGAVFVAVGVVFAVVLYRVVRTIRRRRSQPLHSCR
SVAVIDRKLGLFSYGGGAIVPLDQVQFARRMQIGSSSPKLIALTPGGTKV
LKRGNPFDGGIGNVDEVLSAVVRGG
375142489YP_005003138.1 urea ABC transporter ATP-binding protein UrtD [Mycobacterium rhodesMTEVDASTAGKEPIVGGNVGMGTQYLEVRGLTVDFDGFKAVSDVDLTLFQ
GDLRFLIGPNGAGKTTVIDAITGLVSASGSVNKSGVELLGKKVHQIARRG
VGRTFQTASVFEQLTVLQNLDIAAGAGRSVWTLLRRRNGVLPSIEQALHT
IGLTHVADKPAGVLAHGQKQWLEIGVLLVQNADVLLLDEPVAGMSAEERE
ETGNLLRRIGAERTVVVVEHDMDFMRAFATSVTVLARGRVIAEGSVAEVQ
ANPKVQEVYLGTAAAGADGIELVEENS
375142487YP_005003136.1 urea ABC transporter permease UrtB [Mycobacterium rhodesiae NBB3]MDVLIGQLATGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIMAGCYTA
YVVQQIISSAGASLLISLVIGFFVGGAMGALLEVTLIQRMYHRPLDTLLV
TFGVGLILQQVARDIFGAPAVNVIAPAWLSGGVEILGAVVPKTRIFILVL
AIACVAALATALKVSPMGRRIRAVVQNRDLAETSGISSRKTDITTFFIGS
GLAAVAGVALTMIGSTSPTIGQSYLIDAFLVVVVGGLGQIKGTVIAAFSL
GFLNSFIEYNTTASLAKVIVFVIIVIFLQVRPQGLFTVRTRSLV
375142485YP_005003134.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRKATSIVGAALVLAAGSIAVSQVTADAQPPAPNVKYVVTADAPLSFDIN
YVTSSPADLKAFNANASAYSTRGSFVVPWEATATLDDPQWAYISVARAGH
AMEAPPNAHCEIWVDGQLAVQNTGPTTAFCQLSRW
375142483YP_005003132.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALVRAACVICAVAAFSLSVWTYMDVSMFGFPDGYITDYQAAADTPLTV
ITWIFAGFGLLFVALAFSPLGSRVRAFAWLAALMALIFVATAGYVGVPWY
FGTHLGLDNGIGG
375142481YP_005003130.1 DNA repair photolyase [Mycobacterium rhodesiae NBB3]MRWDGQGVSVDDGALPGLQRIGFVRSVRSPQFEGMTFHEIICKSALNKVP
NARPNVAGRPAAAMLPFNYTVNGYRGCSHACRYCFARPTHEYLDMDPGAD
FDTQVVVKTNVAEVLRRELSRRSWQRETVALGTNTDPYQRAEGRYALMPG
IIAALRDSGTPFSILTKGTLLRRDLPLITEAARHVDVSVAVSLAVGDPEL
HKDVEPGTPAPQARLGLISAVREAGLDCHVMVAPVLPHLTDSAAHLDALL
RQIAEAGATGVTVFGLHLRGSTRGWFMAWLARSHPELVSVYRELYGRGAY
LPSDYKKLLHDRATPLIAKHGLAPDRRSFRSVAAPAVVNTEVLQPTLF
375142479YP_005003128.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLPDNVIAHRTDADHSKTLAVTTEFVIWTPWAGYSPSSTANDQHQPASSL
ATAMLATTDRFLR
375142477YP_005003126.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTETASAPTATSESVEEFATRARKWLAENMPSIDPANPPEHDRGEDEPWQ
RARELQKKLYEGGFAGICFPREYGGLGLPIAYQKAFNNESRNYELPIILN
TPTFTICAATILDTGSEEQKQQHISGALRGDEVLVQLLSEPSGGSDLAGV
ITRADRKGDKWVINGAKTWSTSAFAADYGLMLARTDWDVPKHEGLTMFLV
PINSEGITLRRIKQVNGSVEFCEEFFDNLELGDDAVVGEVNGGWHVASRQ
LYHERRAVGGGSEFASGIGAEGKSDVPIDYVALLEATGQADSERAQEAAG
RALVHRAVREQLIDHVYHGVLDGALPPAAGSIIRVTHADVHHLEFDTVLS
LTGSSGVVDAGDDMIRYGERYLSRQAAALGGGTTEIARNIIGERVLGFPR
EHAADRGVPFNQVKRNKS
375142475YP_005003124.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTRELPYPVFDADNHFYEPKEALTQFLPDHRKGVIDYIDVRGRTKIMVRN
VVSDYIPNPTFEVVARPGAQEEYFRHGSGGKSFREVMGKPMKSIPAFRNP
EARLEVMDSLGLDYSLMFPTLASLVEERLKDDPDLILDIVHALNQWMYET
WQFNYEDRIFSTPVINLGNVDRALEELDWCLERGAKTVLVRPAPVPGYRG
TRSLGVEEFDPFWDACVKAGIPVSMHASDSGYSEYLNDWEPGDEFKPFAP
TAFRMVAMGKRPIEDTMAALVCHGALTRNPDLRVLSIENGADWVPYLFKQ
FKNVYSKMPHGFLEDPIEAFHRCVYVAPFWEDDFAQMAELLGIDRVIFGS
DWPHPEGLAQPTHLIDDLQGLDAEGQRKVMGGNMIDLFKIPNEIVHKPGV
PALEFA
375142473YP_005003122.1 acyl-CoA thioesterase [Mycobacterium rhodesiae NBB3]MTSDAAHPPSQAQWTVQNLLDLFDVAPDGENRFTAETGPAGEDERQVVEG
TQVLAQAIVAVAKRFPEKSVRSVSAVFARAVMVGAGPVELELDIVNEGRS
TATAIVAAKQNGKRCITATVLTDVPTADVIRHHLPRPDVTGPQDANVAEM
PMTGRQLRLVDVHDVNSPDEVGPPELYAWLHYDPIPTRDDLAKALIAYFT
GHLGISTTMRAHVGIGTAQSHLTVSTAPMTVTVSFHEPFTWDGWLLYTHE
STQVGAGMSYVRGAVHTESGELIASFTQDALIRPLRTTDTSIKEQSRL
375142471YP_005003120.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPERDPIEPDTKDWTWVLSRPCPDCGFARESVHHTEVADHIRADAASWV
SRLAGPGVTTRPQPTVWSTLEYGCHIRDVHRIFDHRVRLMLDADEPRFPN
WDQDQTALADDYRSQDPATVAAELVDAAATVADTYTHVPAHAWSRRGFRS
NGSEFTIASIAIYHLHDIVHHAHDVDHG
375142469YP_005003118.1 putative metalloprotease [Mycobacterium rhodesiae NBB3]MTFREGIDIDTSTTSSSGGGGGGRGIAIGGGVGGLLILVVALFLGVDPST
VIPQQQIDTGGVSTPGFDTSQCKTAEDANNIVQCRVIATGNSVDSVWQQL
LPGEYTRPKVMLFTGSVDTACGPATSDVGPFYCPGDQTAYFDTDFFDVLT
TQFGSSGGPLAQEYVVAHEFGHHVQDLQGSLVNAQRDPQGATGGGVRTEL
QADCYAGIWAHYAAVTKQESTGVPFLEPLSDKDIADALSAAASVGDDRIQ
KSATGRVNPEAWTHGSSAQRQKWFTEGYRTGDIAACDTFSTNDLG
375142467YP_005003116.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMAMHECERVGLDFIDSAPFRFVSTVDLDITGEQLFEVLADAESWPHWATA
ITKVTWTSPEPRGIGTTRTVNMRGGIVGDEEFLAWEPFTHMAFRFNEASS
SAIAAFAEDYRVVPTATGCHLTWVMAMKPKGAAGRIGMTLGKRIMGRTFQ
KFLYNLRDYSNRRFGV
375142465YP_005003114.1 2-dehydropantoate 2-reductase [Mycobacterium rhodesiae NBB3]MRIALVGPGAIGTTVAALVYAAGHEVAAYGRTPRPSLELRPDDGDPIVVP
HPVRSEPAEADGPVDVVLLAVKDTQNEAAGAWLARLCGEHTVVCALQNGV
EQVERVGRFCPQSTVVPCVVWFSAETQPEGWVRLRTPVRLVLPDTPAASQ
LAEALRGPRISVDTDPDFVTATWHKLLVNAVAGLMVLTGRRSGMFRRDDI
AAMARAYVAECLAVARAEGATLGDELVDQTVRLFTEVPADMTTSILTDRE
NGRALEWDIRNGVISRKAAAHKIATPISDVLVPLLAAASDGPG
375142463YP_005003112.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWRVIVFTTVGAVIALYLASVLGYHATTDTYRDFSFTEAAPETETSVIIR
LRQFDTLQNSLSVDVLVHPGRDMLSKDPQAVDNLTIRLSSWTASGELIYL
HADVSSDANTTLIAVGDPDNWPLDSYTTDVIGVELFSGTGAARQAVPAGV
IVAGHINGWNIASENATIASPPAPQQTLRLTLERSSAALSFDIGLILVLL
ALPAAALFVATQTLAGRLKFLPPIMTWFAAMLFAVIPLRNLLPGAPPAGA
WIDQLVVLWVLLAVAAAMIMYVVAWWRSRRAD
375142461YP_005003110.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MTEIGDLKAFNANIVDEFRANGGKVGGPFEGGDLLLLTTTGAKSGQPRLS
PLAYFTVDDRLIVVGSYAGADVDPAWVHNLRKYSRAHIEVGTTDYDVIAR
ELPTAERDELYARLVEQSPVFGEYQQKTSRVIPLFELQKA
375142459YP_005003108.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MTVLQGRLADRDAWSAVGECPVEKTMALLGTKTAMLIMREAYYGTTRFDD
FWRRIGVTKAAAAARLSELVDAGLLERRPYREPGQRSRDEYVLTAAGEDF
MPVVWAMFEWGRRHLPNRTPLRLAHADCGAEASVEIRCEKGHRVPPDELV
VRTVRS
375142457YP_005003106.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGIKVALEHRTSYTFDRLVEVHPHVVRLRPAPHSRTPIEAYSLTVEPADH
FINWQQDAFGLFLARLVFPNRARSLTITVGLIADMKVINPFDFFIEEYAE
QIGFTYPKSLAEDLKPYLRPVDEGDEGSGPGDLVQAWVANFSVAPGTRTI
DFLVALNRAVNADVGYSVRMEPGVQTPDHTLGTGIGSCRDSAWLLVSVLR
QLGLAARFVSGYLVQLTSDVEALDGPSGPAADFTDLHAWAEVYIPGAGWI
GLDPTSGLFAGEGHIPLSATPHPESAAPITGATEPCQTTLDFTNAVTRVH
EDPRVTLPYSEAAWGAICELGGRVDQRLAAGDVRLTMGGEPTFVSIDNQV
DPEWTTDADGPHKRRLASELTARLKKVWAPNGLVHRNQGKWYPGEPLPRW
QIGLFWRPDGEPLWHDARLLADPWPSTPQTIEVVSDAGLQLLGALADGLG
LPASQIRPAYEDALSRLAAAARLPDGEPVAATDDLVSDDAEARAELVARL
EASVTEPAAYVLPLHRADDGSGWASADWRLRRGRIVLLDGDSPAGLRLPL
KSISWHPPQPSHDADPLARRGELPVESGAESAEVVAADSAPTTAVVAEVR
DGLLYVYLPPTDEAEHFVDLIRRVEAAAAKIDCPVVLEGYGPPPDPRITS
TTVTPDPGVIEVNVAPTASFAEQRQQLETLYSEARQARLSTESFDVDGTH
SGTGGGNHITLGGITPADSPLLRRPDLLVSMLTYWQRHPSLSYLFAGRFI
GTTSQAPRVDEGRAEALYELEIAFAEIARLSAGDGGSRPDQGRSASSAPD
QGRSASSAPDQGRSASSAPWIIDRALRHLLTDITGNTHRAEFCIDKLYSP
DGARGRLGLLELRGFEMPPHYQMAMVQSLLVRSLVAWFWDEPLRAPLIRH
GANLHGRYLLPHFLIHDIADVAADLRAHGINFDTSWLDPFTEFRFPRIGT
AVFDGVEIEIRGAIEPWNVLGEESTAGGTARYVDSSVERIQVRLIGADRQ
RYVVTANGHPIPLLATDNPDVQVGGLRFRAWQPPSALHPTITVDGPLRFE
LVDTATGMSRGGCTYHVSHPGGRSYDHPPVNAVEAESRRGRRFETTGFTP
GKVDLSDIREKQARQSTDVGAPGILDLRRVRTVLQ
375142455YP_005003104.1 transglutaminase [Mycobacterium rhodesiae NBB3]MTAFPDGPTASGSSRCYQVSHRTTYRYSDDVTSSYGRGFLTPRDSARQRC
LSHELLIEPEAADSSTSRDAFGNISSYFHVTERHRTLSITSSSVVEVDPP
PADLYGGGSARAPWEIARPVGPDGALATEFTLDLRQPEITDALRDYAAPS
FEPERPLIDVLRDLTSRIYTDFTYRSGSTTVSTQVSEVLTAREGVCQDFA
RLAIACLRANGLAASYVSGYLATDPPPGKERMVGIDATHAWASVWTPQNH
WLGFDPTNDQMVDERYITVGFGRDYADVPPLRGIIYTDSEKSVIEVAVDV
APFEGGVLNA
375142453YP_005003102.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLLNRDTAEGIANGSITLVLRRWDAPRAKPGGTQRTVAGTIRIDDVAEYP
GTHRVTAAQARAAGYPDVATAQKDLDRRAARHTYAITVSYLAPDERPDLA
ADDQLSPSDIEAISSRLDRWDAATEAWTRRYLTMICANEAVRAPDLADRE
GIDVPRFKRRVRQLKSLGLTISLEVGYRLSPRGQAFLRLSSDSLGRADSR
375142451YP_005003100.1 AAA ATPase [Mycobacterium rhodesiae NBB3]MSDGLFDVPGETSSSGGALVGASTPLAVRMRPATLDEVVGQDHLLQPGSP
LRRLAEGSGAASIILYGPPGTGKTTLASLISQATGRRFEALSALSAGVKE
VRAVIEVARRAAAHGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAA
TTENPSFSVVAPLLSRSLILQLQPLDANAVRAVVRRAIDDERGLGGKVAV
ADEAVELLVQLSAGDARRALTALEVASEAGEEVTVEVIEQSLDKAAVRYD
RDGDQHYDVISAFIKSVRGSDVDAALHYLSRMLIAGEDPRFVARRLMILA
SEDVGMADPTALQTAVAAAQTVQLIGMPEAQLTLAHATVHLATAPKSNAV
TTALGAAMADIRAGKAGQVPTHLRDGHYSGAEKLGNAIGYKYAHDDPDGV
VPQQYPPDDLVGIDYYRPTTHGAEREIATRLDKLRAIIRKKR
375142449YP_005003098.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTNALDLTAPVDTLAMEFTREFDAPVEALFRAHADPELVKQWLGPHGLEM
EISEWNFTSHGGYRYTHSNDQGTFGFNGTFHTVRDNEFIVQTFEFEGAPD
MVNIEYMWFEDLGNGRSRLRGRSICPNTEARDALLSSGMEGGMTEGYEKL
DELLKNL
375142447YP_005003096.1 secondary thiamine-phosphate synthase enzyme [Mycobacterium rhodesiMPPDGRRLDGVDTDVLDIDTTRRRIVDLTDAVRSFCSGDRDGLCNVFVPH
ATAGVAIIETGAGSDDDLLDTLERLLPRDDRYRHAHGSPGHGADHVLPAL
ISPSVTLPVQGGEPLLGTWQSVVLVDLNSDNPQRKVRLSFISG
375142445YP_005003094.1 RNAse H-fold protein YqgF [Mycobacterium rhodesiae NBB3]MPTESVDRLPDRPGPTLHPPDPGRGRRLGIDAGRVRIGVAVSDPDGILAT
PVETVDRRKGSDKHVRRLAALVGEYEAVEAVVGLPRTLADRSGSAAQDAI
ALADQLAARIAPVPVRLADERLTTVAAQRALREAGVRAKGQRSMIDQVAA
VGILQNWLDQRRAALAAHSDFRDEVGDV
375142443YP_005003092.1 shikimate-5-dehydrogenase- fungal AROM-type [Mycobacterium rhodesiaMIAARKAAVLGSPIAHSRSPQLHLAAYRALGLDGWTYERIECTADQLPVL
VGDFGPEWVGVSVTMPGKFAALRFADERTPRAELVGSANTLVRSDNGWRA
DNTDVDGVTGALGQASGRAAVLGSGGTAPAVVVGLAELGVQDISVVARNR
DKAEPLLALAASVGAQARWIELGTPLTDIDVVVSTIPADVAAAHVDTLAA
VPVLLDAIYDPWPTPLAAAVEAAGGRVISGLEMLLNQAFAQVEQFTGLPA
PRDAMRAAIDDR
375142441YP_005003090.1 ketosteroid isomerase-like protein [Mycobacterium rhodesiae NBB3]MHTQSMQIRQQDLPAISERYFAAWAAHDPDAIVALHTPDTRFWMHMGGEP
VVGRDAVRDTFAEIFAQFPDFTFQTYRVIFGEDHWILDWALISGDIRFDC
LDVVNVSPDGLVARKDTFVDAAQVQAALGVTA
375142439YP_005003088.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MVLGYGRPVATRVAKRTQAQRTEATTAALVDAARELFARDGYEATSLDAV
AARAGMTKGAVYHHFDGKRQLFEAVFSREIDRMTTPLATAYTRKKDPWDA
FKAASRAFLDECLDPGLQRIVLLDAPAAIGWEGIRRLEAPLLDMMELAIS
RAVDAGRIAARPPGPLAHFLFGATCEVAMIVARADDQRTAQRQALAEIGR
VLDSLAIDQ
375142437YP_005003086.1 nitrile hydratase accessory protein [Mycobacterium rhodesiae NBB3]MTLHETCTTDQAAPQFEHEWQRRAFGLALALSEFGHYEWSDFQQSLIDTI
GRWEHTPEAERGEWDYYDHWVTALAKVVDDHHLLTNPAIANGDDHD
375142435YP_005003084.1 nitrile hydratase subunit beta [Mycobacterium rhodesiae NBB3]MKLQHYLGGLEGLPEPLNLEKRVFVEDWEERIFGIHVAMMGLSNHLGSAL
PQYPIDDVPTAFKDEWTWASLRTGAEAMNPFDYFKFRYYEKWLGGITQFF
VDQGYITEHELSSRQAELADAPAATADGTSAIDDQVVEYLRKGDSPRRDV
AHPKFAVGDRVRITNVPAAAHTRLPGYLRAREGTIERIFEGDYGYFVHTG
DGIGDPMPIYIVAFSPDELFGERAEGGPLTIYAELFEAYLEGVR
375142433YP_005003082.1 chorismate synthase [Mycobacterium rhodesiae NBB3]MLRWTTAGESHGRALVAVVEGMIAGVHVTTDDIAGQLARRRLGYGRGARM
KFEQDQVTMLAGVRHGVTLGGPIAIEVGNTEWPKWETVMAADPVDEAVLA
ESARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTF
ARALLREALGVEVLSHVISIGASKPYDGPPPQFSDLPAIDESPVRAFDEA
AAQSMIAEIEAAKKDGDTLGGIVEVVVHGLPVGLGSFTSGDNRLDSQLAG
AVMGIQAIKGVEIGDGFETARRRGSVAHDEMYPGADGVMRSTNRAGGLEG
GMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAVPAA
GVVVETMVALVLARATLEKFGGDSLTETRANVDNYLRAVTEREPAGGQKR
SDPGISTAQPVQAPG
375142431YP_005003080.1 3-dehydroquinate synthase [Mycobacterium rhodesiae NBB3]MPEPVTVDVLVDPPYPVIIGTGLLGELERTLAGRHKVAILHQPTLGETAE
AIRHTLSEKGIDAHRIEIPDAEKGKDLPVLGFIWEVLGRIGIGRKDAIVS
LGGGAATDVAGFAAATWLRGIDIVHVPTTLLGMVDAAVGGKTGINTDAGK
NLVGAFHQPAAVLVDIATLETLPRNELVAGMAEIVKAGFIADPVILDMIE
SDPQAAVDPKGQVLPELIRRAIAVKAEVVAADEKESQLREILNYGHTLAH
AIERRERYEWRHGAAVSVGLVFAAELGRLAGRLDDDTADRHRNVLQALGL
PVEYDADALPQLLEYMAGDKKTRAGVLRFVVLDGLGKPGRLEGPDPSLLA
AAYSVIGKGAA
375142429YP_005003078.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNPDEFCTSDQWSVLTSAASHSQFAGVLGGFLITAIALLMDKKSRESIHT
LALFSAAVLILMLDSFLFSLITGTQTPEGDRRGICAIAWTQGAVSTGMLA
AGATALFGGLGWMLASHAVNRLAEQDPDDAGAYGFLADLGGWLTFAATMA
TTLILSETTIDYLHFMFGRRPDLWATGLIVVSAAVVIGVNFALVYVRTKT
LRRSLADTSEPTRLALRSIKVATVTTMGLAIAASWLAVSLARFPQGWLTE
PNIVFVVFVAILTFVLPTIVATAICYSVASTEGGLSIRGLRGTSGQGRSP
ASRARR
375142427YP_005003076.1 Xaa-Pro aminopeptidase [Mycobacterium rhodesiae NBB3]MTISQRRDRLRQRLVAADLDAILVSDLVNVRYLSGFTGSNAALLVRAEDP
TPVLATDGRYRTQAAQQAPDAELVIERACGPHLVARAAADGVSRLGFESH
VVTVDAFSVLTKAAGELTELVRASGTVEALREVKDAGEIALLRLACEAAD
AALHDLVERGGLRPGRTEKEVGRELEALMLDHGADGVSFETIVAAGANSA
IPHHRPTDAVLAAGDFVKIDFGALVCGYHSDMTRTFVLSPAAQWQHDIYD
LVATAQRAGRDALAPGVPLSDVDAAARQIIADAGYAENFGHGLGHGVGLQ
IHEAPGISASSAGTLLAGSAVTVEPGVYLPDRGGVRIEDTLVVGSDSHQT
SEPGSRRHEAADLLTRFPRELAIL
375142425YP_005003074.1 transcription antitermination factor NusB [Mycobacterium rhodesiae MPDRRGDRGRHQARKRAVDLLFEAEARGLTPADVAEARNALAQTQSDVSP
LNPYTVTVAQGVTEHTAHVDDLISAHLQGWTLDRLPAVDRAILRVAVWEL
LHADDVPEPVAVDEAVELAKQLSTDDSPGFVNGVLGQVMLVTPQIRAAAQ
AVRGAGDSGAGS
375142423YP_005003072.1 transposase- IS30 family [Mycobacterium rhodesiae NBB3]MGFRGQGQQAPASARLAFFEAVNAGSSWAAAATVAGVARDTGDRWARAAG
YQAQTRHFGTRYSAQAREAFWAAMRAGASVTQAALGAGVSEIAGRRWVKQ
AGYVPRTTVPIAAAEVLTVVDGSARCRRALTFTERCRLEMLLENGYTAAQ
LVDLLGRHQDTISREIARGQTASGYRARVGQDVADANRKRPKVRKLVRNP
ALLAEVLQGLQQRCSPEQIAGRLRLDFPDDSEMWVSHETIYQGLYVQLRG
ELTKDLKSALRTGRIKRKPHGRNQIAERRRFKEGMVSITERPAEADDRAI
PGHWEGDLIMGSANASAIGTLVERTTGFVLLLHLPVDHTAETVAAAMTAK
IVEIPEILRRSLTWDQGTEMAQHSAITKATGLPIYFCDPHSPWQRATNEN
TNGLLRQYFPKGTDLSFWGPGFLDQVATELNGRPRKRHGFRTPAEELHRL
LSNPSAYAAATA
375142421YP_005003070.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium rMSDTNRHGRFSTLSPMKLDDNHASIREAIDAGLLAGAVTLVWRSGEVLQV
NELGHRDVDAGLPMERDTIFRIASMTKPVTIAAAMSLIEEGRVALSDPVA
TWLPELSDMEVLLEPRGPLDKTTPARRQITIEDLMTHRSGLAYSFSVLGP
LSKAYGRMSFRQDQDRWLSELVTLPLVHQPGERLTYSHATDVLGIALSRI
EGKSLADVLSERIFGPLGMVDTGFSVGTAGRRRAATMYQLDADLKLRHDV
MGPAHIVDPPFCAGGAGLWSTVDDYLRFARMLLAGGTLDGVRVLSEESVR
QMRTDRLTDEQKRQPFLGSPFWVGRGFGLNLSVVTDPSKSRQLFGPGGLG
TFGWPGAYGTWWQADPSADLILIYLIQNLPELNADAAAAIAGNTSLAKLQ
SAQPKFVRRTYQALDV
375142419YP_005003068.1 aspartate carbamoyltransferase [Mycobacterium rhodesiae NBB3]MKHLLSAADLSREDAVAILDNADRFSQALLGREVKKLPTLRGRTIITMFY
ENSTRTRVSFEVAGKWMSADVINVSSSGSSVSKGESLRDTALTLRAAGAD
ALIIRHPASGAAQQLAEWTRPSGTDATGPAVINAGDGTHEHPTQALLDAL
TIRQRLGDIEGKRVVIVGDVLHSRVARSNVLLLHTLGAEVVLVAPPTLLP
VGVAGWPVTVSHDLDAELPVADAVLMLRVQAERMNGGFFPSAREYSVLYG
LSEKRQAMLPGNAVVLHPGPMVRGMEIAFSVADSPQSAVLQQVSNGVHIR
MAVLFHLLVGAETEAISA
375142417YP_005003066.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNTGTLVGSLIMAAVLAVLIAFIIQAMLRGWRRRAERQAELIGTLPPLPD
TVGSAIIPATRGLYVGSTLVPNWNDRVAVGELGFRHKAVLTRYPEGIMLQ
RSGAGPIWIPEESITAIRTERGVAGKAMTHEGILAIRWRLPSGTEIDTGF
RADNRAAYTPWLEAA
375142415YP_005003064.1 carbamoyl-phosphate synthase large subunit [Mycobacterium rhodesiaeMPKRTDLNHVLVIGSGPIIIGQACEFDYSGTQACRVLRAEGLQVSLINSN
PATIMTDPEYADHTYVEPITAAFVEKIFAQHAERGNKIDALLATLGGQTA
LNTAVALYENGALERWGVELIGADFEAIQRGEDRQKFKDIVSKVGGESAR
SRVCFTMDEVRETVAELGLPVVVRPSFTMGGLGSGMAYSAEDVDRMAGEG
LAASPSANVLIEESIFGWKEFELELMRDGHDNVVVVCSIENFDPMGVHTG
DSVTVAPAMTLTDREYQKMRSLGIDILREVGVDTGGCNIQFAVNPADGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADATLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETTRAGFWTKPDPEVSVDELLEALRTPTDGRLYDLELALRKGAT
VEQVAQASGVDPWFVEQIAGLVTLRAELLDAPVLDEQLLRRGKYHGLSDR
QIASLRPELAGEIGVRALRTRLGIHPVYKTVDTCAAEFEAKTPYHYSTYE
LDPAAETEVAPQTEKPKVLILGSGPNRIGQGIEFDYSCVHAATTLSEAGF
ETIMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVYYAESASGAGGPGVV
GVIVQLGGQTPLGLAERLEKAGVPIVGTSPKAIDLAEDRGAFGEVLNIAG
LPAPRFGTATSFEQARRIAADIGYPVLVRPSYVLGGRGMEIVYDEETLQG
YITRATELSPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGIMEHIEEAG
IHSGDSACALPPVTLGRSDIESVRRATEAIAHGIGVIGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAVPLAKACARIMLGASIAQLRTEGVLAHS
GDGATTARNAPVAVKEAVLPFHRFRKADGAQIDSLLGPEMKSTGEVMGIA
HDFGSAFAKSQTAAYGSLPAEGTVFVSVANRDKRSLVFPVKRLADLGFRV
LATAGTAEMLRRNGIPCDEVRKHFEQPGEGRPASSAVDLIRSGEVDMVIN
TPYGNSGPRIDGYEIRSAAVSMNIPCVTTVQGASAAVQGIEAGIRGDIGV
MSLQELHSVLGP
375142413YP_005003062.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAYDLAAWTDFANTVAGGAAALAGLLFVGLSLNLSEVLRYQGVPSRAGA
TLGLTVAILLTAIFVATPGQSRYALSIEIAVLGLATAALVSEAMRHQRAG
AHRGRALTSMLMLLLPALLLLVAAVSLWSERGGGLYWVTAAVTTGFVAAT
ANAWVLVVEIKR
375142411YP_005003060.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFDQ
375142409YP_005003058.1 DNA-directed RNA polymerase subunit omega [Mycobacterium rhodesiae MVSHPNFTDNRQEIFYVSTPHADAQLTAVDDIESGAGAYDTPLGITNPPI
DELLDRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEK
PLSIAMREIHGDLLEHTEGE
375142407YP_005003056.1 S-adenosylmethionine synthetase [Mycobacterium rhodesiae NBB3]MSEARLFTSESVTEGHPDKICDAISDSVLDALLADDPKSRVAVETLVTTG
QVHVVGEVTTTAREAFADISNIVRARILDIGYDSSEKGFDGETCGVNIGI
GAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIRDTPELMP
LPIALAHRLSRRLTEVRKNGVLDYLRPDGKTQVTVQYDGTTPVRLDTVVL
STQHAAGIDLEATLAPDIREKVVNTVLADLNHESMDTSDFRLLVNPTGKF
VLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRW
VAKNVVAAGLAERIEVQVAYAIGKAAPVGLFVETFGSESVDPARIEKAIT
SVFDLRPGAIVRDLELLRPIYAQTAAYGHFGRTDVDLPWERLDKVEDLKA
AV
375142405YP_005003054.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MPVAEDKPAVDAILLKVIEAVPFQLSTDGGVEEARRRFRDMPRREVHPEV
RSEDRVIDGPAGSMPIRVYRPPTDTHAPWPVVVFIHGGGWSVGDLDTYDG
LARRHVVGAEAVVVSIDYRLAPEHPYPAAVDDAWAATRWVAEHAAELGGD
PDRLSVAGDSAGGNLAAVVTQLARDSGGPRIAFQLLWYPSTTFDTSLPSF
TENADAPILDIEGCKGCTRWYIGDFDLSDMPSTLAPARAQDLTGLPPAYI
AVAGHDPLRDDGMRYAELLGAAGVPVELHNAETLVHGYAGYDGVVPAATE
AVEKGLYALRRALHPA
375142403YP_005003052.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTELNSPARPGATRQQAEHEPIARVLPMLTVPHLDREFDYLVSADQSDDA
QPGVRVRIRFHGRLVDAFVLERRSETDHVGKLGWLDRVVSPQQVLTPDVR
RLTDAIAARYAGTRADVLRLAVPPRHANVEKQPPPESAAFTPAVVDTTAW
SAYRGGEQYCSALDDARAARAVWQALPGEHWADRLAELAAVTANSGRGAL
AIVPDQRDVDALYAEAIRLVGEPWVVALSAGLGPAQRYRRWLSVLRGQAR
IVIGTRSAVFAPVASLGLLMVWDDGDDTLAEPRAPYPHAREVAMLRAHQL
RCAALIGGYARTAEAQALVRSGWAHDLVGTRQEVRARSPRVVALEDSGYA
QERDPAARTARLPSMALQAARTALQSGRPVLVQVPRRGYVPALACGRCRA
IARCRHCTGPLSLPARDTAGVVCRWCGREELSLRCTRCGSDAVRAVVVGA
RRTAEELGRAFPGVHVVTSGGDSMVAAVSDEPAVVVSTPGAEPVAAGGYG
AALLLDTWALLGRQDLRASEDALRRWMAAAALVRGRSEGGVVAVVAESAI
PTVQSLIRWDPVGHADAELDSRAEVGLPPAVHMAAIDGAPDAVHAMIDTA
ELPEGADLLGPVDLPLGVRRPPGTPPDKPVSRMLIRVRRDAGLPLAAALR
RAAGVLSARRDHEPVRVQIDPLHIG
375142401YP_005003050.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVRLLLVIVLALALAALVIFVLGYNRIRSAEVRVAEALSGIDVELTRRAS
LIPSLVHTVQTFAVHEKGILDHVTSARAAVTSATSGKSVAQRSAAEKDLD
TALVPLLALGQSYPQLNSSNNFLNLQDNLADTENKLAFARQYYNDSVATL
NGLLSTIPWMFVAPLTGVAEHEYYQTPR
375142399YP_005003048.1 tRNA/rRNA cytosine-C5-methylase [Mycobacterium rhodesiae NBB3]MTKPRNNKRPTRRKQLDPARRAAFDVLRAVSEKDAYANLALPALLRDRGI
TGRDAAFATELTYGTCRTRGLLDAIIAAAAGRSTDKIDPVLLDLLRLGAY
QLLRTRVEQHAAVSTTVEQAGIEFDSARAGFVNGVLRTIAGRDEQSWVAE
LAPDVAADPIGHAAFVHAHPRWIAQAFADALGTDAGQLNALLASDDERPS
VHLAARPGVLTAEQLAEQVDGTVGRYSPYAVYLAGGDPGQLAPIRDGVAL
VQDEGSQLVARALTHAELDGPDGGRWLDLCAGPGGKTALLAALADGGRVT
AVEPAERRAALVEQNTAGLPVDVVRVDGRDPGLDAGFDRVLVDAPCTGLG
ALRRRPEARWRRVPADVPQLAKLQRELLASAIRLTRPGGVVLYATCSPHL
VETVGIVADALRRHPVTALDTRPLFDPVDGLGDGPYVQLWPHRHGTDAMF
AACLKVG
375142397YP_005003046.1 riboflavin biosynthesis protein RibD [Mycobacterium rhodesiae NBB3]MNLDAAMRLAIEQADRVKGSTYPNPPVGAVILDSDNDVAGVGATEPPGGP
HAEVLALRRAGERAVGGTAVVTLEPCNHHGRTPPCVDALVAAGVSAVAYA
VADPNPVAAGGASRLTEAGLQVTAGVLADQVVGGPLREWLHKQRTGSPHV
TWKFATSVDGRSAAADGSSQWITSDAARADVHRRRAVADAVLVGTGTVFV
DDPLLTARLPDGSLAERQPLRVVVGEREISPEAKVLNDDSRTMVIRTRDP
HEVIKALSDRTDLLLEGGPTLAGAFLRAGVIDRILAYIGPILLGGPITAI
DDVGVLSIAHAQRWRFDGVESIGPDVLLSLVPG
375142395YP_005003044.1 lipoprotein release ABC transporter permease [Mycobacterium rhodesiMLMAALRDMQWRRRRFVIAILSTAIIFAMTLVLTGLANGFRVEADKTVNS
LGVDLFLVKAGASGPFVGATPFAPVELRRVAQAAGVDSAAPLAYAGGTAT
LDGSTRNVDIFGAPENGPGMPTVSAGRPPSTRDEVAVSSTLDRGIGQEVE
IASRTLRIVGIVENSTALANLPNVFLTTEGAQQLVYGGEPLVASIGIRGT
LEQAPPGYRAIDRNGAVEDLLRPLKVAVNSITIVAILLWVVAALVVGSVI
YLSALERLRDFAVFKAIGVPTKSIAAGLAMQAIIVALLAALVGAGLSMLL
GPLFPMQVIVPVQAFIALPVIAIVIGLIASASGLHRAVAVDPALAFGGP
375142393YP_005003042.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALQDWLSDRPMDPRTITTLIRDAIRGLSGDGPEPLAEPTLMGRGLERC
375142391YP_005003040.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPGRPVATGRPTTMQVMQTRLLAIFAALFTAVALLAGCGSSEDTKNLPDA
ATLLKQSVDTTKSQSSVHLLLTVNGEIPEFPIESLEADLTTKPAVAAQGK
ANILLGGQRLEGVGFVVVDGTLYGALTAGSAYQDFGPAADIYDASVLLSP
DKGLANVLSNFSDPKAEARETINGVKTVRVKGSVSQDAVNKIVPQVGATG
AVPGTAWIAEEGNHELIQAKLEPKPDTSLTMTLSDWGKPVTVTKPAA
375142389YP_005003038.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTTPGSQWTDERDEPKQPKKAIHVKHLLVGGISAALLATALAIPAAAEP
SWTMPDLIGSDLQGAQDAIQSVSNGEVWLSTSTDLSGEGRAQIMDRNWTV
CSSTPAPGATFTGTTAIDFGVVRDSETCP
375142387YP_005003036.1 GTP cyclohydrolase II/3-4-dihydroxy-2-butanone 4-phosphate synthaseMTRLDTVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMV
RYTSGYLCVPLDGSVCDKLGLLPMYAVNQDKHGTAYTVTVDAKKGVGTGI
SASDRATTMRLLADPTAVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVD
LARLAGLQPAGAICEIVSQKDEGAMAQTDELRVFADEHDLALISIADLIE
WRRKHEKHIERIAEARIPTAHGEFRAVGYSSIYEDVEHVALVRGEIAGPH
SDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGIVLYMR
GHEGRGIGLMHKLQAYQLQDAGEDTVDANLKLGLPADARDYGIGAQILVD
LGVRSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDR
MGHDLIGLDEYHEAVTMDSYEEGVYLLGDRTPPAERDLGGAL
375142385YP_005003034.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDWDVEIRPHLTPYFAYAAAALILVAHVAVGVLLKIASTGVIFQTADQV
AIALLGVVIASVVLLFARPRLRVGPQGIAVRNLLTYKLIPWSEVVDVSFH
RGARWARVDLPDDEYVPVLAIQAVDKERAVDAMTTVRGLLGRYKAINSR
375142383YP_005003032.1 gamma-glutamyltransferase [Mycobacterium rhodesiae NBB3]MNYRRVMRFSSLTKVMAPLTGIAVVLAGCAAEENPEPGAAGPCAIVANGT
PTPKTAANPTVTTSHNMSTNPEVAAGYRKDMTAVRTSSYSVATANPLATH
AACEVLRDGGTAADALVTAQMVLGLVEPQSSGIGGGGFLLYYDAAADSVQ
AYDGREAAPASATENYLRWISDTDRTVPKPDARASGRSIGVPGIVRLMAE
VHAEHGKTGWGDLFSPAVTLADDGFDISPRMATAIADSAPELKMDPRAAE
YFLNPDGSPKIAGTRLTNPAYAKTLGAIASDPQSFYTGAIADDIVDAVAD
TAGGRTPGLMTRDDLAGYSVKMREALCTPYRGKEICGMPPPSSGGIAVAA
TLGMLEHFAMADHKPSGTDLNGGRPSVLGVHLISEAERLAYADRDKYVAD
TDFVALPGGSPNTLISSDYLAGRATLISEQRSMGTAKPGEFGPPTAPVPP
PPEHGTSQVSIVDARGNAASMTTTVESSFGSFHMVDGFILNNQLTDFSAE
PVGPDGAPVANRIEPGKRPRSSMAPTLVFDAAGQPGRRGPLYAVLGSPGG
SVIIQFVVKTVVGMLDWGLDPQQAVSMVDFGAANTPKTNVGGEHPVIDTS
DDGDHDPLVVGLRKLGHQVDLADQTSGLSAIIRDGSSLIGGADPRREGLV
MGDTR
375142381YP_005003030.1 putative P-loop-containing kinase [Mycobacterium rhodesiae NBB3]MTDRGMREELQDGTTPGDSAESGIDVVLVTGLSGAGRGTAAKVLEDLGWY
VADNLPPELIARMVELGLAAGSRITQLAVVMDVRSRGFTGDLDWVRNDLA
TRNITPRVLFLEASDDILIRRYEQNRRSHPLQGTQTLAEGIAAERAMLAP
LRAVADLVIDTSTLPVPALRESIERAFGGETVAHTNVTVESFGYKYGLPM
DADTVMDVRFLPNPHWVDSLRPHTGQDQAVRDYVLGQPGAVEFLETYHRL
LDFVIDGYRREGKRYMTVAIGCTGGKHRSVAIAEALAARLQGGDGLTVRV
LHRDLGRE
375142379YP_005003028.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAMTAEVKDELSRLVVNSVSARRAEVASLLRFAGGLHIVSGRVVVEAEVD
LGIIARRLRKDIYDLYGYNAVVHVLSASGIRKSTRYVLRVAKDGEALARQ
TGLLDLRGRPVRGLPAQVVGGSVADAEAAWRGAFLAHGSLTEPGRSSALE
VSCPGPEAALALVGAARRLGVSAKAREVRGADRVVVRDGEAIGALLTRMG
AQDTRLTWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERAL
EILADTVPDHLAAAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLL
SMADRKAKQDGIPDTESAVTPDLLEDA
375142377YP_005003026.1 periplasmic component of amino acid ABC-type transporter/signal traMETLRVGAAFPDPPFNGMPDDSGLDIDLMQAIAEKLGAAVEFVSYDGADF
NGIFNGLGSAYDCVTAGTTVTPEREQQATFVPPYLISGQALAVDTTRLPQ
VRSVDDLEGLTIGVQQGNTSQPIAERLVAEGKAAAVRVYDYGAIRTALTD
LTTGACDAFMKLAPVLTELVKAVQGVEVVQRGISVENIAIAVAIGDQALL
GRLTLAQAELEDDGILQRIRGKWLGNPYADQNLAVL
375142375YP_005003024.1 glyceraldehyde-3-phosphate dehydrogenase- type I [Mycobacterium rhoMTIRVGVNGFGRIGRNFYRALAAQKAEGKSTDVEIIAVNDLTDNASLAHL
LKFDSILGRYPEDISLEGEDTIVIGSTKIKALEVKEGPAALPWGDLGVDV
VVESTGIFTARAKAQGHLDAGAKKVIISAPASDEDITIVLGVNDDKYDGS
QNIISNASCTTNCLGPLAKVLNDEFGIVKGLMTTVHAYTQDQNLQDGPHK
DLRRARAAALNIVPTSTGAAKAIGLVLPELKGKLDGYALRVPIPTGSCTD
LTAELSKSATADEINAAFKAAADGPLKGILKYYDAPIVSSDIVTDPHSSI
FDAGLTKVIDNQAKTVSWYDNEWGYSNRLVDLVALVGKSL
375142373YP_005003022.1 triosephosphate isomerase [Mycobacterium rhodesiae NBB3]MSRTPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVAVLPPFTDL
RSVQTLVDGDKLRLTYGAQDVSQHESGAYTGEISGAFLAKLGCTYAVVGH
SERRTYHHEDDALVAAKAAAAFKHGITPIICIGEQLEVREAGNHVEYNVE
SLRGSVAGLTAEQIGEAVIAYEPVWAIGTGRVASAADAQEVCKAIRDELG
KLSSPQLAAGVRILYGGSVNAKNVGEIVAQEDVDGALVGGASLDGEQFAT
LSAIAAGGPLP
375142371YP_005003020.1 phosphoenolpyruvate carboxylase [Mycobacterium rhodesiae NBB3]MAEVGGLEPIGAVQRTKVGREATEPMREDIRLLGTILGETVREQNGEAVF
ELVERARVESFRVRRSEIDRAELASMFDGIDIHQAIPVIRAFTHFALLAN
VAEDIHRERRRVIHVAAGEPPQDSSLAATYAKLDTARLDAATVSDALAGA
LVSPVITAHPTETRRRTVFDTQHRITELMRLRMKGHEHTDDGRGIERELR
RNILTLWQTALIRLSRLKIQDEIETGLRYYAAAFFEVVPRVNAEVRNALR
YRWPDTDLLAEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAYTALEHY
FTEITALEEELSMSARLVKISDALTALADQCREPARADEPYRRALRAIHA
RLTTTAYDILDRQPEHELDLGLDRYDTPAELLADLDVVDESLRTNGSAVL
ADDRLARLREAVHVFGFHLSGLDMRQNSEVHEEVIAELLAWAGVHPDYAS
LSEPDRVELLAAEVATRRPLTSDGAELSELARKELDIVAAAARAVRVLGP
AAVPNYVISMCQSVSDMLEVAVLLKEVGLLDVSGSQAYAPVRIVPLFETI
DDLQRGSSILEQALDLPVYRALVSARGDSQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAIRAQPPGAVR
GSLRITEQGEVIAAKYAEPQIAHRNLETLLAATLEASLLDIEGLGDAAGP
AYDVLDDIAARAQRSYAELVHETPGFVEYFKASTPVSEIGALNIGSRPTS
RKPTTSISDLRAIPWVLAWSQSRVMLPGWYGTGTAFEDWINQGDGRLEVL
RDLYQRWPFFRTVLSNMAQVLAKSDMGLAAHYSELVDDTELRRRVFDKIV
AEHTRTIRMHKLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDDDELVQRGILLTMSGLATALRNSG
375142369YP_005003018.1 sulfotransferase family protein [Mycobacterium rhodesiae NBB3]MTFTVEKLEDGARAATGLDDFGSPYYREGLERTVDALNNEADLNEMGGII
QHATISNALIQRLRIVDTYKQHPEIDDEVIQGPVFVIGLPRTGTTALSQL
VASDPQFRSLRMWESQACTPPPETATQHDDPRIAQAAEGIAMMDSMFPRM
RTMMNSEPEAATECQDLMGMSFRTFHFDGVVRVPGYLAWLMQCDMRETYT
FHRQVLKLLQWHCPPNLWHLKTPVHMFSLDALVEAYPNAKFLWSHRDPAK
VLASVCSLIQYVRSWSSDRDDAHELGAEQLECWAEGIRRAMDFRKRLGDN
RFVDVSFADLNADPIGTLERGYDRLDLVFTGEARRRVQEWADGHRPGSRG
EHAYDLADYGLTREQVHDAFADYLATYDATA
375142367YP_005003016.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MDLGLAGSTAVVTGGSKGMGLAIATTFAEEGAKVAVMARGAEALEEATAK
LRDAGAPDAVGISVEMSDASSIAAGFEIVAQRWGELNSLVHTIGPGDGYF
EEMDDAQWEETFALGTMSGVRSIRAALPMLRAAQWGRIVTLSAHSIQRQN
PRIVAYTASKAALSSVTKNLSKSLAKDGILVNCVCPGTIVTASFTEALKD
ILAADGLDATDPTDVMTWIDNNFHQPCDLGRAGLPEEIASITVYLASRRN
GYVTGATVNVDGGSDFV
375142865YP_005003514.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMNMNDMVLVSVDDHMVEPPGLFDKHIPAKYKDDVPKLIQREDGTDAWVFE
GAEATNVGLNAVAGRPPDEYGAEPTKLSEIREGCYNIDERIRDMNANGVA
AALNFPSFPQFCGQYFARAKDKELGLAVLRAYNDWHIDEWCGAYPGRMIP
QALPPIWDPQLMADEVRRVAKKGCHAVSFSENPTKIEHPSLHDPHWDPFW
QACSDEGTIVNLHIGSSSSVVITSLDAPVDTMITLQPMSIVQAAADLVWS
PMLRKFPDLRFALSEGGIGWVPYFLERIDRVYKMHRAWTHQDFGDKTPSE
VFLERVALCFIDDEFGVANRDKLNMDMVTWECDYPHSDSTWPLAPETLDI
YLDGLDDDEVDKITHENALRLYNFDMFSHIPKEQLTVGALRAQATDVDLG
FRSSERLKKDGTDTVSVLDLASKIAT
375142864YP_005003513.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MNLELTAEQLALRDTVREFLSAKAGVDGHVRPMLADPVGTTDEIWRGLAD
LGTTGLLVPVEHGGEGMSMVEAAIVCEELGAALHPGPWLSSAVAAPRALL
RFGAAAASFSGLADGSTVAAVAPHDAGITRDDDRLHGELESVPDVAAAQT
LFIPVGAEQPALVAVSTSEPGLQIAQIHGIDQSRKLFRLSFDNVAGTVVA
ATSRAALESLHDDMIVAWAADAVGAARQVLHITVEYAKVRRQFGAPIGSF
QAVAHLCAEMYETVELARSGVQYAVWAADCADHAERHLAALRVKAFAGQL
AGVGDKAIAVFGGIGFTWEHDAQLYLKRLLSFSRFLGSPGDYLQQVGHEL
IRNAS
375142863YP_005003512.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSYPQEAEQFRKELQAWLSAHLTDTVIAASARRGSDEDAFETLRAWNA
TIADAGWAAVSWPQQYGGRGASAIEQLVYAEEATRARVPHPLNTIGINNI
APAIMQYGSDEQKAALLSRMLRADDIWCQGMSEPEAGSDLASLRTKAVRD
GDDFVVSGQKIWTSLGHRADWCQLYVRTDPEAPKHKGISCLIVDMSLPGI
EARPLVTLSGDADFAEVFFNGVRIPVDALLGPLNKGWQVATTTLSHERAG
AARLYAEMQLRLRDLVADLVADDSSAVDDPSTVRRLGELDTRIKNLEILC
QRSISAGMHGGDAFATAGLAKSVWGEIGKDLAALAFDTLGPGAGDGRWDE
FRLTSHALTIAGGTTQINKNITAQRVLGLPRS
375142862YP_005003511.1 nitric oxide reductase activation protein [Mycobacterium rhodesiae MTADVDSDRLQLLGMLASALAGRALAVAAGGAGEPSWTDGQTVFVDPSAL
TRTNLESVAVHASMLAADSLTPDVVDRLTRHPKLAKRYLAVEGHRALVAN
ADLLPGVLDSLADRELAGRSDSAQSSLTIATAKGELADAPPGFGVIRAKK
LAAAIKRAETDDTKAGHVARKEAKGELEELDEDAVDDSDDPDLFSSPVGG
GGFIGKWLKKMLSSARKTGSDGGGPPGADTPTHRTNSANRGAYAVSSTAS
MSAEDAGDVKTDGLKYPEWDAARGAYRPDWCTVREVDPKIKPFATQAIES
AVGVRRPLARLGMGLHRRHRQPQGDDIDIDAAVEARVEVMAGSVPDEAVY
LDSLRRRRDLSVLLLLDISGSTAEPGTLGRTVHQQQRTAVANLAVALHDL
GDRVSLYAYYSQGRSAVSMVPVKRFDDHLDAGIFRRLNSLEPGAYSRLGA
AIRHGSAVLERRGGTSRRLLVVLSDGLAYDHGYERDYGAADSRRALNEAR
RRGIGCVCLTVGAGTDVRSLKKVFGSSAHATIGRPEQLAGVVGPLFRSAV
RAAEVRRRVS
375142861YP_005003510.1 ATPase family protein associated with various cellular activities (MANEAGLAYQNGAMPQTDSARPYYQALSNEEAVFKAAYRQGLSLVLKGPT
GCGKTRFVEAMAHDLGRPLITVSCHDDLTTADLVGRYLLRGDETVWTDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLGDHRRQLPIERLGITLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGYPVPEVEEGIVVHESGV
DAATAAELVKFGQAIRRLETGGLREVASTRVLIAAGQLISEGLSISDAAR
AAIAGPLTDDPTVTRGLNEMIDVYLGNQHVSSGD
375142860YP_005003509.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSYESTAEPIKVGYLMDFTLPPGFPEDLFASFTQTFDLVFEEAVEQGLMD
RPVQMIYREVEGLPKGSVKAVIDAYGELVDEGCLVVFGPNITDNCVPVRE
AIEERFKVPALSVTGTDDWLGEWTFAFPQGSMTDEPIFVADLIAKRGLTE
VGVLVEQNLIGESYLTNLRSACRRKGIRIVAEAAIAQTAQDVTDAVRSLH
DAKAEAIVHLGFGFGIIFVNPALEALDWDPPRFTTTAFQNAWVNPVMWQG
FMGWTGIDQYDEGNKVGQDFLDRYAKRYNGSRPEFCVTVVNHDAASTLVR
AFTDAHPLSPRGVKEALERVKMMPAAAGAPGTRVSFGKWTRRAWMGAGYL
VARTLDPDGVNSHLVDRFGEEG
375142859YP_005003508.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTQESLPPDTTTDSSKPARTGPNWGRVIALIGWLGFWAMFLAVARTDVD
PRVANPNVEGRPRPVEFLTAFDHWQIVPQVGALLMVVVLTIVFIRAWRRN
PGSPVLLMVLVTTVIVWQDPIMNWAPYAVYNPALVHWPENWPLVMMSPTV
EPFIVFGYVTFYFGPYFPAIWILRKLQAKWGPEAFVSRHPLLSLGGLVLV
IGFIFDAILEVSLVRTGLYIYSQAIPFGTLFPGSTFQFPLIWESLAVTFV
MVPAAILVYRDDTGKSVAEKLAAKARLFPTKPVLGTFIVMFVIVNVAYFA
YGSWFWAIKASGLATSVACPWPYPEAKIYDPQGYYRANGAEGPYSVGKWA
TWQQGPSRNVDVELGSKSNRCASEDANE
375142858YP_005003507.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MSESRTVVITGAARGLGLASATRLYKEGWRVVAAMRTPDGGMPLLRAATG
ASENDDRLIGVQLDLMDTASISAAAKAIEERVGAPYALVHNAGISAAGMV
EETDIDLWQRMFATHVTGPVELTKALLPSMRAAGEGRIVLVGSSAGVRGQ
PGTGPYSASKGAMERWGESLAAEIAPFGLGVTVLITGTYDTDIITDAGTT
DDRDFAGPYARLHQSMNKRGRFAMKFARSPERFTDGLVKALADRGAFRRH
GVGPDASMLLASNRVLPASGMHHMSRMVLGIPRLGSMRGGAYPLTTAQKA
MVSAAKVLPQPVMARLASLAMRLSPAKPAPDESGSND
375142857YP_005003506.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTEATKVKFESKMMIDGKLVDGESGTFTNINPANEDVLGEVADASKADMN
RAIDAARRSFDETDWSTNRELRKRCLLQLHDAIESELEELREELILEVGA
PRAVTHGPHLDAPLEDGLKYPARLIDSFEWEADLGDKVVSVTGVNTRRKV
WHEPVGVVGAIVPWNFPFEVTINKLGQALATGNTVVLKPAPNTPFNATRL
GRLIAEKTDIPAGVVSVVTASDHFVGEELTLSPKVDMISFTGSTVVGKRI
MEKGAATMKRLFLELGGKSATIVLEDADFNTACLIGIGPLMHAGQGCAAP
TRMLLPRSRYDEGVAILKGIYENIKAGDPQDPGTICGPVISAKQQQRILG
YIRKGVDEGATMLVGSPEPPKEFDKGFWVNPTLFTDVDNSMTIAQEEIFG
PVLVVIPYEDEEDAIRIANDSVYGLAGNVMSSSLDHSLAVARRLRAGFIG
LNGTAGYGADTPFGGYKDSGVGRQNGLVGFSQYTEVKSVAYPAT
375142856YP_005003505.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MSDLFDDLEDFGAFDDVVSGNVRDPYPELAKQRHETPIQRIDMSAMPGEE
GKPVFIVYRHEDIQTMLRDNETYSSNMVIQIFGEVLGQGVMLGMDEPIHG
RLRSLVTKAFTQKALARWEDEIVGRIGNELIDGFAADGKTDLVKTFTFPY
PTRIIAALLGLPEEDFPQFQRWSISMLSFTVNPERGKAASKALIDYFTPI
LEARRAEPREDLISALAAAEIDGHKLEDEDIYSFIRLLLPAGVETTYRSL
GNLLFGLLTNPDQLAAIKDDRSLIPQAIEEGVRWDAPLLNITRVTTRDTE
LGGVQIPQGCSVMPMLGAANRQEDRYPDPDRFDIYRQAKVPISWGHGVHV
CLGMHLARLEMRTAINLLLDRLPNLRMDPDGDDPHIRGMVFRSPTSLPVL
FDPS
375142855YP_005003504.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTNFDSVDYFTDMSLVPDPYAYYDHLRSKCPVQHATPYGVVAVTGHAEAL
AAYKDPAMSSCVAVAGPFPPLPFTPEGDDISAQIEAHRAAIPMAEHVVTM
DADAHQKTRGLLSKLITPKRLSENEDFMWRLVDQQLDKIVDRGSCEFMED
FAKPLAMLVIADLLGVPAEDHDEFRSIFGSEPLGEIEGNEGETVAHNPLM
FLDEKFTAYISDRRREPRQDVLTELAAATYPDGSVPEVDEVVKLATFLFA
AGTDTTTKLVSTAMRVIGERPDIQQSLRDNRSQIPAFLEECLRMESPVKS
HFRLARTSTKIGDVDVPAGTILMMLPGASNRDPRKFEDPNEFKHDRSNVR
EHVAFGRGPHSCPGSPLARSEARIAMNRILDRMANIRISTEMHGPVEDRK
YEYEPTFIMRGLTALHVEYDAIPDA
375142854YP_005003503.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRIEPLAPREFPEEMRKAMAALRPPNATHRAPATENRPTALSVLGTMAH
HPSLARAFFTFNGHILGASTLSERQRELLIMRVAAVRKCGYEWAQHLFMA
RDAGLTDEEIGRIAYGPDAPFWTESDAAMLRSVDELIHDGVISESTWQLL
AGDLNDQQLLDLIFTVGLYDILARLFASLELQIDDDIRELMKRYDELF
375142853YP_005003502.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MPGRLEGKVAFITGAARGQGRAHAIAMAREGADIIAVDICRDIPSNPYPL
ATPDDLAETERSVKEIGRRVVARVGDVRERHELREAVEAGLADLGKIDIV
VANAGILPMAMGRPHDPMSFVDASDVDLLGVMNTVAVTVPHLSDGASVII
TGSTAGMIRGTTDNPNMGPGGRGYGWSKRVIIEYVEEMSMALAPKMIRVN
AIHPTNCNTHLLQNDGMYSMFRPDLTQQGKQATREDAEPLFTLFQAMPIP
YIEPDDMANLGVFLASEESRYITGQQIRVDGGSLLKWPNGPGG
375142852YP_005003501.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDTAQVNADDPVNRKALLDAAERLMLEEGYAAVTTRRVAARAGLKPQLV
HYYFESMDQLLLDLVRRATAHGRDTLARVLASPKPLRRLWEWSTDTEATA
LQIEMMALGNHRKAIRAELADGARRLRRMQVDALSEALERSGIVDDVTRT
DALMMVLASVSRVLVMEKSLGVTAGHRNVRALVEHYLDRLESGS
375142851YP_005003500.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MVTESVAEFDSRARSWLAENMPTVEMDNPPALARDTDAAWQRARELQRRL
HDGGLAGICFPREYGGLGLGYEYKKAFDAACVGYEMPVMLNIPCFAICCA
TLLDVGSEEQKRQHISAALRGDEVLVQLLSEPSGGSDLAGVITRAERRGD
RWVLNGAKTWSTFAFAADYGLCLARTDWNVPKHEGLTMFLVPIHSPGVTM
NRIKQVDGTIDFCEEFFDDVELGDDAVVGEPGKGWEVASRQLYHERRTMG
DGSEFTVGAGLEASQDLSVDFFRLLEMTDQADDESARRLAGRALAHRVVN
QQLSEHVFHSVADGSLPLTAGAIARASLADSHNLDTDTALAIASTSSVVG
DDEGLEIGVRYLGRQIINIGGGTTEMARNVIAERVLNFPREYAADRGVPF
NQVRRNKQEGTRS
375142850YP_005003499.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSEQLRDIREFMGDADAYREELYRRWTGLLSYRYIGRNHSSMNIGETDDT
VTIRRDMRNEAGGIMVAPLAISSPEGCQTDMVAVPNPVIASVQIVDPGFD
VKRIEIVGSGNIHQGRTMGYGRCKIVDADNPDRVIAFNEGQGAVIGIPPE
GLDKMDVSGTELVIEDSEDLPPLWEAFGASKRPDGHWVLPPLSVELASPD
AALHIGPQHVVLETAAIDLAAAAAGTRKVQVVSWHVMFMSRGKVGPFRVE
GTAHTSGSGRVGVRMLLHDEGNDDKPVTTAAAIFDVLD
375142849YP_005003498.1 dihydrodipicolinate synthase/N-acetylneuraminate lyase [MycobacteriMAKAKDARQWARTALHGIGNSLYTPFSGRDGDDIDWDAYRTLVRYCVGAL
GHPMLWVTSGLAEFWSLTTGERKQLLEVAVTESRAVNPDVVIQACTAALS
AKECLELTRHAQDSGADIVYIQTPMMELHGGEGVLNYFRYIADRTDIALG
LFNSPSSGYVLSAQEAARIVEEIPAVCATKEGAFRPHQSRMLHELAPELV
IWECDTTVYRAGWLKAGIVGPGQLGTAGYLFETPEKRVFSEYWDLVWNDK
LLEAMDYAQESGLDQFELDMRGWFTRYPGRPDYFTHWGGAYKYAASVLGL
PIGDYPESRPPQVALPDQARDDIRAAYRKFGLVAS
375142848YP_005003497.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSDKPLAGVRVLEAAAWTFVPAAGAVLAEWGAEVIKIEPREGGDPQRGLV
TMGLIPGGTDGVNYMIEVPNRGKKSIGIDMTTEGGQEVVHELAKSCDVFL
TSYLPNRRKRFRIDVDDIRAVNPDIVYVRGSGYGPQGPDANKAGYDGVSF
WSRGGICDAFTRDLPEPVMQTPAFGDLIGGLTIAGGISAALYKRKATGET
SIVDVSLLGLAAWTMSPGVTASMLYGGDPMPNFTHRELPNPLVGTYKTKD
DRYITLMMLQGDKFYPEFMTVIGRTDLLTDNRFAEGHARFENRGELIDIL
DEEFAARSVDEWREILAPLSGAWSVLQKPSELRYDPAVVANGYIPEVNAM
NGAPFVVPTNPVQFDEDHVRPTGAPEHGQHTEEILLEAGVAWEKIEQYKE
QGAVL
375142847YP_005003496.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPQPSSAKKAAATESARRPRGEARRLLLDAARELFARQDYRGTTTREIAE
AAGVTEYLLFRHFGSKAGLFREALVLPFTNFVDDFGATWQAVVPEETEED
ELAKQFVGRLYDVLVQHQGLLLTLIASDGLSDEEIDSAGIADIRRALTVL
GQISAEGMSIRGMRSTQPDLPAHSTVAMIVGMVALRSTFYGSEPPPREAI
VDELVQATLHGFLHRP
375142846YP_005003495.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGQLIMLGTLFGLIILIFGLVLYFDPDARRGKTTSEDQSR
375142845YP_005003494.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPLLVAANAFGWLSGILFTIAGIYLSVRRGRLHPLLLLCISAISFSWIE
APYDWAMYAQFPPALPRMPSWWPLNMTWGGLPSSVPLGYIGYFCIPAVTG
AWLGRRLVARFNWRAPITLLITGLVVGFCWALVFNAGLGARLGVFHYAYV
LPGLAIFEGTLNQYPIYDAIAMGIQMMVFTYLLGRTDSEGRNVIEMWSDK
LSKTKVQSAVLSIVAVIVIGNVLYGAVFAPHLVTMKLGYVTSGPDVQLFP
GVENQPR
375142844YP_005003493.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MNSKHVVDLYYDPFDFGIDDDPYPVWARMRDEAPLYYNEKYNFYALSRYD
DVARALPDWETYRSGRGTTADILFAGIEVPPGILLFEDPPLHDLHRRLLS
RVFTPRRMLAVEDLVRDFCARELDPLRDGDGFDFVRDLGAIMPMRTIGYL
LGIPEDGQQQIRDLNDKSITVADGSGDVSPTIFQDAIAMFAEYIEWRATH
PSDDLMTELLNAEVEEQDGTRRPLERTEVLAYTAMIAGAGNETTARLIGF
MGQLLGDHPAQRHELVADPSLIPSAVEETLRYEPPSPVQARYVARDVELY
GHTVTEGSYMLLLNGSANRDAAKFTDPDRYDIHRTGGHLSFGQGLHFCLG
SALARLEGRIAFEEVLKRWPDWEVDYDNATRARTSSVRGWAQLPVRTS
375142843YP_005003492.1 citrate lyase subunit beta [Mycobacterium rhodesiae NBB3]MSQPSRLRRSELATPASNEHMCEVAARAGADLVFLDLEDACAPAAKESAR
ATAVAALTDLDWGRTVRAVRINGLDTQWCHDDIIEVVSGARDALDVIIIP
KVLSARDVWWVDVLLTQLETKLRLTRRIAVEALIEEAEGLLNAQEIARAS
ARLEAIIFGAGDLSASLHARVDGNFQPAGDYPGDYWHAVRVQVLAAARAA
GIAAIDAPYPGYRDADGYRRAAAQASMLGYDGKWAIHPDQVPIANAVFTP
TDEAVAEARAIMDDYRRAESEGIGAVGRNGKLVDAALMRHAANVLRRAND
375142842YP_005003491.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSTRPLQGLRVIDAATLAAGPLVATALGEFGADVIKVEQPGTGDPLRTWG
ARRGDIGLVWKSVSRNKKCVTTDLRTHEGRALLHGLLETSDVLVINTRPS
TLARWGLDYQALHARYPRLVMLHVTGFGAGGPASDRPGFGTLAEAMSGFA
YVTGQADGPPTLPPFMLADGVAAQSATYAVMMALYHRDVHGAGGQLVDVS
LIEPLARLVEQATLAYDQLGQIQGRTGNRADASAPRNAYRTADDRWLAIS
SASSSVAARLYRAIGRHDLADRPEYVDPIPRQARADEIDGIVSAWIRAHP
LDDAMKIFHDEDVTAAPIYDAQQLLADEHLRARGTFVPIADPDVGTMTVQ
APVARLSETPGCVEHLGRALGADNETVYRDLLRIDADRLAELRAAGTI
375142841YP_005003490.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGSQLPEGFSEIEEWVDDWALPTRAERYRARLDRPYDDLVAFYDGMAPHA
ERAIAYLDERDINALRPEEKRLMNLLFSMILVSYAVNIFKQNRIPDSGAA
FFEMVAEPAL
375142840YP_005003489.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium rhodesiae MTGIQQKLATGRGKFTTDYPDLGTGPVNYEDSISEEFFAAERKAVFERSW
LCVGRMERLPRKGSYFTRELPGRLASIVITRDLDDNVYAFHNVCAHRGNK
VVWQEHPQEESAGSCRAFACKYHGWRYGLDGVVNHITNEQEFFDLDKSKL
RMPPVHCEVWAGFIFINLAENPVPLRTFLGEGLLGMESYPFHLMTQHYGF
STQIKGNWKLAVDSVCEWYHPPYVHGRFIDPDVSKAEKMVPPVDSYHYDL
FRPHMLTSVPGPPILPPRAPGSAGEPRQDQRWVYKLFRAGLFGPDDVPDI
GPLPGFLNRGEIASWGNDQFWVFPNISIQIWARNYYITYTYWPETVDTHI
YEIDMYFVPPANAHERLAQEVVVDSTIEFAMQDVNTIEATHSALKTRAQN
TFHLSDQELLIRQFHTVIRDTVAAYQAGENREA
375142839YP_005003488.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMAKRTRFSEYQNSYANYKFELTDDGILFMQCHTDGDSLVWSWKAHDEMSD
AFADIAGDREIKVLIHTGTGENYNANWGRLPNGEPPEKPIYQAMPDDRGT
HKLDEKAWYARHLIFNVLDVDVPMISAVNGPCNMHSEVPIMGDIVLASED
AYFQDASHFPRGQVPGDGQHVIWSVLAGHNRARYFLLTGQKLSAQEAKEW
GVVNEVLPKDKLLDRAWEHARELIKRPPLTLRYTRQLFTNPLKRAFVNEL
GHGLGRETYAQRVFFPFGGEMEPLDRPWDQQPWSNANGQPVDEGARQ
375142838YP_005003487.1 putative F420-dependent oxidoreductase- MSMEG_2516 family [MycobactMDRHPFRFAIQATNASGSREWREFARKVEELGYSTLFLADHYLGPGPAQQ
AARTPRQDLAPIAAIAAAAAHTKTLRVGCRVFCIDYHVPAVLAKEVATLD
LLSDGRLELGIGAGWSGVEYEAMGLHFDTPGRRIAKLKEVIALVKAHCAG
AELACSGAYVNVHGYQGTPQTVQRPHPPIMIGGGGKRVLTFAGREADIVS
INTVPFTARNDDGLTPQEEAVRRFEYVREAAGTRIGDLDIESSPFFISVI
DSVADTDDAYQRMATKTGMGVDVLRDHPNVLVGPPDAIAATLEERRETLG
ANYITVQQWQAERFAPIVARLTGT
375142837YP_005003486.1 putative taurine catabolism dioxygenase [Mycobacterium rhodesiae NBMAETRALSAEFGAELVGITDTDDLLDDTVIAACREALKWRGVLLIRGAHF
DDDGQLAFSRKFGGEGGTPGGKELSTISMDKKVNRLAEYLKGAFHWHLDD
TTSEVPSRATMLTARRLSAEGGGTEFANTYAAYENLSDVERKHYDGLRVV
HSFEAAQRKVNPDPTDEELAIWRGVPSHESSLVWQRRDGRRSLVIGATAD
HIVGMPADESRALLDELLDWATQPRFCYAHEWCVGDAVLWDNTAVLHRAL
PYDLSSDRMLRRTHIRGLEAWA
375142836YP_005003485.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MKTALVTGGTSGIGRSIADRLRADGNHVASIDITESDTDFSYVADVTDRA
AIDAALDAVRSALGPITILVNAAGMTSFRRFTNLTPAEWSKVVDVNLNGV
FHVTQAVLPDMLEAGWGRIVNISSSSTHSGSPYQTAYVAAKSAVNGLTKS
LALEYGPSGITANVVPPGSIDTPMLRAAEEKGLLGGSIDDIAARIPVRRI
GRPEDIASTCSFLVSEEAGYITGQIVGVNGGRCT
375142835YP_005003484.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MATRRGRPTQAEAKKLDLAVREAAVATFLEMGYAGASMEAIARAAGITKR
SLYARYPDKRAVFADVIPWALARYTDDGSIDEIDDDDLETALLAVGRAAL
TRATHPENVRLKRIAFNEAAQFPEFNVSAESMMWAGRQRAVTELLRRYEQ
RGTIKVDDLELAAEHFLAMVEAVPARMADFGVFRSKKQQERHLQFAVRLF
LRGVMPR
375142834YP_005003483.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRARTYNQSHIARPHSGGRRISIYWTWSYPWESQRDPAIIENRFSTITEV
RNVAWPAYETPEYDAANFLQGIAGTLELFHRSTLDFQALAEEATGHPVAV
FQRIDQAGYRLPIDERVLADTDTLMVFGLDHLLSEQEAAPEEISAISEWL
KREGTCLLLAPHHDVGFTDDYTQRQVEYEHHGDRLVPRQQRFGQYTRSLM
KALDVPVHNTWGLRPAVVEGTKEIAPLTGLRDLDAARLLDNVTTFNFHPH
LPHYELTAPESDHLRVLGRQRVDPNRPHPYTADGNTEFNALIWMPPADER
AGDIVLIDSTHFTTLFGGTDSLRNLWHNLATMK
375142833YP_005003482.1 putative iron-dependent peroxidase [Mycobacterium rhodesiae NBB3]MTLELDDIQHILLTRTPAITGRYEFLTFDTPHGGRAWLSELLPKTQSATE
ATATMDESDRWVTLAFTWTGLRALGVPEESLATFPEEFRAGMASRADILG
DTGAAAPEQWVGGLAGDDLHAIAILFSRTDEQCARSIEEHDKLLARTDGV
RSLSYLDLNATPPFNYAHDHFGFRDRLSQPVMKGSGEEPTPGSGAALEPG
EFILGYPDENGPVPTLPEPEVLSRNGSYMAYRRLQEHVALFRDYLRENAE
TPDQQELLAAKFMGRWRSGAPLVLAPDEDDPELGADPMRNNDFNYKEMDP
FGYACPLGSHARRLNPRDTAHYMNRRRMIRRGATYGPALADNAPDDGIDR
GIAAFIICADLIRQFEFAQNVWINDKTFHELGNEHDPICGTQDGTLDFTV
PKRPIRKVHKGIPAFTTLRGGAYFFLPGMNAMRYLVSLGD
375142832YP_005003481.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDHNWTKPAAMAIPEEGYFELERGRYGPTYPRTPACHGFSIIAKVKEGR
EEAVRAYGKTIEETIAASPDALAPLRLHYLRWVLFDVGSGLHFQYQGIFD
TDFDKYTEDAVALFSATGITTVFTNLEGFPEDWKENPDAFIKFVRDHQCP
SFLEYGEYPYVTADEIKKALRLKAAFSNMLDQMQ
375142831YP_005003480.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKLTKRYAYLAVVLTLTPVGIVAAAPPAFADCTNAGYATVCAQGEVRGGG
PTPPSGPAYPGYCADPWYCSDDWGIDINLGRPGFGGGGGGGNRPSVGPR
375142830YP_005003479.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFSRSVIGAGMIAGAMLFGSAATATADPPNCTAADLAGVMAGVSAGTSSY
LFTHPDVNAFFTGLKGKPRDQMSADIQAYLDANPRVRDELKAVRQAAADF
RDRCNVQMPDGPMAG
375142829YP_005003478.1 putative HAD superfamily sugar phosphatase [Mycobacterium rhodesiaeMRSTPQCWLTDMDGVLVREEHALPGAAEFLQRLVDKERPFLVLTNNSIFT
PRDLSARLLRSGLSVPEASIWTSALATAAFLADQLPGGSAYTIGEAGLTT
ALHAVGYTLTDVDPDFVVLGETRTYSFEAITKAVRLIIGGARFIATNPDV
TGPSAEGPLPATGSVAAMITKATGRDPYFVGKPNPMMFRSALNRIEAHSE
NTFMVGDRMDTDVVAGIEAGLETILVLTGSTTVEDIERYPFRPSRVLPSI
AEAIDLV
375142828YP_005003477.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIPVELTADVVASLRRNRDRGERQPRCHDGVIRSAIAGAVRRLVDNTLNG
GVRPWDLPELQRRATGLGVVSGARAVSVDDHVLVAELQPGGARILLRGVD
DGWRLVRFVDGDDVRVRPETTRRVALDGWGPDAVLAALGIVKPDWVELQH
ANQYLGQGETEYRDGYQWVDGHGRSIIAEQIKNEIFDGATPSSSYVRGVI
IDGDRGVLLTGRGDSALIIEG
375142827YP_005003476.1 arginase family hydrolase [Mycobacterium rhodesiae NBB3]MRVADIELIGVPFDGYGRPGHQANAAAALHAAGLADAFDHHHVTHHHLEL
PPPDPARGASTSLINEPALLAMTDALNILVGEAITAGRFPFVYGGDCSAL
FGIMTGLRDHVGDAGLVFVDGHEDTMPLDVSEDGEAANTEIGLLLGLTGR
LLTGALGDRLPALEPEQLVVLGPRDDAWRRRFNVGTLAEAGVWVAPLAEV
ADDPAAVGRAAVDELADHVGRWWLHVDLDVLDPAEFSAQGLPGVEDEPGG
LTWDQLTDLVVSLFGSPAHCVGASLAIYDPDQDDGNADADKIVAFVRNAL
ARTTISP
375142826YP_005003475.1 pyruvate/2-oxoglutarate dehydrogenase complex- dehydrogenase componMAEPIDEYFTTAVSAMNASERRLGEDEAVRDGSSLTARLCLALFDVALGS
RHLDLAARYLRSQGRGYYTIGSSGHEGNAAVAAALRLTDPALLHYRSGAF
YLARAALVEDREALSDVLLGCVAATDEPIAGGRHKVFGRHDLHIIPQTST
IASHLPRAVGVAFSIARAKKLGVACAWPDDAIAVCSFGDASVNHSTAVGA
INCALHASYQGVPMPLLFVCEDNGIGISVPTPRGWIEQTYGNRDGLAYFA
ADGSDLAATFDAAAAAAHWVRTRRRPAFLHLSTVRLMAHAGSDYEPAYRR
PDEIAADYERDPVLCTARLLIDAGMLSPADVLDRYEAKRANVIELADQIS
ELPQLDTAKAVMEPLSSARDEVQEAVPASLIASVKSGDTGTPVTVAAAIN
RALHDILDRYPEAMIFGEDVARKGGVYGVTRGLLSATSSARVFDTLLDEQ
SILGLALGAGISGLLPIPEIQYLAYLHNAADQIRGEAATLQFFSNRQYRN
PMVVRVAAYGYQKGFGGHFHNDNSIAALRDIPGVVIASPARPDDAAAMLH
TCAAAARQAGAVCLFLEPIALYHTRDLYDEDDGGWLATYPETAVPVGRAR
TYGEGSDLTILTFGNGVRMSLRVARRLAAADIGARVIDLRWLAPLPVEDI
MREAGETGRVLIVDETRETGGVGEGVLATLVKQGFAGRLDRVAAYDSFIP
LGDAALQVLLSEDTIEAAATKLVRAGA
375142825YP_005003474.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSSDPLRPLAGVRIVEISSFVAVPLAGMTLAQLGAEVIRVDPIGGAADYR
RWPLTAEGESIYWAGLNKGKRSVAADMRSPDGQDLVQRLIAGSDVLITNV
AGREWHSYDVLTRLRPDLIHVEVSGRSDGGTGVDYTVNASIGFPMVTGPA
ELATPVNHVLPAWDVTCGIYTALSVTTALRHRDATGQGQRISIPLENVAL
ATAGNLGFFTEVMINGTSRQRIGNAVFGQYGQDFTSSDGASFMIVALTNR
HFRDLTELTGTTKAVAALAETLGADFTDEGQRYEHRGALFGLFNEWFSQH
TAQEVTDALSASSVLWDRYRTFAEAARGDRVTANPLFTSLDQPRIGEYLA
PGLPMSIGGVYPAAEVSPALGDDTAAVLGEWLGLGPDEIARLTDAGTVE
375142824YP_005003473.1 acyl-CoA thioesterase [Mycobacterium rhodesiae NBB3]MSRLLALLDLATGDAEDTWIGAASGPEGKRSYGGQFMAQSLAAAWRTVDS
DRAPTNMHLQFLRGGEAGDPVEYTVSKVFDGRTAAGRRVDARQGGRLLTT
ATVSFAIDLPGPEHGSRTSLPQDPDALESTGPAGPAPSMPLDEIDIRIAD
EGDGDEFVRRFWWRTTAALPDDPRLHTLVAVYVTDVYMIDPALRVHGHSM
MARTHRSGTTDSSIWFHRPVRADEWNLLETTSPAAARGRGVVTGSLIRAD
GVIASTLVQEGLIAERD
375142823YP_005003472.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MYVRIMLATPVQVAIAALRAAHESLAACDLESLTHRELLGVLDELETLTC
QLPVQWHRALARLQAETTAKELGAKNWKDVLRIRWRISATEANKRLAEAE
VLGPRRALTGEPLEPVLAATAAAQVAGLINGEHVDKIRDAMGRLPGFVDT
VTREQIEADLVRLAAGVGPKELGKAAETMLFLLDQDGPEPDDAERHRKRG
VVVGPQQRDGMVPIKGYLTPEAWAIYEAIFAKWAAPGMCNPDDDEPCISG
TPSQAQIDGDHRSLAQRQHDALIAVGRNTLESGQLGQHNGLPTSIIIRTT
LQDLESRAGVGTTGGGTIIPIKDVIRMAAHAHHHLAVFDGATGSALDLFR
AKRVASPAQRIMLIARDGGCTKPGCTVPAYGSQVHHAACDWADDGQTNID
DLALACGPDNRMVAPNGWTTRINADNDVEWIPPEHLDTGQTRINYCHRPE
LLLRPPEQPDGNSERGP
375142822YP_005003471.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MSLLVEHLQSHGERIALLTDTAQLTYRELADRVTDVAHALGGPRRLVLLE
TRNDISTLVHYLGALAAEHVVLPVDARREHAAIEETYLPDIVIAGGGIHH
HRHDLRPLHDDLAILMSTSGSTGSPKLVRLSHENLIANATVIAEYLGIGE
TDRAATTLPMSYCYGLSVIHSHLLAGAGLILTDRSVVDAEFWELFRRYRG
TSFAGVPYTFELLESVGFDAGNLPGLRYVTQAGGRMAPERVHRFAELAQR
AGFDLFVMYGATEATARMSYLPAELALSRPNTIGRPIRGGSFTIEPVDGW
TDDGVGELVYRGPNVMMGYAHGPDDLALGKTVETLRTGDIARLSPDGLYE
IVGRNSRFVKMYGLRIDLQQVEAALRDKGIHAFCTSDDDVILVAAADRHN
RRDIQSAAAEAAGVPVGAVRAVAVAELPLLPSGKPDYQTVRLLTRTSGDE
PKSPDVRQLFADVLQIDAATLDPDASFVDLGGNSLSYVTMTVRLERMIGQ
LPPEWQRLPIRQLEGFSKPARRSWLATLETSVALRAAAIVLIVGTHAGLF
ELWGGAHILLGVAGYNFGRFCLTPVPRTDRVRHLGNTIAWIAVPSVLWVV
AALLLTRDYTWTNLLLANKFLGPHDSMTAGRLWFVEVLVWTLAVLALAFW
LPLMDRLERRLPFTVAIVFLVIGLALRYDILGLHFGRDAWFTMLAFWFFA
IGWAASKATTTLQRIAVSVALFVSLYDYFDSTLREVMVMVGLLLLIWIPT
IRCPSAFTVPIGVLAEASLYTYLVHYQVYAMFDGHPAVGVIASLSVGILL
TYLVTVLRRWRLGFGSTRSDALDRTNAVIRT
375142821YP_005003470.1 spermidine/putrescine ABC transporter ATPase [Mycobacterium rhodesiMTEAMVDISGLTKSFNGHVVLDHIDLQLQRGTTTAVVGASGCGKTTLLRL
IAGFETPGEGTVTIDGREVASPQRAVPPHRRSVGYVAQDGALFPHLTVGQ
NIAYGIRGEGRDTVRRRVGELLETVSLDPSFADRRPDQLSGGQQQRVALA
RALARQPVLMLLDEPFSALDTGLRATTRKVVAGLLADAGVTSLLVTHDQE
EALSIADQVAVMRDGRFTQVGSPQHVYREPHDRFTAEFLGDSITMPCVVA
SGIAECAIGRVPVRADDGPGTLLLRPEQLVAKVVTDDGELDRVGKVLAVE
FLGHDVLLTIDPAGEIEPIIVRQNSLEPPAIDAKVRIEVVGNGVVFT
375142820YP_005003469.1 Fe3+ ABC transporter permease [Mycobacterium rhodesiae NBB3]MTAAAPPVPAPAVESSKPDAASRPGPLVSATVAILVAATCIPLGYVVWGT
VSVGWTRAYELVVRPRVGELLVNTVALVCITVPLCVLIGVGLAWLTERTD
LPGRGFWRPLFVAPLAVPAFVNSYAWVGVLPSIHGLFAGVLITTLSYFPL
MYLPVAATLRRLDPAVEESARTLGSDSAGVFFRVVFPQLRLAILGGSLLV
GLHLLSEFGAFAMIRFDTFTVAIFQQFQVTFDGAAGSMLAGVLVLLCLVL
LIAEAVARGKIRFARIGSGAPRAATPNRLGHSRIPALLALTALTILSLGV
PVWTLLRWLRIGGADVWDFADLGTSLAQTIGLAGLAAVITVVLAFPVAWV
AVRSSGPLARAVEGANYVTSSLPGIVTALALVTVAIHYVRPLYQSVPLIV
FAYVLLFMPRALVNVRAGLAQVPLSLEEASRSLGASPMETFFRVTLRLSA
PAAAAGGSLVFVAVATELTATLLLAPTGTRTLSMMFWSWSSELDYAAAAP
YALVLVLLAIPVTVLLFRQSMKVAAL
375142819YP_005003468.1 Fe3+ ABC transporter periplasmic protein [Mycobacterium rhodesiae NMRPRWSRIAALVSTVAVVLGATSCSSSSESDELLIYNAQHESLTREWIDA
FTEETGIKVTYRQGGDTELGNQLVAEGDASPADVFLTENSPAMAAVERAG
LFADLDSATLDQVPAQYRPATGKWTGVAARSTVFVYNTSKLRPDQLPQSL
LDLQKPEWKGRWGAPPTKADFQAIVAALLQLKGEAETSKWLAAMKSGATL
YSDNIATLKAVNAGEVDGGVIYHYYWFRDQAKTKEMSANTALHYFKNSDP
GAFVSLSGGGVLESSKKKDQAQQFIQFITGKKGQEVLENGTSFEYPVASG
VPANSALPPLDSLQAPPVDPSTLNSAQATELMTKAGLL
375142818YP_005003467.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKKSAHPTRPRVICAAAAGALAVCAAVITAPAATAGDCTASGLASVAGPV
LAEAGGYLGAHPGANNVLTAAASQPPDVARDNVRGYFTANPGEFLDLRRI
AGPLQDLRNQCGITVTPGQFATLFEALQS
375142817YP_005003466.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTEVTTAGKPPVVDNETWRAALDDLRVREKAATRELDAIAAARRRLPMV
EMDDYTLTGADGPIRLVDVFDGRSQLIVYNHMWQDGAEWQCGGCTGFTSQ
FTRLEFLDNYDARFVIVTNGPIDEALAYREKVGNRMDWYSAAGTSFGADV
DAAPGEGFGVNVFLRDGDAVYRTWHTNGRGTEQLSHSFALIDLLPYGRQE
EWQDSPEGWPSRPTYSGWLDSPDIARAYGRGD
375142816YP_005003465.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADKTLHGVADRATNSDAFEYTARAGFITSGVLHLLVAYIVLRIAFGSGG
NADQSGALATLARQTGGTLILWVAAIGLVALGLWRVAEAIIGSKPGEGSG
PHSDDTPAWKRAKSIGLAIVNFAIAASAVRFATGSGQQSSQQNTGLSAQL
MQSGWGKALLIAVGLGLVGVGGYHVYKGVTKKFFKDLRVSGGTWVTAVGV
SGYAAKGLVLAGAGLLVIIATLQADPSKAAGLDAAVKALGQAPFGKVLLI
LAAIGIAAFGVYNFVRGRYGRM
375142815YP_005003464.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTFPKTSWTRAEIGALGERLAVEHLQSSGLRVLARNWRCRYGELDVIAAD
DTARIVVFVEVKTRTTDRFGGVEHAVTPEKLRRLRRLAGLWLARQDTRWA
SVRIDVIGVRIGRRPIPEITHLRGVG
375142814YP_005003463.1 Mg chelatase-like protein [Mycobacterium rhodesiae NBB3]MALGRAFSVAVRGLDGHIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAITNCGSDWPQARLTLALSPATLPKMGSVYDIALAMAVMSAHGKAEWNR
LEKTVLLGELALDGRVRPVKGVLPAVLAAKREGWPLVVVPVENLAEAALV
HDIDVKGVRTLGQLKSWIEGKGQLEESVETPSPAPSPTADLADVIGQTQA
RYAVEVAAAGAHHLMLTGPPGIGKTMLAQWLPGLLPTLTESEALEVTAIH
SVAGLLSGSTPLITRPPFVAPHHTSSVAAMVGGGSGMARPGAVSRAHRGV
LFLDECAEIGVSVMEALRTPLEDGEIRLARRDGVARYPARFQLVLAANPC
PCAPADPRDCICPGQVKRRYLGKLSGPLLDRVDLVVEMHPQLAGAFAQQE
GESTAAVCQRVATARQAAAERWGPYGIRTNAEVSGSLLRKRFRLPPAVMK
PLSGALDRKQISMRGADRSLRVAWTLADLAGRTSPVLEDVSTALSFRQSG
GAR
375142813YP_005003462.1 DNA protecting protein DprA [Mycobacterium rhodesiae NBB3]MTDQISRAWAYLSRVAEPPCPELRALTRRVGPVEAAERVRTGDVDDVIAR
RTEARRQIDCAANDLETLDRMGGRLINADDAEWPLLAFNSFCGVSGRPQA
HEPMVLWVVGPAYLAGIAERAAAIVGTRAATAYGEFVAADLAAGLAARDA
AVVSGGAFGIDGAAHRAALAADGVTVAVLAGGIDVPYPAAHAAMLRRVRG
EGLVISEYPPGERPARHRFLTRNRLVAALAGATVVVEAGARSGAANTAAW
AGALGRPVCAVPGPVTSSASVGCHALLRAGANVITRTEDLVELIGRAGEL
APEEPRPASPLDELADAERHVYDALPARGSRTADEVAVAAGLPPMQVLGP
LAVLELSGLVVRSEGRWKLARRT
375142812YP_005003461.1 siderophore-interacting protein [Mycobacterium rhodesiae NBB3]MAGRPVHTFEVVRTEQITPHLTRVVLGGDGFDTFTPNDSTDAYVKIIFVA
DSVDVAALPQPLTQDSFKTLPPERQPPVRTYTVRRVDAERREIAIDFVVH
GEHGVAGPWANSAVPGQPAYLMGPSGAYAPDPAADWHLLAGDEAAVPAIS
VALEALPDNAIGQVFIEVAGPDDEIELKAPPGVDIMWIYRGGRADLVAEE
AAGDHAPLIEAVKGAAWLPGQVQVFIHGEAQTVMHNLRPYIRKERGVDAK
WASSISGYWRRGRTEETFRQWKAELAKAEQANS
375142811YP_005003460.1 alpha-hydroxyacid dehydrogenase- FMN-dependent L-lactate dehydrogenMAFSDYEFEIYLQGLSGVLPLLPMSFAELEAKAQAAMSPGIWSYVAGGAG
DERTQRVNVTAFENWGLMPRMFVGAAERDLSVDFLGLNLPSPAMLAPVGV
IALCAQDGRGDLATARAAARTGVPMIASTMSADPMEDVAAELGDTPGFFQ
LYTPKDRDVAASFVHRAEAAGFKGIVVTLDTWIPGWRPRDLTTSNFPFLR
GHCLANYTSDPVFLDSLAQPFEENPQAAIMQWISIFGNPLTWDDLPWLRS
LTTLPILLKGICHPDDVRRAKDGGVDAIYCSNHGGRQANGGIPAIDCLPG
VVEAADGIPVLFDSGIRSGVDIVKAIALGASAVAIGRPYTYGLALGGEDG
IVHVLRSLLAEADLTMAVDGYRSLKELTPDTLRRVT
375142810YP_005003459.1 site-specific recombinase XerD [Mycobacterium rhodesiae NBB3]MDAILEEFDEYLALERGRSDHTRRAYLGDLRSLFDFVAERRPDAGIDALS
LPVLRSWLAAQAASGAARTTLARRTSAAKTFTAWAMRRGLIASDPAARLQ
IPKSRRTLPAVLRQDQALDAMAAAKSGAQQGDPLALRDQLIVELLYASGI
RVSELCGLDIDDVDMSRRLLRVLGKGNKQRTVPFGAPAQAALGSWLSDGR
PGLATANSGPALLLGARGRRLDPRQARTVVHQTMAAVDGAPDIGPHGLRH
SAATHLLEGGADLRVVQELLGHSTLATTQLYTHVTVARLRAVHDQAHPRA
375142809YP_005003458.1 metalloendopeptidase-like membrane protein [Mycobacterium rhodesiaeMRFFALLLTVAIALGAPASADGERLEWPLRPRPAVMRMFDAPSPNWQPGH
RGVDLAGTPGQRVYAAAPGTVVFAGELAGRPVVSVAHRGGLRTSYEPVVA
AVRAGQRIDAGTMLGELQAGHAGCAAPACLHWGAMWGPASRADYVDPLGL
LASTPIRLKPVR
375142808YP_005003457.1 30S ribosomal protein S2 [Mycobacterium rhodesiae NBB3]MAVVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DKAYEFVKETVAHGGSIMFVGTKKQAQESIAEEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMQKVPSAIWVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDLVDYPI
PGNDDAIRSAALLTKVVASAVAEGLQARAGAGKGDGEAQAEGAEPLAEWE
QELLAGATASTEAGGADGAPAAETPQQS
375142807YP_005003456.1 translation elongation factor Ts [Mycobacterium rhodesiae NBB3]MANYTAADVKRLRELTGAGMLDSKNALVESEGDFDKAVELLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNSETDFVAKNAEFQAAADQIVAAAAAAK
ATDVDALKAAKVGDTTVEQLIADLSAKIGEKLELRRVAYFDGNVETYLHK
RSADLPPGVGVLVEYESGDNEKGTAAAHAVALQIAALKAKYLTREDVPED
IVANERRIAEETAKEEGKPEQALPKIVEGRVTGFYKDVVLLDQPSVSDNK
KTVKALLDEAGVTVTRFVRFEVGQA
375142806YP_005003455.1 amidase [Mycobacterium rhodesiae NBB3]MNHGDEAPGRRTNGRCHAFGDDALGDLDAVGLVDALRSGDVSAAELVDAA
IARTEAVNPALNGLAFEAYDRARTRAAATRSFGGYFDGVPSFIKDNVAVR
GWPTMQGTDAWDPRPMPADGAFARVFLGTGLLPLGKTQMSEFGFSGAAEH
PRIGPVRNPWNTEYTAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASC
NGLVGLKPTRGRIPLDKETAQMPLHLVANGVVSRSVRDTAAFLREAERVY
RNPKLAPIGDVTQPSKQRLRAAVCTHSISRGASPEVRELTLKTAALLESL
GHRVTEIDNPVPARFKDDFLVYWSFLAFAVTRSGRRMFGPSFDRTRLDNI
TLGLDRKAARNLHKLPLAIRRLSASHRITARLGQQYDVVLMPTLAEVTPP
IGYLDPTQDFDTVMDRLVDWAAFTPLQNATGDPAISLPLAESANGLPVGM
MLTSPRGHEARLLELAYELEEAQPWARIQS
375142805YP_005003454.1 glycerate kinase [Mycobacterium rhodesiae NBB3]MKIVLAPDSFKESMSATEAVAAMRAGVLEVIPDAECIGVPMADGGEGTVD
AVVDALHGQHVETEVADPFGRTITARYGYIPLRQLAVIEMAAASGLELIP
PDQRDIRRASTFGVGQLIRSALDRGAEELLIGLGGSATNDGGAGMLTALG
ASFVDVDGTPLEPGGAALRHLDHIDVAGLDPRLRDVRIRVASDVTAPLLG
PTGASAVFGPQKGATPADVEILEAALTQLATVSYKTLGNVNPQRPGVGAA
GGLGFALVEFLGAETKPGVDEVAETVGLERAVSGADWVLTGEGSVDAQTV
MGKTPFGVAQVAVRAGARVAIFAGRVAPDASVLLGHGVERLIAITADGTP
LEQALREGAQSLTRATVDFCREITG
375142804YP_005003453.1 arginase family hydrolase [Mycobacterium rhodesiae NBB3]MSFTPTADEAIHLLEGYFYWSGFPKLLGCEIETDFAKADIALVGLPLAVN
PVERTQYLGPRAVRHRSQAYHRGHREFGINPFELARIRDFGDVPIPTPTI
ADQAVLDIEKFYARMDAAGVLPFTIGGDHACTLPVLRAIAGPNSRRKAPI
GIIHFDSHTDTYGDSAGVRCHAGNGFRIGNEEGLIDPSRYVLVGLNGPMV
HPNMDDYSKDAGYRLLSLEEIEDIGIPAAVGEIQKVIGDGPVYVTVDLDV
LTLSDAPAVADPEAGGLTMREMQKILRSFRGMDVIGGDVVCFVPHLDPSQ
ITALHISAIMHEIVTVMAEGVAKKR
375142803YP_005003452.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MELICVKIIDMKDMLEDQPLGYLLSRVANALRAEVTATVLDPMGLAFPQY
ICMRILSKNPGRSNADLARDTNVTPQAMNMVLRRLEGRGLVTRPASVESG
RSLPARLTREGEDLLKRTDAGVRAADRKLMSGLSAEQRREFKRILITLGS
D
375142802YP_005003451.1 Thiopurine S-methyltransferase (TPMT) [Mycobacterium rhodesiae NBB3MTQPTNEMFESAYRGEAPEMAGARPPWSIGEPQPELAALIEQGKFEGDVL
DAGCGEAAISLYLAERGVATVGLDQSPTAIAMAKEEAARRGLDNATFAVA
DISDFGGYDGRFKTIVDSTLFHSMPVELREGYQQSIVRAAAPGASYFVLV
FDKAGMPDGPANPVTEDELREIVSKYWTIDEIRPARIHGVFPEGFEEFFP
VTDVREEPNGRRSVPAFLLIAHLPG
375142801YP_005003450.1 uridylate kinase [Mycobacterium rhodesiae NBB3]MAEPDSQPTSPNGADPVSPGDASMRPVYTRVVLKLGGEMFGGGQVGLDPD
VVHLVARQIAEVVRSGVQVAVVIGGGNFFRGAQLQHRGMERTRSDYMGML
GTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYIPLRARRHLEKGRVV
IFGAGMGLPYFSTDTTAAQRALEIGAEVVLMAKAVDGVFTADPREDPGAE
LLTAISHREVIDRGLKVADATAFSLCMDNGMPILVFNLLTDGNIARAVAG
EKIGTLVTT
375142800YP_005003449.1 ribosome recycling factor [Mycobacterium rhodesiae NBB3]MIDETLFDAEEKMEKAVAVARDDLSSIRTGRANPGMFSRVNMDYYGSPTP
ITQLSSINVPEPRLVVIKPYEANQLRNIEDAIRNSDLGVNPTNDGNVIRV
SIPQLTEERRRDLVKQAKSKGEDARVSVRNIRRKAMEELHRIKKDGEAGE
DEVSRAEKDLDKATHTYTNQIDELVKHKEGELLEV
375142799YP_005003448.1 CDP-diglyceride synthetase [Mycobacterium rhodesiae NBB3]MTDQHITPVTDTPVEEPPKKSSRAGRNLPAAIGVGVVLGGLAIGVLLFAP
IWWLLMLAVAIPIGMHEVIRRLGEAGYALPAIPLLVGSQAMIWLTWPFGP
AGLLGAYAGTIVVCMVWRLVGQGIREQPVNYLRDISAAVLLATWVPLFAS
FSALLIFQDDGGFRTFIVIASVVFADIGGYVAGVLFGRHLMVPAISPKKS
WEGLGGSLVFGVAASVLAVVFLLGKPWWVGIPLGLLLVVTGVLGDLVESQ
VKRDLGIKDMGKLLPGHGGIMDRIDAMLPAAVAGWIVLTLLA
375142798YP_005003447.1 2-vinyl bacteriochlorophyllide hydratase [Mycobacterium rhodesiae NMAVSLPLVFDPPRRAMPPRHIADLDDDARTAAVAELGLPAFRGKQLANQY
YGRLIADPHQMTDLPAALRDQISDALFPKLLDAVREIECDSGETRKMLWR
AVDGSTFESVLMRYPQRNTVCISSQAGCGMACPFCATGQGGLQRNLSTAE
ILEQVRAAAVELRDRDGEGIAPPARGGRLSNIVFMGMGEPLANYNRVVAA
VRRITAAPPFGFGISARSVTVSTVGLAPAIRKLADERLGVTLALSLHAPD
DELRDTLVPVNSRWKLSEALDAARYYADVTGRRVSIEYALIRDVNDQPWR
ADLLGKRLHGALGPLAHVNVIPLNPTPGSEWDASPKTVEREFVKRVRERG
VSCTVRDTRGREIAAACGQLAAEG
375142797YP_005003446.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNPAGASDDAEIARLLYRYARAVDTKDWELYRSVFTDDAHIDYSSAGAIV
GTRDEVVDWFAANFGVIGWSMHYITNIESDISGDTATVRAMFYNPMQLPG
MTAMSTCGGYYHHELVRTPDGWRSRRLREENVWFDNAPGAPTA
375142796YP_005003445.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTSVQDETGVLAGDERMLIDGELQHTSSGATFDVIHPASEEVAGQATDGT
VADMERAIGAARRAFDETDWSRDLDFRYHCLTQLHEAFERNKEHLRRVLI
TEVGCPVKVTGSQIESPIEEVRHWAEHGKNFEYLADNGVHDTPMGPARRK
IHYEPVGVVGAITPWNVPFYLNVAETVPALMAGNTVVLKPAQLTPWSGSE
YGRIVAEETDIPAGVFNVVVSNANEVGAALSGDPRVDMITFTGSTATGRA
ILAAGAPTVKKTLLELGGKSAHIVLDDADFTMALPMAALMACVMSGQSCI
LPSRILLPRSRYDEGIEIMKNMMENFPVGDPWDPNNMQGPQISQGQREKV
LGLIKSGIDSGARLVTGGGIPEHLPKGYYVQPTLLADVDPNSQVAQEEIF
GPVLSVIPYDTDDEAIAIANNSIYGLSGEVSGGDVDRALEVAKRMRTGNV
TINGKSHFGIGSPFGGTKQSGLGYRNGEEGYKEYLEAKTIGMPDTAAL
375142795YP_005003444.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MNEPLHAPYGTAEDTSTRHRILVATAEVLARSGQTKLSLSEVALQAGVSR
PTLYRWFASKQELLDAFGVHEREMFDNGISRATAGLRGTEKLDAALRFIV
EYQHSYSGVRLIDIEPEVVIGQLGRILPIMRARLEKLLSGPNGAVKAATA
IRVAISHYIVRSDDDDQFLAQLRHAAGIKQ
375142794YP_005003443.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MAGPLDGIRVVELGVWVAGPAAGGILADWGADVVKIEPPEGDPARMFGRM
LGVEDGSSPPFEMDNRGKRSIVLDLTSEDGRATARELISGADVFLTNVRP
AALARVGLDFEAVAAHNPTLVYGLITGYGESGPDADRAAFDVAAFWARSG
LAHLLTRPGDTPPFQRGGMGDHAAGMTLAGAVCAALVARDRTGKGQMVST
SLYRQGAYTVSFDLNTFLMTGSPIAIGQRETMGNPCMNNYAAGDGRRFWI
VGLQAGRHWPPLCRAVGRSEWLTDPRYDTPLNRAVNSRELIAELDEIFAT
KPLDEWAKVFAAEPDFFWSPINTLEDVMGDEQFHAAGGIVNVPDGAGGVA
MVASPADFHGTPAQPRSTAPELGEHTDQILAEVAGRQRMNRST
375142793YP_005003442.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGYSAADESFTHQLPRPFDEVHHPDATWSDRCYFFAASPDGDLLLASGYG
NNPNTKTGLGYVKVTFADGRHYDLLAGRPVDGAGRTEVGAGPMRWTCVEP
LKKWKLDVEPNNSGIAWELYYEPTAPMWELLPLKVTGKDGRIIADMYHMK
EPGVWTGWVEVEGQRISVDGFHGGRDRTFGVRVADEIDFWLWLDAGFEDR
AIEAWVFETSDGTVTYVDGGITHNDGTLSKRFVNIVHDIEFDGDRKRAAR
AVLIFTDEDGAKYRVTADSPHQHVNAYYGLPMSKCTYEDLGAGAYFIHFL
WDSNSHDELVENEDKAMAVDQLMRFDFEGRTGWGIFEILMGGDAYPRYPN
WRPLDMSKFKQDRKAVDRKPGGDRR
375142792YP_005003441.1 putative aminoglycoside phosphotransferase [Mycobacterium rhodesiaeMTYSDEVRDGLTGWLQTQLPDAGNLRIEGLDRVEFGHSAEMMTLTIVSRA
GRRDVVIRLRPKPPALLEPYDLTRQFIVLRALADSAVRVPRALWLEDTGG
VLGRPFFVMERMPGTVYELEAPSEPEVTAAGVTRMCESLAEQLAAIHKVD
IVGAGLESLDDGRRHLDREIEHWSAEMQRVKRGTLPALERLLRELTDSQP
APSPSVTLVHGDAKPGNFAFVGDEVSAVFDWELTTVGDPLTDIGYLELLW
RMPVGIPSHDAAPTIDDVLAHYSEASGIAVVNREWYRAFNAFKLAVINLI
GARLFDDGVTDDQRFMLNAYGIPLFTQMGLADLGVTEQLDDGPVMPSEER
MKQAQASHRH
375142791YP_005003440.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTIPAAVNELTPEWFTDVFTTPVDAVHVLDAHSGTTGRARVGLTASSSDV
PETVFVKLQPFGEDQRKFLRQIGLGVAEARLYAEVGDDLPVRAPRVWHSD
YDSSDGSFVMVLEDLTASGCRFPTPSDDDIVDVAASAMDELAVLHAGFHG
RDLDWLRTPSGMRRKPSDSETASRRAQFIVSALEQFADDMPAVFRRLGDL
YSARSLDIVALFAEGERTLIHGDTHSGNLFVDGGRTGFYDWAVASRGPGV
RDVGYFLCNSLPIETRRAEEESLLARYRSALARNGVELDAETAYTQYRLF
AVYSWIAAASTAAMGSQWQPIDVSLAAMASTTQAIEDLDSVGLLEERLSG
375142790YP_005003439.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MEEPGVEADNSTRQRILAATAEVLGRNGMTKLSLSEVALQASVSRPTLYR
WFASKKDLLEAFVVWERQFYERAVAEATADLPACEKLDAALRVIVDYQQS
YPGLRMIDIEPAQVIRRLSRVIPLMRQRLERLAQGSDPSLAVSTAVRVAI
SHYVVRSDDDAEFLDQLRHAARVKHHAPDSAS
375142789YP_005003438.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MQAREYSRFDITSRDFWSRTFDGREEIFAQLRASDGLTWHRPFDSLFGME
EPGFWALTRRADIVYVSQHPELFTSAQGVALNPMPAEIQRFASFFLSMDP
PQHTVYRRLISSAFTPRNVRQIEEQIHRNAIAIVDDLVGAGEVDFVAACS
ARLPMLTIMDMLGVPTADQPAVAYAAEKLFGMSDDEYATPEERAEDPIAQ
ITLLSTTGVELAQFRRKNPGDDLMTAIVNAEVDGHRLTDEEIGAFLILLA
SAGNDTTKQSTTHAMMALAENPAQREWLMEDFENRISSAVEEFVRWSSPV
LQFARFATEDTEINGAPVQAGDKVGLFYCSANRDEAAFAEPGVFDLSRSP
NPHLGFGGGGPHFCLGNQLAKAELRNLFRELLTRLTTVEFGEPDLLYSNF
VHGVKRLPAFVR
375142788YP_005003437.1 ferredoxin [Mycobacterium rhodesiae NBB3]MKVEVDLDKCTGHGICESIAEDVFEVADDGVVVIHDSERPESDRDRMQQA
VTQCPVSALRLAD
375142787YP_005003436.1 trypsin-like serine protease with C-terminal PDZ domain [MycobacterMSCLGVAPRRLSNPPSDGIWVYCLPMRWIQLGFALLFVTLGLGALAGRTA
TTETVEEIAQVAESAPAPTVANVPRPDASLARDSVVSDVAHSVVKISSVA
YSCQKVMAGSGFVIAPGRVMTSAHVVAGADDFIVSVDGHEHDATVVMFDS
TEDIAILEVPGLQAPALNFAQDTAWQGTDAVVLGYPGGGPFVAYPARVRE
VLDFKGPDLYRALLVRREVYSIRGLVRSGDSGGPLIDRSGRVLGMNFAAA
THDPEVGFVLTAKQIYPHVVGSPRSGPVSTGPCIG
375142786YP_005003435.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDSYYELIDGDDPHGAKFAGTDLVRSTWSAEIQHGAPPSALLVRALENC
EARDDTRLSRVMIDLLGAVPAEGDLWVRTRIERSGKQIELVSAQMLAPGR
DGEPRAVAQASGWRLKTIDTSAVVHTSAPPLRPLAEARSRDMKKDWDRNY
VHSLDWRWLTQPMSDGPGESWIRPEVDLVKGETMTPMQRLFSVADDANGI
GTKLDIRRWTFMNTDLVVHVHRIPEGEWIGIRAETNYGPDGIGTTIGTLF
DECGAVGAIQQSVLVRPMPGR
375142785YP_005003434.1 gluconolactonase [Mycobacterium rhodesiae NBB3]MICKGADTLTTLTGGFCFGEGPRWFEGLLWFSDMLGEAVHTVNLQGDLTT
LSLPGHQPSGLGFRPDGTLLISSAEQRRVLRYDGYTVEPIADLSGLVPAA
LGDMVIDDAGRAYVGSQARDGGVIARVDADGSVAVVAENLDFPNGMAITE
DRATMIVAESTGRRLSAFTIGADGSLFDRRIFADGLDGPPDGICLDAEGG
VWVAMTLAHTFERIVEGGTVTERIDMDDRTAIACTLGGPERRTLFLVSST
DAYPQRLVGTKQSRVDATTVDVAGAGLP
375142784YP_005003433.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKTFYGHTLLYLHETIALGEGRSEQFTEVFGDVYHPMMADLGARLFAMWE
TTPYNGHWPQVTIIWEIDAFADYARIGRAQAPGGSHAGPAAKWSTFLSGI
RASGEGRIMYAGKFNRTLAQLKEAEFGAGLVIQEIMQTKPGRQDDYIREL
ERLYVPWSESTGKRWLGSFITTFRFNEVIHYWALDGDWDCFENHYPSWKD
SPPAEIVTWMSVAPALRDGWEDSILQALPPSPLQ
375142783YP_005003432.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MNAPVTQHFSYDPFDPAVMADPPSYYRVLRDDHPVYYIDKWDTYALSRFD
DIWEVLGVNDGTFVASEGTLPAATVLAARNEGAVPDPPLHPLPFHANFDA
PIYDSVRRCTSSQFRPKSVAGLSDRIRILANERLDELLPRGTFDLTQDYG
GIVAASVVCELVGLPVGLASDVLATVNAGSLAQPGSGVEVANARPGYLEY
LVPIIQRRRAGDGEALPIADNLIGYRLPDGSALSDSEAAVQMLGVFIGGT
ETVPKIVAHGLWELGKRSDQLAGVRSDLDANVPVAREEMIRYCAPAQWFA
RTLRKPFTIHGTTMNPGQRVITLLASASRDEREYLDPDEFVWDRRIDRLL
AFGRGQHFCLGVHLARLEIGIMVTEWLKRVPDWRIIAEGATRPPSSFQWG
WNNLPVEV
375142782YP_005003431.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMWAYRLIAPYTFERLDVPDKTADDLDDRHVLLRFMAAGVCGSDLPPFRGV
RGKIAGDTGLNAAEMVGFPVHEVVGEVLASRHADHRVGDRVVGWASGFDG
LTGVVVADGDGLAPYDPGLSAEHAVALQPLACVLYALEQLDGLKGQHVAV
IGQGSIGLLFSYAAKALGARHVTGVDPVDRDGIGKEFGVDTIIRATSDRW
VSHLDPGDRPDVVIEAVGHQVATLGHAIDAAAPGGTVLYFGVPDDDSYPI
SMRAMLRKNLTLKSGVTLERRRVLDAANEFAKDHPELLGAYLTHTFGVDE
VQSAFDLACRPVPERVKIAIRA
375142781YP_005003430.1 2-4-dihydroxyhept-2-ene-1-7-dioic acid aldolase [Mycobacterium rhodMRLQEALSAKPRVWGGWVVGPTIIGPEEFARAGYDYVGFDLQHGYLDDAD
VALLLRRLEHVPIATAVRLPSAHPAPIGRVLDAGADAVILAMVESAETAA
AAVAATRYAPAGVRSFGPLRADIGLDPAEHEARAGVFAMIETARGLAALD
EICAVEGLSGVYVGPADLAISLGENPITALDAPAVLDAVTRIHSVASGAE
LIPGIHANAGKPGKAMAELGFRMITLASESQALRRGAAAHLEEAQ
375142780YP_005003429.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTDRVALVTGAARGQGAAIVERLRAEGFRVAAGDVRIEELKTNVQGSGED
VIAVELDVTSAPQWADAVRATVERFGTLSTLINNAGVLHRASLDAETPEG
FEGSWRFNCLGPFLGIQAALPELRRAEGAAIVNTVSTGAIRPFPNHAAYG
SSKWALRGLTQAVAAELAPDGIRVNAVFPGPIATPMLDDTTQSRLSATFG
RLGEPAEVANVVAFLVSDKASFMTGSEIVVDGGQCLRIG
375142779YP_005003428.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMPADRMSPSVGIIGAGPGGLALAIFLKKNGFRDFTIFDREDGVGGTWRIN
TYPGLACDVKSHLYSYSFDLNAGWSRLWSGQPEILEYFERCAQKYQLARH
LKLCTEIASASWDAETKTWLLTTTSGEQHSFDVVVSAIGLFTQPVLPDLV
EEDPFTGTLMHTARWDHSVDLTDARVAVLGTGSTAAQLIPEVAKVAEKVY
SVQRSPTWILPKPDRSYTEREKWLFAHVPFAKRIYRTRLWLRSESNIGVI
ENGSDKTQEFRDIALRTLEAAVPDEQLRSKLTPEHPFGCKRLVFATDYLQ
TLSAPHVEVVSSPARALRARSLVTADGRELEVDVVLCATGYAAADYLGEI
EVVGEDLTTLRETWSDGAFAYLGMAVPGFPNFFMLYGPNTNVGSNSVIFM
LEAQAHYIVRALKYMRRKRKSYVAVRTETMTEFIARIDEWMEGTVWLTRC
SNYFRAPNGRVVTQWPRSARAFWEMTRRFRPAEYTFEPQAQRSVVQVGSH
TRADE
375142778YP_005003427.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MDAARLDPELRHLAAARTDLSPSLLGIVRDSLNQRRADTARNVNYAGVEI
DEREVASVPVRIYRGAAAPSPVVIYCHSGAFVMGNLDTDHRQCVQFARQG
TCTVVSVGYRLAPEHPYPAGLHDALAVLDWVAQNALELGVDTGRIAVAGS
SAGAALAARLAQCAAHGAAPPVVFQLLHQPVLDDRPTPSKAEFVDTPGFD
GPAVDQMWRLYVGDESAPVDAAPGRADELSGMASALITASELDPLRDEAV
DYARRLMSAGVATELHVFPGTCHGFDSLLPDWETSQRLFDLQGAALRRAL
W
375142777YP_005003426.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMILGIVTTSSETAFDVPPEAIYDFVTNPANWTKTYPGGPDIRNLPDRLPL
QVGDTWDEAHPDPSKDRVFTWQLSMAVRPSLFVFSSVGRLGHDSQGNGGL
EGRMTIEYHFTRPGDGVTLFGRTMTIEAYRHAPLTDGFFRMVNPSHIDAY
HAAVARELSAT
375142776YP_005003425.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWSVLSQLLAPAMVVAISPFSIIVAIVLVLHTDRARANGWAFLAGRLLAL
AAVTVAFMQAPRLIGNLNRPVSPRVLIGAGALLLMIGVWVWFRRDRMTEE
PPWLAKLTRLTPIGAAVIGMLLVVSNPKMLAATAAAGLLIGTASVSVAGA
GGAVVYYSVVASSTVAVPVLAYAAVGSRADDQLTRFKAWLHRHSGVVTAV
ILAAVGIALLVIGISEI
375142775YP_005003424.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSRVELSPEDQAFRDELRALLKTLVTDEVIARDRETGENFDEGVHLAL
GERGYLAAEFTDEADGGFSRLRRRLWNLEIGRAHTPWFHWGTTAMVARAV
RDFGSDELKAEVMERALSGRIRLCLGYTEPEGGSDVATCKTRAVRDGDGW
IINGSKMFTSNAQNAAYVFLITNTDPNAPKHQSLTMFLVPLDSEGVEIQP
LRTVDGDRTNITYYSDVRVDDRYRIGEVNGGWTVLRDALNDEHGTVERGA
DGLQKVAAMAEHLVLLAEAIDKVAALGPDDDAVKYRLGRGIARMEAAMST
PDMFGRVANAQTMRDVSLELMDIQGAVATLPVDAQGAQADGGAEYVFRLA
GPTGIYGGTLEVFRNMIAQHALGLGRPAYAPPAKR
375142774YP_005003423.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMSRCEIGVYLPQMGFTYEQMLHRTLRCEQLGIDSIWLYDHLYAPGMPDYP
SMEAWTLATALLSRTDRVRVGHMVLCNQFRHPAVLAKMATTLDQISAGRL
ALGIGSGSIEDEHARLGLPWGTFAQRSQRLGETLQILQQAFADEVIDFAG
EHFTVKDMPIKPGAVQQPGPPIVVGGVGEKYTLPLVARYADVWNVPTYAL
GELEHKISVLRSICDEIGRDPSTIVLSIEAVMALAADDASLPAVRELAEK
RFGVPAFGLHEGGLIGTPSAIVDRLHELQDMGFGQIVLFTHDRGSDETLN
LLAAEVVAKL
375142773YP_005003422.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MSETVIAGRHGPFGGHLDPTMIARYAAATGDRTASVLDGRATPSVFPVVL
VFTPNEAARSDLPESVWERVRGGVHGAHDIVVHRPLIPGEPLQTWSQISA
VRTSRSGTQVVMRFEQVDVDGAIAVEQWWTMVLLGLHGIADLGSTPAEHR
FPDDARARPVGSAVHHIDGDVAQRYAEVSGDWSAHHFDIAAARAAGFDFV
FTHGLCTMAICAHRMLELVGIDDPGRVRRIAARFATPTPLDCDLTVNAFA
ISENSYAFEAHTDSTTTITHGRLELRS
375142772YP_005003421.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMLNARLGRAEAEHYMRFTFTHPMHSHPYNPELVTGSGIATVAAAAEAAGF
HGFGFTDHPAPSQRWLESGGHDAVDPFVAMGYAAAHTSSLRLIPNIVVLP
YRNPFVVAKAGATLDLLSGGRFTLGVGVGYLKREFTALGVDFDERAALFE
EALEVIRGIWTTDDFSYEGRHFSAKGITAHPRPVSTPHPPIWIGGNTAAA
RKRVVAHGDGWCPFPAPAMLAQTARTAVMDEDALAEGVDDLRRRFDAADR
DFAEIDITFTNAAGGNPGSEDFNADAYLAGLEKLAAVGVTWVQVGLPGDN
LAHVLETIERFGGSVIKAAS
375142771YP_005003420.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MLRRRSDVATHGSNLYTTEVIVNPYPHYKTLRTLGPVVWLSRHRVYALPR
YAECKAVLRDDKTFVSGKGVALNALTNRLSRGTTLSSDGAEHDQRRKLVA
HRLLPRALRAIDDDVRVQAARVVETALTRGEVDGVEDLAYALPMAVVPDL
IGWPREQRAHLLPWGAATFDVLGPINRHAVKALPASLRMLAYARRVVRER
SLIEGSIGHEVLIAADDGKVDLAECAPLMIDYIAPSLDTTISAISNALHL
FACHPDQWQLLKADPGLIPNAVNEIVRYESPLRAFTRKVRTSTEVAGQSI
PEGARVLVLYSSANRDEREWDAPDTFDITRDATRHLGFGHGAHACAGQGL
ARMETQAMLSALVERVERIEPAGTPTWAINNIIRRHERLPLKLIAS
375142770YP_005003419.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMTREASPPVVIVGAGPTGTTAATLLAQFGVGCLLLDRWSAVYPQPRAVHL
DDEIYRVLARLGIADEFAAISRPAHGLRLLDPALRVLAEFRRDTALSVNG
YPQANMFDQPDLETLLRTNLKRYPSVEVRGDAEVTSIAERSDGRIRVTYV
DRADDSLHTVDTDYVLGCDGANSVVREQISVRMHDLKFDQRWLVIDAATE
TDLGQWDGVHQVCDPVRAGTFMRIGPARYRWEFRLLPGETADGFRTIEAL
RPLIAPWTSNIADDEIELIRVTEYTFRARIAGRWRRGNVFLLGDAAHLTP
PFIGQGLGAGLRDAVNLAWKLAGVIAGDLPQSALDSYEQERKPHARSMIR
LALAVGWAMTAGGDFGNAVRRLFVTRMRLIPGLRKKIVGSRTPALHRSAF
VRPTHVPGQLPGTLCPNPVGLDGRRLDEILGNGFAVVTVTPPTDAQRCDL
DARGAEVHVAAHDSVLADWLRSGHAAAAIIRPDRSVMCAGRDLQKLCELV
PNFRHSRIRSHA
375142769YP_005003418.1 2-keto-4-pentenoate hydratase [Mycobacterium rhodesiae NBB3]MTTSVLRTADAWWVQTPTGAARIATAATTTGELLADRDAIERAAHSTDTV
PVDSLTLLSPVTRPCRVVAQMTNFASHVKDAGMNPASIPLTFFRKSSASI
SGPFDDIVKPGHVKFLDYEVEIGLVIGRDIPVGTAISESALSDYIAGLVV
TNDVSARDIQLPQTQFYEAKSYPTFTPVGPALVLLDADELKRFTDLRLRL
RVNGEIRQDMVVGDDMIYRPMQALESLARFQDLAAGDLVMTGTPAGTALS
APPKPIEIIGSLLPPAVKWKAFFNRQAKNTKYLKHGDLVELSVATDDGVI
DLGVQRTAVRYA
375142768YP_005003417.1 lactoylglutathione lyase-like lyase [Mycobacterium rhodesiae NBB3]MSSIIGAHNELHSEQGARSGEHSGRSPDPVIKVADIAWLEFEKPDLARAE
AFARAFGFATTLRTADELHLRGANAGAPCVLLRRGPRSRFVGVAFRTQDD
ADVLRLGNATDTRVRALPESIGGVSVDLVDPSGVPVRVVSGMHTLPELPK
QLPHTFNFGDRTPRTNATQRPARVPATVQRLGHVVMQTADYTQTLNWYLD
HLGMIVSDFLYYPGQRDRGPAMSFIRTDRGALATDHHTLALALGPTARYV
HSAYQVCDLDALAAGGEYLCERGYFRSWGIGRHIQGSQLFDYWRDPDGFL
VEHFADGDMFDNTLEPGWAPFTASGLAQWGPAVTKDFLGINPKALPHEAR
SILDALRGDNEFTLTRLRGLMKVATS
375142767YP_005003416.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSDQPEAPINRLERRKQRTRAALIKAAQSFIAAGKVNAPVLEITQAADVG
MGSFYNHFDNKEQLFDAAVAEVLDAHGALLDELTSSIDDPAETFACSYRL
TVRMFRRRPQESQILLATGMTLLASDKGLAPRALRDIEEATRAGRFSVDD
PELALAMAGGALLGLGNLLRNQPKRDDAEAADAVTADILRLFGVPAEEAR
EICSRPLPDLDGLTKPDSAA
375142766YP_005003415.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MVGHYIANVRDIEFNLFEVLGLGSVLESGGYGDLDVDTVRTMLDEVARLA
EGPVAESFASADRHPPVFDPQTHSISVPGELAKSIQAVKDAEWWRIGIAE
EIGGVAAPAPLVWAINEILLVANSSAAFWWALGPSMANALYVEGTDEQKR
WAAAGVERGWAGTMVLTEPDAGSDVGAGRAKAIAQPDGTWHIEGVKRFIS
GGDVGDTAENIFHLVLARPEGAGPGTKGLSLFYVPKFLFDLETFELGPRN
GVFTTGLEHKMGIKSSPTCELTFGADGVPAVGYLVGDTHNGIAQMFTVIE
NARMTIGVKAAGTLSTGYLNALAYAKDRIQGADMTQMTDKTAPRVPIIAH
PDVRRSLMTQKAYAEGLRALYMYAAAHQNNDVAQHVSGADPQMAHRVDDL
LLPIVKGVGSERAYEILTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEG
TTAIQAMDFIFRKIFRDNGAALAHVATQISKSIDDCDGALKAQSDQLRIA
LADVQAMTAKLTEYLMAASEQPSEIYKIGLASVRYLMAVGDLIIGWQLLV
QADVAHAALEAGASDSDEAFYRGKVATAAFFAANMLPRITTIRGIVDTID
DEIMRLPEAAF
375142765YP_005003414.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLMSLVTGRGPLSKDPAGWFSPPVAAGTVYVEPHPRRVQALRGEHAVIDT
EQALLVHRPDRPLSYAFPVDEIGDLPGEPVPEAPGYVRVPWDAVDVWVEE
GRRLVHYPPNPYHRVDCRPTARALRVALGDEILVDTTDTTIVFETALEPR
LYVAPSLVRTDLLQRSQTSSYCNYKGYATYWSAGAVGDVAWSYEDPLPET
SPVRGFFSFDPGLADVTADLPRA
375142764YP_005003413.1 acyltransferase- WS/DGAT/MGAT [Mycobacterium rhodesiae NBB3]MKRLNGVDALMLYSETPEVHMHTLKIGILDVSGVDGFDFDLFRRVAYPRL
MALTPLRYQLVGIPMKLHHPMWVENDDIDLDYHLRRARVPAPGGRRELDG
LIGEIASTPLDRARPLWEMYLVEGLADDRIAIVHKVHHVLADGVASANQM
AKAMEPFASGDVVTPTLNNMPRTRGRLLAEAGRDHVGLIRKLPRLVSETA
TGVSRVRQRSKERGKHPDLARNFAPPSCFVNHRVTPGRRFATAPLALSDV
KETAKHLGVTLNDIVLATAAGALRRLSLRYDGRADEPLLAGVPVSTNPSR
ERLAGNEFTYITPSLPVHIDDPMERVRLTALSTGIAKENHQLLGPAVLPA
WMSYLPPAMAPGIFRRQARRVESASVFNLTVSNVPGPRDRGSIEGGLVTE
IYSVGPVVAGSGMNITVWSYVDQLAISVLTDDSTLADPHEATDAMIDSFV
EIRRAAGLPVELTEVGAAMPLAAAVG
375142763YP_005003412.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPLPLDESNPISSRRYQLTVVANSIADLVGSAGGWMCDKARAGWDVKVVL
TGDGDTRPVAILGASHLDAELSDVMKMATRGGALAVSAAALTDERIRAGV
LGIVKRGLTQVTVWGQDWPTEFSRKADPIEHRLSAAARAFKAHALGAATV
SVAGTETLYNLGPDALRPLHSV
375142762YP_005003411.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATTEVERHPGRAVADVEDVPSAEWGWSKENHKAIHLGGILAGLFLLAML
RGNHVGRVEDGFLIGFAVLIFVAVGRDWWLRRRGWIR
375142761YP_005003410.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MAGQFSGKVAFITGAARGQGRAHAVRFAEEGADIIAVDLCDQLDTVAYPM
ATPEDLDETVNLVEKTGRRIVAEHADVRDLEQLKAVVAKGTDEFGRIDFV
LANAGILPAAGEQGAQIGAFVDAVDVMLNGVYYTIVAALSSMLSHGDGGA
IVITSSAAGFRPVTVDFGTASHGAAGYTAAKHGVIGLMRHFAIALAEKNI
RVNTVHPGGVATPMIYNEAMAEWSAEHPSFSPSQQPLLDNPPVEPEVISD
TMVYLCGESGRYLTGVTLPVDGGQIIK
375142760YP_005003409.1 deoxyribodipyrimidine photolyase [Mycobacterium rhodesiae NBB3]MPTLLWFRRDLRLHDLPALLDAASADNEVLACYVLDPRLKASSGQRRLKY
LYDALRDLDESLDGRLYVTRGRPDQRIPKLVKAIGASSVHVSGDFTPFGR
RRDDAVREALGDVPLEESGSPYLVSPGRITKGDGSPYKVFTPFYGSWRKH
GWRSPASSGPKSATWIDPDDIPGAVEIPDLDVELELPAGERAAKRQWRSF
VQKHLDGYAENRNRPDLPATSRMSAHLKFGTIHPRTMAADLGHSADAQAY
LRELAFRDFYAAVLDQWPDSVWWNWNKSFDKIEVDDDEDARSLFDAWKHG
RTGFPIVDAGMRQLAQTGFMHNRVRMIVASFLVKDLHLPWQWGARWFLDQ
LVDGDMANNQHGWQWAAGCGTDAAPYFRVFNPTTQGEKFDPDGEYVHRWV
PEVDDDDYPDPIVDHKAERAEALRRYGEIT
375142759YP_005003408.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMQFWSGTPFMKTSEILPLARMLDEAGYDGMITADHLIYPRKLSSPYPDHP
SGKPPWPPETSWPDCWVQIGAMAAVTSRLRFSNAVYIAPARPLLEVAKQV
ATASALSEGRVQLAVGVGWMREEYDMLGQDFTTRGKRLNEMIPALRALWG
GGWVSWSGEHYQVPEMMIEPHPEAPVPIHCGGESDAALRRAAKLCEGWVG
YAYGWDDAVSYANKLTKLRHEYGRASEPFDITLALLEPPSPDLYKRAEDA
GITSVMCAPWMGADLPGDDVERYREPIERFAEDIIARVRS
375142758YP_005003407.1 methionine-R-sulfoxide reductase [Mycobacterium rhodesiae NBB3]MDLTRRRFFFGAGVFVATVAATTACARSATASPGDFEVTHTDAEWQQLLT
PDQYYVLRQAGTEAPFSSPLDDEHGQGLFSCAGCDLDLFASDTKFDSGTG
WPSFWQPLAGAVLERGDDSIGMSRTEVLCRRCGGHLGHVFDDGPPPTGLR
YCMNGDAMTFRST
375142757YP_005003406.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MSNPKPPWYLKPMNRFVRAIQRLGIPAGPSQILTVPGRKSGKLRSTPMTP
FSHDGGLYTVAGYPGADWAANARAAGAGTLTRGRKSRRVRIVELDPAQAR
PVLRSFATEVPVGVGFAKRSGLVREGTPDEFEALAGELAVFRFDPQD
375142756YP_005003405.1 putative nucleoside-diphosphate sugar epimerase [Mycobacterium rhodMNTILVTGATGNVGQPLVSQLINAGARVRAVTRRPESVTFPAGVEVVGSA
AAGLDGATSVFLNSRALGDGLAPLVASARLAGVTRLVALSAINADDDFSR
QPSRVRGDRNLEVEQLAIQSGLEWVSLRPTVFVTNFFGMWAPQIRAGDVV
AGPFADASTAPIAARDIAEIAAHALLTDELIGQKIPLTGPQALTNTELVD
VIGTLLGRRLSYREVPTEEVRQRFVAMGFPAPFADAYIALLATTVGKPAL
VTHDVEKILGRPPESFADAVSANHDLFTNL
375142755YP_005003404.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMSSSHGVEAAWREHRAYLVNLAYQMLGDVGGAEDVAQEAFLRLARTDAAQ
IDDLRAWLTVVAGRLCLDQIRSASARHEFADESGVLDVVVSRDLEPADRV
TLDDDVRTALLEVLRRLTPGERVAFVLHDVFGLPFDEIAETVGRPVGTCR
QLARRARAKFSAAAPRLADIGNREHQLVSDTFITACANGDLQALTATLDP
TVWGVGTILGEGAPPPQINHGPHDVAVNLLRYLGHGATLVSGPAGQPVLL
AFMNRRLFAVLVLTLRDSLIHKIEASVDPSAIGLG
375142754YP_005003403.1 secreted/surface protein with fasciclin-like repeats [MycobacteriumMYAKKALGVGFAAVAAAGLSLGVASPAHAELVGTGCSAYAQQVPTGPGSV
QGMAMDPVAVAASNNPMLTTLTKAISGQLNPQVNLVDTLNGGQFTVFAPT
DDAFAKLDPATIEKLTTDAPLLTSILTYHVVPGQANPTQVVGTHKTVQGA
DVTVTGMGSDLEVNDASVVCGGVQTANAQVYMIDTVLMPPMN
375142753YP_005003402.1 cytochrome c biogenesis protein [Mycobacterium rhodesiae NBB3]MFTLALIGFLGGLITGISPCILPVLPVIFFSGTQSARASANGTGVAVATE
PTLSDRPRPYRVIAGLVLSFSAVTLAGSALLSLLHLPQDAIRWIALIALV
AIGIGLIFPKFEALLEKPFSKLPQKQFGSGSSGFGLGLALGVLYVPCAGP
VLAAIVLAGATGTIGVPTIVLTLSFAIGAALPLLFFALAGRRVAERVAAF
RRRQREIRIAAGVVTILLAVALAFNLPAALQRAIPDYTGSLQESVGGDEQ
IREKLNLAGLVNDQNRELSNCTDGAPELESCGTAPDIKNIAAWLNTPNGS
AVDLKSLRGKVVLVDFWAYSCINCQRATPHIVDWYDTYRGLGFEVIGVHT
PEYAFERVEGNVASGARDLGITYPVALDNGYSTWTNYRNRYWPAKYLIDA
NGTVRHIKFGEGDYDTTERLIRQLITDAAPSAQLPPPVDADDATPQDETT
PETYLSVGKVINYGGSGPYDEGSFNFSYPQQLPDDSFALRGDWALDYQGA
TSRGQDSSIALNYHARHVYIVAGGEGTVTVTRNGVTSMVPISGPPTLHQI
IDDDGVSRGRLDVAVPPGLQVFSFTYG
375142752YP_005003401.1 secreted/surface protein with fasciclin-like repeats [MycobacteriumMRTVHRKTVAAAGLSALAIFGAVSCSNDRSSEATSTSSAAMETTTSAAPA
SPSTTAMADPAANLVGTGCAAYAEQVPSGPGSVAGMAQDPVAVAASNNPM
LKTLTQALSGQLNPQVNLVDTLNSNPALTVFAPTDDAFAKIDAATLEKLK
TDSELLTSILTYHVVEGQASPNAVAGDHKTLEGGSVTVTGSGPDLKVNDA
GLVCGGVQTANATVYMIDTVLMPPAS
375142751YP_005003400.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium rhodMRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNPGLLARQLAETG
VTNVAVADSEAAAKVPDVTYSGPDAVTHLVENTPADVVLNALVGALGLNP
TLAALASGARLALANKESLVAGGPLVLKAAAPGQIVPVDSEHSAMAQCLR
GGTADEVAKIVLTASGGPFLGWSAADLDSVTPEQAGKHPTWSMGPMNTLN
SATLVNKGLELIETHLLFGIDYDRIEVVVHPQSIVHSMVTFTDGSTLAQA
SPPDMKLPIALALGWPARVPAAALACDFTTASTWEFLPLDAEVFGAVDLA
RQAGQGGGCLTAVYNAANEEAAAAFLDGSIGFPAIVRTIAEVLRAADQWA
AEPATVEDVLDAQRWARDRAKREVEREISRKGLLTT
375142750YP_005003399.1 putative membrane-associated Zn-dependent protease [Mycobacterium rMMFVLGIIAFALCILLSVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRPNKLGYTEYGVKAIPLGGFCDIAGMTSVDEIAPEDRPYAMYRQKTWKR
TAVLAAGPAMNFVVGLVLVYAIAVIWGLPNLHPPTQAIVGETGCVAAQIS
KDQVADCSGPGPAAEAGIRAGDVIVKVDDTPVSTFDEARTALQKASGPTT
VVYERDGQPTSAVVNVTRTQRFTGEGDQPTTVGAIGIAAAHFGPTQYNPL
SAVPATFAFTGDLAVELAKSLAKIPTKIGALVHSIGGGERDPETPISVVG
ASIIGGDTVDAGLWVAFWFFLAQLNFVLGAINLVPLLPFDGGHIAVAWYE
KIRNMIRSARGKVAAAPVNYLKLMPATYVILVVVVGYMLLTVTADLVNPI
RLFQ
375142749YP_005003398.1 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [MycobacterMTSIGLGIPTPPAPTLAPRRKTRQLMVRDVGIGSDHPIAVQSMCTTKTHD
INSTLQQIAELTASGCDIVRVACPRQEDADALPAIAKKSKIPVIADIHFQ
PKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGAAGIPIRIGVNAG
SLDKRFMEKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMV
AAYELLASKSDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTIRVS
LSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANEVTA
GLEGMEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVIKTV
PEAQIVETLIEEALRLAEEMGAAPGSDASGSPIVTVS
375142748YP_005003397.1 putative acyltransferase [Mycobacterium rhodesiae NBB3]MSAPPLFRRVDERRVSVVREPGEVYRVLDEDPVGACMVASRVVEHGIEPA
AIGGELWTRQRPTESLCYAGANLIPLRGSADDMHAFADKAMSTARRCSSL
VGRAEMVLPMWQRLEHAWGAARDVRAHQPLMALSTPPVCATDPAVRQVRA
DELDAYLVAAIDMFIGEVGIDPRIGDGGRGYRRRVAGLIAAGRAWARFER
GQVVFKAEVGSQSPSVGQIQGVWVHPEWRGHGIGTAGTATLAAAVVRTGR
TASLYVNDFNTIARATYNRIGFTQVGTFATVLLD
375142747YP_005003396.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDKDPRVARREIADTLMRALERRHELLDVIVKSEDYDAAIEAIANQLGT
SAVAAEAVLRMSFDRLTKVSRRRIAAELEDLNNQLSFTMGQPASSVDNIV
LRPFAADTDRDIFAARTADVQEAGDGSRAPAGDLEDEIRAGLRRVDVEEA
AWLVAVHGPQKVGMVFGDLISGEVNVRIWIHPDYRKQGYGTAVLRKSRSE
MAAYFPAVPLVVRAPAAGT
375142746YP_005003395.1 cell division protein FtsI/penicillin-binding protein 2 [MycobacterMAAAVVLAFGPACTPKPNGPEPTAQQFFAALTTGDTAAAAELSDRPADAR
QTLNDAWAGLQATGLDVAILNSKYAEDTGSVTYRYTWHLPKDRTWTYDGQ
LNLVRNEGRWEVRWSATGVHPKLGENQTLALRADPPRRASVNERGGTDVL
VPGYLYSISLDAQGAGGSLMTTSRAVVDALRPFDNTLEPQRLAEQASSSK
QPMYLITLRQSDRDRVAGAIAALPGVVITPQAELLPTDEGFAPAIINEVK
KAVVDELDGQAGWRVVSVNQNGVDVDVLNEVPGEPAPSVTISLDRAVQDA
AQNAVNFTGKPAMIVAIKPSTGEILAVAQNSSADAQGPLATTGLYPPGST
FKMVTAGAAIERDMATPNTMLPCPGTMDIGHRTVPNYGGFDLGTVPMSRA
FASSCNTTFAELASRMPPRGLTQAAAKYGIGADYTIEGLTTVTGSVPPTV
DLAERTEDGFGQGKVVVSPFGMAMAAATVAAGKTPVPQLIEGRHTEVTGD
QTPISPKILDGLRPMMRLVVTNGTAKDLQDAGDVRGKTGEAEFAGGSHSW
FAGYRGDMAFAALIVGGGSSEYAVRMLKGMFDSLPSGYLA
375142745YP_005003394.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEINHDAMRVSDAQAAMRISDAQAGMRVSDADRNGTLRRLHNAVALGLI
DIEEFEERSARVSSARLHTDLDTLVGDLPGPGAIVTSATDRVELRGVLGS
LKRQGEWIVPTRLALHRRMGSVDLDLTKARFAGAIVVVELDLKFGGLDLR
LPDGASASIDDVEVVVGSARDHRRDAPAEGRPHVILTGKVMCGSVDIRGP
RKGLRFGRIT
375142744YP_005003393.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAAHFRPDLLIEQACDIAGCDDFGLDDTWRDGLTRLCDGLVAEARLSAI
GVEIALGDLIRPMVNRLQIIKWRKDNPDVASQPISRPIFIVGQPRTGTTI
LFDLLAQDPELRPPLTWEVDNPYPPPKLETYETDPRIAETQASIEMSEQL
VPGLLTFHPMGALVGQECVRITAGQFCSMIFSVQYRLPSYYKWLLYEADH
HPAYRYHRIFLQHLQSGVPGGACFWLLKSPAHLWQLDALVAEYPDALIVQ
THRDPLNVISSISALTHHLRRLASDDSSIPDCAGQSCEEIVVGLERGMKL
RDSAALAGQQIVDVQFADFIRDPFATIRTLYGELGRELSPVAEANMRAFL
AAHPGDGGGKRYTWADTGLDAGLVREQVREYQQRFGVPDEPLK
375142743YP_005003392.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDTDGNAAAPKTLESWRLVQQMLADLTKSVIEDAIDERELIEGLQVVAKV
TGLCAELSVQADTERPEFFDMCPDTRMIGGPNPDGRYLLAMIRGDRAYRV
IGTRGSTAYLGYQVLAGTGLTPRRMSGYVSDSDLVLGSGAFELLFSATEP
PPAVLGSAQWVSIPEDASSIVVREYVGDFATEVPATMRIEALDPAPLQPI
TDEVAAEQFTAMAWTIVKLATMHRTIKPELLTHPNELVTASAAELGGADT
TPDNLYMIGTFALESDESLVLEIRPPGTRYWNVTLESIWHECLEPRHRHS
SVTNKAVAPDADGIVRIAIGGRDFGHGHWLDTGGRRRGFVVLRWLDNPDP
HKVQTTVRRGGAAS
375142742YP_005003391.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MDVVSPENARESLTVRRQRATRARIATAAAQRVSEFGLAGATVEQIAAAA
EVGRATFFRYFSSKEDAVAEGMTTHWLDAITEVIARQPAHLSAGEAVIAG
FADLGDGFETVREQVRELATLTRSSPVLSAWTLQIYLRYETAIADLVAPR
IRDLTPDDPRPRLIGAIAMASVRIALDDWLVHGGSLPARVRSALSSMPVE
375142741YP_005003390.1 methionine aminopeptidase [Mycobacterium rhodesiae NBB3]MAADYPDVMAVRTALRPGVVSPTLPVPRSIARPEYVGKATAQEGSEPWVQ
TPEVIEKMRVAGRIAANALAEAGKAVAPGVTTDELDRIAHEYMIDHGAYP
STLGYKGYPKSCCTSLNEIICHGIPDSTVVEDGDIVNIDVTAYIDGVHGD
TNATFLAGNVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIESYAN
RFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVQTVLEPGMTFTIEPMIN
LGALDYEIWDDDWTVATKDKKWTAQFEHTLVVTDDGAEILTQV
375142740YP_005003389.1 cobyric acid synthase CobQ [Mycobacterium rhodesiae NBB3]MTAGAGALLIAGTTSDAGKSMVVAGLCRLLARKGIRVAPFKAQNMSNNSA
VTVDGGEIGRAQAVQARAAGLSPHTRFNPVLLKPGSDRTSQLVVRGRVVD
TVGARDYFTHRERLAAVVVDELQALRTEFDAVIVEGAGSPAEINLRATDI
ANMGLARAADLPVVIVGDIDRGGLLAHLYGTLAVLEPEDQRLICGFLVNK
FRGDPALLAPGLTQLQEMTGRPTYGVIPYSDGLWLDAEDSVSVLAHRVVG
EPQTPRGQQWLRVAAVRLPRISNSTDVEALACEPGVLVRWVSDPADLADA
DVIVLPGSKATVADLAWLRERGLADAIAAHARLDKPVLGVCGGFQMLCRR
IDDSVESRAGRVDGLALLDADIEFDPDKTLHHHEVPMHGYEIHHGRVVRS
TEDDWLGVGIRSGAVYGTHWHGLLDNDDVRRGWLTAAATAAARRGFVVAD
DVDVRARRDAQLDVMAELITSHVDVDAVLALLENGPAPLPTVATRLTP
375142739YP_005003388.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTWRNVLVLCAVALLAGGCAQPIAGTATWPGARLEKVLLTPADFPDGVQY
DLINQEPGQADGAGAPPAMLSRPEGCSDGLTRVIADSAERGPGSAAEYLV
AYDGARMVITVLTWRLDLEKLAAVADRCAEFQTFFDPSTPGIPITTTRLQ
TPRPDALVYEQTMRLGDTSDSVYFSFENIGDTAVFGVAFPTPNPSIGVKG
SLPQTFLDITAKQADRARTA
375142738YP_005003387.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPPTTITVDGVGVSVNVAGPDKGSVVVVLGAAHHAATAYDAVCQRLHTAS
LRTVVIAPDPRLTAESVIGVMDALEVKWALLVGDRVGAELAWELAATRLD
RFIGLVVIDRGHPRVADLTGAIRDDACPPVEMNTTALVSTAAARAVAKAS
QRYVYGDYRMVDLLGRRNAQESTAQLAAEIVMRTSTW
375142737YP_005003386.1 GNAT family acetyltransferase [Mycobacterium rhodesiae NBB3]MDPDHTEAITLGLHDASPQHLVDAMADDVAVEMGWGRLIFGQTFADPAKL
AEVLRQEGHGRRDICIYAREPHVLVSMAPAELFIDPSHTYRLRFTEGDEP
PAAPTGFTVRPLERAEETDEINRVYMRCGMVPAPVDVLWDNSEHRDAVDY
LVAVRDDDGSLIGTVTGVDHERLFNDPENGSSLWTLAVDPTTSLPGVGAA
LTRALAALYRERGRAYMDLSVAHDNEAAIGLYEKLGFERVPVMAVKRKNA
INEPLFTHPPETVDDLNPYARIIADEAMRRGIWVEILDAGAGEMRLSHGG
RSVITRESLSEYTSAVAMARCDDKRLTRRLVSEAGIQVPKGRLATFDEQD
HAFLEEVGDVVVKPTRGEQGKGITVGVSSTQELDAALARAREEHPNVLIE
QRAAGDDLRLVVIDGKVVAAALRKPAEIVGTGHHTVRELIEAQSRRRAAA
TGGESRIPMDEVTESTVAEAGFTFDDVLPEGQKLRVRRTANLHQGGTIHD
VTAKVNPHLSEVAVTAADAIGIPVTGIDLLVPDVTAADYVFIEANERPGL
ANHEPQPTAKAFVDFLFPGSPALPQAWTPDEPPTS
375142736YP_005003385.1 asparagine synthase [Mycobacterium rhodesiae NBB3]MCGATGEVRLDGLPPDIAAVSAMAEAMTPRGPDGAGVWSQGRVALGHRRL
KIIDLTEAGAQPMVDSDLGLSIAWNGCIYNYKELRQDLSGRGYRFFSTSD
TEVLLKAYHHWGDRFVDHLKGMFAFAIVERDSGRVLLGRDRLGIKPLYLA
EDAKRIRFASSLPALIAGGGVDTRIDPVALNHYLSFHSVVPPPRTILRGV
SKVPPAALVAIEPDGRRVTTRYWEPDFTRRAETAAWSEKDWEDAVLESLR
LAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLATFSIGFESVGG
VKGDEFKYSDIVAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDC
VAFYLLSQEVAKHVKVVQSGQGADEVFAGYHWYPPMADAASLDDAVARYR
AAFFDRDPSGVAALVNADYLAESDPSLEFVTEHFANPGADGGIDRALRLD
TTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPELKIAHDG
KGVLKQAARRVIPSEVIDRPKGYFPVPALTHLEGPYLEMVRDALYAPVAK
ERGLFRPDAVEQLLADPNGRLTPLRGNELWQLALLELWLQRHGINGTAA
375142735YP_005003384.1 amino acid transporter [Mycobacterium rhodesiae NBB3]MPEGHEHLDEDERHLASLGYTQELNRSWSGFSNFAISFSIISILAGCFTS
FGLGWNNGGPAAIAWGWPIVSVFILIIGLCMSELVSAYPTSGGIYWWAAK
LGGAKAGFYTGWLNLIGLIAILASVAYGCATFLDLTLGTFSETWVEGYSL
TRTFIIFLIILVLVATINIFSSHLLAVINNISVWWHVAGAMVVVAILWLL
PEQHASFSTVFATTVNNTGFFGGETGIAFIFFVLPISAILTQYTITGYDA
SAHLSEETKSAADGAAKGIWRSIFYSAIGGWILLLTFLFAVQDVDEVTAG
GGAVAVIFGQALDSSWMGIVLLISTAGQFFCTTACQTSASRMLFAFSRDR
AVPGHQLWSKVSKSRIPANAVIVTAAIAALITLPALVEVDINGAPVPVAF
FAVVSIGVVGLYLCFAVPIYYRWKLGDEFQVGRWNLRGHHKWMAPVALME
ILLTSFIALWPTSNLGAPWDPGFEWKYVNYTPLLVGGVLILLYIYWHVSV
KKWFTGPVRQIDETGEALEGVS
375142734YP_005003383.1 glutamine synthetase [Mycobacterium rhodesiae NBB3]MGRQPGLVSQAELESLVADGEIDTVIVAFCDMQGRLTGKRVSARLFVDDV
AEHGAECCNYLLAVDVDMNTVDGYAISSWETGYGDMVMTPDFTTLRLLPW
LPGTAMVMADLSWTDGTAVTQAPRSILNRQIDRLAERGLVPYVGTELEFM
VFDIGYRQAWADGYRGLPAATDYNVDYAMHASTRMEPLLRDIRLGMEGAG
MYCEGVKGECNLGQQEIGFRYDHARVTCDNHTIYKNGAKEIADQHDKSLT
FMAKFDEREGNSCHIHISLRGDDGSAVFADPDDDLGMSPMFRSFIAGQLA
TLRELTLFYAPNINSYKRFALGSFAPTAIAWGMDNRTCALRVVGHGHGMR
VECRAPGGDVNQYLAVSALIAGGLHGIEQELELPEALEGNAYTSGADCLP
TTLAEAADLFDKSEIARSAFGDDVVDHYLNNARIEVNAFNAAVTDWERVR
GFERL
375142733YP_005003382.1 putative glutamine amidotransferase [Mycobacterium rhodesiae NBB3]MSGFDASSEGGSRGLRPVIGLTTYLQKAQTGVWDVRASFLPAIYFEAVAL
AGGISTLLPPQPVDADIAERVLDGLDGLVITGGRDVDPGTYGQQRHPATD
DPVEDNRLRDAFEFALFAGAVRRGMPVLGICRGAQVVNVAMGGTLHQHLP
DVLGHPRHQQGNAVFSTSSVRTVPGTRLAALIGESSDAQCYHHQAIDRLG
AGLIVSAQDTDGVIEAVELDPATEPDKWVVAVQWHPEERLDDLRLFAGVV
EAAAAYRRGRVNA
375142732YP_005003381.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTTSDVINPATEELLRTVEQTDLAGVDDAVARAKVAQRDWARRAPAERAA
TLRDFAAVVDAHVDELAALEVANSGHPIGNAQWEAGHVRDVLQFYSASPE
RLSGKQIPVAGGLDVTFNEPLGVVGVITPWNFPMTIASWGFAPALAAGNA
VLVKPAEWTPLTTIRLGELAVEAGVPADLFAVLPGKGSVVGERFVTHPDV
RKIVFTGSTEVGTRVMAGAATQVKRVTLELGGKSANIVFDDCDLEKAAAT
APYSVFDNAGQDCCARSRILVQRTVYDRFMELLEPAVKGVVVGDPTDKAT
EMGPLVSKAHWETVAAYVPDDAPVAFRGDAPSGPGFWFPATVLTPPRTDR
TVTDEIFGPVVTVLPFDDEADAISLANDTPYGLSGSIWTDNMSRGLRVSR
AVESGNLSVNSHSSVRYNTPFGGFKQSGLGRELGPDAPLSFTETKNVFIA
IGDA
375142731YP_005003380.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MDLTQRLAGKVAVITGGASGIGLASAKRMAAEGATIVIGDIDPKTGKTVA
DDLNGTFVPVDVSDQVAVDALFDTAAQTHGSVDIAFNNAGISPPEDDLIE
DTGIDAWQRVQDINLKSVFFCCKAALRYMVPQQKGSIINTASFVAVMGSA
TSQISYTASKGGVLAMSRELGVQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPVGRFAEPEELAAAVAFLASDDASFITASTFLVDGGIS
GHYVTPL
375142730YP_005003379.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTADPDVPQASEALLRPVRPPNAFEDTVGRLLQTIRLGMLAPGESLPPER
ELATKLGVSRDTVREAIKSLADAGYLVSRRGRYGGTFLADELPSHTGDSD
DVTRAEIDDALRLREILEVGAARMAANRTLTAAEREVLWTRLTDVRGAEP
EDYRRLDSRLHLAIAEAAGSPSLVPLLAENRMRLNALLDQIPLLPRNIAH
SDEQHEAIVIAILAGDGEGAAAAMRAHVEGSATLLHGFLD
375142729YP_005003378.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVEAGGHAEVEAVVQRASSALADVDTAGWAQRFDLLSDPHRLEILLVLHR
APGINVGDLASVLGRSENAVSQALRVLRQQGWVSSTRVGRAVSYRLEDEI
VHDLLHWIGARHG
375142728YP_005003377.1 putative choline kinase involved in LPS biosynthesis [MycobacteriumMALTLSDDRLNELFEEFPVLAGRPRRLEELSGGLTNRNVKITTPDATYVA
RCTDTSSNLLGIDRDRECHNTRAAEQAGVGAPVIDYRPDLGIMLLGYLEG
KTLSNDDFQRPGVIAKAAGAIRTLHSGPRFVGRFDMFEQQPIYLKTARDK
GFRIPADYLDHADTFDEIARVLAATDQGTVPCNNDLLAGNFIEDGDRIWL
IDYEYSGNNDPCFELGNTWAECGLSTEQLEEFVTAYYGRRLRHKTARAQL
QGIVGKYGWTLWGCIQNGSSAIDFDFWGWAMERYEGAVAEFRGPNLARLL
DDAQAAD
375142727YP_005003376.1 glycine cleavage system T protein (aminomethyltransferase) [MycobacMTTELPQRAHTVIIGGGVIGTSVAYHLTKLGVSDVVLLEQGQLSSGTTWH
AAGLVGQLRASESATRLVQYSTQLYAELESEVGLSAGYKQCGGVTVARTE
DRMIQLRRTAANAEAFDMECELLSPRQALERYPVMRVDDLVGAIWLPGDG
KANPTDLTFALAKGARMRGARIVEKVRVTDILSDGGRVRGVRTDKGDVEA
EVVVNCAGQWAKQIGALAGVNVPLHSAEHFYVVSEAIDGVHTDLPILRDP
DGYTYFKEEVGGLVIGGFEPEAKPWVSPDKIPYPFEFQLLEEDWEHFEIL
MNSALLRIPALETTGIKKFYNGPESFTPDNQFILGEAPELANFFVGAGFN
SVGIATAGGAGRALAEWIVNGAPTSDMTGVDIRRFAPFNGNTRWLHDRVA
EVLGLHYEIPWPNREMATARPFRRSPVHHLLQAANANFGSRMGWERANFF
APPDTDPTIEYTWGKPNWLAWSAAEQTATRTNVTVFDQTSFSKYMVVGRD
AESALQWLCTADVAVPVGRSVYTGMLNERGTYESDVTVTRTGPDEFLIVS
SAATTERDKDHIRKNLPSGVDASLVDVTSAYAVFGVMGPRSRDLLARLTT
ADLSDGAFGFGTSRLISLGYATVRATRITYVGELGWELYVPAEFAVGVYE
DLMSAGAEFGVRRGGYYAIESLRLEKGYRAFGRELTPSENPVEAGLLFAC
KLKTDIAFLGREAVEKAKAEGQRRKLVGFAVESPEAMLWGGELVLRDGAV
AGQVTSAAWGETTGSCVGLAYLRATDNAIVSADWVRAGRYEVNVGGRLYP
ISVSLRPLYDAANTRIRP
375142726YP_005003375.1 putative ATPase [Mycobacterium rhodesiae NBB3]MTVEFRLLGDVEARLDGQRVDIGHARQRCVLAAMLVDVNRPIPADQLIDR
VWAADTPHRARNTLAAYLSRLRPLLANASVQIVREPGGYTLSADALSVDL
HRFRDIVARARAATDPARAATLFDEALALWRGTPFAALDTPWFNDMRDSL
EVERFSVAMDRNEAALRAGRHAELLGELTAAVQSHPLDERLAGQLMLAQY
RSGRQAQALDTYRKTRDRLVDELGVDPSPVLQAVHRQILDGEAAPPPPVH
VATRPLAGLPRRATTFVGREPDLARIGAALADSPLVTLTGVGGVGKTRLA
LEAAEREHARFADGVSICELAPIDDGSAVTHAVAAALRLQQQQGLGIEDT
VIEYLRARELLLVVDNCEHVLDDAALLLERIAGHCPGITVLATSREALGV
AGERIVPVEPLPVGDATVLFADRAKATRSDFDLDSEPVGAVAEICRRLDG
LPLAIELAAARMRAMSSLDVARRLDRLRLLSGGARGTHPRHQSLSATIDW
SYHLLSEPEQALFTRLSVFAGGFDIEAAHGVCGDECTHEDDTLEVLTGLI
DKSMVTARGGTQISRYSVLETLRAYGRDRLRENTVDDEYAMRHAEYFTAL
AERAASGTQGGDEQAWVQRMLPDYDNLRVAFEHLMADSDVDTALRLVTSL
PEFIHLRIGYESSGWAERVVELADTSHPLYVAAVGFAARGAWNRGDFVAA
EALASLARGRTPGRGAGRVAYPGDVLADVALYRGDAAQALAHYDGEVARA
RHDDDPIRLVWTLFYVSICHAAMREPLDGMGAAEESLRVAEETANPTARS
MGRYALGLVLKKSDPDRALALFDDAAELAASVQNFWWHGIALMEAAATRS
VHGDPVSAAYALIEVLDHWDRVGDWSQQWLNVRYVARFLARMGAHDDAAA
LHHALVAAGRLSPLAHDAVGDPPSDPLSPSDAVVRARTSLVRWTSKTA
375142725YP_005003374.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGHHTTLKRAIAAGLLSATFATPAAALLTAGTAAARPIESPNCRNIAKAI
DSSMHMANVARDQGDTKAAREHMRDAARASANFQRHSVT
375142724YP_005003373.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTSIVKSEFDRELKAKHRALWASGDYPAVAAELIPALGPELVRAAGIRPG
DRVLDIAAGSGNAAIPAAEAGAIVTASDLTPELFDAGRRIAAQRGVELEW
VEADAEALPFADNGFDVAMSCVGVMFAPHHQAAADELIRVVRPGGTIALI
NWTPEGFIGNLFKTMKPYAPPPPPGASPAPLWGSEDHVRELFSDRVTDLT
MQRRTVVLDHCEEPTEFREYWKRNYGPTIAAYKFNADAPTQVEALDNAFL
EFLTSTNRGDGGRARWEAEYLVVTAKKA
375142723YP_005003372.1 high-affinity nickel-transporter- HoxN/HupN/NixA family [MycobacterMSVATHSEGRAVTKFDRTDWTTIAAMSSVVLALHLFGWGVLVFGVAPQHI
TLGSAGVFGVGLGVTAYLLGVRHAFDADHIAVIDNTTRKLVGEGTRSLSA
GFWFSLGHSSVVFGLAFLLAIGVRAVVGPVQDEGSPMLQTLGLIGSLVAG
TFLILIGLSNLFAAVGIAKVYRRMRSGDFDEAELERLLQQRGFLARLFAR
VMRRVSKPWHLYPVGLLMGLGFDTATQVALLVLAAGTAAFTLPWYAILVL
PVLFAAGMSLFDAADGVFMSRAYGWAFLKPIRKVYYNLTVTVLSVVVALL
IGVIVLAGLVADRLGLESGPLAAVGSLDLEFVGFMIVGLFLAAWLIALAV
WRLGNVEDRWAPAVD
375142722YP_005003371.1 mycothione reductase [Mycobacterium rhodesiae NBB3]MTHFDIAIIGTGSGNSILDERYEDKRVAICEQSVFGGTCLNVGCIPTKMF
VYSAGVAQQVRESSQYGIDAHIDNIRFPDIVSRVFGRIDPIAAGGENYRR
SSPNVEVFGSHTRFAPTKADGRYAFRTDDGDEFTADQVVIAAGSRAVAPE
AVTACGVDYHTSDTIMRISDVPEHLVIIGGGFIACEFAHIFSALGSHVTL
LIRGSTLLRGHDDDIAMRFTDIASRKWEIRSHHELADAHNVGDGVEITCK
DGTKVRGDALLVATGRVPNGDLLDAENAGVKVNANGQVVVDEFQRTSARG
VFALGDVSSDYQLKHVANHEARRVKHNLLQDWDDTDALMPSDHRNVPSAV
FTDPQIANVGLTENEARAKGFKIRVKIQDFGDVAYGWAMEDTTGIAKIIV
DDDTGLILGAHIMGHQASSLIQPLIQAMNFDLPAQDMARGQYWIHPALPE
VIENALLALCGEPPWPPSKRH
375142721YP_005003370.1 lysophospholipase [Mycobacterium rhodesiae NBB3]MTEWEPDVLAGYRQQTIELGPDPDGEGHLVATLVRRGAVQPSATRAVLVV
HGFTDYFFHTELADHLASRGFAFYALDLHKCGRSWREGQTPHFTTDLTRY
DDELSRALDIINAECPADVLVYGHSAGGLIVSLYLDRLHSGGLTRRKRVT
GLVLNSPWLDLQGPSFLRTAPTGAAIAALSRMRKLSVVRSPTPGGYGTTL
HRDYAGEFDYDLKWKPIGGFPVTFGWIHAIRRGHARLHRGLDVGVPNLIL
RSDHSVREVNDPDTIQRGDAVLDVKQIARWAGCIGNRTAVVPITDAKHDV
FLSVADVREVAYDELDRWLTDYTADGAEPPSQTTETIAQQHNPHKG
375142720YP_005003369.1 putative acyltransferase [Mycobacterium rhodesiae NBB3]MTVALRRSWAKDLDAATLYELLKLRVEVFVVEQATPYPELDGRDLLTETR
HFWLEGADGEVICTLRLMEEHPGGQKGFRIGRVCTKREARGQGHTTRLLQ
AALAEVGDHPCRINAQTYLEEMYARHGFVRDGAEFLDDGVPHVPMVKS
375142719YP_005003368.1 Mg-chelatase subunit ChlI [Mycobacterium rhodesiae NBB3]MTTYPFNAIVGHDRLRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAE
VLAAVDGAALVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGG
VLYVDEVNLLHDHLVDVLLDAAAMGRVHVERDGVSHSHDARFVLVGTMNP
EEGELRPQLLDRFGLTVDVHASRDVDVRVEVVRQRMAFEADPAGFAQRYA
AADAELVDRIAAARQKVAAVTLPDSELRRIAALCAAFDVDGMRADLVVAR
TAVAHAAWRGDDTVTEDDVRVAAELALPHRRRRDPFDDPGLDPDQLDQAM
QQAGESADPDPEPDPPGGGESASDQTSEPAAPQRNSSSATRPSAPPSAVF
RTRALVVPGVGDGAPGRRSRARNRTGTVVSSTTHAAEGHGVHVFGTLLAA
AGHQQAPGRPRPVLEDVRHAVREGREGNLVIFVVDASGSMAARDRMSAVS
GAALSLLRDAYQRRDKVAVITFRQSGARLLLPPTSSVHIASRRLARFDTG
GKTPLAQGLLAARDVVVREKARDRARRSLVVVLTDGRATGGPDPLGRTRE
AAARLMAEGAAAVVVDCETSYVRLGLAEQLARQLGAPAVRLAQLRADSLT
DVVRTAA
375142718YP_005003367.1 cob(I)alamin adenosyltransferase [Mycobacterium rhodesiae NBB3]MPQGQPATVPDDGLTTRARRNAPLLAVHTGAGKGKSTAAFGMALRAWNQG
FSVAVFQFVKSAKWKVGEEAAFGQLGRLHDEHGVGGPVEWHKMGAGWSWS
RKHGDEDDHAAAAADGWAEISRRLAHERHDFYVLDEFTYPLKWGWVDVDE
VVAVLTGRPGTQHVVITGRDAPQKLLDAADLVTEMTKVKHPMDAGRKGQK
GIEW
375142717YP_005003366.1 cobyrinic acid a-c-diamide synthase [Mycobacterium rhodesiae NBB3]MTASTPAVVIAAPSSGSGKTTVATGLMGALRRAGTTVAPFKVGPDYIDPG
YHALAARRVGRNLDPVLVGESLIGPLYRHGSAAADIAVVEGVMGLFDGRI
ADGFTGTAQGSTAQVAAILGVPVVLVVDGRGQSHSVAALLHGFSTFDTRI
RIAGVILNRVGSPRHEEVLRQACEHAGVTVFGAIPRVDELSVPSRHLGLI
TAAEHGAQAGAAVDAMIGQVSRHVDLAGIAGIAASRVDGEPWNPAPAQPV
AGHVVVALAAGRAFTFGYAEHRELLCATGAEVVEFDPLIDPLPPRAAALV
LPGGFPEQFSTELSGNDVVRQQINALAASGAPVHAECAGLTYLVDDLDGH
PMCGVLPGSAHFTDRLTLGYRTAVAVTESPLYALGERAVGHEFHRTAVNL
REGCSPAWAYNGRGVDAVRDGVVAGGVHASYLHTHPAAHPQAIARFVSAA
ESRFYSSPRNL
375142716YP_005003365.1 uroporphyrin-III C-methyltransferase [Mycobacterium rhodesiae NBB3]MSDNAYLVGLRLAGRKVVVVGGGSVAQRRLPLLVANGADVHVITRSATPA
VEALAGITLELREFREGDLEGAWYAIAATDDPAVNAAVVAEAERRLIFCV
RADVAREGTAVTPASFEYEGLSVGVLAGGDHRRSAAIRSAIHEALQQGLI
AAETPGVLPGGVALVGGGPGDPELITVRGRRLLAHADVVVADRLAPPELL
AELAPHVEVIDAAKIPYGRAMAQDAINEVLIDRAKAGKFVVRLKGGDPFV
FARGYEEVIACADAGIPVTVVPGVTSAIAVPALAGVPVTHRAVTHEFVVV
SGHVAPDHPESLVNWDALASMSGTIVLLMAVERIEQFASVLLAGGRPADT
PVLVVQHGTTAAQRTLRATLADAPERIREDGVRPPAIIVIGSVAAFGG
375142715YP_005003364.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMTALNDAERAAMYRDAEGGAKRSLSSRLGNPVKERTGSYPAWLPSRRFIA
AVIAIGGMQLLATMDSTVAIVALPKIQDELSLSDAGRSWVITAYVLTFGG
LMLLGGRLGDVIGRKRTFIVGVALFTIASVLCGLAWNEATLVTARLLQGV
GAAIASPTALALIATTFPKGPARNAATAIFAAMTGVGSVMGLIVGGALTE
VSWRWAFLINIPIGLLMIHLARRTLRETHRERLKLDAAGAILATLGCTAA
VFAFSMGPEQGWISPVTIGSGLAAGAFLLAFLYVERTADNPVMPLDLFRD
RNRVATFAAVFLAGGVMFTLTVLIGLYVQDIMGYSALRAGIGFIPFVIAL
GIGLGVSSALVSRFPPRVLVIAGGVLVLAAMLYGSTLNGGIPYFPNLVIP
ITVGGFGIGMIVVPLTVSAIAGVGFDQIGPVSAIALMLQNLGGPVVLAVI
QAVITSRTLYLGGTNGPVKDMNAAQLHALDQGYTYGLLWVAAVAVIVGAV
SLFIGYTAAQVAHAQEVKDAIDQGEL
375142714YP_005003363.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMSAVGGTSGSDRATTPLSSSVLGMAIIAITGMQLMSTLDGTIVIVALPRM
QADLDLSDAAKSWVITSYVLAFGGLLLLGGRIGDAIGHKRAFLSGVGVFT
IASLVCGLATEGVTLIIARAVQGTGAAIAAPTGLALIATTYAVGQARNRA
MAVSAAMQGIGSVLGLVLGGALTVVSWRLAFLINIPIGIAIIAVAVLKVN
ETHHERLKLDVTGAILATLGCTSAVLVFTQGPPRGWVDPWVFGAGIASAI
FFIAFLIVERTADHPIVPFSVFDNRNRVMTFMSLFLAGGVMLTLTVMIGL
LVQDVLGYSALKAGIAFVPFAIAFGIGSIVAAKLAPHVAPRWLLIGSGCF
VVGAMLFGSTLTRDIPYFPDLFGPIVVGGFGIGAIAVILPLCAVAEVGPR
EIGPVSSITLMVQNLGGPVVLVVIQAVQTSRTLYLGGTMGPVKNMTPAQL
DALGYGYTYSLLWVAGIAVIVGVTAFWIGFSARQIAAAQHTREAVEAGEL
375142713YP_005003362.1 prolyl-tRNA synthetase- family II [Mycobacterium rhodesiae NBB3]MITRMSELFLRTLRDDPADAEVPSHRLLIRAGYVRPVGPGLYSWLPLGLR
VLRKIEHIVRSEMNAIGGQEILFPALLPRAPYETSNRWTEYGDGVFRLQD
RRGNDYMLGPTHEEFFTLTVKGEYSSYKDFPLRLYQIQTKYRDEARPRAG
ILRGREFIMKDSYSFDVDDDGLKKAYHAHREAYQRIFEKLEVSYVIVAAT
SGAMGGSASEEFLAESDIGEDTYVRCPASGYAANVEAVITAVPESIPFDG
LPEAQVYDTGDTPTIATLVEWANGADLGREIVAADTLKNVLLKVREPGGE
WELLAVGVPGDREVDDKRLGAALEPAEYAMLDDADFGRYPFLKRGYIGPK
GLLANGVRYLVDPRIVDGTSWITGADEKGKHVVNLVAGRDFTPDGTIEAA
EVREGDPSPDGRGPLVAARGIEIGHVFQLGRKYADAFEADVLGENGKPVR
LTMGSYGIGVSRLVAVIAEQHHDDLGLRWPASVSPFDVHVVIANKDDAAR
AGATELAGELDRQGFEVLLDDRKASPGIKFKDAELLGVPSIVVVGRGWAD
GVVELRNRFSGETQEVPVANAATDIATALRA
375142712YP_005003361.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSPNPGPQPSPTTTTSSRAAEPTSPARPSDGSDGAMFDAIATTQASIYG
YGIVSAHSSPEMNSLVSSSMAEHRKRREEALAMLQARSVQAPLPAAGYQL
PFEVDNPTDAAKLAVRMEEDSAVAWRAVIEQANNEQDRTFAVSALTECAV
TAARWSRVLGAKPITVAFPGGSE
375142711YP_005003360.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLHVPSLNPTVSRRRVLVGAAALALLSAPVVACGSSPPPPEVDELVAQLE
RARSDSQLASDAAAAARGEIAEALSAVASERSAHAQALSDELVRIQRTTA
STTSPSEPTSTTAEAAKAPTVGDVIGALKMSAQSAAGLAATSSGYRAGLL
GSIAAACTAAYTVALVPPEKPQ
375142710YP_005003359.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTERSTGLPSQRQVVELLDDEFARAGYEIEDVVIDAAARPARITVVADGD
QGLDLDAAATLSRSASELLDSVDDNATPYVLEVTSPGVDRPLTDEKHFRR
ARGRKVDMVLSDGTQLTGRIGETSGGAVRLVVRDGRDLAVREISLDTITK
AVVQVEFSPPNQRELELAGQTGKEAPQ
375142709YP_005003358.1 transcription termination factor NusA [Mycobacterium rhodesiae NBB3MNIDMAALHAIEADKGISVDVVVETIKSALLTAYRHTEGHEADARIEIDR
KTGVVQVLARETDEDGNVISEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVGGVIQRDARANARGLVVVRMGSETKGSEGVIPAAE
QVPGERYEHGDRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
AEGSVEIAAVAREAGHRSKIAVTSRVPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDFDPDPAKFVANALSPAKVVSVSVIDEAARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDAEAVPTA
375142708YP_005003357.1 putative nucleic-acid-binding protein implicated in transcription tMIQRETSAPPHKRPEGPVRTCVGCRKRGLAVELLRVVAVDGGNGACAVTV
DTARKLPGRGAWLHPDPQCLDAAIRRQAFVRALRITGSPDTTAVVEHVGA
AHSAQAPPRPRNRTGSEEHEHTVKSR
375142707YP_005003356.1 translation initiation factor IF-2 [Mycobacterium rhodesiae NBB3]MAGKARVHELAKELGVTSKEVLARLSDQGEFVKSASSTVEAPVARRLRES
FGGAKPAADTVKAGGNGSAAAAPATPAAKTSAKPAAPKPAPPPEPTAPAP
PPAAAAAPPAPPAAPPAQPGPTPGPRPGPAPGGAPKPAARAPRVGNNPFS
SQQPVDRPIPRPQAPRPGAPRPGAPRPGMSPGNMPPRPAGPRPGVPAGGG
RPGGPRPGPGGRGPGGGGGRPGGPGGGGGGGNYRGGGTGGGGAGGGAPAG
GGYRGRPGGGGRPGQRGGAAGAFGRPGGAPKRGRKSKRAKRAEYENMQAP
VVGGVRLPHGNGETIRLARGASLSDFAEKIDANPASLVQALFNLGEMVTA
TQSVGDETLELLGGEMNYVVQVVSPEDEDRELLESFDLTYGEDEGSEDDL
EVRPPVVTVMGHVDHGKTRLLDTIRNATVREGEAGGITQHIGAYQVEVDL
DGTPRPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAL
NHAQAAEVPIVVAVNKIDKEGADPSKIRGQLTEYGLIPEEYGGDTMFVDI
SAKAGTNIESLLEAVVLTADASLDLRANPDMEAQGVAIEAHLDRGRGPVA
TVLITRGTLRVGDSVVAGDAYGRVRRMVDEHGEDVEEALPSRPVQVIGFT
SVPGAGDNFLVVDEDRIARQIADRRSARKRNAMAARARKRISLEDLDSAL
KETSQLNLILKGDNAGTVEALEEALLGIQIDDEVELRVIDRGVGGVTETN
VNLASASDAIIIGFNVRAEGKATELANREGVEIRYYSVIYQAIDEIESAL
KGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVTSGVIRRNAKARLLR
DNVVVAQTVTISSLRREKDDVTEVRDGYECGLTLTYSDIKEGDVIEAYEL
VEKERT
375142706YP_005003355.1 ribosome-binding factor A [Mycobacterium rhodesiae NBB3]MPDPARARRLAKRISEIVATAIEYEIKDPRLAGVTITDAKVTNDLHDATL
YYTVLGSSLDEEPDYAGAEAGLSKATGVLRSRVGAALGVRFTPTLAFARD
TVPDAANRMEELLARARAADEDLARVREGARHAGDADPYRVDGVQEIGGD
RDDEFDAEDTGDRDRQSD
375142705YP_005003354.1 exopolyphosphatase-like protein [Mycobacterium rhodesiae NBB3]MTAIDKATDVPLEGTAGERVDARTAADLLSAAGTVSVVCHVYPDADTLGA
GLALALVLDNAGKSVQVSFAAPAELPESLQSLPGAHLLVAPDAMRRDTDL
VVTVDIPSVNRLGALRELADPEREVLVIDHHASNLLFGSANFVDPSADST
TMLVADLLDAWGKPIDLGVAHCLYAGLTTDTGSFRWASARAHRLAARLVE
LGVDNASISRTLLDTHPFAWLPMLSRVLGSAQLLPDAAGGRGLVYAVVGH
DEWATARPEEVESIVDIVRTTQQAEVAAVFKEIEPGHWSVSMRAKSYDLA
TLASTFGGGGHRLAAGYSATGSADEVVAALRQALH
375142704YP_005003353.1 putative efflux protein- MATE family [Mycobacterium rhodesiae NBB3]MAEPVDGSEVPVATGRRIAKLALPALGVLAAEPIYLLFDIAIVGRLGALP
LAGLAIGGLILATLSSQMTFLSYGTTARSARFFGAGNRPAAVGEGMQATW
LALGLGTLIVAVVQLAGVPLVSALAGSGEIADEALPWVRIATVGVPAILV
SAAGNGWMRGVQDTMRPLRYVVTGFALSAVLCPLLVYGWLGMPRLELEGS
AVANLVGQWLAALLFLRALLVERVSWRIDPAILRAQVVLGRDLLLRTLAF
QACFVSAGAVAARFGVAAVAAHQVVLQLWNFLALVLDSLAIAAQSLVGAA
LGAGRLAHAKSVAWRVTIFSTLASAVLAGVFAAGASVFPSVFTDDRSVLD
AIGVPWWFMVAQLPVAGIVFALDGVLLGAGDAKFMRTATLISALVGFLPL
IWLSLAFGWGLLGIWAGLSSFMVLRLAFVGWRAFSGRWLVSGTG
375142703YP_005003352.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKPLAYGLVMATASLVAAPQAVAQPSVGTAVYVQIRQSFTPVDGDDQCVG
TAALGPVRRGSSVVLSEGATATDSPKVAVGQFFRSRLRDGVCEALYITSA
PVMPTFNVQFAGPGGEVSPTFGPTPSEPVTYQPGIEQVVRVDI
375142702YP_005003351.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMTNPNDTAVLLIDTRDRVRTLTLNRPQARNALSAELRAKFFAALADAESA
DDVDVVIFTGTDPVFCAGLDLKELGDSTELPDISPKWPAMTKPVIGAING
AAVTGGLELALYCDILIASENARFADTHARVGLLPTWGLSVRLPQKVGVG
LARRMSMTGDYLSAVDALRAGLVTEVVPHDELIPTARRVAASIVGNNPKA
VRALLASYHRIDEEGTARGLAIEAESALEWMRSASGDDIAASRAAVFERG
RAQVR
375142701YP_005003350.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MCRNITELRGLEPAATAEEIEAASRQYVRKVSGITRPSGANVEAFEEAVA
EVTAITTRLLDGLAPRRQPPKTVPPLRRPEVRARIEARAAGTG
375142700YP_005003349.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAALKEWSAVVHALLDGRQTVLLRKGGIHEKRFALTASVVSRFTAPRFL
FFPTVAHSHAERVRPEHADLLHAAADDSTDDEVILRAGAKVVAAVEVGRP
ENLHEIESLHIWTAESVQVDRLDFRPKRRLTVLVVQASPLHEPVRLTRTP
DYAGCKSWVPLPVDPEWASPVYADDALAEIAARVRRSVA
375142699YP_005003348.1 putative hydrolase- CocE/NonD family [Mycobacterium rhodesiae NBB3]MTAVSDAATALPAKGKIKAFTGRTLSRLLHLPPQTSDHTVHHRVRVPMRD
GVELLADHYEPTTATPVGTLLVRCPYGRGFPFSTLFGSVYATRGYHVVFQ
SVRGTFGSGGDFDPMVNEIADGADTVEWLRHQPWFTGSFATIGLSYLGFT
QWALLADPPPEMKAAVITVGPHDVSGPRWGPGSFGLHDFLGWSALVARQE
DRNRLRLLIRQARSRRALARATTGLPAGQAGRKLLGDGATWWEDWLSHPE
PDDPFWANTNIRDALKRTDIPVLLIGGWQDLFLEQTLAQYSALKERGVDV
ATTVGSWTHTQVMSKGAPTVIRETLDWLDAHLGGRGTTRRPVRIEMKGEG
WIDLSDWPPTMPERVLYLQPTGRLGDTAPPDTAAPMRFTYNPVDPTPTIG
GRLLSPEAGYRRDTKLAERPDVLCFTGDRLPTDLYVVGTPFIELSHSCDN
PYHDLFVRISEVDAKDVSRNVSDGYRRSPTVSKGAGTIRIDLDSVAHRFR
AGSRIRVLVAGGSHPRFARNLGTSEPLLSGRELMVSTHTIHLGEGGVSRL
VLPAGSQPPSGH
375142698YP_005003347.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSGSSIAPRRTYDNRARQEKAAQTRERIVTAGSELVHEFDSWNWRDLTFK
AVAERAGVGERTVYRHFPTERHLHDAVMQQLESEAGVSYEDVDLTNIGDV
TAKVFASLQRFSVRTSVETPQDPTFVGVDVRRRDALLRAVSTSAPEWSAA
EKHATAALLDVLWNVPSYERLVGEWGIDAADATRAIGWLMSKVVGAIEDD
DPPPA
375142697YP_005003346.1 sulfotransferase family protein [Mycobacterium rhodesiae NBB3]MPSPDELMTAAVERTGLADFGDDSFREGLEILVRALDEEARLNARGEAFI
YDRLRLHLCQRLQVEDWYRRHPEIDDETIEAPLFGLGLPRTGSTALSFLL
SRDPGVRYLRSWESTRPCPPPSTVQGDDPRIPPEERPVVVGTRHHVPNDI
QGPMECLDLMALDFTSQMFQAFAQIPSYSDWLLDRADFTSTYRYERRVLK
LLQWGEPARPWRLKSPAHVISLGYLDRVFPDARFVMTHRDPTDVMLSVAD
VYADIAGGFSDHVDRRYLGELNVKQWSTGMHRTMEFRTNGAEDRFYDIDF
RAMQDDPIGEVRRLYAWLGEPVTGEFEDAMRRWWADNAQKREPHPKANPQ
VFGLDLDTIRPLFATYVDTYIGDSHGN
375142696YP_005003345.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAIDLTGGIDIQRELPFARRPDNPEMRDSVSFWTFDESGTVGLPRVGIEA
VASNWEQHNVQVNVAFGDGRVYRLREDGASRPVEAADGRPTVLGAGPLAF
TCVEPFDVWTMTFDGRAVATSSADLVAGRKDGPLVDLRFEVEAKMAVPPW
VQGALQPEAGNQLKTSIVGDLMGGPRYEQLYRATGRVQVAGEEHSFTGSG
LRIRRQGVRKLDGFWGHCWQSALFGSGRGFGYIAYPQRPDGEPAFNEGYL
YLGDSAGDGDLIPATVVEAPWLSRLQPLGEDVSVVLQTAKGTERIEGETV
VSTHDITDPSDVPPDMAKLLANWTFPALQQAGVRYRWNGEETIGMLERSI
PKDQITR
375142695YP_005003344.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVAKLRVLAALCALVAAVVVVSQSHPGGPLQVRATDIPMTNVTTSIKYPV
IETTDPDPFNPCRDIPLDAVAAMGLAFTPPQPEEALRCKYDAGNYQMAIE
AFVWKTYEEALPTDAIELDIDGHRAAQWWVMKPTDWNNRWWITCAIGLKT
SYGLIQQTMFFSPIYSNPPPDCMQTNLQRAHDLIPYYKFQGDSSE
375142694YP_005003343.1 putative phosphohydrolase [Mycobacterium rhodesiae NBB3]MTRDGRQPTLWAISDLHTGHTGNKPITESLYPATPDDWLIVAGDVGERTD
EIHWALDLLRKRFAKVIWVPGNHELWTTNRDPMQIFGKARYDYLVNICDE
MGVITPEHPFPVWTEGGGPATIVPMFLLYDYTFLPEGAATKAEGLAIARE
RNVVGTDEFLLSCEPYATRDAWCRDRVAHTRKRLEDLDWMEPTVLVNHFP
LVREPCDAMFYPEFALWCGTTATADWHTRYNAVCSVYGHLHIPRTTWYDG
VRHEEVSVGYPREWRRRKPYRWLRQVLPDPRYAPGYLNEFGGHFEITDEM
REHAQKVQQRIRARQS
375142693YP_005003342.1 phosphopantetheinyl transferase component of siderophore synthetaseMTVIAALLSGVLPDDARRLAAAEMYTDPTELAPLPEEEPLIAKSVAKRRN
EFITVRYCAREALGELGIAPVPILKGEKGEPCWPDGIVGSLTHCEGFRGA
AVARHDEVRSVGIDAEPHDVLPKGVLEAVSLPGERVELAALPAGLHWDRI
LFCAKEATYKAWFPVTRRWLGFEDAHITFDVDGSGTAGGFQSRILIDPSA
PTGPPLQTLSGRWSVRDGLALTAIVL
375142692YP_005003341.1 tRNA pseudouridine 55 synthase [Mycobacterium rhodesiae NBB3]MTSGGQERSDRGIDTAGLVVVDKPAGMTSHDVVGRCRRIFGTRKVGHAGT
LDPMATGVLVVGIERATKILGLLTATDKSYAATIRLGQTTSTEDAEGEVL
DTVSAAGVDQTQIESAAAALRGEIDQIPSTVSAIKVGGQRAYKLAREGQS
VELAPRTVRIERFDVRSVRREGDFVDVDVVVDCSSGTYIRALARDVGAAL
GVGGHLTALRRTRVGSFGLDQAATLDELTERPRLSYSLDEACLRTFPRRD
LSDDEAEHTRHGRPLAPAGIGGVYAATTGEGHVIALLRDDAGRTRSVVVL
RPATL
375142691YP_005003340.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MTRSVPVIGRSASSRASGAGFSALLGFAVSNPSLLVRLRPSLDAAIARMS
PVVPGTEVVPARLPLGGEWVRGPGVPVPVRGEGPVILVLHGSGYVACSAR
THRGFASHLSAHSGILALTVNYRLAPESPFPAAEDDSFAAYRWLLDRGYD
PAKVVIAGDSAGGHLAVAVALRAKREGVPGPAALSLFGPLIDPAFRASSA
DPRSRKQPLHPKLAARALAIYVGGHDVDDPRLCLLNADLSELPPIDLHYG
SRELMRADAEAFAAKVIAAGGRCDTRMWPGLMHGYWLRPLDERRGLTSLM
TAGQFLGATVA
375142690YP_005003339.1 Mn-dependent transcriptional regulator [Mycobacterium rhodesiae NBBMSPNGNPRDLTMVAQDYLKVIWTAQEWSREKVSTKMLAERIGVSASTASE
SIRKLADQGFVDHEKYGAVTLTDAGRAAALAMVRRHRLMETFLVRELGYS
WDEVHDEAEVLEHAVSDTMLARIDAKLGHPTRDPHGDPIPAADGHVPTPD
ARQLSVCRDGDTGVVARISDADPEMLRYFDSVGITLDSRLLVLARRDFAG
MISVAVKSAHSGEHEKGTTVELGSPAAEAIWVVG
375142689YP_005003338.1 riboflavin kinase/FMN adenylyltransferase [Mycobacterium rhodesiae MQRWRGQDEIPTDWGRCVVTIGVFDGVHRGHQELINHAVKAGRSRGVPTV
LMTFDPHPMEVVFPGSHPAQLTTLTRRAELVEEMGIDVFLVMPFTSDFMK
LTPERYVHELLVERLHVVEVVVGENFTFGKKAAGNVGLLRKAGERFGFAV
EGMSLVSEAATNGDETVTFSSTYIRSCVDAGDMVAATEALGRPHRVEGVV
VRGDGRGKVLGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPIAGAVVPG
ERYQAAVSVGTNPTFSGRTRTVEAFVLDASADLYGQHVAVDFVARIRGQE
KFGKVEDLVTAMGVDTEKARGILAAQ
375142688YP_005003337.1 30S ribosomal protein S15 [Mycobacterium rhodesiae NBB3]MALTAEQKKTILGEYGLHDTDTGSPEAQVALLTKRIADLTEHLKKHKHDH
HSRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR
375142687YP_005003336.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MANLPAVAVTAVVAIGGVAGCSSSSAANLAVGDCLKTGGTPERPEVTKVA
CGSPESNFKVAATVENSEQCPADVDSYYSMRTAFSDTSTTICMDIAWVVG
NCMSVDPTNDKDPLQVACDDSSVPNRQRATQILDDVANVDQCASGVGYAY
DERGFTVCVEDVA
375142686YP_005003335.1 polyribonucleotide nucleotidyltransferase [Mycobacterium rhodesiae MSVVELEEGVFESTATIDNGSFGTRTIRFETGRLAKQAAGAVVAYLDDET
MLLSATTASKSPKDHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPTFVSGLRNEIQVVVTILSLDPKDLYDVLAINAASAST
QISGLPFSGPVGGVRVALIDGQWVAFPTVEQLEGAVFDMVVAGRKAGDSA
GADIAIMMVEAEATDKVIELIGGGAGAPTESVVAEGLEAAKPFIAALCNA
QQELAEKAAKPTADYPLFPDYQDDVFESVSAVATDELSKALTIAGKEERN
DRTDEIKVEVLDRLAEQYAGREKEIGAAFRSLTKQLVRQRILTDHFRIDG
RGVTDIRALSAEVAVVPRAHGSALFERGETQIMGVTTLDMVKMAQQIDSL
GPETSKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALMPVLPSV
EEFPYAIRQVSEALSSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGL
VSDDVDGERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDTKLDGI
PSQVLAAALAQAKDARLTILEVMAEAIDTPDEMSPYAPRITTIKVPVDKI
GEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAIDKINAI
ANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGKRIAKV
EDVVKVGDKLRVEIADIDNRGKISLVLVAEDEAADAPSETAPADAAAATS
375142685YP_005003334.1 putative Zn-dependent peptidase [Mycobacterium rhodesiae NBB3]MPQRRPARALRRGANTAESSTRDISTVRRTVLPGGLRVVTEYIPSVHSAS
VGVWVDVGSRDEGPTVAGAAHFLEHLLFKSTPTRTAVEIAQAVDAVGGEL
NAFTTREHTCYYAHVLDTDLELAVDLVADVVLRGRCAADDVEIERDVVLE
EIAMRDDDPEDTLGDVFLSAMFGSHPVGRPVIGSSESIAAMTRTQLHSFH
MRRYTPERMVVAVAGNVDHDDVMALVREHFGARLVRGRKPVPPRKGKGRV
TGRPTFELVNRDAEQTHLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRL
FQQIRETRGLAYSVYSTVDTFADSGALSIYAACLPERFGEVTRVTSDVLE
AVARDGITETEYRIAKGSMRGGLVLGLEDSGSRMNRIGRSELNFGTHRSI
ADTLAKIEAVTLDEVNTVARKLLTGPYGGAVLGPQTSKRALPQPLRAMTH
375142684YP_005003333.1 beta-lactamase class A [Mycobacterium rhodesiae NBB3]MTELSRRHVLLGGLTLAAVAATSEKPALADPAEPPSLSVEALIQGLEQKH
NASIGVFATNLASGKTVAHRAQEPFAMCSTFKAYASGRILQMAQHGELSL
DDPMFVDPAGILPNSPVTAPRAGGEMTLAELCQAVLQQSDNAGANILLNR
IGGPQAITAFARSIGDHQTRLDRWETELNSAIPGDLRDTSTPEALGAGFR
ALLDGDVLAPPQRGLLDDWMRANQTSSMRPGLPAGWTSADKTGSGDYGST
NDVGIAYGPEGQRVLLAIMTRTQANDPKAENLRPLIGEVTTLVMPTLLA
375142683YP_005003332.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTMPATALCPCGSDEPYGRCCLPLHLGERQADTAEQLMRARFSAYAAGNL
DYVWQTWHPTTRPSELADTGLTWTGLEIIETVDGRRGDESGEVEFRAHYL
QDRRSGYLHERSRFAVRARRWFYVDGEMFR
375142682YP_005003331.1 alanine dehydrogenase [Mycobacterium rhodesiae NBB3]MRVGVPTEIKNNEFRVAITPAGVAELVHRGHEVLIQAGAGEGSAISDNDF
KRAGAQMINSVDEVWEEAELLLKVKEPIEAEYSRLREGQTLFTYLHLAAS
KPCTDALLASGTTSIAYETVQLADGSLPLLAPMSEVAGRLAAQVGAYHLM
RSHGGRGVLMGGVPGVAPAEVVVVGGGVAGYNAARIAKGMGAHVSVFDVN
INTLRKIDNENSGAIETRYSSMLDLEDAVKEADLVIGAVLVPGAKAPKLV
TNSTVAHMKSGAVLVDIAIDQGGCFEDSRPTTHDDPTFAVHDTVFYCVAN
MPGAVPRTSTYALTNATMPYVLKLADKGWQAACEADPALAKGLSTHEGSL
LSEQVATDLDLSFTDPATLLA
375142681YP_005003330.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSEETSLPSARLQRSPKDFRAIDLDEVDRRILLTLHADARISNSALADSV
GIAASTCHARLKRLQDLGVIRGFYTDIDPAAIGLHLQAMISVSLQSNARG
KIHSFINQIRRKPQVMDVYFLAGAEDFILHVAARDTDDLRSFVVENLNAD
ADVAGTQTSLIFEHLRGASPL
375142680YP_005003329.1 dihydrodipicolinate reductase [Mycobacterium rhodesiae NBB3]MRVAVLGAKGKVGATMVAAVEDAEDLTFTVGVDAGDALSELVDSRTEVVI
DFTHPDVVMENLRFLIDNGIHAVVGTTGFTDERVSEVREWLAAKPDVSVL
IAPNFAIGAVLSMHFAQQAARFFESVEVIELHHPQKADAPSGTAARTARL
IAEARKGLPPNPDATSTGLQGARGADVDGIPVHSVRLTGLVAHQEVLFGT
MGETLTIRHDSFDRTSFVPGVLLAVRKVAEHPGLTVGIEPLLDL
375142679YP_005003328.1 tetratricopeptide repeat protein [Mycobacterium rhodesiae NBB3]MSERSRALRIQLLIGFMCAALVVYFVLLGRIALAFISSGEPAAIGLGLAL
MIMPLIGVWVMVSTLRAGLAHQRLGRMAKAEGLELDVSALPRMASGRIER
DAADALFATVRGELEDDPDNWRRWYRLARAYDYAGDRSRAREAMKKAVEM
EERS
375142678YP_005003327.1 NADPH-dependent FMN reductase [Mycobacterium rhodesiae NBB3]MTAPPRKTLLIVHHTPSPHTHEMFEAVVSGASDPEIEGVQVVRRPALTVS
ATDVLEADGYVLGSPANLGYMSGALKHAFDVIYYPCLDATRGRPFGLYLH
GNEGTEGAENGVTAITTGLGWTKAAEYVVVSGKPNKADLESCWELGATVA
ATLMG
375142677YP_005003326.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MVAATNFALLHGGGQGSWVWDDVIGELSASGDCITLDVPGCGRKRERDTS
AIEFDDIVAELISDIETSGMRDVVLVGHSQAGMPMSQMVEVAPELFSRLV
YVTCSAPPPGTSLLELIGNCRHGEHEDQVGYPLDPKTTSFEERFAVMFCN
DMSAPEREAFLAKLGRDMWPASSYMYLDWRYDHLGTVASTYVVCERDMSL
PTLWQKRFAETLRVDRVVRIDAGHQVMNTQPEALAAILLAEAQSTEEDHA
CRV
375142676YP_005003325.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPGIAELALGAAPIAGGALLGAAAGSFKGPDVRGMIAKDMDLLERIPDDK
PELKARLEASINERISDLIAGTERSRAIREAAASYSGNWRDIVVFICAVL
FTIVWWNVSHSRSNWLVMFIAMIILSVLAGIYAGRGIIRAIGSFMHRSDK
KSQ
375142675YP_005003324.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAAGVVIRPKDRVEMLFDELAELAGQRNAIDGRIVEIVAEFDHDELVGI
TGARSVAALVAWKLGMSSANAGTIAAVAHRLPEFPRCAAGMTEGRLSLDQ
VGVIAKKAADGSDDHYATFAEVATVSQLNTAVKLEPRPTPDPAPWSVPQR
SITKTSDEQCVRYRMTLTHDDAATFDAALASHQDALVAEWKRDHDDDSAQ
APPFPTAPDAFMSLVTAGWDADVARRPHGQHTTVVVHLDVKDRIASLHLG
PLLTAAERQYLSCDATCEVWFERSGQVIGAGRTTRTINRRLRRALEHRHP
TCAVPGCGATRGLHAHHIQHWEDGGTTELDNLVLVCPYHHRLHHRGGITI
TGPAPNITVTDSDGRQLHSSSLARPPNRPPPDVAPYRGPTGERADWWWYT
PFEPPPPTDN
375142674YP_005003323.1 citrate lyase subunit beta [Mycobacterium rhodesiae NBB3]MRNHLLMDVQATAEQPDPSHGSRIDPVLARSWLLVNGAQYDRFAPAAISR
ADIVVLDIEDAVAPKDKAGARDNVIRWLDEGNSDWVRVNGFGTPWWADDL
DALSKTKVGGIMLAMVESVDHVTETAKRLPNVPIVALVETARGLERITEI
AATKGTFRLAFGIGDFRRDTGFGDNPTTLAYARSRFTIAAKAAHLPSAID
GPTVGSSALKLSEATAVSAEFGMTGKICLTPDQCPTVNEGLSPSAEEISW
AKEFFTEFERDGGEIRNGSDLPRIARANKILDLARSYGIEPSEFDDVDDP
AHIPAPSDTYHY
375142673YP_005003322.1 dienelactone hydrolase-like enzyme [Mycobacterium rhodesiae NBB3]MPTITDSITTADGTCRVSLHTPDGDGPWPGIVMYPDAGGARQTFRDMGDQ
LAAYGYAVLVPDVYYRDGDWAPFEMASVFTDENERKRLFSMISKVTPDMM
AADAGAFFDYLVSRPEVSGEVFGTTGYCMGGRTSLVVAGRVPDRVAAAMS
FHGGGLAADDPGSPHLLADQMQAAVYVGGAENDASFTTDAAETLAKALTA
ANVEYLIEWYAAGHGFAVPDNAPYDQAAAQRHWDAMESFFGVHLG
375142672YP_005003321.1 thymidylate synthase [Mycobacterium rhodesiae NBB3]MPVTGSISTPYEDLLRLVLEHGTPKADRTGTGTRSLFGHQMRYDLTAGFP
LLTTKKVHTKSIVYELLWFLRGDSNVRWLQEHGVTIWDEWASDTGDLGPV
YGVQWRSWPTPSGEHIDQISAALELLKTDPDSRRNIVSAWNVGEIPQMAL
PPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAG
LGVGEFIWTGGDCHIYDNHVQQVTEQLSREPRPYPELVLAPRDSIFDYTY
DDVVIKNYDPHPAIKAPVAV
375142671YP_005003320.1 dihydrofolate reductase [Mycobacterium rhodesiae NBB3]MTTVGLIWAQSSTGVIGRDGGIPWRLPEDQARFKELTMGRTVVMGRLTWE
SLPAKVRPLPGRKNVVLTRQADYMADGAHVVPLLQDALTDDITWVIGGEQ
IYALALPLATRCEVTEVEIDLPRDDGDVVAPTLDETWIGTAGEWLTSSTG
LRYRFFSYVRP
375142670YP_005003319.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRLTATQARRIAVAAQGFADQKPTGPVTRAHLRRLISRIQVLQLDSVSV
AVRAHYAPVFSRLGPYDRDVLDRAAWSHTARSPRLLVEYWAHEAALMAVD
DWPLLRWRMREYTHGRWGREIVKKNGRLADDIVAAIAELGPATAGQIEAH
LGAEQRGRKGPWWDRSDTKWVTEALWSAGVLTTATRVGFARHYDLTERVL
PPDVVARDVGDDEAVRELILRAAGALGVGTEADIRDYFRLSPKQSKPAVA
KLVADGELETVDVDGWAAPAYMPAGHKIPRRDRGTALLCPFDPLIFFRPR
VERLFAFHYRIEIYVPQPKRQFGYYVWPFLLDGRLVGRVDLKADRTQGAL
NVVGAFAEPGEQPARVAAALAPELRTMATWLGLADVRVGKRGDLAPLLRR
ATRGLS
375142669YP_005003318.1 cytosine/adenosine deaminase [Mycobacterium rhodesiae NBB3]MAAQGVASRLLDIMEFDVLPMTERGVAAGNKVFGAALLRKSDMSLVVAGT
NSETDNPLLHGEISTLNQFYAMPDRPTTQDLMFLSSHEPCPLCLSAITWA
GFDNFYYFFTFEDSRDAFGIPHDLKILEEVFGVEDGEYRHTNAFWTAHSI
GDLVEAEPEPLRTQLRTQDQRIRDVYAGLSQQYQDSKGNNDIPFN
375142668YP_005003317.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPTDYDAPRARNADDVGDESLEDLTARRREQVDVAVLDVADGDAVDAIDL
PDIDLSGEELTVRVIPKQANEFTCSSCFLVQHRNRLALQSGDRLVCADCV
375142667YP_005003316.1 thymidylate synthase- flavin-dependent [Mycobacterium rhodesiae NBBMADIAPLRVQLIAKTDFLPPSDVPWSTDAEGGPALVEFAGRACYQSWSKP
NPRTATNESFVRHIIDVGHFSVLEHASVSFYITGISRSATHELIRHRHFS
YSQLSQRYVPEHDSEVVLPPGMEDEPELAEIFAAAADASRAAYTELLAKL
EAKYMGDEPGDSKAVLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFI
AMRASEHADLEIRRLAVECLRQLIDVAPQAFSDFEIYALADGTEVATSPL
ATEA
375142666YP_005003315.1 dihydrodipicolinate synthase [Mycobacterium rhodesiae NBB3]MSTSGFDVTAQLGTVLTAMATPFKPDGSLDTDAAARLATRLVDAGCDGLV
LSGTTGESPTTTDGEKLTLLRAVLEAVGDRARIIAGAGTYDTEHSIELAR
ACQGEGAHGLLVVTPYYSRPPQSGLIAHFTAIADATPLPVVLYDIPPRSA
IPIEWDTIRTLAGHPNIVAIKDAKGDLHGGGQIIAETGLAYYSGDDALNL
PWLAMGAVGFVSVWGHVAASQLRDMLSAFNSGDVATARKINVTLGPLADA
QARLGGVTFAKEGLRLQGFDAGEPRLPQMPATSEQIDALAADMRAATVLR
375142665YP_005003314.1 putative metallo-beta-lactamase superfamily hydrolase [MycobacteriuMNEELAPPGPLVPGGLRVTALGGVSEIGRNMTVFEHLGKLLIVDCGVLFP
THDEPGVDLILPDLRLVQDRLDDVEALVLTHAHEDHIGAIPFLLKLRPDI
PVVGSKFTLALVAEKCREHRIKPVFEEVDEGQSSTHGVFECEYFAVNHSI
PGCLAIAIHTGAGTVLHTGDIKLDQSPPDGKPTDLPGMSRLGDAGVDLFL
CDSTNSEIPGVGPSESEIGPNIHRLMRGAQGRVIVACFASNVGRVQQIID
AAVALDRKVAFVGRSMVRNMGIAKELGYLTLTNNDDIIDIGAAEMMPPER
VVLVTTGTQGETMAALSRMSRGEHRSITLTPGDLIIMSSSQIPGNEEAIF
GVLDALAKIGARVVTNAHVRVHVSGHAYAGELLFLYNGVRPRNVMPVHGT
WRMLRANAALAARTGVPEENIVLAENGVSVDLVAGRASIAGAVSTGKMFV
DGLVHGDVGETVVGERLTLSSGFIGVTVVLRSGTGKLAAAPQLHSRGFSE
DPKALEPATRKVQEALETLAAEQVTDVARIAQAVRRAVGKWVGEAYRRQP
MIVPTVIEV
375142664YP_005003313.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MRALDGKVAFITGAARGQGRAEAIRLASDGANIIAVDICDQIASVPYPLA
TPDDLALTVKLVEDTGARIVAQQADVRDQDGLKSALAAGLDELGRLDIVI
ANAGIAPMDTGQAGWRDVVDVNLTGTYHTVEVAIPTLIEQGEGGSIVLIS
SVAGLVGMVSGDPGAMGYTAAKHGIVGLMRQYANILAEHSIRVNSVHPTG
VNTPMIDNDFVRAWLQRMGPQAGGNALPVPAVEPEDIANAVAWLVSDAAR
YVTGVTLPVDAGAIVKR
375142663YP_005003312.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPIVVVATMKAKPESVDAVRDACKQAIEAVHSEPGCDLYALHEADGTFVF
VEQWTDADALTAHSQAPAVATLFGTVGELLDGAPDIKMLQPVVGGDPAKG
ALRP
375142662YP_005003311.1 DNA segregation ATPase FtsK [Mycobacterium rhodesiae NBB3]MPSKTAARSGSRSSRSKSGARSSTRTAQKRKPAPRRSSSPVSSAGATVGR
GVRAGWLMLAKGAGSTARSVGRARELEPGHRRDGIALALLGIAVVIAASS
WFDAARPVGAWIDTFLRVLIGSSVALLPIALAVVAVLLMRTEPNPETRPR
LILGVTMIVLPVLGLWHLAAGSPADPVARQHAAGFFGFAMGGPISEGLTV
WIAAPLLFIAALFGLLLLTGTTIREVPDTMRSLFSARALRGDDYDEYYDD
EEYDDVAESDDFSDGYYDDPAGHRDDESQAWPGTPMDNYPIEDETPTIPE
PAARVRKKKPAKPKIVDRVVEGPYTLPSLDLLIAGDPPKRRSAGNDRMIE
SITEVLEQFKVNASVTGCTRGPTVTRYEVELGPGVKVEKITALQRNIAYA
VATESVRMLAPIPGKSAVGIEVPNVDREMVRLADVLTDPGTRNDHHPLVI
GLGKDIEGEYISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLARATPEE
VRMILIDPKMVELTPYEGIPHLITPIITQPKKAAAALAWLVEEMEQRYQD
MQASRVRHIDDFNKKVRSGEITTPLGSQREYKPYPYILAIVDELADLMMT
APRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSRLAFA
TSSLTDSRVILDQQGAEKLIGMGDGLFLPMGANKPIRLQGAFITDEEIHA
VVEATKAQAEPEYTEGVTAAKTNSERTDVDPDIGDDMDVFLQAVELVVSS
QFGSTSMLQRKLRVGFAKAGRLMDLMETRNIVGPSEGSKAREVLVKPDEL
AATLMLIRGDSGGDDDEDD
375142661YP_005003310.1 acetyltransferase- N-acetylglutamate synthase [Mycobacterium rhodesMSADPERVLIRRARTSDVPAMKALVDIYSGKILLEKNLVTLYEAVQEFWV
AELDGELIGCGALHVLWSDLGEVRTVAVHPKVRGQGVGHAIVDRLLDVAR
DLHLERIFVLTFEVDFFSRHGFTEIDGTPVTAEVYEEMCRSYDTGVAEFL
DLSYVKPNILGNTRMLLTL
375142660YP_005003309.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase MPGEPTTDPVVPPVRVANIANALTGVRLVLVPVFLVVLFVGDGHETFWRI
AAFIVFTVAVITDRFDGALARSYGMVTEFGTLIDPIADKALIGAALIGLS
MLGELPWWVTVVILTREIGITVLRFAVLRHGVIPASRGGKLKTLVQGVAI
GLFILPLSGPWLVGAWVVMAAAVFLTVVTGVDYVISAIRDSRARPAAD
375142659YP_005003308.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVAALPLYKAQRTTAWKGSTMTALLREVIGDVLRRARTEQGRTLREVSDS
ARVSLGYLSEVERGRKEASSELLSAICSALDVPLSRVLFEAGDEMGRKEF
AAIERESVGAANIDAATKVVIPQVVSMAVA
375142658YP_005003307.1 phage shock protein A (IM30)- suppresses sigma54-dependent transcriMANPFTKAWKYLMALFSSKVDEYADPKVQIQQAIEEAQRQHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYTN
AAEAFAAQLVTSEQSVEDLKTLHDQALQAAGQAKKAVEQNAMMLQQKIAE
RTKLLSQLEQAKMQEQVSASLRSMSELAAPGTTPSLDEVRDKIERRYANA
IGSAELAQNSVQGRMMEVQSASVQMAGHSRLEQIRASMRGEQLPAGGTAA
ATPAAPATNPQATPENPLSQ
375142657YP_005003306.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNSRASRPEAWRSLAQRGVDTAAEWSDVLAEKLNAAADPRAKLLRKRRWA
FRLGVFFTVSTLFWIGVTGLLSAWETPFWALFIPAPIAVGAAFLATLSFL
RYRWLRGEPLPPQRSRSSRRLPAWGSAARQPMAALAASERGLFSLLGVME
RGRMLPPDELRELTAAANQTAATMTATANEVVSMERAIGSAPQSRAHLAP
TIQAFTAQLEQGSRQYNEMVTAAAQLVSAANTGSMSSSPMAQQRYRNELS
NATDRLLGWAQAFDELGHLRRA
375142656YP_005003305.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPSVNVTRDLRGGVLVLPGGRPRDTSPSRGWQLANQRMLWLATSLRYELG
SSVRVQRVQYRTRGWNSPRLDAVRDAESALARLQRDIGSSPVVLVGHSMG
ARVAAHLSGSDGVVGVVALAPWWPHNDAELVPAGRRLLTLHGTADTWTDP
RASSTQTRWASDRGVDARWVGLPNSGHYLLRDFRRWHRLTAEFVAEQLCV
SEARPGD
375142655YP_005003304.1 limonene-1-2-epoxide hydrolase [Mycobacterium rhodesiae NBB3]MTDQAAPTRPDLDNVRAVETFLYAMQDEDFDTVDRLMADNIEWQNVGFPT
IRGRQRIVGMMRRGEGRLGFEVKIHRIAAEGNAVLTERTDALVFGPLRLQ
FWVCGVFEVHAGRITLWRDYFDALDFVKATVRGIAATVFPSLRATM
375142654YP_005003303.1 UDP-glucuronosyltransferase [Mycobacterium rhodesiae NBB3]MRVAVVAGPDPGHAFPAIALGLRFLANGDSPTVLTGTRWLDTAEEAGLGA
MELLGLDVTEDDDDTDAGEKINRRAARMAVLNAPRIAQLAPDLVVSDVIT
VAGGFAAELLGLPWIELNPQPLYRPSKGLPPIGSGLAPGTGVRGRIRDAV
LRAMSARSWREGLRQRAAARAGIGLPAVDPGPLRRLVATLPALEVPRPDW
PSEAVIVGPLHFEPTSSTLQIPAGSGPVVVVAPSTAHTGARGLAEVALDS
LRPGEVLPEGSRVVVSRLDGPAGPLPPGAAIRPLPPGAAIRPLPPWAAVG
LGRQDELLSKADVMICGGGHGIVSKTLLAGVPLVVVPGGGDQWEISNRVV
RQGSAQLVRPLTAEALSGAVREVLSSPDYREAARRAGATLADVDDPVRVC
HEAVAASA
375142653YP_005003302.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLTEFHDLVEGQFGSVRGGSLLVDHVLTRLDGRTAVQAIEDGVDPRDVW
RALCADFDVPRDQW
375142652YP_005003301.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSGDELFARFAYPPNELGYCGPADAAHAELASHAREFDGAWPYLKTLADA
AGVADPLDDDVVRSYWVGGRLLDKVDSGELVTRLRRSFAGQVTGLLNDLP
ASAPTLAHHSFHVFVVYPWVRFLDRDPTTPLRVMQDCRIRWGTVESIDGE
HAEIVSRRLTMKDAMLTLGDPEIERVHWSKAGESLAPVPVRGQTVCAHWD
WVCGALSDSDAEALESATRSTLDLVNSVRTNHH
375142651YP_005003300.1 hydrogenase expression/formation protein HypE [Mycobacterium rhodesMPDTPAEADTAIDMESWVCPAPLRDSPNIVMGHGGGGAMSAELIEHLFLP
AFGRAAEAGMGDSAVLDVGNVRLAFSTDSFVVKPLSFPGGTIGDLAVNGT
VNDLAMAGARPLVMSTAFILEEGTSLDDLARVAQAVGTAAMAAGVKLVTG
DTKVVDAGHGDGVYINTAGIGLIDERADIRPQRATEGDVVIVSGDIGVHG
VAVMSCREGLEFGTTVASDTAPLHGLVAAMIDTGADIHALRDPTRGGVAA
TLNEIAKTADVGISLDERTFPIPAEVRDACGLLGLDPLYVANEGKLLAFV
APTEADRVLTAMRAHPLGAHATVIGRCVAEHPKMVSAKTALGGTRVVDLP
IGEQLPRIC
375142650YP_005003299.1 hydrogenase expression/formation protein HypD [Mycobacterium rhodesMKYLDEFSDPQLARRLVDEIKAATSRRWSIMEVCGGQTHSIIRHGIDQLL
PDTIEMIHGPGCPVCVTPLEIIDKALEIASRPEVIFCSFGDMLRVPGSEM
DLFGVKSRGGDVRVVYSPLDALKIAKENPAQQVVFFGIGFETTAPANAMT
VYQAKRLGIENFSLLVSHVLVPPAISAIMESPTCRVQAFLAAGHVCTVMG
TDEYPPLCDKYGVPIVVTGFEPLDILEGIRRTVLQLESGRHELENAYPRA
VQSEGNAVAKAMLLDVFDVTDRGWRGIGTIPSSGWRLSPAYRDYDAEYRF
AVTDIHTEESSVCRSGEVLQGLIKPHECAAFGTLCTPRNPLGATMVSSEG
ACAAYYLYRRLEVVNA
375142649YP_005003298.1 hydrogenase assembly chaperone HypC/HupF [Mycobacterium rhodesiae NMCLAVPGKIVSIDDRDGTLMSVVDFGGIRKDVCLEYLPDAEVGQYVVVHV
GFALQRLDEESAMRTLAEFEHLGILEEEFSDGFEVAAQRSGLDNPDEPRR
SEVTS
375142648YP_005003297.1 (NiFe) hydrogenase maturation protein HypF [Mycobacterium rhodesiaeMTDRRRVRICVRGVVQGVGFRPFVYACAAAFGLSGSVRNDSAGAVIEVEG
STVQIDDFLTRLRNRPPPLAVVESIETRDLAVVGGTGFTIAHTSRSAGGR
TLASPDVAMCAECAAEQRDPTNRRYRHAFINCTNCGPRFTIIDALPYDRT
STTMAPFAMCADCAAEYHDPLDRRFHAQPVCCPRCGPTMRYRSSDGGSGE
GEAALRQARRLLNDGGILAVKGIGGYHLACDAANARAVTELRTRKRRGDK
PFAVMVADLATARTLAEVDAGSAHLMSGTQRPIVLMPRRAGAAVADAVAP
HNPDLGVMLAYTPLHALLFGLPGDEHGPAALVMTSGNLGGEPICFTDSDA
LERLSLLTDGWLTHDREILVPCDDSVVRAVYLDSADDRARYIELPIRRSR
GYAPLPVALPVALPPTLAVGADLKNTLAVADGKYAWLSQHIGDMDDLATL
SAFDSARHHLQALTGVAPDVLVADAHPLYRSTAWAHRNAGDRPVRTVQHH
HAHIASVMAEHGLDGSRPVLGFAFDGTGYGPDNAVWGGEVLLADYKGYRR
LAHLKYVPLPGGDVSVLRPYRMALAHLWAAELPWDTDLAPVRACPEDERR
VLAHQLETGLGCTPTSSFGRLFDTVAAVAGVRQVVAYEAQAAIELEGLSR
DTACGTATYQFAIDVDQEPATIDAAPVIEAVVADTRSGVAAGVVGARFHR
AVADLIVRLATTVVADAPTVALSGGVFQNALLLRLAVTGLHNQGFDVLTH
RLVPPNDGGIALGQLLVGNSP
375142647YP_005003296.1 hydrogenase assembly chaperone HypC/HupF [Mycobacterium rhodesiae NMCLGIPGQVVRMLEGYGDQLALVNVAGENRKVNIGMLPEETFCAGDWVII
HMGFVVEKTDEAGADAAMAGLQMMGRGADPEESP
375142646YP_005003295.1 hydrogenase maturation protease [Mycobacterium rhodesiae NBB3]MTARILVAGIGNIFLGDDGFGPEVMRYVLGRSFGSDVHAVDYGIRGMHLA
YDLLEDWHALVLVDALPDRGAPGTLHVFEADPGTLSATAGLEAHSMDPAA
VFATLNALGGTAPRTIVIGCEVENIEDGIGLSESVAAAVPAAAAAITDVL
VEIAARAPAAAEG
375142645YP_005003294.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MEVIGWIATGVVAVVVVGGVVVGLRSIPDVRRYMKIRNM
375142644YP_005003293.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPGWDRARAVADAVLYEGYLLYPYRATSGKNQSRWQFGVVGPPGASDAG
IGESDSLSAQFLVDGAGALTLVVRFLQLQHRRAERDIGGGTFEPVDELTS
GAQSWVTWDEAVERELVFGPYELGGLIQPRILAIDIDEGSESEVVDGGRL
VRTRSAVRADLTLTAEHDDADRFRVSVSIRNTGAPAADKEAAIGTSLIGT
HLIAEVVGAQFISLLEPPDSAAASVSQLVQHRCFPVFAGRPGERDLLLIS
PIILYDYPEIAEQSEGALYDSTEIDEILTLRVMTMTEAEKAQARATDPLA
AAIIDRCDSMSPDAMRQLHGVLRNPHAQGLGHDPGLDELHEQMRSAGLIP
EIPEGVDWWDPVADTAVRPDLDAVLVNGVRVAAGSRVRLRPSRRADAQDI
FFAGKSARVTSVHEDVDGQQYVGVIVEGDPDVEMPASYRRYLYFAPDEVE
PMNVRTVNADGSS
375142643YP_005003292.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSLAFTVADVAAEQFSVTPRLIARIGIVAGDDQPIQAIALRCQIRIEPL
RRPYSDDEAAGLIDLFGPRERWVNTQRTFLWQHSTAMVQGFTGVTEVSLP
LECTYDFEVAASKYLHALRDGAVPLLFLFSGTVFMPGGRGFSVRQVPWEC
EAQYEMPVSVWDSLVRTHYPNSGWVRLGHDTLRALAAYKSARGMLDFEDA
VTTLLAEAPAATQPTHQPEEVR
375142642YP_005003291.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGAYDVLARIRASKPAAQQAGERCEMCAEPIADEHQHVVNIVARQLMCT
CRGCYLLFTDPHAKLRYRAVPDRYLTFSDFALDRLAWEGLQIPVGLAFFF
RNSDINKTVAFYPGPAGAAESELDVDAWAAAYGADGLLRMLADDVEALLI
RVPERDDELNCAAECFLVPIDACYEFVGRLRLLWRGFDGGHEVRDYVEEF
FELIKARSKVASTMNGLT
375142641YP_005003290.1 thioredoxin-like protein [Mycobacterium rhodesiae NBB3]MASTGPQDPEALDDETRWRSAGDRIQTLLDASAGSGTVVRERTEQLAAEL
TDLYGAALERMIAITAGSAPELVDQFAKDELVASLMLVHGLHPHGVERRI
EDALDGVRPYLGSHGGDVALLEVVERQDGPVVRLQFAGSCKSCPSSAVTL
EYAVEDAVRAAAPEIVSIEVVAAQPDSPESPSLISVDSVLSRLRDHNDRA
GATWHPVPDIGDLGQGEIAGFLVAGVPILACRVADDVFAYHDRCGRCHES
LAGAALHRPLGAAIGQAVLRCPRCHAHFDVVHAGVGVDDTAETAEHLDPI
PLLRRDGVPSVSVIAEASGVM
375142640YP_005003289.1 Ni-Fe-hydrogenase I large subunit [Mycobacterium rhodesiae NBB3]MTTTVPGPQHTKKDPSTLVDMSWDPITRIVGSLGIYTKIDFENREVAECH
STSSIFRGYSIFMKGKDPRDAHFITSRICGICGDNHATCSCYTQNMAYGV
QPPHLGEWIVNLGEAAEYMFDHNIFQENLVGVDYCEKMVSETNPPVLAKA
ENTLAPNSDAHGYRTIADIMRALNPFTGEFYREALVVSRWTREMFCLMEG
KHVHPSTLYPGGVGTVATIQLMTDYMTRLMRYVEFMKKVVPMHDDLFDFF
YEALPGYEQVGLRRTLLGCWGSFQDPEVCNFAYKDMEKWGNAMFVTPGVV
VDGKLVTHSLVDINLGIRILLGSSYYDDWTDQEMFVRNDPLGNPVDRRHP
WNQHTNPKPQKRDMDDKYSWVMSPRWFDGKDHLALDTGGGPLARLWSTAL
AGLVDIGYVKATGASVQINLPKTALKGPVALEWKIPTHGSNTLERNRART
YFQAYAAACALHFAEKALVEIRAGRTKTWEKFTVPDEAIGCGFTEAVRGV
LSHHMVIRDGKIANYHPYPPTPWNANPRDSYGTPGPYEDAVQGQPIFEEN
DRENFKGIDIMRTVRSFDPCLPCGVHMYLGEGKTLEKLHSPTQSVTGE
375142639YP_005003288.1 Ni-Fe-hydrogenase I small subunit [Mycobacterium rhodesiae NBB3]MLTEAAKKAEETLIHVLWINAGLSCDGDSVALTGATQPSIEEIALGALPG
LPQIAVHWPLIDFECGPTGGADDFLEWFFKADRGELEPFVLVVEGSIPNE
NLHQEGYWCGFGNDPATDQPITTSEWLDRLAPKATAIVAVGTCATYGGIH
AMAGNPTGAMGVPDYLGWEWKSKAGIPIVCVPGCPIQGDNLSETLTYLLY
MATGQAPMIPLDDALRPQWLFGNTVHEGCDRAGYYEQGDFATEYGSPKCI
VKLGCWGPVVKCNVPKRGWINGVGGCPNVGGICIGCTMPGFPDKFMPFMD
EPPGGKISTAASGLYGSVIRNLRHITGKTVDKEPSWRHRGKELTTGAKRT
W
375142638YP_005003287.1 hydrogenase nickel incorporation protein HypB [Mycobacterium rhodesMCATCGCGEDRASVTLSGHRHPHDHTHPHDHTHPHTETVVLEQKVLAKND
ALAEQNRRWLAGRGILAFNITSSPGAGKTTLLERTIRHLGSQRQVSVIEG
DQETLLDADRITAAGARAVQVNTGAGCHLDAEMIDRALHTLDPEGGSVLF
IENVGNLVCPALFDLGEHCKVVVISVTEGTDKPLKYPHMFAAAGLILINK
IDLLPYVDFDLDLCARHARSVNPDVEIMPVCATNGDGMALWYQWIDARAN
ELRASSLTCD
375142637YP_005003286.1 Zn finger protein HypA/HybF (possibly regulating hydrogenase expresMALTQSVVDAVCEHAAGRRVHSVRLEIGALCAVVPDAMTFCFELATEGTL
ADGARLEVDMRPGEARCRSCDTIFAVNDLILLCHCGSADVEVTAGRDLKI
LSMEVS
375142636YP_005003285.1 protein RecA [Mycobacterium rhodesiae NBB3]MAPQAPDREKALELALAQIDKNFGKGSVMRLGDEVRPPISVIPTGSIALD
VALGIGGLPRGRVVEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHA
LDPDYAQKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDILVIDSVAA
LVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREK
IGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVK
NKVSPPFKQAEFDILYGKGISKEGSLIDMGVEQGFIRKSGSWFTYEGEQL
GQGKENARNFLLENPDVANEIEKKIKEKLGIGADVTAAPADGSINDVLPA
PVDF
375142635YP_005003284.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTYCPPQSTSEVSREEQARALCLRLLTARARTRSELEGQLTKRGYPDDVS
AKVLDRLAHVGLVDDADFAEQWVRSRRINAGKGKRALAAELRNKGVDNEV
ITAALADIDAGAERQRAEQLVRDKLRREKLQDGDDTKVARRLVGMLARRG
YHQSMALDVVSVELASERARRSV
375142634YP_005003283.1 putative F420-dependent oxidoreductase- Rv1855c family [MycobacteriMLLSAKIAPTFDYPVLHEFWSRADELGFHSVANYDHFYGLSDMADPTYEG
WTSLAAMACVVSRARIGCMVAGVTYRHPAILAKMAVTVDHISGGRLDFGL
GAGWHEEEHRGYGLEFPSAAVRVEMLDEALTIIRRLWTEDTVSFEGRHYR
LREALANPKPLQKPHPPIVVGGEKPKMLRVIARHADEWNVPSHGDVQMWA
KTSARLDEACAEVGRDPGAIRRSIQLFVLPAKEGHLEEQLARLPELEALG
CDHAVLSFYQPPSAQQMKRCAELI
375142633YP_005003282.1 amine acid ABC transporter permease [Mycobacterium rhodesiae NBB3]MSTASVLFDAPGPRARVRNRIVTVVTLVVAAAVVWVLYSRLQARGQLDAA
KWEPFLTANLWKTYILPGVQGTLTAAAVSIVLAMVLGFALGVGRMSAHRA
IRVPSAIFVEFFRAVPVLIMMIFAYFLFAMYDVFPSKHLALAGVITGLTL
YNGAVIAEIVRAGVNALPRGQAEAASALGLRWGQTMRAILLPQAITSMLP
VLISQLVVVLKDTAIGYQITFLEMVRQGTQVGAAYGNYIPALIVIAILMI
AVNFSLGHFATWLEGRLRRSRRGPAPMHADEPVNQGAFGAGAGGTI
375142632YP_005003281.1 amine acid ABC transporter permease [Mycobacterium rhodesiae NBB3]MEVFTEYRAQIFEAFWTTIQLTVFSAVGALILGTLLAAMRLSPVPMLNWV
GAAYVNVVRNTPLTLIILFCSFGLSQTLGITLVDRNSPTSIDDSNFRLAV
LGFTVYTAAFVCETVRSGVNTVPLGQAEAARSLGLTFGQNLRIVLLPQAF
RSVIIPLGSVLIALTKNTTIASAIGVAEAALLMKEMIENTAALMTIGIIF
AAGFVILTLPTGLFFGWLGKRMAVAR
375142631YP_005003280.1 periplasmic component of amino acid ABC-type transporter/signal traMPFISKRVLGAVVLALALPLAATACGGGSGGGDTIVIGTKFDQPGLGLKN
PDGTMSGFDVDVAKYVAQQLGYSEDKIEWKESPSAQRETLIQNGQVEFIA
ATYSITDSRKEKISFAGPYLVTGQSLLVREDNTDITGEASLQNNKKLCSV
SGSTPAQRIKDKYPGVQLQQYDTYSACVEALKNGAVDAVTTDEVILAGYA
AQTPGAFKLVGGTFSEERYGIGLKKGDTELQKKINDAIVKMETDGAWKAA
WDKNLGPAGLPAPTPPKIDQT
375142630YP_005003279.1 polar amino acid ABC transporter ATPase [Mycobacterium rhodesiae NBMEAGGSEVKEGDPTPGAVPMVSMEGVNKHFGSLHVLKDINLTVDRGQVIV
VLGPSGSGKSTLCRTINRLETIDSGTIAIDGEVLPAEGKKLAQLRSDVGM
VFQSFNLFAHKTILENVTLAPMRVRKVSKDKARETAMSLLERVGVANQAD
KYPAQLSGGQQQRVAIARSLAMNPKVMLFDEPTSALDPEMINEVLNVMTS
LAKEGMTMVVVTHEMGFARGAANRVVFMADGAIVEAAEPTEFFTNPKSDR
AKDFLSKILKH
375142629YP_005003278.1 tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB [MyMRTYQVRTYGCQMNVHDSERLAGLLEAAGYRKAADDTDADIVVFNTCAVR
ENADNKLYGNLSHLVPRKQANPDMQIAVGGCLAQKDRDTVLKRAPWVDVV
FGTHNIGSLPALLDRARHNRAAQVEIVEALEEFPSALPAARESAYAAWVS
VSVGCNNTCTFCIVPALRGKEVDRRPGDVLAEVTSLVDQGVLEVTLLGQN
VNAYGVSFADKGEPRDRGAFAKLLRACGRIDGLERVRFTSPHPAEFTDDV
IEAMAQTPNVCPTLHMPLQSGSDRILRAMRRSYRAERYLAIIDRVRAAIP
HAAITTDLIVGFPGETEEDFQATLDVVERARFASAFTFQYSKRPGTPAAE
LADQIPKDVVAERYKRLIDLQERVSLEENTALIGHTVELLVATGEGRKDA
ATARMSGRARDGRLVHFNPGGLQIRPGDVVTTTVTDAAPHHLIADAAIGS
HRRTRAGDAHAAGKTPHTGVGLGMPGVGVPAEPQSSTGCGR
375142628YP_005003277.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNRPEDGDFESFKGDIEAAERRVAREIDPGPRALVIAIGVFVLLLSFVLP
HTGTAKGLDVLISSDVAVREGITLPSRVFTWLALVFGVGFSMLALLTRRW
ALAWIALAGSTVASLLGLLAVWSRQTAPSAYPGPGIGLIVAWLAVILVTF
HWARAVWARTAVHLAAEEERRRRVAEQQRKGLLDGLDDDNGEN
375142627YP_005003276.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTISEPGGPASSLEPAAGSLPPRPTPRPGPPRPAPRPGRPAATIAAPPSS
DPHRFGRVDPDGTVWLITGSGERNIGSWQAGDTEAAFAHFGRRFDDLATE
VALMESRLESGTGDARKIKAAAAALAETLADAHVLGDVDALAARLTTIVE
HADETAQADKAKREEHRAAQIARKEALAAEAEELAANSTQWKVAGDRLRE
ILDEWRTITGLDRKSDDALWKRYSAAREAFNRRRGSHFADLDRERAGARQ
AKEAICERAEALADSTDWGPTAAAFRDLLTEWKAAGRAAKDVDDALWQRL
KAAQDTFFSARNAATAERDTEFRANAEAKEKLLAEAERLDTGDLDAARAA
LRTIGDKWDAIGKVPRERSAELERRLRAVEKKVRDAPTSGVDPEAQARAD
QFRSRAEQYERQAEKAAAAGREKDAAEARANAEQWRQWADAAAESLGKR
375142626YP_005003275.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPCAYGFTDAFAYALIEDDERGPMPALHEQADIAAMLALGAAFFIAIGDV
MHQRQAHEVTDEQVGHVALFVQLLRDRQWWLGSLVAAVGFGLQAAALGLG
SVLLVQAMLVTSLLFALPINARLSHRRVTRWEWTWAALLAAAVVVIVTVG
NPTAGHSRAAFETWAAVVAVLGPALVLCVIGGSMAKGPLSAVLLAVVSGA
LWGVFAVLTKGVVDRLDDGVIALLRTPELYAWVAIAVAGTAWQQFSFRAG
SLTASLPTMTVTEPVVASALGVVVLGETLRPGDAGWLTLIVAVAVMVFST
GALARGEAASSGDRATRH
375142625YP_005003274.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLSSIAIVPSAPVMVPELASGAAAELADLREAAFTAVGSLPGRWVAVGRG
PADSVVGPGQTGTFAGYGVDVPIALAPGQSAAPTELPLAALVTGWLRGRV
NPDAHAEVRMYADEHDADAAIERGRRLRAEIDEVDGPVGVLIVADGVHTL
TQSAPGGYDPDSIPVQAALDDALASGDAAALTRLPEAVVGRVAFQVLAGL
TEQPRAAKELYRGAPYGVGYFVGVWLPAGGSEVTGESV
375142624YP_005003273.1 tRNA isopentenyltransferase MiaA [Mycobacterium rhodesiae NBB3]MTRPIAIVGPTGTGKSALALAVAERLGGEIVNADAMQLYRGMDIGTAKLA
PAERRGIPHHQLDILEVTETASVARYQQAAATDIEAIADRGAVPVVVGGS
MMYIQSLLDEWTFPATDPQVRAKYELRLADVGVAALHRELARVDADAAES
ILPTDGRRIVRALEVVELTGRPFAASFPAIGAPRWDTAIIGLDWETTLLD
ERLTRRTDAMFSDGLVDEVHSLLSRGLRAGVTASRALGYAQVIADLDDGG
DGTAAREPTFVGTRRYVRRQRSWFRRDHRITWLDGAAADTVDDTLRIWRH
VS
375142623YP_005003272.1 diaminopimelate epimerase [Mycobacterium rhodesiae NBB3]MKFAKGHGTQNDFVLLPDPEGRLTLTPAAVAALCDRRRGLGADGVLRVTT
AAAAHAAGVFDRIPEGVAPGDWYMDYRNADGSIAQMCGNGVRVFAHYLRA
SGMESRDEFIVGSLAGPRPVVLHAWDSTGADVTVEMGKANHFGTGEATVG
GRPFAGLAIDVGNPHLACVDPGMTLDDLAALDVAAPVSFDRAQFPDGVNV
EVLTAPADGVVAMRVHERGVGETRSCGTGTVAAAVAALAFEGATTGTLRV
HIPGGDVTVTVTDASSYLRGPSVLVAEGDLSEEWWRAVQR
375142622YP_005003271.1 GTP-binding protein HflX [Mycobacterium rhodesiae NBB3]MTHPEFPVNEKPSAGELALEDRAALRRVAGLSTELSDISEVEYRQLRLER
VVLVGVWTEGSAADVDASMAELAALAETAGSEVLDGLIQRRDKPDPATYI
GSGKAAELREVVLATGADTVICDGELSPAQLTALEKAVKVKVIDRTALIL
DIFAQHATSREGKAQVTLAQMEYMLPRLRGWGESMSRQAGGRAGGAGGGV
GTRGPGETKIETDRRRIRERMSKLRREIKDMKKIRDTQRSRRLASDAASI
AIVGYTNAGKSSLLNALTGAGVLVENALFATLEPTTRRGEFEDGRAFVLT
DTVGFVRHLPTQLVEAFRSTLEEVVDADLLVHVVDGSDVNPLAQIRAVRT
VVNEVIVDHQHKPAPELVVVNKIDAADDLALAQLRRALPDAVFVSAHTGE
GLQRLQQRMAELVAPTDTAVDVTIPYDRGDLVNKVHADGRVDATEHTADG
TRIKARVPVSLAATLGEFATF
375142621YP_005003270.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRQKSRRRMVMPRVVIGLLAVSTTVLLAPVTAAQPEADANGAITAAWEA
SGGDGGALGPRNGDVYPIGEGFGQNFAGGKMFFTPATGAHFVQGAILEKY
ESLGGPADSDLGFPTIDEGPGRAPDSRNVTFSATDKPVIFFTPATGARVV
RGPINAAWDTLGGSAGELGVPAEDEVYRGSVVSQKFTGGELSYDLRKKTF
TTVPPELAARLGDLKIPDDPEAAINAARRAAGGALGPLGAAEGEATPIGK
DGLRQNFAGGAIFYTPATGANVVTGQVLAKYESVGGPEGDLGFPISSEVD
GGLATESRMSSFAAEDKPVIFWTPEYGAVIVRGAMAAAWDRLEGAKGALG
APMADQTEAGDVVTQRFSGGVVSWDRSKNQFTTEPANLASELSGLEVPGQ
KSPEAPNGSQASDDSGGKNWFKFSWWWLLALVPLVILVGAVLLATLLRRR
KGEDPFAPDGYPMADNRFGGESESAYGTGGSPERMTTDDEYAAAMFGDRY
ASEGLGSAPHGVDEPHGHDLPHGEEAPPHDDDRSHVEEWLRSDEVHAPDD
DVWGAPPPDVQEEPPAPFDEPDQPVESVEPAEDEDSDAVDTAPTAVITVP
PVIARDPLTDTGRHARIEVDEPEPRIAFLMPLDDPNQAPDGYPVKANTKT
GVYWAPGSTMYEDASAEIWFASEELARVNGFVADDDVR
375142620YP_005003269.1 SOS regulatory protein LexA [Mycobacterium rhodesiae NBB3]MDSDSGTPNGTDSTGGRGGLDTGLTERQRTILDVIRASVTTRGYPPSIRE
IGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVDVRGADSLPSIVAT
DVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGSLFL
LKVVGDSMVDAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRTR
GQVWLMPHNPAFDPIPGNDAAVLGKVVTVIRKV
375142619YP_005003268.1 LysM domain-containing protein [Mycobacterium rhodesiae NBB3]MFEHKSERLEPEGRKMTILETRENRAIPVVRPGIRPAGARRRPVSRRPGG
APVRYRNSGVLVSRASHRRKPITPVTTVLLALVAAGITVWLGLVAQFGGV
VGESAPVPDRLAVVQVQTGETLQQVAGRVAPDAPVGPVVDRIRELNHLDS
VSVHAGQTLIAPIS
375142618YP_005003267.1 transcriptional regulator NrdR [Mycobacterium rhodesiae NBB3]MHCPFCRHPDSRVVDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSREKVVKGVRRACQGRQVDDDALNLLAQQVEDAVRAAGSPEV
PSNEVGLAILGPLRDLDEVAYLRFASVYRGFSSAEDFEREIQALREHRKS
PEPAPN
375142617YP_005003266.1 putative epimerase- PhzC/PhzF [Mycobacterium rhodesiae NBB3]MAIDVTVLRVFTDPEGNYGNPLGVVDNSTVDPADRQRIATELGYSETIFI
DFPEGGASTAHARIFTPAVELPFAGHPTVGASWWLREQGYAIKTLQVPAG
IVQVIYDGDLTAVSARAEWAPDFAIYDLGSVDELMAADPADYSDDVEHYL
WTWLDRSAGKIRSRMFATHLGVPEDEATGAAAVRITDYLSRDLDIVQGKG
SMISTEWSPEGWVRVAGRVVSDGTKHID
375142616YP_005003265.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MAARTPNLRPVRELTPELEFRTIHGYRRAYQRAGSGPAILLIHGIGDNST
TWSTVQSKLAQRFTVIAPDLLGHGKSDKPRADYSVAAYANGMRDLLSVLD
IDKVTVVGHSLGGGVAMQFAYQFPQLVERLILVGAGGVTKDVNIALRVAS
LPMGSEALAFLRLPLVLPAMQVVGRVAGAMFGSTGLGRDIPNMLRILADL
PEPTASSAFARTLRAVVDWRGQVVTMLDRCYLTQSVPVQLIWGSSDAVIP
VSHARMAHAAMPGSQLEIFEGSGHFPFHDDPDRFVEVLEQFICSTEPAVY
DQDYLRGLLRTGIEAGDICGPAGTRDAVLDAMDHDERSAT
375142615YP_005003264.1 ATP-grasp superfamily enzyme [Mycobacterium rhodesiae NBB3]MADQADQPEQHYQPDQTGMYELEFPAPQLTSPDGRGPVMIHALEGFSDAG
HAIKLASQHLKNTLDTELVASFAIDELLDYRSRRPLMTFKTDHFTHYEDP
ELSLYAMHDSVGTPFLLLAGMEPDLRWERFLTAVRLLAERLGVRRVIGLG
AIPMAVPHTRPITLTAHSNDKELIAEHQPWVGEVQVPGSVSNLLEFRMSQ
HGYEVVGFTVHVPHYLAQTDYPAAAEVLLAEVAKSASLQIPLEALDAAGA
EIQAKINEQVEGSSEVAQVVTALEHQYDAFAAAQENRSLLAHDENLPSGD
ELGAEFERFLRQQDRGRDDDAK
375142614YP_005003263.1 pyruvate/2-oxoglutarate dehydrogenase complex- dihydrolipoamide dehMLEYDLIVIGSGPGGQKAAIAAAKLGKSVAIVERGRMLGGVCVTTGTIPS
KTLREAVLYLTGMNQRELYGASYRVKEKITPADLLARTSHVVGKEQDVVR
SQLMRNRIDLIQGHGRFIDAHTVLVEEPTRGERTTVSGDYVVIATGTKPA
RPPGVEFDEDRVLDSDGILDLKSLPATMVVVGAGVIGIEYASMFAALGTK
VTVVEKRDTLLDFCDPEIIEALKFHLRDLAVTFRFGEEVTAVDVGAAGTV
TTLASGKQIPAETVMYSAGRQGQTEHLDLANAGLQPDSRGRIAVDSNFQT
LVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPAKGMTDLQPIGIYS
IPEVSYVGATEVELTRNAIPYEVGVSRYRELARGQIAGDSYGMLKLLVST
DDLKLLGVHIFGTSATEMVHIGQAVMGCGGTIEYLVDAVFNYPTFSEAYK
VAALDVMNKLRALNQFRR
375142613YP_005003262.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAVLLGACSRVVVGSSQPVEAAAERPPVPVAQLLIEPARFPPQYSAAVL
DVAGVDRAVRDVDGVPIGAVVTPAACTPPVLWHSEVVGVEGVDAATASRL
IVVLTRPVPPLSDRLAQLRACPTFEVGESTVTVTELPAPPVDADASYAVE
QVVTTPDSERTTLTFAAEIGDARVSVTWLQDPASGEADTASLDALFRDSV
LKLRRES
375142612YP_005003261.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGPDRDGGGMTSQSSDFQLNRPGVLIAALPAVLGFVPEKSLVLVTVDRGE
MGCVMRVDLSDELTASVEHIADVAATAGPDAAIAVVVDDEAAGCRMCNEA
YRRLAASLSSALAERGIELLAAHVVDRIAAGGRWHCADGCGHTGSVEDPS
ASPLAAAAVLDGRRLYARRAELQEVIATADPARSVALAEMIGSCEDARSD
ADARRDVETAMAAAADVADGRPLADDTAARLACALTDPLVRDTLYALAVG
DYAGQAESLWAELSRTLPEPWRVEALVLLAFSAYTRGDGPLAGVSLDAAL
RCDDSHRMAGMLDTALQSGMRPEQIRDLATTGYRLANRLGVRLPPRRAFG
RRAG
375142611YP_005003260.1 Mn-dependent transcriptional regulator [Mycobacterium rhodesiae NBBMNDLVDTTEMYLRTIYDLEEEGVVPLRARIAERLDQSGPTVSQTVSRMER
DGLLHVAGDRHLQLTDKGRGLAVAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVRVLDNPTTSPFGNPIPGLSELGLASSDPGAEIN
LVRLTELPAGMPVAVVVRQLTEHVQGDVELIGRLKDAGVVPNARVTVEVN
DHGGVMIVIPGHEQVELPHHMAHAVKVEKV
375142610YP_005003259.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMANATISRIEGDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAQHLLATRKRLGENRKRDLAAVVRDGEAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYAKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPVEK
INDLLEHSRDPVSLDMPVGSDEEAPLGDFIEDAEAMSAENAVISELLHTD
IRHVLATLDEREQQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERE
VMAKLRNGERADRLRSYAS
375142609YP_005003258.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKQSPELSFDDDGQPVLITRAAPAYEEQHRERVRRYLKLMFWRVPALIGA
AVAYGIWQNGLISLVILVASIPLPWMAVLIANDRPPRRAEEPRRYESTRR
IPLFPTAERPALEYRAYSSRQADETEPPRDVAG
375142608YP_005003257.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRTQTIERTDTDERVDDGTDDDAPKFFHYVKKDKIAESAVMGTHVVALCG
EVFPVTKAAKPGSPVCPDCKKIYEKLKK
375142607YP_005003256.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDQSQPLPRPPSRHHIRHIVRRTLSKSWDDSIFSESAQAAFWCALSLPP
LLLGMLGSLSYIAPLFGPETLPAIQDQLISTAERFFSSSVVNEIIAPTVR
DIVKNARGEVVSIGFVISLWAGSSAISSFVDSVVEAHDQTPLRHPVRQRF
FALGLYVVMLVAAIASAPFVALGPRKISAHLPEGLDNALASGYYPLLFVI
LVVSVNILYRVSLPEPLPSHRLILGSVLATVVFLIATLGLRFYLTWITST
GYTYGALATPIAFLLFAFFLGFAIMLGAELNAAIQEEWPASTTHANRVRA
WLKRKAEAKLNGGGKPAADATSDAATS
375142606YP_005003255.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTATLISPELTKADRCDRCGAAARVRATLPSGGQLLFCQHHANEHEAKLV
ELAAVLQVSPVEA
375142605YP_005003254.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRPLPAVLVHVCGAEDWRSAQTDGELRPESLTAHGFVHLSTPEQVHLPAN
RLYAGRTDLVLLRVDPARLSSPIRWEPGVPTDPAAMVFPHLYGPLPVTAV
ISVTSYEPDGNGRFGPVSP
375142604YP_005003253.1 putative translation initiation inhibitor- yjgF family [MycobacteriMQRHNVSSGSEFESTVGYSRAVRIGPHVAVAGTTGAGDGIASQTRDALRR
IDSALQEVGATMSDVIRTRMFVTDMSKWGEVGRVHAEVFGDIRPAATMVE
VTALIAPELMVEIEVDAYVT
375142603YP_005003252.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGILFGFAPWIVYWVLVGNVPFAAAVLVALAVAVGSFVIGRMRGAAGRTL
EIGAVATFLILAVLTFTLSQSFMEQWLQPLSSAGIFLVALGSVLLGKPFV
REFAEVGQPKEVIETDLFKKITNVLTWIWVAAFAGMTVSSAIPPIVYGEA
TILDTKTPLSFVCYWVLPFSLLGLAALASRILPERMAPPDEEIVRNTTFV
AFAEAEIDQLIYLATEHANREVGAGKEAFDIRIGSKGVPLVGDETRESWP
STYKVREKKR
375142602YP_005003251.1 O-methyltransferase [Mycobacterium rhodesiae NBB3]MKIRYRPVGCRSVPEKPAKVPPARVVRIIESARTALQKANRAMVPGYVAL
LETAQGAWVSQALYVAAKLGIADELADGPKTADQVAAKVGGHPDSVFRLM
RMLAGRDVFRQLQDGRFELAAMGQALRADAPGSLRPMVLFIGSPEHWAEW
GELLYSVQTGRPSPEKLYGKSYFEHLDEAPEQAAIFNDAMSTMAAMANET
VIPAYDFSKFKLIVDVGGGHGRLISAILRSAPTARGVLFDLPSVVAGADP
VLAEAGVAHRCAVEGGSFMDSVPDGADAYVLKSIIHDWDDDISEKILRNV
RTAIAPNGRLLLLELVLPERATANWGAVLDMEMLVSPGGRERTRAEFANL
LARCGFRLTRVVDTATPMMSIVEAAPA
375142601YP_005003250.1 excisionase family DNA-binding [Mycobacterium rhodesiae NBB3]MVGTLSAVPEIRIREAAELLGISDDTVRRWVDDGALDAHLDASGRKVIDG
AALAAFARANAGSAPKDPLTVASSARNRFAGLVTKVVTDTVMAQVEMQCG
PFTVVSLMSADAVRELQLEPGSVAVAVVKATTVIVETRGGQS
375142600YP_005003249.1 molybdenum ABC transporter periplasmic molybdate-binding protein [MMTSLRTFAVALLISALAGCGGGQDSSTTSSARDGGDRTVTVFAAASLKKT
FTEIGEQFTTDNPGVSVDYNFAGSSDLVTQLTQGAQADVFASADTKNMDK
AVEAGLVEGDPVSFASNTLTIAVAPGNPKQIKSFQDLTTPGLTVVVCAPQ
VPCGSATEKVEEATGVQLTPVSEESSVTDVLNKVTTGQADAGLVYVTDAT
GAGDKVTAVPFPESPTAVNTYPIAALETAGSGELARKFIEAVTGDAGQKI
LGAAGFAKP
375142599YP_005003248.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMVHDPLPASGTPAPTGTQRDERVYVAATKASPATDEPVKRTAAKKASAAK
STNGSAPAKRAAKATATKAAKATSATATKAKPAKAAAKSASAKAAPAKKA
AKAAGPRGRGKKATSPEADATTTDVEAEGLETEELEGEPDGDIDDAEIDL
TDIEVDDAESSEGDATEEAEGDKPAAKVAPAAPVEDDEIAEPSEKDKASG
DFVWDEEESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELA
KRIEAGLYATQLMLELADKGEKLPAAQRRDMSWICRDGDRAKNHLLEANL
RLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWW
IRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDA
VSFTLLQDQLQSVLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTR
ERIRQIESKTMSKLRHPSRSQVLRDYLD
375142598YP_005003247.1 transcriptional regulator/sugar kinase [Mycobacterium rhodesiae NBBMSATDSPATAPDTGAGQRRGFGIDVGGSGVKGGIVDLDTGLLIGDRFKLE
TPQPATPEAVSKTVAAVVREFGWTDKVGVTYPGVVTGGIVHTAANVDKSW
IGSNVSEFYSKALDGQPVTVLNDADAAGLAEERFGAGRDNTGVIVLLTFG
TGIGSAVIHNGVLLPNTEFGHLEVGGKEAEHRAASSVKEKKDWSYARWTE
EVTKVLVAIENAIWPDLFIAGGGISRKAEKWVPLLKNRTPVVAAALQNTA
GIVGAAMAAEVDVTATGK
375142597YP_005003246.1 inositol monophosphatase/fructose-1-6-bisphosphatase family proteinMVENDTHPVQLRLVAERLATEAAAFVRTRRAEVFGAAPDAPTTASPVRSK
STPTDPVTVVDTETEALLRDRLAVLRPGEPVMGEEQGGSLAGAGRLTWVL
DPIDGTVNFVYDIETYAVSVGVQRDGVSVAGAVANVPTGALYSAAKGHGA
QVQRGGVTTMIRASGASELSMSLVGTGFSYRAERRRRQAEILAALIPAVR
DIRRIGSCALDLCMVAAGRLDAYYEDGVHVWDWAAGALIAAEAGAVLRLP
PADGAPGFIVASAPGIADAMNDALSQSGAP
375142596YP_005003245.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVAQITEGTAFDRHGRPFRRRNYLPGILLLIALSVVTLTIWVMALNQPVE
VQETAACNPPPAPADPNTPPVSLGEQVTRSQMIDVTPAKLADTTIRVLNA
SGQGGQAAEVAGELRDLGFAEPSAANDPVYATARLACQGQIRFGPSGRAA
AAAVWLVAPCTELFEDDRTDDTVDLAIGTDFSELSRNDDIEAVLASLRPD
ATQMADESLIAKIHSTTC
375142595YP_005003244.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATDYDAPRRTESDDVSEDSLEELKARRNEAQSAVVDVDESESAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVHHRSRLASEKNGVMICTDCAA
375142594YP_005003243.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDTRATSQTVRYRERLTVPWWWWPPGLGLAAVIALEVNQGVPALPVWLP
FAILLPVAGVVLLLLGSTQVRVVSGDGEVEVWVGDAHLPVSVISRSAEVP
RSAKSAALGRQLDPAAYVVHKAWVPPMVLLVLDDPDDPTPYWLLSCRHPD
RLLSALRSPV
375142593YP_005003242.1 deoxyuridine 5'-triphosphate nucleotidohydrolase Dut [MycobacteriumMSSTLAVVRLDPDLPMPSRAHDGDAGVDLFSALDVELAPGQRALVPTGIA
VAIPHGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEVKVSLINLDPA
EPIVVNRGDRIAQLLVQRVELPDLVEVTSFDEAGLADTTRGDGGHGSSGG
HASL
375142592YP_005003241.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAFGKNKDDVSSGDAEVTSTPEADDDLDGPFDIDDFDDPATATVGRLDLG
SVLIPLPEAGQVQVELTQQGVPSAVWVVTPNGRFTVAAYAAPKSAGLWRE
VASELAESLRKDAGQVSIKDGKWGREVVGVAPGAQGQAGMVRFIGVDGYR
WMIRCVVNGPEENSDALAKEARDALADTVVRRGDTPLPVRTPLPVELPEA
MANQLRAAAEQQAAQQAQQPGEQPPQPPTPAARRSEQGSAMQQLRTITGG
375142591YP_005003240.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPVDLRGVTTVLLPGTGSDDDFVYRAFSAALHAEGAIVVTPKPQPQRLVD
GYRDALDNAACTAPIVVGGVSIGAAVATAWALAHPDRAVAVLAALPAWTG
APDSAPAAIAARYSANVLRRDGIASATAQMRASSPPWLGDELTRSWVGQW
PSLPDAMEAAASYVAPACSELERLEVPMGIAAATDDPVHPVEVGIEWMTA
APRAALRTVTLAEMGADPAVLGAACVSALLEL
375142590YP_005003239.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATAEGYLRRLTRRLTEAPEQLDVEELSDEAASTGAQKAIDCQRGQEVTM
VGTLRSVECNGKGCAGGVKAELFDGTDTVMLVWLGQRRIPGIESGRTLKV
HGRVGKLDNGSKAIYNPHYEIQK
375142589YP_005003238.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDPGANPGKRSTKAHAVLEQMGGISGLIYSSLPVLAFVPVSQLFGLTPA
IVSAMGIAAVILVWRLVRRESAQPAISGFIGVGICALIAYVMGESKGYFL
LGIWSSLVWAAVFALSVLIRRPVVGYVWGWVNDHDRDWRTVRKAVRAFDI
ATLVWVLVFASRFVVQHHLYDADQTGWLGVARISMGWPLTAVAALVTYLA
IRSAQRALHAHDALPDAQSENPGMAQPDAR
375142588YP_005003237.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMPADPDDRTSRRVDDTDKPLVAVAVLASFVAFLDGSVVNLALPAIGREFG
GGLALQQWVVDGYLLTLGALILVAGAISDQFGRLSVLRMGLMVFAVSSVL
CAVAPSGWVLVAARCLQGVGAAFLVPSSLAMINAHFSGPAQARAIGTWTA
WTGTAFVIGPLLGGVLVDALNWRWIFGVNLVPLAVTLYLVTKLPSGELAA
AKRPTRIDFVGALLNAVGLTGAVYALIEGQRLGFSHPAVVASLVIGIACL
VAFPLWEWRTPQPMMPLQIFAARNFAVGNLATVFLYAGVSLGMLVVGLFL
QETAGLSATAAGLASLPVPVLSFVLARRFATLAGTHGPRLFMAVGPLTAA
LGYLVMARASEPFDFWTQMLPGLVMFGLGLTITVSPLTAAILAAVDPAQS
GIGSAINNAVSRISGLIAIAFTGVIVALGERWGHGLGPGDDGNGGSAVDF
QGFRQGMLVTAGLFVLAGVISAVGIRNDRYDTSRVSASTAAPCHDRSTPP
PAYTPN
375142587YP_005003236.1 K+ transport system- NAD-binding component [Mycobacterium rhodesiaeMRVAIAGAGAVGRSIARELVDSHEVTLLERNPDHIDVDAIPAARWTLGDA
CELVVLESVQLHEFDVVIAATGDDKVNVVLSLLAKTEFAVPRVVARVNDP
RNEWLFDENWGVDVAVSTPRMLASLVEEAVAVGDLVRLMEFRKGQANLVE
ITLPDDTPWGGKPVKRLDLPRDATLVTILRGPRVIVPEGDEPLEGGDELL
FVAVTEVEDQLQELLLNPESR
375142586YP_005003235.1 K+ transport system- NAD-binding component [Mycobacterium rhodesiaeMVVAFSNAAVLSGEDRQVRVVVMGCGRVGASLSDSLARIGHDVAVIDRDN
TAFHRLSADFPGERVLGMGFDRDVLLRAGIEDAGAFAAVSSGDNSNIISA
RVARETFGVERVVARIYDAKRAAVYERLGIPTVATVPWTTDRLLNVLTRE
TETAKWRDPTGNVGVTELALHEEWVGHRLTALEAVTGGRVAFLIRFGAGL
LPDAKTVVQAGDQVFMAAIAGHIAEALAIAALPPSEDVDAE
375142585YP_005003234.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSKLSTVTRRLFLGKPFRSDKLAHTLLPKRIALPVFASDALSSVAYAPEE
IFLVLSVAGLTAYSMAPWIGLAVAAVMLIVIASYRQNVHAYPSGGGDYEV
VTTNLGPTAGLTVASALLVDYVLTVAVSMSSAMSNIGSAVPFINQHKVLF
AVIAILLLASINLRGIRESGTAFAIPTYAFMIGMYVMLAWGFFQIYFLGT
PLKAESAGFEMHSDHGEILGFALVFLVARAFSSGSAALTGVEAISNGVPA
FRKPKSRNAATTLALLGGIAISLFMGIIMLAKETGVQIAEHPHEQLIGAP
PNYHQKTLVAQLADAVFHDFTLGLYLIAGVTALILVLAANTAFNGFPVLG
SILAQDSYLPRQLHTRGDRLAFSNGILFLAFAAIAFVVAFRAEVTALIQL
YIVGVFVSFTLSQVGMVRHWTRLLRTETEPAVRSKMKRSRVINGIGCVCT
ATVLVIVVITKFMAGAWIAILAMGALFVIMKSIHKHYNTVARELEEQAAA
EADSMVLPSRNHAIVLVSKLHLPTMRALAYARATRPDVLEAITVSVDDGE
TKALVHRWEDSDISVPLKVVASPYREITRPILDYVKRVSRESPRTVVTVF
IPEYVVGHWWEQVLHNQSALRLKGRLLFEPNVMVTSVPWQLSSSERLKKL
QPQSAPGDARRGFLD
375142584YP_005003233.1 SAM-dependent methyltransferase- tRNA(uracil-5)-methyltransferase [MTVDATIDGPSGSSELTLTVGPPANGGSCVARHDGRVVFVRYALPGETVR
VRVTSDRGSYWHADVMEVIEPSADRVDSICPIAGVDEAGCCDLAFADPAA
ARRLKGAVVANQLARLGGFAWRDEAGAVAEPVGDHGATGWRTRVRLDTSP
QGQAGFHRYHSAELVTDLDCAQLPTGMLDGIHDWVWPHGAHVHVAVDDNG
DRHVVQSGPREGRKTPTHVIEGEYEAVQRVGERVWRVPVTAFWQAHRDAP
QMYSDLVAEWAQLGRGMTAWDLYGGAGVFASVLAEAVGDTGKVLTVDTSR
AASRSAREALAGAGWVSVLTDSVRRALSAQRIRPDVAVLDPPRTGAGREV
IDLLAAAEVPRVIHIGCEAASFARDVGLYRSHGYAVEDLRVFDSFPLTHH
VECVAVLTR
375142583YP_005003232.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQTLLPHPDFVVWCAAGKADTCAVTLVADLAQTIGMTTPGSQEQLAAAHE
LPPWLGDEALHRSHQSALSRKDPAHYGPLFPGVPDDLPYVWPAADRDRRV
PLS
375142582YP_005003231.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIVERRSVIDAPTDRVWARVVTPEGINDELRPWMTMSMPRGAKDLTVDTV
PVGTPIGRCWMRLFGILPFDYDNLMIAELFPGRGFDEQSTMMSMRSWRHE
RTLEPAGDAKTVVRDRLTFEMRAPLRVLTPIIGIGIRALFGHRQRRLRRH
FAS
375142581YP_005003230.1 Na+/H+ antiporter NhaA [Mycobacterium rhodesiae NBB3]MSNPLSRRLLTRSTWPEAKRLSEILRQETVGGVLLLIAAGAALLWANSPW
SDGYHALSDFMFGPEPVHLHLSVSAWAADGLLAIFFFVVGVELKREFVAG
DLRDPRRAALPILAAVGGMVVPAAIFVTINVTSGHPENVVGWAVPTATDI
AFAVAVLAVLSTHLPSALRTFLLTLAVVDDLLAIIVIAFFYTDDLSPSAL
ALALLPAGLFALCIQRGVRHWWLLVPLAVATWALVHASGVHATVAGVLLG
FTVPVLGRHACAENVERRLRPVSAGFAVPVFAFFAAGVTVGGWSGFVTDL
VSPVTLGIIAGLVIGKPLGVLCTSYLLARFTRADLDDDLAWRDVLGVSLL
AGIGFTVSLLIGELAFGHGTAAGDNVKIGVLVGSVVAGVLASVVLLSRNA
AYRRICELETVDADHDGVPDIYDARQD
375142580YP_005003229.1 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium rhodesiae NBMLEQIRGPADLQHLTQSQMSDLAQEIREFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPIIFDTGHQSYVHKMVTGRIHEFDTLRKKDGLSGYPS
RAESEHDWVESSHASAALSYADGLAKAFELSGHRNRHVVAVVGDGALTGG
MCWEALNNIAAARRPVVVVVNDNGRSYAPTIGGFAEHMAGLRLQPGYEKV
LEEGRKAVQKVPVIGELCYQGMHSIKAGIKDALSPQVMFTDLGLKYVGPI
DGHDEQAVETALRRARGFNAPVIVHVVTRKGMGYAPAENDEADQMHSCGV
IDPETGLATSVPGPGWTAAFSDALISYAARRRDVVAITAAMPGPTGLSDF
RKRFPDRFFDVGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMM
DVALHKLPVTMVLDRSGVTGPDGASHNGMWDLSLLGIVPGIRVAAPRDGV
RLREELGEALNIKDGPTAIRFPKGDVGEDIPAIEKRGEVDVLALPADGLS
DDVLVVAVGPFAVMALAVAERLRNQGIGVTVVDPRWVLPVPSVLGELAAA
HKLVVTIEDNGVHGGVGSAVSAALRRAEIDVPCRDLGLPQEFFAQASRGE
VLTDVGLTDRNIARQITGWVAAQGSAVSETEVSRQLD
375142579YP_005003228.1 phosphodiesterase/alkaline phosphatase D [Mycobacterium rhodesiae NMTLLLGPALRHVSDTTALIWVQTESAGVVEVLGCSAPTFEVQGYHFALVE
VTGLEPDSVSEYQVRFEGATVWPLADPSFAKFPPSVIRTRGPASAHRLRA
IFGSCRYPKTQVKKVEKKLKHDALDSYATRMRDLPIDKWPDALILLGDQL
YADELPPDEVRRVAGRRRNRNGDRPPDEVVSFAEYERLYRHSWGDPEIRW
LMSTVPTAMIFDDHDIRDDWNTSKVWRAQMADLDWWHDRIRAGLASYWVY
QHLGNLSPDELADNEDYQQLLAVDGDTWPHLAEVADRADREVDSNKGVRF
SYRWDLGRTRLIMIDSRNGRILDSGERMMIGEKEFRWVEAKAEENPETLN
HLLLASSVPWLMPPAIGDLETLNEQAAERAGWRGKLGEKLRQAGDFEHWP
AFYKSLVRLGEMIARIANHPDGPATISILSGDVHHSYAARAEVDGVSPDG
STVHQLVCSPVHNYVPLFVKPAFLLGWTKPAAAVTRWWVRRSGVQSPPVA
WTNVCGPLFGNTIATVEVDGRNAEVFFEQPRKTEALQEAGRVPLNRAGG
375142578YP_005003227.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MDAELERWKTAGQYFDYLGFDIFYRVEGSGPNLLLVHGYPFNSWDWSLVW
PTLVDRFTVIAPDMIGMGFSAKPVAYGYSVPDHADMHEALLAHLDVDSCH
MLAHDLGDSVGQELLARSEFGEHSYGSIRYDSITWLNGGLFNEAYTPRTM
QKLMSGTPLGDLISPLQGRPLSRRIVEPTINEMFGPNTKPSRELMGRFHE
ILEYNDGKRVLHKVGRFLGDRYTHRNRWVRAMRETSVPMRLIDGPIDPNS
GAHMARRYAEVIPDADVVMLADDIGHWPQIEAPEAVLEHFLAHIDRVG
375142577YP_005003226.1 ribonuclease D [Mycobacterium rhodesiae NBB3]MTDPHEADPESGPEDEPEATPLLAPRDGVPDLAVSADEIKSAAELLASGS
GPFAVDAERASGFRYSNRAYLVQIRRAGSGTVLIDPVNHGGDPVDTLAPI
AEVLATGEWVLHAADQDLPCLAEVGLRPTTLYDTELAGRLAGYDKVNLAA
MVQRLLGLQLMKGHGAADWSKRPLPHDWLNYAALDVEVLLDLRHAIAAVL
DAQNKSDWAAQEFEHLRMFEGAPTRRDRWRRTSGIHKIRDPRALAAVREL
WITRDRIAQRRDIAPGRILPDAAIVNAATADPDTVEKLTTLPVFGGSRQR
RQAHVWLEALARARTTDDPPTPQEPSTGPPPASRWARRKPEAAVRLEAAR
SGIAELSQRVSVPTENVVTPEIVRRLCWDWQPLPTAEQTASAIDEFLRDA
GARQWQRDLAVPVLADALYPDPTQANSD
375142576YP_005003225.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVTTAEPVQFREAVAAMNATTVRAEIELGPIRPPQRLAPFSYALGAEVRH
PETAIVPERSEGDAFGRLILLHDPEGAEAWDGTMRLVAYIQADLDASEAV
DPLLPEVAWSWLVDALETRAEHVTALGGTVTATTSVRYGDISGPPRAHQL
ELRASWTATTLQLGPHVEAFCEVLEHAAGLPPTGVTDLSSRTRA
375142575YP_005003224.1 uroporphyrinogen decarboxylase [Mycobacterium rhodesiae NBB3]MRPDRELGRYRVGMAALEPMTTRRELPDSPYLAAARGRKPSRVPVWFMRQ
AGRSLPEYRALRAKNTMMQACFDAELITEITLQPIRRHGVDAAILFSDIV
VPLRAAGIELDIVPDVGPVIDHPVRTVADVNAIKPLEPQQVAPVADAVTN
LVSELGDVPLIGFAGAPFTLASYLVEGGPSRNHERTKAMMLGESDTWHAL
MTTLTDVTIAFLQTQLTAGVDAIQLFDSWAGTLSLADYRTYVLPHSSRVF
STLKDAGVPMTHFGVGTAELLGAMGEAGASVVGVDWRTSLTDAATRVAPG
TALQGNLDPVVLLAGWPVVERAARAVVEDARRAVDAGAAGHIFNLGHGVL
PGTDPDVITELVALVHSL
375142574YP_005003223.1 protoporphyrinogen oxidase [Mycobacterium rhodesiae NBB3]MSASYSVVGGGISGLVAAYRLRVAAGPDASITVFDPADRLGGVLRTERIG
GQPMDVGAEAFVARRPEVPALLAELGLAGRQISTTGARPLIYSQGRLHAL
PSDTLQGIPAHAEALTGLVDDATLAWIRDEPTRPFSWRPGADPSVAELVG
HRFGDQVVARSVDPLLGGVYAGSSATIGVRSALPPLAAALDRGARSLTDA
VRDALAASAPSVTGSVFGAIDGGYAVLVDELVRRAGIRWLQVAVERVDRG
QQGWEIVDDEGMRHQADAAVLAVPAPRLARLVEGVAPRTAAAARRIGVAS
SALVALALPGGTPVPQQSGVLVAGGERLHAKAITLSTQKWGRRGNVELVR
LSYGRFGDDLARNVGDEDLLAWAAQDLATVFDVAAEPEDYHVQRWIDAMP
QYGPGHGELIADLRAGLPPTLAVAGAYLDGIGVPACVGAATRAAASLVTS
RVAR
375142573YP_005003222.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAKLDYDALNAEVRYLMFSVFSVEPGELGEDRSAVVDETATFLKQQEDKG
VVVRGIYDIAGMRADADFMFWTHAETVEALQATYSDFRRTTALGRVSDPV
WSSVALHRPAEFNKSHIPAFLAGEEPGNYVCVYPFVRSLEWYLLPDDERR
KMLAEHGMAAREYKDVRANTVPAFALGDYEWILAFEAPELYRIVDLMREL
RATDARRHTREETPFFTGPRVSPEQLIASLP
375142572YP_005003221.1 malic enzyme [Mycobacterium rhodesiae NBB3]MFDALRTKGTAFTHAERLELGLLGLLPTAEKTLEEQAKHSWREFSTRREG
LDQHIYLRALQDRNETLFYRLLRDHIPETMPIVYTPTVGEACQRFSEIYR
RPRGLFVSYPDRDYLREVLRNRPADRHDVDVIVVTDGQRILGLGDQGIGG
MGIPIGKLSLYTLIGGIDPARTLPIVLDVGTDNVELLEDPEYLGWRHRRV
ADEEYFAFIDEFVTAVHEEMPDVLLQWEDFATAHAQPILERYRDKLLTFN
DDIQGTAAVALGALHGAATIAGRPLSQQQVVMLGAGSAGIGVLNMVRREM
VAQGISEQEATSRIWVVDVVGLLTDDRTDLSEGQRSFAQPASAVAGWGVS
GAAQLADVVHHIDVGVLLGLSTAAGAFTEQIVRELASKTDRPIIFPLSNP
TSRAEAHPAELDEWTDGRALIATGSPFAPLVRNGVQRPVAQCNNAYIFPA
MGLAVTAAQATRVTDEMMRAAAASLGDASPALTDPDAPLLPAWNDVPEIA
VRIALAVGRQAVADGVAPKRSDDELAARIDEVRWIPEYPTT
375142571YP_005003220.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSLKALITTTLPLVALAMAPSAVAQPPGGSHCPPRDGQSVVITVGDIDCV
TAADFAAQYDPNGDKYQQIGPFTCYSGNAMTAPLIFQCVADTEDHAEFGV
YPG
375142570YP_005003219.1 methionine-R-sulfoxide reductase [Mycobacterium rhodesiae NBB3]MTTPAPKLQLTDDEWRKKLNPQEYHVLREAGTERPFVGEYTDTKTDGVYQ
CRACGAELFRSSEKFESHCGWPSFFDPADSDAVILRSDDTLGMHRVEVIC
ANCHSHLGHVFEGEGYPTPTDQRYCINSISLKLVPAES
375142569YP_005003218.1 adenylate/guanylate cyclase family protein [Mycobacterium rhodesiaeMAENRRACASCGAPNEEDARFCEGCGGSLARICVTCGVEASATARFCRGC
GAPLNDQTTQPRMPVAGPVRKTVTVMFADLAGSTTFEERVDPETAREVIG
RYHELLRSTAERHRAGVTKYIGDGFMAVWGVPEIGADDAVHAVDAAVELQ
ERFVGLAAQIDESHGVELALRVSVNTGEVVVGADDADLVGDALNVGARLE
SECPRGRVVVGEETWRATRGHYGYESLGKVHVKGRTAPVAVYQWVARQSE
TTDTAPFVGRGDEVRRLQAAMDDAVSACAARLVTVIGDPGVGKSRLAAEF
TRSQVDARVIEARCVLEGTVALSPLVEVLRALDLENDIPASTPERDRLLR
DLHGLADGVPGSVEENFWALRRFVEVLATRTPVVLVLDDIQWADTLLLDF
IEHLLEWVKDVPVLVLSLARPELRDIRPELVTVSRWGSEAVHLGGLDAGA
TAELAARVLGATRLPDELLNRLPSSTGGNPLFVRELIGMLAHDGVLIEES
HGWRLTIDVDAITIPPTIHALLASRLERLDATDRRVLEIASVVGSDFSLG
PVRALADKGTEGIKLSLNRLRRLELAQPSGAYVGDEPVWRFHHVLIRDVA
YRRLLKSDRANLHERLADWVASGGQSVAFDADEMIARHLEAAHSYRRELG
TADEHTGDLALRSARHYTTSARRALDRDELVSAGTQAARGAAVAAADGAL
HAELLLIGCEAYLSAGDVAAGAPLVDDLDRIADESLAPWATCYRCQFVVY
TEPERLPDVDTRLQGAIDEFTRRKDSAGLAKAHRVRASARSRLGRIGDCE
ADLFEALIAARHSGDHRQITAALGAAPGAALWGPSPVPKAGGRCLDVVRM
QRMTTAAPSLEATSLRHLAVLELLRGRPDKARKMLADARQVVADLGLRHG
LMETELFAGIIESMEGDAVAAEPHFRTALDGFKALGVSADAGQAAALLAR
MVLAQGRIDEADCYAAESERLAGRNLKTAIGWRAVRAEILAAQERYEEAV
ALARDAVAVAAGTDLVLDHADACLALRRVLDAAGDTEGANAARAKAEMLY
AAKEVTARIGRVPPAASPTPTVTPSETTSSPSRLQVTNQSCAFLPAFVRA
LHAFDVDGALSAFSDRFVYDDHRRLSGDPITGLVEMRRAIERIFEQYSQF
EFRVLAVRGQSLNLLWSRWSDTHGNQTSTLYVNEADDDGRVLYHGRFDED
DFEKAYRELDRRYYAGEGVVFAESGALTTECLSAVNQGDFDRLFGELSRS
DLRFEPRSRNAFPARSAEDLRASFESLAAMVASSRTWLATVAWVSPEWAV
SRFERTAIGLDDERYSWTRILVIGVRGGLLAALCQFEIDDEAAAFAYAEE
QSRGFTSRLAVANLASNTFDIVCLAMRDHDAKGAVRVYSKTFAYDDHRRV
SGGPVVGIDAMRTGIAMLCEQYPQLEWRTMAVRGELLELRWARQWDDAGN
ETSGLMVIEVNRSGQIVYQGRFDEDDFDSAIQELDRRYFAGEGAAFAENG
IPSSEAPRAMDRNDFGLLFGELCAPDLIVESRSSRAFPHRSAAELRRGFE
ELNKFVASKRTWNSACAWLSPTVSVIRLEREAIGHDGETYEWAMLLAAEH
ADGRLITLCEFDPDDEASAFEYAEVKVRAQAGRLVVANKASETLHTLQRA
MQAHDIETSTSCYSEIYDYDDHRTISGGAIDSREAMRAAILHVFDQYTDF
EHRVLAVRGERAVLFWSKWSDANGNETVGLFVHECEYDGRITHTARFDEN
DFDAAYRELDQRYYAGEGAEFAEWGNLATEWVAAVNRGDFEKAFGELTAP
GAQMESRSRSPFPDPTVSDLGVSYQDLTTMVASMRTWLSIGHWLSHNLWI
ARFEREAIGHHGEQYSWTWIVVGEARNGQFVSSCIFDIEDEDAAFAYAEE
RMRTPASRIGVTNRSVQTADMLYRALNAHDIDEVLKHCAEPFTYDDRRRL
TGDPIDGRAEVRAAFERVLAQYSHFESRILAVRGDRLHLHWGRWSDDSGN
ESAALHVFETDGNGRQVYEGRFDEDDFEGAYCELEKRFIAGEGAAYATPI
TVSMNWITALNRGEVDRMLTEFCTPDVRFQSRSRSAFPERSGAELGASLR
ELGAMVSSVRTWNSAVHWMSPDCAVVRMQREAQGLDDERYNWTRIYVAEF
RSGLLASLCEFELEDEEAAFAYAEERRRASTSRLAVTNRSSDVVRAIVGA
ATAQDIDAILAHYSERFEYGDHRRLLGHPVHGLSALREAFERILLQYTHS
EWRTLAVRGDTLSFHWSRWSDDSGNETAYLHVFEIGDDGLIVYEGRFDEE
DFEGACRELERRYYAGEGAAFAVPGVTATEFEMALNARDYDRMFDELAAP
DMRLVNRSRSVFGDRSSAEFRASIEELDSMISSVRTWNSAARWLSPNWSI
ARQEREAVGIDGEQFAWTRIYVAEIRDGRMASLCQFEPDDEAAAFAYAEE
RIRASTSRLAVTNRSCESAVAMTSAMHDQDIDGIMSLLSEHLEYDDRRQL
SGGPIVSRGEFRAAFERILQQYSRFEARILAVRGDRLNLNWSSWSDISGN
ETSYLHVFEIGDDGRQIYEGRFDEENFEGAYRELEERFYAGEGAEFAEAG
NMLTDFTIAANQGDFDRIFGDLSSPDFHVDNRTRSGFPDRPSAQFRASLD
ELRNMVTSLRTWSSAVCWVSSSWLVFRLEREALGRDGERFSWTRVVASEI
NDGRVASMCAFEPEDEDQAFAYAEERAQAAASRLAVTNRASERSHAARQA
AQARDVDAMVDCYVESFVYDDRRRLSGNPLGDRRSAAEGILAQYAQFDGR
TLAVRGDRLCLSWSRWRNDEGFETEYLIVHEVDDSGRFVYEGRFDEDDFE
GAYRELTRRHYEGEGAGIAETGRLADDLTTAMDRGEFDRILTELALPEFR
LENRSRSIFPDRSAPEMIAGFEEIGRMVVSTRTWNSAVCWLSPSVLIGGF
EREAIGADGERYAWGGINVAVQRDGRFASVCLFDAGDEAAAFAYAEECVR
QEQQR
375142568YP_005003217.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSLIPDDPSSITTEWLSEVLGADVVTCKVEQIAVGVGLLGRLFRVHLEGG
PEVPATVIVKLPTLDMRARVNLCEAAEFYLREVRFYQEVGAANPLSPAHP
YYAAFDDATHDFVLVMEDLGRLRNADQIVGCSPADAETVVDGIARHHAHW
WDNDRLAALTWLHAYNTEPFSTVVADAYAAAWPGFVERVGYDMSAALRAF
GERMPSLMPWYLAEICRPPWTFLHGDLRLDQLFFAVGPEDAPVRALDWQI
TSKGRGAFDLAYFLSQSLTAETRRNCEDDLVDRYAGRLGECGIDYPRAEL
RRDYRLTTAWCFIYPVIGSGQIEIANDRQLALLRTMFRGSATAIEDHDAL
SLHPD
375142567YP_005003216.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMRDLVLAAFRPRTSAPNAATVLRSILWPLAILFIIHRSYVLATNGYITDD
YGPVYRAVVNFKMGWDIYNEHFNHVDPHYLYPPGGTLIMAPFGYLPVDAS
RYWFITFNTIAIILAAYFLIRLFGFKFDSVALPALLAAMFISESVVNTLV
FGNINGCILLLEVLFFRWLLDGNRNHEWLAGISIGLTLVVKPLLAPLLLI
PLLNRQWRALVPAFLVPLAFNAVAWPLVKDPMNFVTRTSAYIFTTRDYFN
SSIAGNGLYYGLPTWLIILLRLAFIVLAVLSLWLLYKYYRTRDPLFWMTT
SSGVLLIVSFLVSSLGQGYYSMMLFPFLMTVVLKNSVLRNWPAWLAIYGF
MSADRWLLGHWPTTGRFLEYMKFTYGWCLMLIVVFVVLYFRYLDAKSENR
LDAGIDPVWMKDATKTPTPAQTE
375142566YP_005003215.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MQRRHPVRVLSTSALVLSVVLAGCAPGLAANPRYATDSGAHPQGQPATTK
PPEGPPPIEAPKNDLSWRDCTSRVFGDASVAPIPGVKLDCATYDADLDPI
KGASGTISIGVVRATTDQTPQDAGPLVMTTGSDLPTSTQLPVWLTRSGSD
VLKTRPIVAVDRRGIGMSGALDCRDLYDRQAMLDQAQFQPGDDPVANLGE
IAQAATTSCTDTIAPGDSAYDNAHAAEDIERLRSTWDVPSLALFGVGNGA
QVALAYAGSHPNKVARLVLDSPLPLGIAAEAAMEQRVKGEQSALDAWAAQ
CVAVNCPLGPDPKGAVDAVLDQVRGFDTSSAHSVAAVADAIATALAYPRG
DRVAATNRLASALAGARSGDWNGMDTLVSEAETLRGTDGQFVNSCSDSLN
RPTPDRVRELVVAWEKLYPQFGQVGALELVQCLNWPSGSAPEEPQNLKTP
VLLLGTQHDPIVGNEGVAAVAATALNAGATNKRVIWQGIGHGASVYSPCA
LPPVSGYLDSGQLPDTDTFCPA
375142565YP_005003214.1 pyrimidine reductase [Mycobacterium rhodesiae NBB3]MLFMADTAAGVQFTVLGPDGSAIDGADGRLSDFYTYPEGLQQCWVRANMI
ASLDGGATSDGKAGGLAGPGDRSMFALMRHAADVILVGAATVRVENYSGA
QVPLAQRSARQQRGQAEVPPIAVVTRSGNLDPDALFFTRTEVPPLILTSA
DSFDDAKQRLGAVSEVLNASGPQSDSVDNATALQLLAERGLFRVLAEGGP
LLLSQLISDDLLDELCLTVAPILVGGQGRRIAAGAGEVHSTMRAAHLLSD
GEGYLYTRYVRAR
375142564YP_005003213.1 putative ATPase [Mycobacterium rhodesiae NBB3]MDGSSDVGHLVDRHPKVTPERLVAALTPPPTFADVSFDTYIPDPVEPSQS
AAVQSCRQFCGQAVERRTGRKKLFGRREVLPGVGIYLDGGFGVGKTHLLA
SSYYELPEPKAFATFGELTQLASVFGFVECIDLLADYVVVCIDEFELDDP
GNTTLISRLLSQLVERGVSIAATSNTLPEQLGEGRFAAQDFLREINTLAA
IFTTVRIDGPDYRHRDLPAAPEPLSDDEVSARAAQTPGATLDDFDALCAH
LATMHPSRYSTLIEDVTAVFITGVHGIDDQNVALRLVSLTDRLYDAGIPV
VASGEKMDTIFSEEMLAGGFRKKYLRATSRLLALTAAGQTR
375142563YP_005003212.1 acetyltransferase [Mycobacterium rhodesiae NBB3]MTAAVAADLHELADVAAQTFPLACPASVSADNVAAFIDENLSEDRFRDYL
ADPDRLVLAARHDGRMVGYAMLIRGVSDDDDVRRAVSVLPAIELSKMYVL
SDSHGAGVSAALMSAALERAAKLQAGSVWLGVNQKNQRAQKFYAKHGFAI
RGTKTFQLGDATENDYVMVRPA
375142562YP_005003211.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRRWFVLVVASVMTFAGLMASPAQAAPVEESTPAPIGRIGETLRVNFEGL
VADITVNSLDPSPVPPGFGYPPRPPRYQVWRAQITVHPIELPTSYAQIIT
YQFRGVTATGDSYEPRNTDAPDALALALTNAPAGSTVSGGVWWDCYRDLI
SNVVLLDKVTGQHLAQWNVS
375142561YP_005003210.1 PPOX class F420-dependent protein [Mycobacterium rhodesiae NBB3]MELNDAARDLIGEGTDAILVTLNADGSPQVSTIWMELQSTPDGDELVSAH
LNEYRKTRNIRRDPRVAVTILAGEKPRQLRDYLSITGTARIVEGGAPDLL
KRLARVMLGSDEHFPPPNAPEGLLTRVRIDKIGGSGPWVSEKRL
375142560YP_005003209.1 O-6-methylguanine DNA methyltransferase [Mycobacterium rhodesiae NBMSANIFDELQADDETMSRLHARLEGAAEADHSLDLAYRTIDTPVGSLLLA
ATTVGVVRVAYDIEGHDVVLSRLADTVSPRILQSPARLDALARQIDEYFA
KRRTTFDVAVDLRLANGFRRDVVEHLRNIGYGRRESYAAVAAAIGHPGAV
RAVGTACGHNPLPVVFPCHRVVRSDGSAGHYVGGAAAKTALLELEAG
375142559YP_005003208.1 sigma-70 family RNA polymerase sigma factor [Mycobacterium rhodesiaMRVRPFEEVVAEHGATVLRVCRAVVGPIDAEDAWSETFLSALRAYPTLPA
DANVEAWLVTIAHRRALDVGRARTRRPVPTDTLPDRATPNADPATRDPDL
WTALQRLPTKQRQAVAYHHIAGLPFAEIAILLDNSPDAARRAAADGIKSL
RKTYQKDERS
375142558YP_005003207.1 Clp amino terminal domain-containing protein- partial [MycobacteriuMTEPAKITNPVRLDDLIDVIKKVHEEPLEQLTDAVLAAESLGEIADHLIG
HFVDQARRSGASWTEIGKCMGVTKQAAQKRFVPKAPSADVLDPNAGFGRF
TPRARNVIVQAQNKAHEAGNTEITPDHLVLAMFTDPEALAVKLLAGQNVD
ATKVCEEVTLPPRSEGDLPALTPFDGPAKKVLELTFRQALRLGHNYVGTE
HIVLALLESEASDGLLHRLDVDQERFERDLQTALEPFTKN
375142557YP_005003206.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMTERIEVARTIAAPAADIFAVLCDPQGHVAIDATGMLQDADGDPARAVGD
TFVVHMDRESLNDYPLGKYDVTVSITQYEQDKLIAWTIFGQLKPDIGHVY
GYRLEPTDGGTLVTSFYDWSDIDQHWRDANIFPIVSELALRATLGILDRT
VRRGYPQASTNG
375142556YP_005003205.1 transcriptional regulator containing an amidase domain and an AraC-MSTNKVEPSTAQPVLLRRALAFIHDNAHRDITLSDIAASVNVTPRSVQYT
FRRHVGLTPLEYLRSLRLDHAHRELQAADPSVDTVMAIAGRWGFGHAGRF
SSMYKRTFGHSPSRTLRGERSAHRHQRG
375142555YP_005003204.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRELIGAIAIAGAAISAAPVAAADDLMYPDTSGRYPSDVPGMNYEAHLT
APCTNMERFTFGRGPGGEVLQCRWIANQWPPVYTGFWVATYELFGVQEQG
APCPKPQATAQHPDGRPMLCLGAQGWQPGIFTRDGFFPR
375142554YP_005003203.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSIKHIAVSSAAIAVVGFGAVAGAVSLSEAAATSTTPEMANVHSWGELLA
STPQPAFHR
375142553YP_005003202.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNTTNLKKIAVAGAVSGALGLAAIGLGTGTASADPLDDIAPMIPSDVTDE
VVNYLPLIESVSEIGSNAGLGELGNVPVLGDIGNLGNLPDLLALAGGF
375142552YP_005003201.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAPDHAENTGDNLRHAAEVQEKAKEGDGPAATTAEQSVEKLPPDFNT
375142551YP_005003200.1 response regulator with putative antiterminator output domain [MycoMSADLFAPLARLQTTAEAIEGLRDLFAAEEVLDVVAERVAKTALAAIPNA
DIISIAVLSWPDARTAACTHEEALELDYQQYASGRGPCLEAAMQRTPLRA
VIDEEHQRWPEFVEAAQRNGVRASLSVPLLMVGMDYEQELVGSLNIYSHA
ATAFDSFDAELMRLYSVAAGQAISNSSRWQSARETVNQLETALISRSDID
MAKGALIALHGCSPSEAFDKLADESQRRNIKLRDIAGEMLTRMQTRV
375142550YP_005003199.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSGTSFASSAVLVTNNTMLVTDTGLGRNDQGPRYEVGFTGEGVSLVYLR
DVGAAHPLS
375142549YP_005003198.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNKTLVVGATTLTLLFGGTGVAAASTFEAPASTTTTVAQAQETPEDDGGD
NGLWGLAGLLGLVGLVGLKRRKDADYPANRAGGTITNNPRV
375142548YP_005003197.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQAPTSPLGPARGGLASTLGGRRDKVCAGALAVGDVVDQAACADVVPVAH
GTMPAPARWRRLGLAAERVLERRPDANDSPRTTLSIQALVHTGIASRCSS
VAKYPRCRSIYVFAEDSLDPARYSPLVVATVRVRVSVLAREHPSRPYPES
GTAEEPKGRIRMSGHEDVGSWRNVDIPDDMPVSRILRDYVANACGFDSYL
SAGTQADPFDVIGLLWGAVLGLEARLADAQRQQETHG
375142547YP_005003196.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAQVIRRSATVVAGFATALATLTACGGSPAPQPTSPSSAETVASAKSPAR
TSSTGEPKPVDREVSAYTGFISPTGNVSCAIDVDLARCDIIDRDWSPPPR
PADCEFDYGQGIQLVPSEPASFVCAGDTTFGAEEVLPYGEAITAGPLRCE
SAESGITCRDAGSRHSFTISREAYDLS
375142546YP_005003195.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLHVARLRMSGWRAAQFLPLVIQPQGCPGSLLLEVQWHHNYSPCRTCCDT
GPGSSNGSHRARRASLHFVGRIGAHQRSSAPLQGHPTGGRQQMLRAHSDE
VTEAEFRAVPAVESVDILCIGSGSAGLAAGIAGADAGLQVLVADPAQRVV
TPAQTPVDVESWTTLLQRRWGTELLGDQTSTYLDEMTSSLGPASVARKAG
HLPVGTVETFTDLSGDPTQTVPPFRGSELATWARQCLASPFGMILSRVST
STLTPMRQVHGTDITATRIVSVPMAARGEVTVREWLSDVARDRNVTVNEC
SVQGLLFNRGQPVGAVLDTPDGARSVRARRGVLLGTSCSTSDAVLAMSPM
AIVGGATLCVVGRTASRFARLEFLHSAAALEQCAPPGRLA
375142545YP_005003194.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDASDQWQISGYARRQTKAPTARTLTGTSAAIGTGIDHDTRRAVRVRRRR
RASTYDRQMREPAITDDGRYIVVNGRRWRATDPLIPEERRVELVRILMAW
RREVRRAKGTAKESEARAGVHAAKVALGERGDPPWWDQNEAHRRARWQVE
VAEPR
375142544YP_005003193.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPDMATPDPDRPEPGPEAGIDDIEADIEQTREELGQTVAALTDKLDVKGR
AKEKAAETKAHVVDKADALKHSATDNPQRTVPIAAVVLVSAIAVGVLVWR
RRRR
375142543YP_005003192.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAVESKPAADASIGELLSQMSTQTSRLVRDELRLAQKEFQQSAKHAGLGA
GLFSAAGLLAVLGLATLIGAAVAALSLVLPVWAAAVIVAAVLFLVAGGAA
LIGRRQTEEVTPAAPKTVETVKADLQEVKDARHGNA
375142542YP_005003191.1 EmrB/QacA subfamily drug resistance transporter [Mycobacterium rhodMGNGDVVFGFADSGPLVRRRGGMLIVMRDSGSRELTRTPGQYPDRVDARL
LRIGAVCLLASMMAGLDATIVAVAQRTFVEEFHSSQAVVGWTVVGYILGL
ATVTPMTGWATDRFGAKRVFIGSVLAFTLGSLLCAMAPNILLLIVFRTIQ
GIGGGPLMPLTLTIMLREAGPNRLGRVLALGAIPMLLAPISGPTLGGWLI
RSFGWEWLFLINLPVGVLTVVLAAILFPRDQSTRLERFDFVGMLLLSPGV
TALLYGLSEIPGRGAVTDRHVWIPVIAGLALIAAFVRHALHRADHPLIDI
RLLKNRAVGLANTAMLVYVIGGSVGLLVPSYFQQLMHLTPLQTGLHMIPA
GLGAMLTMPLAGTFMDKFGPGKIVLVGLILVVTGLGVFTYGVAIQAAYSP
TLLVAMVITGMGSGCTMLPLSGSAVLTLESDQLARGSTLITVNQMLAGSV
GAALMSVLLTNQFNRSENIAAANTVAILQRQAAETGLPVDETAIPQLTLG
PDFVAALQRDLSAAYTTVFLVAVVLVALTFIPAAFLPKKPTGRSANELAR
PTA
375142541YP_005003190.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALPGPPLAPPIVPPPLVPPIVPPPLVPPLVPPLVPPIVPPLAGPVPIGA
PVAGLPLTTMGGAPAGKGDPVGPAPSGAPVAGQPIAPGPGASGH
375142540YP_005003189.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDSVAHGAMRMKPIQPETVRGTSMPFSRTMIGSPTLTVFMYHSASSVLS
PMQPWLTFSYPI
375142539YP_005003188.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRVVVRCVLAAIVIAGGLVAGPTGPSTAAASRSYQPAITSVLPTQGAVVG
VAHPVVVTFRSPVADRRAVERALDITSVPAMTGTFDWVENNVVQWVPDQF
WPAHSTVALSVRNMPLTNFETSAAVVGVADIAAKTFTVTIDGVPPSDLPA
PHHRANWGKPGVFPASMGRPEYPTPVGTYTVLSKEHDVMMDSSTVGIPVT
APDGYQLDVEYAVRFTQRGLFVHSAPWSVNQMGYENVSHGCIGLSTEDAE
WYMNTVKVGDPIIVRENGIEVPRTVSG
375142538YP_005003187.1 response regulator with putative antiterminator output domain [MycoMNISSEVETTHLRIAELVQNLHSRPSADSDTVIAELAEHAAAEIPGAQYA
GVTVTRNRKHIDTPAATHMYPMLLDKIQERHREGPCLSAAWEEKTVHVAD
LETDKRFPRYRKDALAETPIRSIMAFQLFIAGETMGALNVYAESANAFNS
ESKTIGLIFAAHSSVAWNSARRDEQFQNALASRDIIGQAKGMIMERYGVD
AVQAFDLLRKLSQDSNVALIKVATKLVNDTAPDAV
375142537YP_005003186.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKLSDIADLPLTYSDVGATASTLPAGYHHVQKSAVIGRGRQRFEEAAAAG
MRWGMLRGAGVKVRATTALAAVGSEVIVHLGPVQAPCRVVYVVEEPDRGG
FAYGTLPGHPESGEELFLVRYDPATEDVFAEVTAFSRHATWWSRLASPFT
SLVQRVVTTRYLKAL
375142536YP_005003185.1 putative oxidoreductase- aryl-alcohol dehydrogenase like protein [MMTTFTLGGDLPVNRLGFGAMRLTGKGVWGPPDDHDECVRVLRRLVELGVN
FIDTADSYGPFVSEELIKEALHPYADGLVVATKAGLLRTGPDEWPPLGFP
AYLRQQCEMSLRRLGLDTIDLFQLHRIDTKFPAEDQVGELVKLQQEGKIR
HIGLSEVTVDQLEAAQNVATIASVQNMYNLSVRTAEPVLEACESQDIGFI
PWFPLAAGPLAAADGPLQRIAADHGASASQLALAWLLKRSPVLLPIPGTS
KVAHLEENVAAASIELSDDEFDTLSKAGSAPPGSGNPA
375142535YP_005003184.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTDEPSGAHPGGGFNPPVPTTRGGPDYGRFVEAVRTLQDHARAADAPDE
VIAEAADLVDKVTHLLAPYYADEWASPSGRRMDLPNRGNLLAIPLDLHTT
PDGRIEGTAMFRRFHLGRNGAAHGGAVAQLFDGLLGYTAFTLSGSRAQRT
AFLHVDYRRIAVVEKQFQVDGRIDSIEDRKIFVSGRLMDGDDVVAESHAL
FVKLKPGQP
375142534YP_005003183.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKQDEQQGPVRARRWARWRDKLRDRPKVEFVYRIGVGFVGLVVFAVGIVA
IPYPGPGWAILFVGLGILATEFEWARRLLAFAKERYDKVMAWFQERHWSI
QILGGIFTALVVAGTLWLLGAADWTAELFGRDWPWLNSPIGLGS
375142533YP_005003182.1 threonyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MSAVVSPASAAPIRVAAGTTAGEAVREAGLPGRGDPQAIVVVRDAEGRLR
DLSWVPDTDVDVAPVAADTEDGRSVIRHSAAHVLAQAVQEIFPEAKLGIG
PPIADGFYYDFDVARAFTPEDLEALEKRMRQIVKEGQLFSRRVYESKEQA
REELANEPYKLELVDDKSGDPDVMEVGGDELTAYDNLNPRTREREWGDLC
RGPHIPTTRYIPAFKLTRSSAAYWRGNQDNASLQRIYGTAWESQEALDRH
LEFLEEAQKRDHRRLGAELDLFSFPDEIGSGLAVFHPKGGIIRRELEEYS
RRKHIEAGYEFVNTPHITKEQLYITSGHLEWYADGMYPPMHMDAEFDEDG
ALRKPGQDYYLKPMNCPMHHLIFRSRGRSYRELPLRLFEFGSVYRYEKSG
VVHGLTRVRGMTQDDAHIYTTREQMRDELASLLRFVLDLLADYGLNDFYL
ELSTKDPQKYVGSDEDWDEATETLREVAEASGLHLVPDPGGAAFYGPKIS
VQVKDALGRSWQMSTIQLDFNMPDRFELEYTAADGTRQRPVLIHRALFGS
IERFFGVLTEHYAGAFPAWLAPVQVVGIPVADDHIPYLNGLVAQLKTAGI
RAEVDISDDRMAKKIVNHTNQKVPFMLVAGDRDIEAGAVSFRFGDRTQLN
GVPRDEAVAAIANWVASRENATPTAELVNVGAKP
375142532YP_005003181.1 HIT family hydrolase- diadenosine tetraphosphate hydrolase [MycobacMTRDDGAGDELSAQDDDAIVDYGAGEPDHLQRLWTPHRMSYIAEAPLRRS
TSEPSRPFTDIPKLSDEDGLVVARGEEVYVVLNLYPYNPGHLMVVPYRVV
SELEDLTDAESAELMAFTQKAIRVIKSVSNPMGFNVGLNLGKVSGGSLAE
HLHMHVVPRWIGDANFITIIGGAKVVPQLLSETRHLLATEWAKQQ
375142531YP_005003180.1 phosphatidylglycerophosphate synthase [Mycobacterium rhodesiae NBB3MSDLYLMTRAAYEKLSRPLAKAALRAGLTPDSITILGTAGTVLSALTLFP
IGVLWWGGFAVFIFVLADMLDGAMARQRGGGTRFGAVLDATCDRIGDGAI
FCGLLWWAAFGMRSTSLVVATLICLVTSQVISYIKARAEASGLSAEGGMI
ERPERLIIVLMGAGLSGLFGLPWLLHVAMWLLAVTSLITLGQRVHSVRTS
PGAMDRLVKPENTGGETPEAPAAQGDES
375142530YP_005003179.1 Lauroyl/myristoyl acyltransferase [Mycobacterium rhodesiae NBB3]MTTPSDLGTSLSGRFADWGYAAGWRLVRAMPEVVARNTFGAGAHYAARGG
GPEQLRKNLARVLGVEPARVPDGLMRASLASYARYWREAFRLPTMDLAAV
GRRFDEVSIGTHRPQAAMDAGRGGIIALPHSGNWDMAGVWLVYKHGTFST
VAERLKPESLYNRFIAYRESLGFEVFPASGGERPPFELLAERLRENKMVC
LMADRDLTRSGVEVDFFGERTRLPAGPAKLAITTGAHLIPAHVYYDGDDC
VIDLQEPLDTSSKDVTAVTQELANRFARNIAAHPADWHMMQPQWLADLSE
ERRAKIGAT
375142529YP_005003178.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MRIGMVCPYSFDVPGGVQSHVLQLAEVMHGRGHVVSVLAPTSSDAHGSLP
EYVVSGGKAVPIPYNGSVARLRFGPATHRMVKRWLAEGEFDVLHLHEPNA
PSLSMLALNIAEGPIVATFHTSTTKSLTLSVFEPLLRPMHEKIVGRIAVS
DLARRWQVESLGSDAVEIPNGVDVDAFASAPVMDGYPRAGKSVLFLGRYD
EPRKGMAVLLRALPRLVERFADVEVLIVGRGDEDELRRSAGKLAKHLRFL
GQVDDAAKASALRSVDVYCAPHTGGESFGIVLVEAMAAGTAVVASDLDAF
RRVLMDGAAGRLVPVDDAGQLADALIEVLDSDKVRKRYIEAASDAVRRYD
WSVVAGQIMRVYETVASAGAKVRVAGTAGAAGSFRAKARGLS
375142528YP_005003177.1 ADP-ribose pyrophosphatase [Mycobacterium rhodesiae NBB3]MTTWIVSISLALLLVALLLIGAWAFQTANRLDRLHVRYDLSWQALDGVLA
RRAVVARAVAVDSYGGAPAGKRLAALADVAERSPRDRREAAENELSAALA
LVDPTTLPLALVAELADAEARVLLARRFHNDAVRDTLALRERPVVRMLRL
GGTAALPTYFEIAERALGAAASEEAARAAGQRVSARVVLLDRDGAVLLFR
GSDPAVTDAPIWWFTVGGAVEPGEALADAAAREIAEETGLRVSSADLIGP
VWRRNAVFEFNGGLIRSEEKFFVYRTDRFEPSTSGHNDLERRTIHGYRWC
DETMIAELVAKGETVYPLQLGELLGEATNLADHPVEMATRQLQSIR
375142527YP_005003176.1 pyridoxal 5''-phosphate synthase- synthase subunit Pdx1 [MycobacterMDTAPNGVQTGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMA
LERVPADIRAQGGVARMSDPDLIEGIIEAVTIPVMAKVRIGHFVEAQILQ
SLGVDYIDESEVLTPADYTHHVDKWKFTVPFVCGATNLGEALRRITEGAA
MIRSKGEAGTGDVSNATTHMRKIGGEIRRLTSLSEDELFVAAKELQAPYE
LVVEVAQAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGDP
AGRAAAIVKATTFYDDPDVLAKVSRGLGEAMVGINVEDVAAPHRLAERGW
375142526YP_005003175.1 acyl-CoA thioesterase II [Mycobacterium rhodesiae NBB3]MSIEQILDLEQLEVNIYRGTMWSPESGFLQRTFGGHVAGQSLVSAVRTVE
PEYQVHSLHGYFLRPGDATAPTVYIVERLRDGGSFVTRRVNAIQHGENIF
SMSASFQTDQSGIEHQDAMPSAPPPDDLPGLSDIKAFDDAGFKQFAEWDV
RIVPQEALTRLPGKASQQQVWFRHRDPLPDDYVLHICALAYMSDLTLLGS
AQVHHAAERQHLQVASLDHAMWFMRQFRADEWLLYDQSSPSASGGRSLCQ
GKIFNSDGEMVAAVMQEGLTRYKRDFTP
375142525YP_005003174.1 pyridoxal 5''-phosphate synthase- glutaminase subunit Pdx2 [MycobacMSAPHVGVLALQGDTREHLAALREAGAEASTVRRLRELEAVDALVIPGGE
STTMSHLLRELELLEPLRARLADGMPAYGSCAGMILLASEILDAGTAGRD
ATPLKGIDMTVRRNAFGRQVDSFEDDIDFTGLDTPVHAVFIRAPWVERVG
PDVEVLGEAAGHIVAVRQGKMLATSFHPEMTGDRRIHKLFVDLL
375142524YP_005003173.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MSFDLELSPDLIHIRDWVHEFAADVIRPAAAEWDEREETPWPIIQEAAKV
GVYSMEFFAEQAGEPSGLGMLVAFEEMFWGDAGIALSILGTGLAAASLAG
GGTPEQMAEWLPQMFGTVDDPKVASFCSSEPGAGSDVGAILTRARYDEAT
DEWVLNGTKTWATNGGIAEVHIVVASVYPELGSRGQASFIIPPNTPGFRQ
GQKFLKHGIRASHTAEVVLEDVRIPGRLIVGGREKFEERIARVREGKSSK
GQAAMATFERTRPTVGAMAVGVARAAYEYALDYALQREQFGRKIGEFQAI
AFKLADMKARVDAARLLVWRAGWMARNGKAFDNAEGSMAKLVASETAVYV
TDEAIQILGGNGYTREYPVERMHRDAKIFTIFEGTSEIQRLVIGRAVTGL
PIR
375142523YP_005003172.1 putative hydrolase- CocE/NonD family [Mycobacterium rhodesiae NBB3]MKAERTLNGPQTTGRDYRNLSRPRFSIRSDDNIHVPMRDGVSLLADVHRP
DADGRYPALIAASPYPRQMQDFGAPAGFIEAGATDFWVTRGYVHVIANVR
GTSGSEGTFAFFDPQEREDMYDLVEWAAAQPWCDGNVGMIGISYFAMTQL
EAAVEKPPHLKAIFPVAVTADLYDAATHHGLASTSFITPFLSMMGLTSDR
SDEFWRHNPFIVTARKILNAPPVHRRFATMNGEAAVTMMHGLLRLPHNPH
PWDDLWFDTVVKHPMRDDWWEARNLLPLLKNIDIPVYLGCDWENVPLHLP
STFTAWEALADNPNVRMALLGRFGLTWPWESLHHEALAWYDHWLKGFDTG
IMDGPPIRYVLPGADGWHTADEWPPAATTLSTFALRADGTLGADEGSPGS
REYLTLGGGLNRAKPSPIDPPSLLSWTTAPLTESIDMVGDIELRLVASAT
APDTAWMATLEHIAADGTATEVTAGWLRASLREVDETVSRIGAPVLPCRR
FAAVPVGEDVEYRIPLVPNARRFAVGDRIRLTLTSDDQDPRTPAIMNFRH
ASVDSSSLNTVRSSSRLLLPVQPLT
375142522YP_005003171.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPKNNAPGPRDERGVLSARILAAARDEFAQHGWAGTTIRAVARTADVDPA
LVYHYFGSKEALLDASTNPPQRWLESVAKTWTTPVEQLGEALLRLMLGAW
ADEEIGPVLRAVLLTAAHDETTREKLRRVVESSLMGVSQLGADERDRLVR
SGLISSQIMGLAMMRFVWKIQPVASMTDDGLVAAIAPNLQHYIQGDLT
375142521YP_005003170.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTMVEVEPQPCIDTLVRLPGGGEARRTEYVGTAWFDGKPQVSGLTLRRPP
TAPRGIRTPNFSTSFFLPNSLAYDRAALGDSTLTVSVVLQAAGEVSAIVD
AVATFTDDPSGAPTWIQLHLGGHLGWPAGIGYRIVALTPPDAVR
375142520YP_005003169.1 YebC/PmpR family DNA-binding regulatory protein [Mycobacterium rhodMSGHSKWATTKHKKAVIDARRGKNFAKLIKNVEVAARVGGGDPAGNPTLY
DAIQKAKKSSVPNDNIERARKRGAGEEAGGADYQNITYEGYGPNGVAVLI
ECLTDNRNRAAGEVRVAMTRNGGNMADPGSVAYLFSRKGLVTLEKNGLTE
DDVLTAVLEAGAEEINDLDDSFEIICEPTDLVAVRTALQDAGIDYESAEA
SFQPSVSVPVDLEGARKVLKLVDALEDSDDVQDVFTNMDIPDDVAAKLDE
E
375142519YP_005003168.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMPDDTELETATNLAVTLAWAAGAMTAALLLGVLLTWALGRIGRRSAMLCD
VAELTRMPVRATLMVVAATISVQRTSDPADSWRRLVDHSLLILLIVGVTW
LLTSLVRVAERRMIARFGGGGEEISDADRRWRRVRTQVTVLRRLAIAVVV
IFGGAAILMTFPAFSDIGTTVFASAGVLSVVAGLAAQTSLGAVFAGMQIA
FSGAIRVGDVVQLENGQWWGRVEEITLSYVVVRLWDERRLVLPSTYFTTE
PFENWTRSDTEIMGSVEFDVDFSVPFHDMRAELDRLLVNSELWDGRKGVL
QVTDAVGGVVRVRIVVSAPNAGALFDLRCAVREGMVNWVNSRRVLPIQRL
ENADFTPESTAPSAPSRTTDETPRAAEGMFSGSPEAEKRARAFDEHADYE
DDYVSSSNGSR
375142518YP_005003167.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAVLTDHNGTVWSIKRRWWSFPDFLNLLGWVGDLIGVLFMILWPFWLLSK
FCGVRWVITINRDGERVGKERVRGWKNSKLRMEAIAQEVAAGDYSEPDSE
PQSGPESELPPGTIVY
375142517YP_005003166.1 crossover junction endodeoxyribonuclease RuvC [Mycobacterium rhodesMRVMGVDPGLTRCGLSVIEGGTGRQVIALDVDVVRTPSDEPLHRRLLTIS
DAVEYWMDTHRPDVIAIERVFANQNANTAMGTAQAGGVIALAAAKRNIDV
HFHTPSEVKAAVTGNGRADKTQVTTMVTKILALQAKPTPADAADALALAI
CHCWRAPMIARMAAAEAMAAEQKRKYQATIKAKAKAAR
375142516YP_005003165.1 Holliday junction DNA helicase subunit RuvA [Mycobacterium rhodesiaMIASVRGEVLDIALDHVVIEAAGVGYKVMATPSTLASLHRGNEARLITAM
IVREDSMTLYGFSDADARNLFLTLLAVSGIGPSIALGALAMYDGPTLRRA
IADGDITALTRIPKVGKKTAELMALSLRDKMVATPSGGAVFSGHSVRGPV
VEALVGLGFALKQAEEATDKVLANEPEATQTTALRSALSMLGKK
375142515YP_005003164.1 Holliday junction DNA helicase subunit RuvB [Mycobacterium rhodesiaMNRFEDEAPEDREVTPALTVGEGDIDASLRPRSLGEFIGQPRVREQLQLV
LEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGTSLRVTSGPALERA
GDLAAMLSNLVEHDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPG
ATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAELERVLT
RSAGILGIELQSDAGAEVARRSRGTPRIANRLLRRVRDFAEVRADGVITR
DIAKSALAVYDVDELGLDRLDRAVLSALTRSFGGGPVGVSTLAVAVGEEA
TTVEEVCEPFLVRAGMIARTPRGRVATAAAWTHLGMTPPAGATGFGQPGL
FE
375142514YP_005003163.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGFAGLFFAGLAALLHVYIWVMESLTWTSARTRATFGITEDEALATKEMA
FNQGFYNLFLAIVTVTGIVIGGIGYNYVGLALVFAGTGSMLAAALVLLIS
SPDKARAAITQGILPLIAIVLLVVGLVI
375142513YP_005003162.1 thioester reductase-like protein [Mycobacterium rhodesiae NBB3]MSADTREERLARRIADLYENDQQFADARPDTAISRAISEPQQPLAEIIRG
AMDGYADRPAVGTRAVDFVTDPQTGRTTVRLLPRFDTITYGELWNRVEAL
ASALATDVDAGDRIAILGFTSVDYTVADLAAFRLGAVSVPLQTSAPVTQL
RPIVTETEPTAIASSVDFLDDAVDLVLTGHAPRRLVMFDIHPEVDDHRDA
LESARARLADAGSSVAIETLADAVTRGGALPSAPTYTPNADALALLIYTS
GSTGAPKGAIYTRFLVGQTWRPASWGWNDSPDPFITLSFMPMSHVMGRSG
LYATLAHGGTAYFAAKSDLSTLLDDLALVRPTQLTFVPRVWDMLAAEARR
EIEARLSPAADADTEAQVRAEVRTLMLGNRYLTAMTGSAPLSPDLRAWVE
DFLDMHLSDGYGSTEAGGVFHDGKVVRPPVIDYKLVDVPELGYFHTDRPH
PRGELLLKTTNMFPGYYKRPEVTAEVFDVEGFYKTGDIVAEIGPDQLQYL
DRRNFVLKLSQGEFVTASKIESVFETSPLVRQIYIYGNSARSYLLAVVVP
TVEALEALDGEALPKAINESLQDVAKTAGLQSFEIPRDFIVETTPFTLEN
GLLTGIRKLARPKLKEFYGPRLEELYTEMADGQAAELRELRQNGAQRPVV
ETISRAAGALLSAATADIGPEAHFTDLGGDSLSALTFANLLKDIFDIDVP
VGVIVSPANDIQALADYVETERTGSKRPTFAAVHGPDATAIHAGDLTLDK
FLDEQTVAAASSLPGPASEIRTVLLTGATGFLGRYLALEWLERMSLVGGK
VICVVRAKDDAAARRRLDATFDSGDPELLEHYHSMAADHLEVLAGDKGDA
DLGLDAATWQRLADTVDLIVDPAALVNHVLPYDQLFGPNVVGTAELIRIA
LTTKIKPYIYVSTVGVGDQIDPPAFVEDADVRVMSATRRVNDTYANGYGN
SKWAGEVLLREAHDLSGLPVAVFRCDMILAEPRYAGQLNVPDMFTRLMLS
LVATGIAPGSFYELDTAGNKQRAHYDGLPVDFIAEAISILGVHHAGAFET
YHVMNPYDDGIGLDEYVDWLIEAGYALDRVPDYRQWLQRFETSMRSLPDR
QRQASLLPLLHNYQQPSTPMRGSFAPTDRFRAAVQEAKIGPDKDIPHITA
DIIAKYITDLQLIGLL
375142512YP_005003161.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQRSRGAMSGLVLILLGAWGAIIPFIGPLFDFAFSPDRAWAWSEARGWLQ
VLPGVVAVVGGLLLLASSNRATAMLGGWLGVLAGAWFVVGRACAELLGIG
DVGAPVAATETKALALELSYFSGLGALIVFVSAAALGRVSVRSVRDVEYV
DAAVAPAQPQPVFSDSDAVTEIQPTAGDTGRHRGWRDALSRRRTAAH
375142511YP_005003160.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAPSRDLPTDRLAIGQLLVRLLREFRDDLAVPRADAGYGDVREVHFQIFG
NIRMGGIRLTELADRAQLSLAAASELVNDLVDLGYLTRRPDPADGRAKLI
DLTQRGQALMADAGGRVIDIERRWSAAVGERNFAQMVRTMQRLLDELDPK
DSRS
375142510YP_005003159.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MIVPRPDFVSTDLGRLHVRRSGTGPPVVLWHSLFVDSQSWGPLVDELARD
RTVYAIDGPSHGKSESVLRDFTFDEVVTAAEQALDRLGLVEPVDWVGNAW
GGHVGIRLATGSRLRTLTTIGTPVQGFNVRERVTKGWPLVAMYRLMGGSG
LVGKLLAESLIGVDSIAAQPEQAETTMAAFRNADRNGMYHAMRSMMLHRA
GVASLLPSITVPTLVMSVRDDAVGWQPDEARQTCAAIPNCQVEQVEGGGH
VAPLLVDRERVLRLLTDFWARTDHDHAAK
375142509YP_005003158.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MTKVQNFIGGELVDSVSGATMVLVDPSTGEEYATAPVSNEADIDNAYAAA
SKAFKDWKRTTPSTRQKALLDFADEVERNAAALVEAEGRNTGKPNHVTTA
EEIPPMLDQIRFFAGAARVLEGKSAGEYMENHTSWIRREPVGVIGQVSPW
NYPMMMAIWKFCPAIAAGNTVVIKPSDTTPVTTVMLAEIAAKHFPPGVLN
VVCGDRNTGAAVVAHPTPEMVSITGSVAAGRAVAVSAGGHLKRTHLELGG
KAPVIVFDDSDIAAAAEGIATAGYFNAGQDCTAATRVLATAKVASDLTEA
LAEQARGATTTFGKAADDEDAWVPPVNNVNQMERVLSFFDDVPSHATVAA
GGERQGDKGFYVAPTVVGGLRQDDRLVQQEIFGPVITVQSFSDEDEAIAW
ANGTEYGLASSVWTKDVSRALRVSAALDFGCVWINTHIPLVAEMPHGGYK
SSGHGKDLSMYGLEDYTRIKHVMAFTG
375142508YP_005003157.1 4-aminobutyrate aminotransferase [Mycobacterium rhodesiae NBB3]MSTLEQSRYLATEIPGPLSKALIDRKSAAVSRGVGNTMSVYASRAFGGIV
EDVDGNRLIDLGSGIAVTTIGNSSPAVVAAVQDQVARFTHTCFMITPYEG
YVAVAEQLNRLTPGSGEKRSALFNSGSEAVENAIKVARTYTRKQAVVSFD
HAYHGRTNLTMALTAKSMPYKHGFGPFAPEVYRAPLSYPFRDAEFGKEMA
TDGELAAKRAIAVMDKQVGADNLAAVIIEPIQGEGGFIVPADGFLPALLN
WCRDNNVVFIADEVQTGFARTGAMFACEHEGIEPDLIVTAKGIADGMPLS
GVTGRAEIMDAPHVSGLGGTYGGNPVACAAALATIETIEADGLVERAQQI
EALMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKAGSIEPDPDLTKALCA
GCHAAGVIVLSCGTFGNVLRFLPPLTISDDLLIEGLDVLALVLKDL
375142507YP_005003156.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLGHLGINVDDLTAAKNYYDAVMPMLGFDEFFTAEDEFSYRPADGKPGTY
LFFYPSAEPSQYSRHQTGLQHLAFRVRTRSLVRDVHGLVTATLIPQFGGE
VLHRPQVFPQYPQPYFATFWLDPRGLMLEAVCHHDRD
375142506YP_005003155.1 preprotein translocase subunit YajC [Mycobacterium rhodesiae NBB3]MDLVIFLPLLIIMGLFMFFASRRQKKAMQATIDLHESLQIGDRIHTTSGL
EGTITGIGDDSVDLEIAPGVVTTWMKLAVRDKIGPDIDEDEDFDDFDDEE
STATEITESPNKKD
375142505YP_005003154.1 protein-export membrane protein- SecD/SecF family [Mycobacterium rhMASSSTPVHPARYLAFFLVLLVGAYLLVFLTGDKKAEPKLGIDLQGGTRV
TLTARTPDGSRPTRDALNQAQTIISDRVNGLGVSGSEVIIDGDNLVITVP
GNESSEARNLGQTARLYIRPVIHAMPAAGQGQQPPTEAPQGAPPGAPGAI
PGVPGAEPGAPAPGGAGTPPAAPPQTPAPQPRPYPEQPPTQPTPSPSPSQ
PAPPPGTAQQPPPPGQQPPPPNPNDIPLSQRIADEKELRQSADQQIQILA
LQFQATRCGQDDVLAGNDDPNLPLVTCSQNGQEVYLLDKSIISGEQIENA
SSGLDQQQGQYIVDLQFKSDATKIWSDFTAANVGTQTAFVLDSQVVSAPE
IREPIPGGRTQISGQFTEQTARELANVLKYGSLPLSFESSEAETVSATLG
LTSLRAGLIAGAVGLALVLLYSLLYYRILGVLIGLSLVASGAMVYAILVL
LGRYIGYTLDLAGIAGLIIGIGMTADSFVVFFERIKDEIRDGRSFRSAVP
RGWNRARKTILSGNAVTFLAAAVLYVLAVGQVKGFAFTLGLTTILDVVVV
FLVTWPIVYIASKSPTMAKPRLNGLGAVQQIARERRAAAHVTGRG
375142504YP_005003153.1 protein-export membrane protein- SecD/SecF family [Mycobacterium rhMADKDKDPDELTTSAVEAPDLAATEAPHHGFFTRLYTGTGAFEVIGKRKL
WFTISGLIVAVCVASILIRGFTFGIDFEGGTKVSMPAQTASGTVTTQQVE
DVFSESLGKPAEAVVLVGSGDSATVQIRSETLDNAEIEKLRTALFDKFQP
RGPDGKPAKSAISDSAVSETWGGQITDKALIALVVFLALAAIYITIRYER
YMALAALATLVFDLVVTAGVYSIVGFEVTPATVIGLLTILGFSLYDTVIV
FDKVEENTHGFEHTTRRTFAEHANLAVNQTFMRSINTSLISVLPILALMV
IAVWLLGVGTLMDLALVQLVGVIVGTYSSIYFATPLLVSLRERTTQVRNH
TRRVLNRRKGSAAKASDTDDQSTPAEAATATAAVSSAAAAPDKPAPGARP
VRPTGTRTGRPSGKRNTRRR
375142503YP_005003152.1 dipeptide ABC transporter periplasmic protein [Mycobacterium rhodesMAMAWSRRGGALAAAMMVGAAGLSSCSSGPAESIDFAVDGLLTTYNTNTV
AGAASGGPQAFARVLTGFNYHGPDGQIVGDHDFGKVSVVGRAPLILDYEI
NADAVYSDGKPITCDDMVLAWASQSGRFPGFDAASRAGYVDVASVDCAPG
QKRARVSFAQDRAFVDYGQLFAATSMMPSHVIADELGLPDGGVVNAITKN
DGPAVERIAQAWNTTWNLKRDVDIKKFPSSGPYKLESVTEGGAVVLVAND
KWWGAPPVTSKVTVWPRGADIQDRINQRAYDVVDVAAGSSGTLNLPDDYV
RTDSPSAGIEQLIFASQGPMSTTPERRALAQCTPRDVIARNAAVPIANAR
LNPVTEDAYSAAENTVEAGKFSVADPVAARASINNRPLTVRIGYQSPNAR
LAATVGAIAKACAPAGITVQDVATEETGPLTLRDNKIDVLLASTGGAAGS
GSSGSNAMDAYDLHSANGNNLSRYNNERVDGIISTIAVTTDPKELSRLLG
EGATILWTDMPTLPLYRQQRTVLTSKQMYAVSSSPTRWGAGWNMDRWALG
Q
375142502YP_005003151.1 PRPP-binding protein- adenine/guanine phosphoribosyltransferase [MyMGCGMEHGPLGAGPVSASVPGADIAALVASLMRDVPDFPEPGIQFKDLTP
LLADAHGLAGVTDALAETARGADLVAGIDARGFLLGAAVALRLGTGVLAV
RKGGKLPPPVHSQTYQLEYGSATLELPADGIELTGRTIVIIDDVLATGGT
VAATNKLLQQCGATVTGAAVVLELAALNGRDVLEPLPVTSLLTI
375142501YP_005003150.1 RelA/SpoT family (p)ppGpp synthetase [Mycobacterium rhodesiae NBB3]MAEDPGTGQAVQSPPSAQMPETQPLEIPKTDSSKAATSASRRVRARLARR
MTAQRSLVNPVLEPLVAVHKQFYPKANLTLLQRAYEVAEERHAGQLRRSG
DPYITHPLAVANILAELEMDTTTLIAALLHDTVEDTGYTLEALTEEFGTE
VGHLVDGVTKLDKVALGTAAEGETIRKMILAMARDPRVLVIKVADRLHNM
RTMRFLPPEKQAAKSRETLEVIAPLAHRLGMATVKWELEDLSFAILHPKK
YEEIVRLVADRAPSRDIYLAKVRAEITATLNASKINAVVEGRPKHYWSIY
QKMIVKGRDFDDIHDLVGVRILCDDVRDCYAAVGVVHSLWQPIAGRFKDY
IAQPRFGVYQSLHTTVVGPEGKPLEVQIRTVDMHKTAEYGIAAHWRYKEA
KGRNGAPANHAAAEIDDMAWMRQLLDWQREAADPGEFLESLRYDLAVQEI
FVFTPKGDLITLPTGSTPVDFAYAVHTEVGHRCIGSRVNGRLVALERKLE
NGDQVEVFTSKAPNAGPSRDWQTFVVSPRAKAKIRQWFAKERREEALESG
KDAIAREVRRAGIPLQRLMNAEQVAALARELRYVDVSALYTAVGEGHVSA
RHVVQRLVAQLGGDEDATDEIAERATPSTMPVRQRHTDDVGVAVPGAPGV
LSKLAKCCTPVPGDIIMGFVTRGGGVSVHRTDCTNAASLQEQSERIIDVQ
WAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSDDRV
AISRFTFEMGDPKHLGHLLNVVRNVEGVYDVYRVTSAA
375142500YP_005003149.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRTALVATLAAAALLVAGCGSTIKPEGAAQSVVDLVKKQTGFEPKDVKCP
EGVEAKVGTKFECKFTGPEGSEYTADMRVTKVEGDDVEFYIETKPSS
375142499YP_005003148.1 peptidyl-prolyl cis-trans isomerase [Mycobacterium rhodesiae NBB3]MTNPPPPYGAYPPPYGAYPPYGGYPSGYPGYPPPQPTNTLAIASLVCAFV
FAPLGIVFGHISLSQIKKTGEEGRGLALAGLIISYLITALTILVVVLSVL
FVIAVGRSLEDLDGMTTDYTATPTRPINAPPLPEFKRPATLGSNCQYPTT
TEPASKPAKPPRTGRVPTEPALISAGIKTNRGAIGLQLDNAKAPCTVNNF
ASLAQQGFFDDTTCHRLTTTPTLGVLQCGDPSGSGTGGPGYRFPNEYPTN
QFRLTDPSLKTPMRYPRGTLAMANAGIGTNGSQFFLVYEDSALPPTYTVF
GTIDKTGLATLDKIAAGGVADSSGDGEPNQTVKIESVRVD
375142498YP_005003147.1 peptidyl-prolyl cis-trans isomerase [Mycobacterium rhodesiae NBB3]MPTNEQRRATAKRKLDRQLERRAAKERKRRLFTIIGSVVGVVVVAAAVAT
TVILTRDDSDNQNTAATSTPPTSAAPAGDGALPAFVAPAGLGDNCQYPAT
PDKASKPVKPPRAGKVPTEPAQVSASMETNQGDIGLMLDNGKSPCTVNSF
ASLANQGFFKDTTCHRLTTSDSLSVLQCGDPTAQGTGGPGYQFANEYPTN
QYQPDDPKLQEPVLYPRGTLAMANAGPGTNGSQFFLVYKDSQLPPNYTVF
GTIDETGLATLDKIAAAGTTDGAPDGKPKSDVKITSLMLDP
375142497YP_005003146.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MLITGFPAGMLACNCYVLAQRTGADAIIVDPGQRAMVPLRRILDENHLTP
AAVLLTHGHIDHIWSAQKVADMYGCPAYIHPDDRFMLTDPIKDFGPRLAQ
LAFGALFREPKQVVELDKDGDKVELGGVTVTVDHTPGHTRGSVVFRVSEG
TEEIVFTGDTLFRQSVGRTDLPGGSGRDLLGSIVTKLLVLGDDTVVLPGH
GEKTTIGYERRTNPFLEGLNQ
375142496YP_005003145.1 histidyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MSDFQAPKGVPDYLPPDSAQFVGVRDGLLDSARRAGYGDIELPIFEDTAL
FARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVMRAVIEHGLDRGP
LPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAIADA
GFRSLGLDGFRLEITSLGDDTCRPQYRELLQDFLFKLDLDEDTRRRAEIN
PLRVLDDKRPKVREMTADAPVMLDHLSDAAKQHFDTVLAHLDALGVPYVI
NPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMQQLGGKDLSGI
GFGLGVDRTMLALKAEGKSVGGTARVDVFAVPLGEQAKITLAVLAARLRA
AGVRVDLAYGDRGIKGAMRAADRSGASLALVAGDRDIEAGTIGVKNLATG
DQVDVAADGLLAEVLSRLNRA
375142495YP_005003144.1 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protMAAIQFVTDPMPNRDQVRAPRTEDYFRSVVDSLATGLVVFKHDGHIECVN
PAAQRILGVAADDLIHGCGAGTISGRMVDAAGRRIGADRWSMTCSVRASR
RAVGRVVGVDRPDGKRVWLSTSWCLLDPVDSTRSPLLVSFTDITAERATS
QRLAHQANHDALTGLPNRAHVLTKVTEALRASGENALGAILFIDLDNLKV
INDTLGHEAGDAALKIVADRLRTAVRPDDLVARLGGDEFVAVLGGSISGV
AVDRLSERLHTLLSEPAIIGGTTVRLGASVGIAEVGPDDHRDAAELLRDA
DQAMYHAKKSGRGRTCRFAEQMHRDAESIAK
375142494YP_005003143.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSKVCETSRVAFRTLAAVCAVLVLWSSGPVAIDTRLTDVTEARATGGMIA
LLPRAADAQMLTVVGGEPADELHLTLIDFGPDVSGRSGDDLARRLGDLMT
RWAGEVKADVFGHATFSPGRPGECAVYLVGDSPELVDLRASVTEVSTQLY
QLPPQHDPWVPHITAKYGVLEGELTYSGPVMFDRVRLRWAGETRDFALHP
AG
375142493YP_005003142.1 dihydrofolate reductase [Mycobacterium rhodesiae NBB3]MGKLIYGFNVSVDGYIADAQGNIDWSDPSEELHQYWNDFAAEVAVSCYGR
RLYDLMSSYWPTADEAPDATPFIVDFARTWRDMPKVVFSRTLESVDWNSR
LERGDPVEVVTKLKAETDGTLELAGATLAAPIVQAGLVDEYRIVVTPTAV
GGGTPFFPPLPSWISLRLLENRSFPEGTVLLRYEPRHD
375142492YP_005003141.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMSLIALEEHYAWDPASEGNVVATWLRANNGVAYDRLYDRGPLRIEQMDAA
GIDFQILSLFDPGVQDEVDAVRAVDLARRANDDLAESVRANPSRFGGFAT
LATQQPDAAVAEFDRAVTELGLVGGLINGHCQGRYLDDPAYEALFSRAEA
LGAPIYLHPTTPHPAVMDAWFAPYVGDGLHLASWGFAAETGTHVLRLIYS
GLFDKFPRLQMIIGHLGEMLPFAAYRIDRYYGLGGGGTGHTLQHLPSDYL
RNNFHVTTSGNFCSPALDCTLDVMGADRVMFSVDYPMDDNQTGADFLASY
PMDDTNRRKVASENALRLFGDRIPAALRN
375142491YP_005003140.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAPTEAKVLIDTGGLVVTDDGRRVNIFDRCTGALAITAFVLGIATLVVG
GFGLVAMVTNVPSVELGAVFVAVGVVFAVVLYRVVRTIRRRRSQPLHSCR
SVAVIDRKLGLFSYGGGAIVPLDQVQFARRMQIGSSSPKLIALTPGGTKV
LKRGNPFDGGIGNVDEVLSAVVRGG
375142490YP_005003139.1 urea ABC transporter ATP-binding protein UrtE [Mycobacterium rhodesMLQLVDVRTGYGRSEVIHDVSIEVPADGVAAVMGHNGAGKTTLLRAAVGL
LKCTAGKVLFDGEEITKLRPSARVKRGLAYVPQGQQSFGQLTTAENLQVV
ADGRKNGKQLIDEQLDLFPALKELLTRRAGLLSGGQRQQLAIARALITTP
TCLILDEPTEGIQPSVVAEIEAAITALTQRGDLGVLLVEQHIGFALDSAQ
RYYILESGRITSSGTGGSASEADVRAAMAI
375142489YP_005003138.1 urea ABC transporter ATP-binding protein UrtD [Mycobacterium rhodesMTEVDASTAGKEPIVGGNVGMGTQYLEVRGLTVDFDGFKAVSDVDLTLFQ
GDLRFLIGPNGAGKTTVIDAITGLVSASGSVNKSGVELLGKKVHQIARRG
VGRTFQTASVFEQLTVLQNLDIAAGAGRSVWTLLRRRNGVLPSIEQALHT
IGLTHVADKPAGVLAHGQKQWLEIGVLLVQNADVLLLDEPVAGMSAEERE
ETGNLLRRIGAERTVVVVEHDMDFMRAFATSVTVLARGRVIAEGSVAEVQ
ANPKVQEVYLGTAAAGADGIELVEENS
375142488YP_005003137.1 urea ABC transporter permease UrtC [Mycobacterium rhodesiae NBB3]MRTVLGRWQTWAGFGIAAVVLFGIAPVVLSDFRLSLLGKFLCFAIVAVGI
GLAWGRGGMLVLGQGVFFGLGGYMMGMHLKIADAQIRGDGVPDFMQIAGV
RELPAYWQPFASPAFTLLAIVLLPTAIAAALGLGVFKRRVKGAYFAILSQ
ALAAALAILLVGQTSIGGSNGLNRFRTFFGFTLNDPANRRMLYFIAAGVL
LVVVAVVRQLMLSRYGELLVAVRDGEERVRFLGYDPANIKVVAYTVAALF
ASIAGALFAPIVGFIAPSQVGILPSIAFLIGVAIGGRTTLLGPVLGAIGV
AWAQTLFSERFPSQWTYAQGLLFIVVVGFFPAGLAGLGVLLKRRKAKDKP
HTEMARDSDPDAEKVGASS
375142487YP_005003136.1 urea ABC transporter permease UrtB [Mycobacterium rhodesiae NBB3]MDVLIGQLATGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIMAGCYTA
YVVQQIISSAGASLLISLVIGFFVGGAMGALLEVTLIQRMYHRPLDTLLV
TFGVGLILQQVARDIFGAPAVNVIAPAWLSGGVEILGAVVPKTRIFILVL
AIACVAALATALKVSPMGRRIRAVVQNRDLAETSGISSRKTDITTFFIGS
GLAAVAGVALTMIGSTSPTIGQSYLIDAFLVVVVGGLGQIKGTVIAAFSL
GFLNSFIEYNTTASLAKVIVFVIIVIFLQVRPQGLFTVRTRSLV
375142486YP_005003135.1 urea ABC transporter- urea binding protein [Mycobacterium rhodesiaeMRLPQRFSLRRSALATGSIVATAGLLLAGCGSKATESDSANAQSCVDTSG
STIKVGSLNSLSGTMAISEVTVRDAISLAVEEINAKGGVMGKQIQVVGED
GASEPTVFAEKAEKLISSDCVAAVFGGWTSSSRKAMLPVFEGANSLLYYP
VQYEGLESSKNIFYTGATTNQQIVPALDYLKEKGVKSLYLVGSDYVFPQT
ANRIIKAYAGANGIEIKGEDYTPLGSTDFSTIVNKVRTADADAVFNTLNG
DSNVAFFREYKNVGLTPQAMPVVSVSIAEEEVGGIGVQNITGQLTAWNYY
QTIDNPVNDAFVKAYKEKYGANKPTSDPMEAAYVSVYLWKNTVEKAKSFE
VAKIQEAAGGVTFDAPEGLVTIDGENNHITKTARIGEVRPDGLIYTIWES
PGPIEPDPYLKSYPWAAGLSG
375142485YP_005003134.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRKATSIVGAALVLAAGSIAVSQVTADAQPPAPNVKYVVTADAPLSFDIN
YVTSSPADLKAFNANASAYSTRGSFVVPWEATATLDDPQWAYISVARAGH
AMEAPPNAHCEIWVDGQLAVQNTGPTTAFCQLSRW
375142484YP_005003133.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGLVALPLAVSVFTAAPAQAAAVIDFDGDPSDVVNTHVGAVLPWLIGDPA
IGGSKGSIGGWAWAHTGPKGTQAGVKGVLQQTTHLGPAYFNLDVTKSAVF
TYTPATTTTTTPPSGHGPCDHPEHQPTTTTTKGPKAELNLVDIGNWSVGV
KGFAEWYGQLGFTSDTVVDENGISFNWSGVNRQYLVLGGGLLVLGFDFTP
SFGFHIPTPGVNLAAPLAPILAPGSTPAGTATTLASAAKTGDEAAKPGDQ
SAKQGDGGEKPDRNIEATGYETVKPGQEGQTPGTDGVNPGQEGVKPGQGG
VTPGQEGVKPGNEGATPGQQGGTAGGEGASPGEQGGTPGHDGTKGDDGAK
GDNGTKGDNGTKGNDGTKGDNGTKGDNGTKGNDGAKGGSNANGSGAHGGG
GDKGGDKGNDGGAKSGAGGDKGGDKGGDK
375142483YP_005003132.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALVRAACVICAVAAFSLSVWTYMDVSMFGFPDGYITDYQAAADTPLTV
ITWIFAGFGLLFVALAFSPLGSRVRAFAWLAALMALIFVATAGYVGVPWY
FGTHLGLDNGIGG
375142482YP_005003131.1 UDP-glucuronosyltransferase [Mycobacterium rhodesiae NBB3]MRVLLSAWGSRGDIEPMLALAVQLRLQDVAVLLCAPPDFAEHAARIDIPM
IAAGQSVRDLVHGVKSSGIRPSTPVDAPRVAAALVASQFETVAPAAEGCD
ALVATGLMPAGQRSIAEALGIYYACVAFMPGVLPSLHQTPLPRPGRPFPP
NASNKVLWEVDAERVQALYGAPLNTHRAALGLPPVDNVRDHVHTDRPWLA
ADPVLAPWPGSPDLDVVQTGAWILPDTRPLPTDLVDFLDAGSPPVYVGFS
SVRAPEDVATVAIEAIRAHGRRVVISRGWADLAPIDDRDDCHIVGEANLQ
ELFTRVAAVVHHGGAGTTTTAARAGAPQVVVPQIADQPYWAGRVAALGIG
AAHDGANPTVETLSAALETALASEVSRRASEVALTIRGDGAAVAARLLIE
AVERATPRA
375142481YP_005003130.1 DNA repair photolyase [Mycobacterium rhodesiae NBB3]MRWDGQGVSVDDGALPGLQRIGFVRSVRSPQFEGMTFHEIICKSALNKVP
NARPNVAGRPAAAMLPFNYTVNGYRGCSHACRYCFARPTHEYLDMDPGAD
FDTQVVVKTNVAEVLRRELSRRSWQRETVALGTNTDPYQRAEGRYALMPG
IIAALRDSGTPFSILTKGTLLRRDLPLITEAARHVDVSVAVSLAVGDPEL
HKDVEPGTPAPQARLGLISAVREAGLDCHVMVAPVLPHLTDSAAHLDALL
RQIAEAGATGVTVFGLHLRGSTRGWFMAWLARSHPELVSVYRELYGRGAY
LPSDYKKLLHDRATPLIAKHGLAPDRRSFRSVAAPAVVNTEVLQPTLF
375142480YP_005003129.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGQGEAAAATVAVAAASFDQMSVVVVSSVSCRRVVSLICAGWLPQDRDFE
SELAAI
375142479YP_005003128.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLPDNVIAHRTDADHSKTLAVTTEFVIWTPWAGYSPSSTANDQHQPASSL
ATAMLATTDRFLR
375142478YP_005003127.1 transposase [Mycobacterium rhodesiae NBB3]MVGQRTSVGLDVHARSVVACGLDRETGEVVERRLTPEHREILDWIGDLPG
PVAVTYEAGPTGFCLARALDAAGVECQVAAPSKLIRPAGDRVKTDARDAA
HLARLLHLGQITAVAIPSADQEAARDLVRAREDCRGDLMAARHRLSKLLL
RQGIVYYGGATWTSRHELWLRQQRFDNRALQLTYDATFDAMTSCVDRRER
LEAAIEEMAADSEFTPVVRRLGRLRGIATLTAFGLATEIGDWHRLTGRTI
GAYLGLVPSEFSSGGSRVQGEVTKTGNKHVRRLLVEAAWHHRSPYRPGAV
LRRRWDLACPAARARGQAANRRLHQRWANFDQRKKRSVVANIAVARELAG
WCWSLAVLDGE
375142477YP_005003126.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTETASAPTATSESVEEFATRARKWLAENMPSIDPANPPEHDRGEDEPWQ
RARELQKKLYEGGFAGICFPREYGGLGLPIAYQKAFNNESRNYELPIILN
TPTFTICAATILDTGSEEQKQQHISGALRGDEVLVQLLSEPSGGSDLAGV
ITRADRKGDKWVINGAKTWSTSAFAADYGLMLARTDWDVPKHEGLTMFLV
PINSEGITLRRIKQVNGSVEFCEEFFDNLELGDDAVVGEVNGGWHVASRQ
LYHERRAVGGGSEFASGIGAEGKSDVPIDYVALLEATGQADSERAQEAAG
RALVHRAVREQLIDHVYHGVLDGALPPAAGSIIRVTHADVHHLEFDTVLS
LTGSSGVVDAGDDMIRYGERYLSRQAAALGGGTTEIARNIIGERVLGFPR
EHAADRGVPFNQVKRNKS
375142476YP_005003125.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTDPANPERLLFASTTQSFLEKGASLPRLRELHDAGTSFESDWWQRAAEL
GWTSLLVPEELGGGNVSGDGVADLALVAELCGRSVAPGPLHPVSVVLASL
AEAPENHEQTIESLISGEVVASWAVYEPGKQWSPLDVSVTATPTDTGFRI
DGVKDRVEAGADSALLLVVARCDGAVRQFLVPTDATGVTVEPQRSLDMVK
TYARVRFDGVEVDANAVVGSAELTPALIARQTQIAVILQCAEIVGILETV
LDFTIQWGFDRHSFGRPIGSYQALKHKYADLKIWFESCRATTNAAVAEVA
ARSPGAEIAVSVAKSYVGEHAPGMLQDCIQLHGGIGVTWEHDLHIFLRRV
TLYRSLFGTPEDHNLRVYALTKDLVGPRESWGHAS
375142475YP_005003124.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTRELPYPVFDADNHFYEPKEALTQFLPDHRKGVIDYIDVRGRTKIMVRN
VVSDYIPNPTFEVVARPGAQEEYFRHGSGGKSFREVMGKPMKSIPAFRNP
EARLEVMDSLGLDYSLMFPTLASLVEERLKDDPDLILDIVHALNQWMYET
WQFNYEDRIFSTPVINLGNVDRALEELDWCLERGAKTVLVRPAPVPGYRG
TRSLGVEEFDPFWDACVKAGIPVSMHASDSGYSEYLNDWEPGDEFKPFAP
TAFRMVAMGKRPIEDTMAALVCHGALTRNPDLRVLSIENGADWVPYLFKQ
FKNVYSKMPHGFLEDPIEAFHRCVYVAPFWEDDFAQMAELLGIDRVIFGS
DWPHPEGLAQPTHLIDDLQGLDAEGQRKVMGGNMIDLFKIPNEIVHKPGV
PALEFA
375142474YP_005003123.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAKRSGRPPGEGARTAATDAVVDLDPESRPKRFMKSALAILGETGRTDFT
VLEVVERSKTSLRSFYQHFSTKDELLLALVDKIMSESTRKWREDTTGLPA
DEALRVLIDRICTPAETTTQDKVNRGLTSYNDRLAEALPSEYARVLAPVH
ELIKDIIHRGVDEGTFRTGIDVDATAALIMQSALGAMRLRVLGAELSGVP
VDADHIYDFCVSSLQSRRDPV
375142473YP_005003122.1 acyl-CoA thioesterase [Mycobacterium rhodesiae NBB3]MTSDAAHPPSQAQWTVQNLLDLFDVAPDGENRFTAETGPAGEDERQVVEG
TQVLAQAIVAVAKRFPEKSVRSVSAVFARAVMVGAGPVELELDIVNEGRS
TATAIVAAKQNGKRCITATVLTDVPTADVIRHHLPRPDVTGPQDANVAEM
PMTGRQLRLVDVHDVNSPDEVGPPELYAWLHYDPIPTRDDLAKALIAYFT
GHLGISTTMRAHVGIGTAQSHLTVSTAPMTVTVSFHEPFTWDGWLLYTHE
STQVGAGMSYVRGAVHTESGELIASFTQDALIRPLRTTDTSIKEQSRL
375142472YP_005003121.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MSTMAEDTPLAGKVAYVTGAARGQGRSHCIRLARAGADIVAIDACAPVAE
HNGYPPALPEDLAETVSLVEGEGRKIRAEEVDVRDLDGQQRVVSDAIEQF
GRLDIVVANAGVLNWGRLWEISAQQFQEVVDTNLTGVWNTIKAVVPAMIE
AGNGGSIINISSAAGIKAVPGCGHYCASKFGVVALTNSLAVELGEFGIRV
NSVHPYGTDTPMGNDASMWQMFADHQNFIHSFSPGALPTDSLAAPDLVSD
IVLWLASDASSLVTAAQIPADKGYLKI
375142471YP_005003120.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPERDPIEPDTKDWTWVLSRPCPDCGFARESVHHTEVADHIRADAASWV
SRLAGPGVTTRPQPTVWSTLEYGCHIRDVHRIFDHRVRLMLDADEPRFPN
WDQDQTALADDYRSQDPATVAAELVDAAATVADTYTHVPAHAWSRRGFRS
NGSEFTIASIAIYHLHDIVHHAHDVDHG
375142470YP_005003119.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MRMDTVVLSSNLTMLRVRGWQVYVWRDDDSVTVIDTGAPGSGAEILAEVP
RIDRIVLTHGHVDHCGSAAELQDATGATVFAGAGDAAPIRNGTAMPPPVF
EDWEIPIHERVSAGLPDAAPPVALLHEVHDGDALDFGDGAEVLAVPGHTD
GSIAIHLPRHGVLFTGDTIANVGTVMLGTFNQVRAQTVASFKRLAALDVD
TACFGHGEPITAAAGIRIRETAATLTE
375142469YP_005003118.1 putative metalloprotease [Mycobacterium rhodesiae NBB3]MTFREGIDIDTSTTSSSGGGGGGRGIAIGGGVGGLLILVVALFLGVDPST
VIPQQQIDTGGVSTPGFDTSQCKTAEDANNIVQCRVIATGNSVDSVWQQL
LPGEYTRPKVMLFTGSVDTACGPATSDVGPFYCPGDQTAYFDTDFFDVLT
TQFGSSGGPLAQEYVVAHEFGHHVQDLQGSLVNAQRDPQGATGGGVRTEL
QADCYAGIWAHYAAVTKQESTGVPFLEPLSDKDIADALSAAASVGDDRIQ
KSATGRVNPEAWTHGSSAQRQKWFTEGYRTGDIAACDTFSTNDLG
375142468YP_005003117.1 carboxylesterase type B [Mycobacterium rhodesiae NBB3]MAVVVGHSGSSAVVHTDLGDLRGTTEGGVGVWRGIPYAEQPVGDRRFLAP
APAQRWTGLRDALEHGPLPPQTKSFVGGGRDDPKVRDEACLTLTVWSPDT
SASLPVMVWIPGGAFVYGAGQFQLYNGSRLAANGNVVVVNVTYRIGVFGG
FELSDLGDGFDDNLALRDQIAALQWIRDHIAAFGGDPGRVTVFGESAGAT
SVLALLASPAASGLFSRAIAQSPPLPLIGDRETRARQAHDFLKRLGVEPS
EVKALPQRQLRRAAGMVQLKSASNTPHLAYGLTYGVDLLPRHPVDAARGG
AVERMPLIIGTNSHEASMFAWTKPPMLPTTTASIGAYLDRVAPDAKDQIL
AAYPDYPRRRALVAFGSDAMFGAPAWAFADAYSALAPTHMYRFDHVGWSL
RALGLGATHGSEIVHIQHSYASFIGRKLHPLGRRLQPPVGRRMQRAWLDF
AAKGWDTGDERSREECQTGEIEWSNGHDWPIYDTDRRMTRIIMTARDTVT
EDPDAERRKAWAGLH
375142467YP_005003116.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMAMHECERVGLDFIDSAPFRFVSTVDLDITGEQLFEVLADAESWPHWATA
ITKVTWTSPEPRGIGTTRTVNMRGGIVGDEEFLAWEPFTHMAFRFNEASS
SAIAAFAEDYRVVPTATGCHLTWVMAMKPKGAAGRIGMTLGKRIMGRTFQ
KFLYNLRDYSNRRFGV
375142466YP_005003115.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLEDEAIAWQPQSHLTFRLNATSVDTALLAKLVAKHLMNSKYRQYLSKLR
KCTAMRVDVSI
375142465YP_005003114.1 2-dehydropantoate 2-reductase [Mycobacterium rhodesiae NBB3]MRIALVGPGAIGTTVAALVYAAGHEVAAYGRTPRPSLELRPDDGDPIVVP
HPVRSEPAEADGPVDVVLLAVKDTQNEAAGAWLARLCGEHTVVCALQNGV
EQVERVGRFCPQSTVVPCVVWFSAETQPEGWVRLRTPVRLVLPDTPAASQ
LAEALRGPRISVDTDPDFVTATWHKLLVNAVAGLMVLTGRRSGMFRRDDI
AAMARAYVAECLAVARAEGATLGDELVDQTVRLFTEVPADMTTSILTDRE
NGRALEWDIRNGVISRKAAAHKIATPISDVLVPLLAAASDGPG
375142464YP_005003113.1 aspartyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MLRSHAAGSLRSADAGQQVTLAGWVARRRDHGGVIFIDLRDSSGVSQVVF
RAADVLANAHRLRSEYCIAVDGVVEIRPEGNANAEIPTGDIEVNATSLTV
LSESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNAIRLRSKVNAAARDV
LARHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLL
MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDADDVMAVSEEV
LKALWALIGYDLPTPIPRISYADAMRRFGSDKPDLRFALELVECTEYFSD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVAED
GSLGGPVAKNLTDAERDGLAAHVGAKPGDCIFFSAGPTKAARALLGATRI
EVAKRLDMIDPDAWAFTWVVDWPLFEAADEATAAGDVAVGSGAWTAVHHA
FTSPKPDSEATFDTDPGSAMADAYDIVCNGNEIGGGSIRIHRRDVQERVF
AMMGIDHDEAQEKFGFLLDAFTFGAPPHGGIAFGWDRITALLAGLDSIRE
VIAFPKSGGGVDPLTDAPAPITAQQRKESGIDAKPRKDGD
375142463YP_005003112.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWRVIVFTTVGAVIALYLASVLGYHATTDTYRDFSFTEAAPETETSVIIR
LRQFDTLQNSLSVDVLVHPGRDMLSKDPQAVDNLTIRLSSWTASGELIYL
HADVSSDANTTLIAVGDPDNWPLDSYTTDVIGVELFSGTGAARQAVPAGV
IVAGHINGWNIASENATIASPPAPQQTLRLTLERSSAALSFDIGLILVLL
ALPAAALFVATQTLAGRLKFLPPIMTWFAAMLFAVIPLRNLLPGAPPAGA
WIDQLVVLWVLLAVAAAMIMYVVAWWRSRRAD
375142462YP_005003111.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MRVIVTGGNSGVGAATATALAVLGHDVMIACRDVDKAQRVAVEMPGNIEV
RSLDLADLASVRTFADSVETVDVLVNNAGVMGMPLTRTVDGFEAHMGINH
LGHFALTCLLGERIKDRVVSVASATYLFTHLDLADLNWHTRKYSKWAAYG
QSKLANLLFVRELANRGVRAYASDPGATDTDITRSMGMGEHQRIRKLLHT
PAQGARASLEAVTTDLPTGTYLAPRFNQLGAPTVTKLRPKAVDPAMARRL
WELSAELTGCDWAI
375142461YP_005003110.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MTEIGDLKAFNANIVDEFRANGGKVGGPFEGGDLLLLTTTGAKSGQPRLS
PLAYFTVDDRLIVVGSYAGADVDPAWVHNLRKYSRAHIEVGTTDYDVIAR
ELPTAERDELYARLVEQSPVFGEYQQKTSRVIPLFELQKA
375142460YP_005003109.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MAGFAGRDAVIVEAVRTPIGKGKANGALHDVLPVDLLAHSLTELVKRSGI
DPAQIDDVITGAVSQVGDQAVNIGRNALLAAGFPETVPGTTVDRQCGSSQ
QAIAFAAQGVIAGAYDIVVAAGVESMSRVPMGSSVLPGSDPFGAMAQRYP
EGLVPQGISAELIAAKWGFSREQLDDFSAGSHEKAAQATKEGRFDNELIP
INGLTTDEIVRPGTTVETLAALKPAFYTPAYEARFPQIQWAITPGNSSPL
SDGSAAVLITTSEVAKRLGLRPLARIHTSTVVGSDPLYMLTGVIPATEKV
LRNAGLSLSDIDLFEVNEAFAPVVLAWAHDVGADLSKTNVNGGAIAIGHP
LGASGARIMTTLVNALEQRGGRYALQTMCEGGGMANATIIERLAK
375142459YP_005003108.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MTVLQGRLADRDAWSAVGECPVEKTMALLGTKTAMLIMREAYYGTTRFDD
FWRRIGVTKAAAAARLSELVDAGLLERRPYREPGQRSRDEYVLTAAGEDF
MPVVWAMFEWGRRHLPNRTPLRLAHADCGAEASVEIRCEKGHRVPPDELV
VRTVRS
375142458YP_005003107.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLHLRVIAPGELRDDVMGLLRANAGVTHIVVHPDAAVDPTGDEITADIAR
ECADDIVRGLKALGVKESGAMTLEVLDTVLSTRAWHAEDAAAGQPADAVI
WDELVSRTREESTLTFTFVMFLCIACLIAAIGVVTDSPVTVVGAMVVGPE
FGPLAGLAVALVQRRSHLAQRAALALLVGFPVAMAVTIAFTLIFEALGWV
TLQTTRELNEVDFIFQVGPFSFVIALLAGAAGMLSLVSSKSAALVGVFIS
VTTVPAAGFAVVAATIGDWHVAAQSTLQLAVNLTGITIAGVLVLWVYRLR
RTR
375142457YP_005003106.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGIKVALEHRTSYTFDRLVEVHPHVVRLRPAPHSRTPIEAYSLTVEPADH
FINWQQDAFGLFLARLVFPNRARSLTITVGLIADMKVINPFDFFIEEYAE
QIGFTYPKSLAEDLKPYLRPVDEGDEGSGPGDLVQAWVANFSVAPGTRTI
DFLVALNRAVNADVGYSVRMEPGVQTPDHTLGTGIGSCRDSAWLLVSVLR
QLGLAARFVSGYLVQLTSDVEALDGPSGPAADFTDLHAWAEVYIPGAGWI
GLDPTSGLFAGEGHIPLSATPHPESAAPITGATEPCQTTLDFTNAVTRVH
EDPRVTLPYSEAAWGAICELGGRVDQRLAAGDVRLTMGGEPTFVSIDNQV
DPEWTTDADGPHKRRLASELTARLKKVWAPNGLVHRNQGKWYPGEPLPRW
QIGLFWRPDGEPLWHDARLLADPWPSTPQTIEVVSDAGLQLLGALADGLG
LPASQIRPAYEDALSRLAAAARLPDGEPVAATDDLVSDDAEARAELVARL
EASVTEPAAYVLPLHRADDGSGWASADWRLRRGRIVLLDGDSPAGLRLPL
KSISWHPPQPSHDADPLARRGELPVESGAESAEVVAADSAPTTAVVAEVR
DGLLYVYLPPTDEAEHFVDLIRRVEAAAAKIDCPVVLEGYGPPPDPRITS
TTVTPDPGVIEVNVAPTASFAEQRQQLETLYSEARQARLSTESFDVDGTH
SGTGGGNHITLGGITPADSPLLRRPDLLVSMLTYWQRHPSLSYLFAGRFI
GTTSQAPRVDEGRAEALYELEIAFAEIARLSAGDGGSRPDQGRSASSAPD
QGRSASSAPDQGRSASSAPWIIDRALRHLLTDITGNTHRAEFCIDKLYSP
DGARGRLGLLELRGFEMPPHYQMAMVQSLLVRSLVAWFWDEPLRAPLIRH
GANLHGRYLLPHFLIHDIADVAADLRAHGINFDTSWLDPFTEFRFPRIGT
AVFDGVEIEIRGAIEPWNVLGEESTAGGTARYVDSSVERIQVRLIGADRQ
RYVVTANGHPIPLLATDNPDVQVGGLRFRAWQPPSALHPTITVDGPLRFE
LVDTATGMSRGGCTYHVSHPGGRSYDHPPVNAVEAESRRGRRFETTGFTP
GKVDLSDIREKQARQSTDVGAPGILDLRRVRTVLQ
375142456YP_005003105.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALPAASSHDDIDNLLSRYRTARAQQALFDVRGGSGIGGGGYDEFVDAAG
NIRPAWHELAECVGERGRIGLNQLRSTVRSLVDNDGITYVQVDRHGDAVT
NGNGAAEPGPWHLDALPLLISSADWDMLEAGVLQRSRLLDAVLTDLYGPR
VSVTSGVLPPQLLFAHPGYVRAARGIEVPGRHQLFMHGCDISRTPDGSFM
VNADWTQAPSGAGYALADRRVVAHAIPDLYERIGPRPASPWAQALRLALI
DAAPESAQEPVVVVLSPGILSETAFDQAYLASVLGFPLVESADLVVRDGK
LWMRSMGTLKRVDVVLRRVDADYADPLDLRPDSRLGVVGLVEVLRRGAVT
VVNTLGSGILESPGILRFLPELAERLLGETPLLRTAPMYWGGINTERSYL
LSNLTSLLIRPVTGGESIVGPALTAAQRKALGVRIEASPWQWVGQELPQF
SSAPTDYYPGGLSAANVGMRLFTVSQRSGYAPMSGGLGYLVAPGNAGFKL
NTVAAKDIWVRTPTRVTAERIPTAPPVDLPAITPSPTGAVSSPRVLSDLF
WMGRYAERAENMARLLTVTRERYHEFRYRRELAGSECVPVLLAALGSITG
TSTGDGDYAEMVATAPSTLWSLTADRHRPGSLAQSVDRLSLAARAVRDQM
SNDTWMVLAAVERALLHAPDSPPESKAEGDAFLSSTSNLTLAGMLALSGV
AAESMVHDVGWTMMDIGKRIERGLGLTALLRATLTTVRSAGAEQTITEAA
LVACESSVIYRRRNPGTVSVAAVAELVLFDAENPRSLAFQLERLRAALKS
LPGSSGSSRPERLVEEIGTRLRRIEPADLEEATPDGRRGDLDSLLKSMHA
ELRELSGVITATHLSLPGGMQPLWGPDERRVMP
375142455YP_005003104.1 transglutaminase [Mycobacterium rhodesiae NBB3]MTAFPDGPTASGSSRCYQVSHRTTYRYSDDVTSSYGRGFLTPRDSARQRC
LSHELLIEPEAADSSTSRDAFGNISSYFHVTERHRTLSITSSSVVEVDPP
PADLYGGGSARAPWEIARPVGPDGALATEFTLDLRQPEITDALRDYAAPS
FEPERPLIDVLRDLTSRIYTDFTYRSGSTTVSTQVSEVLTAREGVCQDFA
RLAIACLRANGLAASYVSGYLATDPPPGKERMVGIDATHAWASVWTPQNH
WLGFDPTNDQMVDERYITVGFGRDYADVPPLRGIIYTDSEKSVIEVAVDV
APFEGGVLNA
375142454YP_005003103.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRDFTCPNCGQRLAFENSVCLSCGSSLGFSLQDMALLVIAPDDESDHAGA
VPQSNYQLCANLYRAKCNWLVERAPVRRLCASCALTRTRPNDADTKAMAA
FADAEKAKRRLIAELYELKLPIIGRDEDPDFGLAFDLLSSENEKVFTGHE
NGVITLDLAEGDDVHREQLRVSMEEPYRTLLGHFRHEIGHYYYYRLVDPS
ADYKARFGELFGDADADYQAALDRHYNDGPPPDWNKNYVSSYATMHPAED
WAETFAHYLHIRDTLDTAAAFSLAPASATFERGVLGPSGFQTIIDMWLPL
SWSLNMINRSMGKQDLYPFVLPAPVLEKMQFVHTVIDEITSSPPALASQN
375142453YP_005003102.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLLNRDTAEGIANGSITLVLRRWDAPRAKPGGTQRTVAGTIRIDDVAEYP
GTHRVTAAQARAAGYPDVATAQKDLDRRAARHTYAITVSYLAPDERPDLA
ADDQLSPSDIEAISSRLDRWDAATEAWTRRYLTMICANEAVRAPDLADRE
GIDVPRFKRRVRQLKSLGLTISLEVGYRLSPRGQAFLRLSSDSLGRADSR
375142452YP_005003101.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADRYGSDVLASNPHRKPRSTELPVQIGMVVEDAQTGFVGAVLRIEYGRM
ELEDRHGRKKPFPVGPGYLVDGKPVILTPPRAAAPKASRTASGSVAVAGA
RAKVALASRIYVEGRHDAELVEQVWGDDLRIEGVVVEYLGGIDDLVAIVE
DFRPAPGRRLGVLVDHLVVGSKEARIAEAVRRGPGGGDTLVVGHPFIDIW
QAVKPGRIGVPAWPVVPKATDWKKGVCAELGWPYAQQTDIALAWQRIRSR
VRDWNDLEPALIGRVEELIDFVTQPCA
375142451YP_005003100.1 AAA ATPase [Mycobacterium rhodesiae NBB3]MSDGLFDVPGETSSSGGALVGASTPLAVRMRPATLDEVVGQDHLLQPGSP
LRRLAEGSGAASIILYGPPGTGKTTLASLISQATGRRFEALSALSAGVKE
VRAVIEVARRAAAHGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAA
TTENPSFSVVAPLLSRSLILQLQPLDANAVRAVVRRAIDDERGLGGKVAV
ADEAVELLVQLSAGDARRALTALEVASEAGEEVTVEVIEQSLDKAAVRYD
RDGDQHYDVISAFIKSVRGSDVDAALHYLSRMLIAGEDPRFVARRLMILA
SEDVGMADPTALQTAVAAAQTVQLIGMPEAQLTLAHATVHLATAPKSNAV
TTALGAAMADIRAGKAGQVPTHLRDGHYSGAEKLGNAIGYKYAHDDPDGV
VPQQYPPDDLVGIDYYRPTTHGAEREIATRLDKLRAIIRKKR
375142450YP_005003099.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MERGGDADDRLDRAFLALADPVRRAIVARLSRGPATVNELAAPFDITKQA
VSKHIQVLEHAGLVTRTRDAQRRPVHLDAAALERLTAWIDRYRLDAERSY
RRLDALLADMTDTNEKGTKT
375142449YP_005003098.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTNALDLTAPVDTLAMEFTREFDAPVEALFRAHADPELVKQWLGPHGLEM
EISEWNFTSHGGYRYTHSNDQGTFGFNGTFHTVRDNEFIVQTFEFEGAPD
MVNIEYMWFEDLGNGRSRLRGRSICPNTEARDALLSSGMEGGMTEGYEKL
DELLKNL
375142448YP_005003097.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTVTGIITAILIGIVIGVLARLLLPGKQPIGMLVTILVGIVAALIGTWLA
RQLGISTTTPGVDWGELLVQLVVAVIGVALVAALMGRRHTGVMGRRRSGL
MR
375142447YP_005003096.1 secondary thiamine-phosphate synthase enzyme [Mycobacterium rhodesiMPPDGRRLDGVDTDVLDIDTTRRRIVDLTDAVRSFCSGDRDGLCNVFVPH
ATAGVAIIETGAGSDDDLLDTLERLLPRDDRYRHAHGSPGHGADHVLPAL
ISPSVTLPVQGGEPLLGTWQSVVLVDLNSDNPQRKVRLSFISG
375142446YP_005003095.1 alanine--tRNA ligase [Mycobacterium rhodesiae NBB3]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPYFLG
QRTPPWNRAVSVQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKKGA
IEFAWTLLTNSVEQGGYGLDPEKLWATVYLDDDEAIGLWQDVAGLPPERI
QRRGMADNYWSMGIPGPCGPSSEIYYDRGPEYGIEGGPEANEDRYIEIWN
LVFMQNERGEGTSKENFEILGPLPRKNIDTGMGVERVACLLQDVDNVYET
DLLRPVIDVIVAVAPRGYGQGNHSDDVRYRIIADHSRTAAIIIGDGISPG
NEGRGYVLRRLLRRIIRAAKLLGVEQPIMAQLMDTVRDTMGPSYPELVSD
FDRIQRIAIAEETAFNRTLASGSRLFDEAAATTKRSGKSTISGTDAFTLH
DTYGFPLELTLEMAAEADLSVDEEGFRGLMAEQRRRAKADAAARKQAHSD
LSAYRELVDTAPTEFTGFDELTTEARILGIFVDGKRVPVIGHGTHDADRV
ELVLDRSPFYAESGGQIADEGTITGAGASAAAKAAVTDVQKIAKTLWAHR
INVESGEFVEGDTVVAAVDPRWRHGATQGHSGTHMVHAALRQVLGPNAVQ
AGSLNRPGYLRFDFNWQGGLSEDQRTQIEEVTNEAVEANFEVHSFTTDLE
KAKSMGAMALFGEAYPDEVRVVEIGGPFSLELCGGTHVNSSAQIGPVTIL
GESSVGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSEEVPARVA
NLVERLRAAEKELDKMRLANARAAAVNAAAGAEQVGKVHLVAQRMAGGMS
AGDLRALVGDIKGRLSSEPSVVALIAEGDDDAVPYVVAVNPAAQDLGLSA
NDLVKQLGAQVNGRGGGKADLAQGSGKGAAGIDAALAALRAELGRS
375142445YP_005003094.1 RNAse H-fold protein YqgF [Mycobacterium rhodesiae NBB3]MPTESVDRLPDRPGPTLHPPDPGRGRRLGIDAGRVRIGVAVSDPDGILAT
PVETVDRRKGSDKHVRRLAALVGEYEAVEAVVGLPRTLADRSGSAAQDAI
ALADQLAARIAPVPVRLADERLTTVAAQRALREAGVRAKGQRSMIDQVAA
VGILQNWLDQRRAALAAHSDFRDEVGDV
375142444YP_005003093.1 putative periplasmic solute-binding protein [Mycobacterium rhodesiaMSDDWGRERVEPDWRSERVEPMAVGPPRRRRTRADRLREARGRRKRRLAS
GLALGILIVVVLGVVFLGSKLWHGVFGTGSDFTGDGVSDVVIQVHEGDST
TAIGQTLQDQNVVATSAAFVSAAQGNAAISAIQPGFYKVRTEIPAANAVE
RLADPQNRVGKLVIPEGRQLDDIRDVKTNAVTDGILSLISKATCVDLDGE
RNCVAADALKESAKTAEPSALSVPEWAIGPVNAMGDDHRRLEGLIAPGSW
NIDPSAPPQDILSTLIDASATQYAQGGLLDTAKAMNMSPYQILTVGSLVQ
REATPEDFAKVARVIYNRLGENRTLEFDSTVNYPLDRIEVATTDGDRGQH
TSWNTYVRPGLPATPICSPGQPALAAAEKPEPGDWLYFVTIDKQGTTLFT
RDYQQHLANIELAMRNGVLDSSR
375142443YP_005003092.1 shikimate-5-dehydrogenase- fungal AROM-type [Mycobacterium rhodesiaMIAARKAAVLGSPIAHSRSPQLHLAAYRALGLDGWTYERIECTADQLPVL
VGDFGPEWVGVSVTMPGKFAALRFADERTPRAELVGSANTLVRSDNGWRA
DNTDVDGVTGALGQASGRAAVLGSGGTAPAVVVGLAELGVQDISVVARNR
DKAEPLLALAASVGAQARWIELGTPLTDIDVVVSTIPADVAAAHVDTLAA
VPVLLDAIYDPWPTPLAAAVEAAGGRVISGLEMLLNQAFAQVEQFTGLPA
PRDAMRAAIDDR
375142442YP_005003091.1 prepilin signal peptidase PulO-like peptidase [Mycobacterium rhodesMLVWFVVLCWYDVTQRRLPNWLTVPGAVAVLAWAAATGHGVPAFAGAATL
FAIYLALHLIAPAAMGAGDVKLAIGIGALTGAFGVDVWVLAALAAPLVTA
AWAIVVKLGSAVRTVPHGPSMCVTAALAAAPVMV
375142441YP_005003090.1 ketosteroid isomerase-like protein [Mycobacterium rhodesiae NBB3]MHTQSMQIRQQDLPAISERYFAAWAAHDPDAIVALHTPDTRFWMHMGGEP
VVGRDAVRDTFAEIFAQFPDFTFQTYRVIFGEDHWILDWALISGDIRFDC
LDVVNVSPDGLVARKDTFVDAAQVQAALGVTA
375142440YP_005003089.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAVAPVDQLPLIDTLPVEYLFDMHVDLAPAQPITTPVGARMTFITTGGV
IDGPRLQGEVLPGGGDWLLVGGDGAGRVDVRATLKTHDGVLIHYEARGII
KVPADGLQRLAAGEVLPFDQTYVRTTPTFETADERYAWLSELVAVGYNVL
SPNHIDYRIYRVL
375142439YP_005003088.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MVLGYGRPVATRVAKRTQAQRTEATTAALVDAARELFARDGYEATSLDAV
AARAGMTKGAVYHHFDGKRQLFEAVFSREIDRMTTPLATAYTRKKDPWDA
FKAASRAFLDECLDPGLQRIVLLDAPAAIGWEGIRRLEAPLLDMMELAIS
RAVDAGRIAARPPGPLAHFLFGATCEVAMIVARADDQRTAQRQALAEIGR
VLDSLAIDQ
375142438YP_005003087.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEARPISAARIDVSAVAAAAWLTGTAFLALLVLYVVGLDQGATSILGSD
THIHEFVHDARHLLGYPCH
375142437YP_005003086.1 nitrile hydratase accessory protein [Mycobacterium rhodesiae NBB3]MTLHETCTTDQAAPQFEHEWQRRAFGLALALSEFGHYEWSDFQQSLIDTI
GRWEHTPEAERGEWDYYDHWVTALAKVVDDHHLLTNPAIANGDDHD
375142436YP_005003085.1 nitrile hydratase subunit alpha [Mycobacterium rhodesiae NBB3]MSDQFQYPADRESASAAKVAALESLLIEKGVITGQTVDKVLSYFESEMTP
LNGRKIVVKAWTDPGFAARVVVDTPAAIAELDLPEGMAGAEGEHLQAVAN
TPGVHNLIICTLCSCFPWPVLGLPPYWYKDPVFRSRAAREPRKVLGEIGV
DLPAETEIKVWDSSGHSRWFVIPERPSDTDDFTDEMLMDLVTTESMMGVA
LAGPVK
375142435YP_005003084.1 nitrile hydratase subunit beta [Mycobacterium rhodesiae NBB3]MKLQHYLGGLEGLPEPLNLEKRVFVEDWEERIFGIHVAMMGLSNHLGSAL
PQYPIDDVPTAFKDEWTWASLRTGAEAMNPFDYFKFRYYEKWLGGITQFF
VDQGYITEHELSSRQAELADAPAATADGTSAIDDQVVEYLRKGDSPRRDV
AHPKFAVGDRVRITNVPAAAHTRLPGYLRAREGTIERIFEGDYGYFVHTG
DGIGDPMPIYIVAFSPDELFGERAEGGPLTIYAELFEAYLEGVR
375142434YP_005003083.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDSRSALTLSIGVLGGLAVALTAEVITVPIWVVFLTWASFFFVGGGVTGW
VRSLSSNLVGVLIASASLYAAHLMGGGLWMTALAVGVGSAVMVQASWVPL
LSTTPAVVVGFASTVSTVAGTGNTITVTSISHPGLVAAMACLLGASFGLL
SEYLANALTREPAKEGSPAQ
375142433YP_005003082.1 chorismate synthase [Mycobacterium rhodesiae NBB3]MLRWTTAGESHGRALVAVVEGMIAGVHVTTDDIAGQLARRRLGYGRGARM
KFEQDQVTMLAGVRHGVTLGGPIAIEVGNTEWPKWETVMAADPVDEAVLA
ESARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTF
ARALLREALGVEVLSHVISIGASKPYDGPPPQFSDLPAIDESPVRAFDEA
AAQSMIAEIEAAKKDGDTLGGIVEVVVHGLPVGLGSFTSGDNRLDSQLAG
AVMGIQAIKGVEIGDGFETARRRGSVAHDEMYPGADGVMRSTNRAGGLEG
GMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAVPAA
GVVVETMVALVLARATLEKFGGDSLTETRANVDNYLRAVTEREPAGGQKR
SDPGISTAQPVQAPG
375142432YP_005003081.1 shikimate kinase [Mycobacterium rhodesiae NBB3]MAPKAVLIGLPGSGKSTIGRRLAKAMNLTLLDTDAAIEETTGRTIADIFA
TDGEEEFRRIEENVIRSALKTHDGVLSLGGGAVTTAGVRDALAGHTVIYL
EINAAEGVRRTSGPTVRPLLAGPDRGEKFKALMTQRVPLYRRVATLRVNT
NRRNPGAVVRYIVERLENSETSRHQRRRRRPPWRRTPTTLTPAPTTEAPP
SPAELAAKKAPGPHA
375142431YP_005003080.1 3-dehydroquinate synthase [Mycobacterium rhodesiae NBB3]MPEPVTVDVLVDPPYPVIIGTGLLGELERTLAGRHKVAILHQPTLGETAE
AIRHTLSEKGIDAHRIEIPDAEKGKDLPVLGFIWEVLGRIGIGRKDAIVS
LGGGAATDVAGFAAATWLRGIDIVHVPTTLLGMVDAAVGGKTGINTDAGK
NLVGAFHQPAAVLVDIATLETLPRNELVAGMAEIVKAGFIADPVILDMIE
SDPQAAVDPKGQVLPELIRRAIAVKAEVVAADEKESQLREILNYGHTLAH
AIERRERYEWRHGAAVSVGLVFAAELGRLAGRLDDDTADRHRNVLQALGL
PVEYDADALPQLLEYMAGDKKTRAGVLRFVVLDGLGKPGRLEGPDPSLLA
AAYSVIGKGAA
375142430YP_005003079.1 3-dehydroquinate dehydratase [Mycobacterium rhodesiae NBB3]MTTVLVLNGPNLARLGKREPEVYGSTTHDELVTLIENEAEDLGMKAVVRQ
SDSEAELLNFIHAAADAGDPVILNAGALTHTSVALRDACAELTGPLIEVH
ISNVHKREEFRHHSYISGVATGVIVGLGTQGYVLALKYLATLG
375142429YP_005003078.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNPDEFCTSDQWSVLTSAASHSQFAGVLGGFLITAIALLMDKKSRESIHT
LALFSAAVLILMLDSFLFSLITGTQTPEGDRRGICAIAWTQGAVSTGMLA
AGATALFGGLGWMLASHAVNRLAEQDPDDAGAYGFLADLGGWLTFAATMA
TTLILSETTIDYLHFMFGRRPDLWATGLIVVSAAVVIGVNFALVYVRTKT
LRRSLADTSEPTRLALRSIKVATVTTMGLAIAASWLAVSLARFPQGWLTE
PNIVFVVFVAILTFVLPTIVATAICYSVASTEGGLSIRGLRGTSGQGRSP
ASRARR
375142428YP_005003077.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSKWLLRGLVFAALMVIVRLLQGALINAWETRAGLISIVLVTLFAVAVFI
WGLADGRADARANPDPDRRGDLAMTWLLAGLFAGIVSGAVAWVIHLVYKA
LYVEGLINELTTFAAFTALLVFLVSLLGVTLGRWLVDRNAPPVTRHRSGD
DERADTDVFAAVRHPDGEQTEEYETTEARRES
375142427YP_005003076.1 Xaa-Pro aminopeptidase [Mycobacterium rhodesiae NBB3]MTISQRRDRLRQRLVAADLDAILVSDLVNVRYLSGFTGSNAALLVRAEDP
TPVLATDGRYRTQAAQQAPDAELVIERACGPHLVARAAADGVSRLGFESH
VVTVDAFSVLTKAAGELTELVRASGTVEALREVKDAGEIALLRLACEAAD
AALHDLVERGGLRPGRTEKEVGRELEALMLDHGADGVSFETIVAAGANSA
IPHHRPTDAVLAAGDFVKIDFGALVCGYHSDMTRTFVLSPAAQWQHDIYD
LVATAQRAGRDALAPGVPLSDVDAAARQIIADAGYAENFGHGLGHGVGLQ
IHEAPGISASSAGTLLAGSAVTVEPGVYLPDRGGVRIEDTLVVGSDSHQT
SEPGSRRHEAADLLTRFPRELAIL
375142426YP_005003075.1 translation elongation factor P [Mycobacterium rhodesiae NBB3]MASTADFKNGLVLQIDGQLWQIIEFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVETATVDRRDATYLYRDGSDFVFMDSEDYEQHPLSEALVGD
AAKFLLESLPVQIAFHNGAPLYLELPVTVELEVTHTEPGLQGDRSSAGTK
PATVETGAEIQVPLFINTGDKLKVDSRDGSYLGRVNA
375142425YP_005003074.1 transcription antitermination factor NusB [Mycobacterium rhodesiae MPDRRGDRGRHQARKRAVDLLFEAEARGLTPADVAEARNALAQTQSDVSP
LNPYTVTVAQGVTEHTAHVDDLISAHLQGWTLDRLPAVDRAILRVAVWEL
LHADDVPEPVAVDEAVELAKQLSTDDSPGFVNGVLGQVMLVTPQIRAAAQ
AVRGAGDSGAGS
375142424YP_005003073.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGAPQDWAPYSSVDEAAKVYLRDPELALDQLRSVVDLPAIRSFIMSRGFS
DGSWGDTDENPLWQEVVLTDGHRLIIWRADDEVTTVDDRERRVLNASVRT
ILLSTITDHVLTTEYEVFDDGTRRLSEVRLRMYTQLITRSRHRSLTETDI
YCESFRYYKSVDNGGLAQMQRLLQFGRVLSRCME
375142423YP_005003072.1 transposase- IS30 family [Mycobacterium rhodesiae NBB3]MGFRGQGQQAPASARLAFFEAVNAGSSWAAAATVAGVARDTGDRWARAAG
YQAQTRHFGTRYSAQAREAFWAAMRAGASVTQAALGAGVSEIAGRRWVKQ
AGYVPRTTVPIAAAEVLTVVDGSARCRRALTFTERCRLEMLLENGYTAAQ
LVDLLGRHQDTISREIARGQTASGYRARVGQDVADANRKRPKVRKLVRNP
ALLAEVLQGLQQRCSPEQIAGRLRLDFPDDSEMWVSHETIYQGLYVQLRG
ELTKDLKSALRTGRIKRKPHGRNQIAERRRFKEGMVSITERPAEADDRAI
PGHWEGDLIMGSANASAIGTLVERTTGFVLLLHLPVDHTAETVAAAMTAK
IVEIPEILRRSLTWDQGTEMAQHSAITKATGLPIYFCDPHSPWQRATNEN
TNGLLRQYFPKGTDLSFWGPGFLDQVATELNGRPRKRHGFRTPAEELHRL
LSNPSAYAAATA
375142422YP_005003071.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMTQRTVVISGAGIAGPSLAFWLTRNGYRVVIAEIGPGIRPGGQTVDLRGA
GGDVVERMGLIDEMRARALEQRGAAWVRSDGSRRAEMPVTAFGGNGLVSK
LEILRGDLVDVLYQVTRDSVEYRFNTSISNIDHGADGAEVAFADGTVLRA
DLVVGADGPHSAVRRLVFGPEDQFVEPIGGYNAWFSAPDRVGLDGWFLLY
QAPGGLNASMRPSHDPSIAKAGLAFQSEPLAYDRHDTDEQRQILIERFAG
AGWECDALLAAAQDADDFYFDSFAQVHMPTWSSDRVTLVGDAGYCASPLS
GMGTSLALVGAYVLAGELGAADAFDAERLSAKLSRYETVMRPYVDKCQDL
PNSIDRYAPMKESDIAITAQVMKWMQRWPLRPIASRLWFTAADSIVLPDY
PG
375142421YP_005003070.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium rMSDTNRHGRFSTLSPMKLDDNHASIREAIDAGLLAGAVTLVWRSGEVLQV
NELGHRDVDAGLPMERDTIFRIASMTKPVTIAAAMSLIEEGRVALSDPVA
TWLPELSDMEVLLEPRGPLDKTTPARRQITIEDLMTHRSGLAYSFSVLGP
LSKAYGRMSFRQDQDRWLSELVTLPLVHQPGERLTYSHATDVLGIALSRI
EGKSLADVLSERIFGPLGMVDTGFSVGTAGRRRAATMYQLDADLKLRHDV
MGPAHIVDPPFCAGGAGLWSTVDDYLRFARMLLAGGTLDGVRVLSEESVR
QMRTDRLTDEQKRQPFLGSPFWVGRGFGLNLSVVTDPSKSRQLFGPGGLG
TFGWPGAYGTWWQADPSADLILIYLIQNLPELNADAAAAIAGNTSLAKLQ
SAQPKFVRRTYQALDV
375142420YP_005003069.1 pyrimidine operon attenuation protein/uracil phosphoribosyltransferMGAPGTDRELMSAADVSRTISRIAHQIIEKTALDGPDAPPVILLGIPTRG
VTLAARLAEKITEFADVTVARGALDNTLYRDDLDSKPPRPLEDTSIPEGG
VDGTLVILVDDVLYTGRSVRAALDALRDIGRPRAVQLAVLVDRGHRELPL
RADYVGKNVPTSRSENVKVRLMEDDEVEGIWIAPQGGPPR
375142419YP_005003068.1 aspartate carbamoyltransferase [Mycobacterium rhodesiae NBB3]MKHLLSAADLSREDAVAILDNADRFSQALLGREVKKLPTLRGRTIITMFY
ENSTRTRVSFEVAGKWMSADVINVSSSGSSVSKGESLRDTALTLRAAGAD
ALIIRHPASGAAQQLAEWTRPSGTDATGPAVINAGDGTHEHPTQALLDAL
TIRQRLGDIEGKRVVIVGDVLHSRVARSNVLLLHTLGAEVVLVAPPTLLP
VGVAGWPVTVSHDLDAELPVADAVLMLRVQAERMNGGFFPSAREYSVLYG
LSEKRQAMLPGNAVVLHPGPMVRGMEIAFSVADSPQSAVLQQVSNGVHIR
MAVLFHLLVGAETEAISA
375142418YP_005003067.1 dihydroorotase- multifunctional complex type [Mycobacterium rhodesiMSVLIRGVRLYGEGDRVDVLVSDGQIADIGADLAVPDDGSVSDVVDAHGQ
ILLPGFVDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTNPVAD
SPVVTDHVWHRGQQVGLVDVHPVGAVTMGLAGAQLTEMGMMAAGVGKVRM
FSDDGICVHDPLIMRRALEYATGLGVLIAQHAEEPRLTVGAVAHEGPNAA
VLGLAGWPRAAEESIVARDALLARDAGARVHICHASTAGTVEIVRWAKEQ
GISITAEVTPHHLLLDDRRLASYDGRNRVNPPLREATDAEALRQALADGV
IDCVATDHAPHAEHEKMCEFAHARPGMLGLQTALSVVVETMVRSGLLTWR
DVARVMSENPARIVGLPDQGRPLEVGEPANLTVVDPDATWTVEGSELASR
SDNTPYESMTLPATVTLTLLRGKVTARDGKSPT
375142417YP_005003066.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNTGTLVGSLIMAAVLAVLIAFIIQAMLRGWRRRAERQAELIGTLPPLPD
TVGSAIIPATRGLYVGSTLVPNWNDRVAVGELGFRHKAVLTRYPEGIMLQ
RSGAGPIWIPEESITAIRTERGVAGKAMTHEGILAIRWRLPSGTEIDTGF
RADNRAAYTPWLEAA
375142416YP_005003065.1 carbamoyl-phosphate synthase small subunit [Mycobacterium rhodesiaeMTKALLVLADGRIFTGTAFGAIGQTLGEAVFSTGMSGYQETLTDPSYHGQ
IVIATAPQIGNTGWNDEDAESRGDKIWVAGYAVRDPSPRASNWRATGTLD
DELVRQGIVGIAGIDTRAVVRHLRSLGSMKAGVFSGDALAHPDELLARVR
EQPSMLGANLAGEVSTDVTYVVEPDGPQRFTVAAIDLGIKTNTPRNFAGR
GIRSHVLPSTVTFDQIADLKPDGVFLSNGPGDPATADHIVGVTREVLGAG
IPLFGICFGNQILGRALGRSTYKMVFGHRGINVPVIDHATGRVAVTAQNH
GFALEGEAGETFDTPFGSAIVSHTCANDGVVEGIKLVGGRAFSVQYHPEA
AAGPHDANYLFDQFVDLMEGGR
375142415YP_005003064.1 carbamoyl-phosphate synthase large subunit [Mycobacterium rhodesiaeMPKRTDLNHVLVIGSGPIIIGQACEFDYSGTQACRVLRAEGLQVSLINSN
PATIMTDPEYADHTYVEPITAAFVEKIFAQHAERGNKIDALLATLGGQTA
LNTAVALYENGALERWGVELIGADFEAIQRGEDRQKFKDIVSKVGGESAR
SRVCFTMDEVRETVAELGLPVVVRPSFTMGGLGSGMAYSAEDVDRMAGEG
LAASPSANVLIEESIFGWKEFELELMRDGHDNVVVVCSIENFDPMGVHTG
DSVTVAPAMTLTDREYQKMRSLGIDILREVGVDTGGCNIQFAVNPADGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADATLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETTRAGFWTKPDPEVSVDELLEALRTPTDGRLYDLELALRKGAT
VEQVAQASGVDPWFVEQIAGLVTLRAELLDAPVLDEQLLRRGKYHGLSDR
QIASLRPELAGEIGVRALRTRLGIHPVYKTVDTCAAEFEAKTPYHYSTYE
LDPAAETEVAPQTEKPKVLILGSGPNRIGQGIEFDYSCVHAATTLSEAGF
ETIMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVYYAESASGAGGPGVV
GVIVQLGGQTPLGLAERLEKAGVPIVGTSPKAIDLAEDRGAFGEVLNIAG
LPAPRFGTATSFEQARRIAADIGYPVLVRPSYVLGGRGMEIVYDEETLQG
YITRATELSPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGIMEHIEEAG
IHSGDSACALPPVTLGRSDIESVRRATEAIAHGIGVIGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAVPLAKACARIMLGASIAQLRTEGVLAHS
GDGATTARNAPVAVKEAVLPFHRFRKADGAQIDSLLGPEMKSTGEVMGIA
HDFGSAFAKSQTAAYGSLPAEGTVFVSVANRDKRSLVFPVKRLADLGFRV
LATAGTAEMLRRNGIPCDEVRKHFEQPGEGRPASSAVDLIRSGEVDMVIN
TPYGNSGPRIDGYEIRSAAVSMNIPCVTTVQGASAAVQGIEAGIRGDIGV
MSLQELHSVLGP
375142414YP_005003063.1 orotidine 5''-phosphate decarboxylase [Mycobacterium rhodesiae NBB3MTGFGARLTAAITARGPLCPGIDPHPELLSAWGLAVDADGLARFCDICVE
AFAGFAIVKPQVAFFEAYGAAGYAVLERTTRALRDAGVLVLADAKRGDIG
STMAAYAQAWAGHSPLAADAVTASPYLGFGSLQPLLDTAHDNGRGVFVLA
ATSNPEGADIQSADINGRTVAQSIVDAAATVNRDRAAGAVGVVVGATLAA
PPDVSALGGPVLVPGVGAQGGRPEALGGLGGAQRGQLLPAVSREVLRAGP
DVAALRAAAERFRDAVAYLA
375142413YP_005003062.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAYDLAAWTDFANTVAGGAAALAGLLFVGLSLNLSEVLRYQGVPSRAGA
TLGLTVAILLTAIFVATPGQSRYALSIEIAVLGLATAALVSEAMRHQRAG
AHRGRALTSMLMLLLPALLLLVAAVSLWSERGGGLYWVTAAVTTGFVAAT
ANAWVLVVEIKR
375142412YP_005003061.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLFARRGVERDRLRNMIRQKEVVVVVRACRSLIMVFTVLAGALLFSVASP
AWACGCGAYVPDHPGSSVADERALIAWDGSTEDILMSLSVTGSSDRAAWV
MPVPSAARITLGDTEVFSELARITAPRIEYRDSWWPTIPWLVWAGSASDT
AGAPAGAVNVLGRQRLGPFDVTRLAANDPTALANWLSDNGFPHPDGLDDN
LAPYVADGWEVVAVQLVPAEEGGSLSGALQPLRLSFASDTVIYPMRLSRS
ATTSQYIDLYVLADHRMDPSAVPVAGDRPTLEFAGRIERSDSPALADYVD
DGAFLTRWKNTIWDPAAIGGDYVFEQAASDTPFQQVTYRTRDRGHITYLI
LVASIGVLGLAGAVLVIRRMMRSGR
375142411YP_005003060.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFDQ
375142410YP_005003059.1 guanylate kinase [Mycobacterium rhodesiae NBB3]MSAGRGAGRVIVLSGPSAVGKSTVVRCLRDRVPDLFFSVSVTTRAPRPGE
VDGVDYSFVTADRFQELIDHGALLEWAEIHGGLHRSGTPAQPVLDAARAG
RPVLIEVDLAGARAVKQSMPEVVSVFLAPPSWDALESRLTGRGTETQQVM
DRRLATAREELAAQNEFDVVVVNSELESACSELVSLLVAHGEPPEFHR
375142409YP_005003058.1 DNA-directed RNA polymerase subunit omega [Mycobacterium rhodesiae MVSHPNFTDNRQEIFYVSTPHADAQLTAVDDIESGAGAYDTPLGITNPPI
DELLDRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEK
PLSIAMREIHGDLLEHTEGE
375142408YP_005003057.1 phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cystMTERKRIIVGVAGGIAAYKAATLVRQLTEAGHTVRVVPTESALRFIGAAT
FEALSGNPVHTGVWDDVHEVPHVRIGQEADLVVVAPATADLLARAVSGRA
DDLLTATLLTARCPVLFAPAMHTEMWFHPATVDNVATLRRRGAVVLEPAS
GRLTGADSGAGRLPEAEEISTLANLLLERGDALPYDLAGVRVLVTAGGTR
EPIDPVRFIGNRSSGKQGYAMARVMAQRGAEVTLIAGNTAGLIDPAGVDV
VHIGSAAQLSDAVAKHAPDAHVLVMAAAVADFRPTEVQTNKIKKSADPDA
AAPVIELTRTDDVLAGAVRARTDGQLPNMRAIVGFAAETGDANGDVLFHA
RAKLKRKGCDLLVVNAVGENRAFEVDNNDGWLLAADGAESALEHGSKTLM
ASRIVDAIGAILQSGGG
375142407YP_005003056.1 S-adenosylmethionine synthetase [Mycobacterium rhodesiae NBB3]MSEARLFTSESVTEGHPDKICDAISDSVLDALLADDPKSRVAVETLVTTG
QVHVVGEVTTTAREAFADISNIVRARILDIGYDSSEKGFDGETCGVNIGI
GAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIRDTPELMP
LPIALAHRLSRRLTEVRKNGVLDYLRPDGKTQVTVQYDGTTPVRLDTVVL
STQHAAGIDLEATLAPDIREKVVNTVLADLNHESMDTSDFRLLVNPTGKF
VLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRW
VAKNVVAAGLAERIEVQVAYAIGKAAPVGLFVETFGSESVDPARIEKAIT
SVFDLRPGAIVRDLELLRPIYAQTAAYGHFGRTDVDLPWERLDKVEDLKA
AV
375142406YP_005003055.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMKAAPQYDTVIVGAGFSGIGAAIKLDKARMSNYLVIEAGEGPGGTWYWNT
YPGIAVDIPSFSYQFSFEKSPDWTRTYAPGRELRAYAEHCVDKYGLRRKI
RFNTKVLGATFDDDDSLWRVELDSGETVTTRFLVNASGVLITPNMPDIDG
VDSFAGATMHTARWDHDLDLTGKRVAIIGTGASAVQVIPEIAPIAERLTV
FQRTPIWCLPKPDVPLSPLTRRLMRLPGGHTVQRVLSQAYVELTFTLPAQ
YFTLNPMARNMSKVGESYLRKQVRDPEVRDKLTPRYAVGCKRPGFHNTYL
STFNRDNVELVTEPIDKITGSGVATVDGETRDIDVLILATGFKVMDIEDN
PTYPVTGSGGRSWSQHFSENRLQSYEGVAVPGFPNFFTVFGPYGYVGNSY
FALIETQTHHIVRCLKHARSKRAYRVEVKQEANDRYFAEMMRKRHRQIFW
QDSCKDARSYYFDKNGDVPLRPASTLHTFWRARSFPLDDYEFTA
375142405YP_005003054.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MPVAEDKPAVDAILLKVIEAVPFQLSTDGGVEEARRRFRDMPRREVHPEV
RSEDRVIDGPAGSMPIRVYRPPTDTHAPWPVVVFIHGGGWSVGDLDTYDG
LARRHVVGAEAVVVSIDYRLAPEHPYPAAVDDAWAATRWVAEHAAELGGD
PDRLSVAGDSAGGNLAAVVTQLARDSGGPRIAFQLLWYPSTTFDTSLPSF
TENADAPILDIEGCKGCTRWYIGDFDLSDMPSTLAPARAQDLTGLPPAYI
AVAGHDPLRDDGMRYAELLGAAGVPVELHNAETLVHGYAGYDGVVPAATE
AVEKGLYALRRALHPA
375142404YP_005003053.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTAAVVGACYGIFLIVTALRLPSGAELTGQFALQPVVKAATAVLLAAAAL
THPLARERRWLVAALLLSAAGDFLLAMPRWEPSFVLGLGAFLLAHLCFLA
ALLPLARRSGPRLVAAAVTVAACLALLVWFWPKLIAEGMAVPVTLYIAVL
GAMVCTALMARLPTPWTALGAVCFAVSDGMIGISKFVLGDETLAVPIWWA
YATSLLLITAGLFFGRAAQPSAPSATTA
375142403YP_005003052.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTELNSPARPGATRQQAEHEPIARVLPMLTVPHLDREFDYLVSADQSDDA
QPGVRVRIRFHGRLVDAFVLERRSETDHVGKLGWLDRVVSPQQVLTPDVR
RLTDAIAARYAGTRADVLRLAVPPRHANVEKQPPPESAAFTPAVVDTTAW
SAYRGGEQYCSALDDARAARAVWQALPGEHWADRLAELAAVTANSGRGAL
AIVPDQRDVDALYAEAIRLVGEPWVVALSAGLGPAQRYRRWLSVLRGQAR
IVIGTRSAVFAPVASLGLLMVWDDGDDTLAEPRAPYPHAREVAMLRAHQL
RCAALIGGYARTAEAQALVRSGWAHDLVGTRQEVRARSPRVVALEDSGYA
QERDPAARTARLPSMALQAARTALQSGRPVLVQVPRRGYVPALACGRCRA
IARCRHCTGPLSLPARDTAGVVCRWCGREELSLRCTRCGSDAVRAVVVGA
RRTAEELGRAFPGVHVVTSGGDSMVAAVSDEPAVVVSTPGAEPVAAGGYG
AALLLDTWALLGRQDLRASEDALRRWMAAAALVRGRSEGGVVAVVAESAI
PTVQSLIRWDPVGHADAELDSRAEVGLPPAVHMAAIDGAPDAVHAMIDTA
ELPEGADLLGPVDLPLGVRRPPGTPPDKPVSRMLIRVRRDAGLPLAAALR
RAAGVLSARRDHEPVRVQIDPLHIG
375142402YP_005003051.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRRFFLMLIPLALIAVGVLWPVLFRPGSDASDVSDPVVFSNYDVDLIVSA
GGRLDAVETITAEFPSGRHGLFKYWAVDNQNDAGVRQIPEVTSILLDGQG
VSYQMLWEGGERFRVAKIGDPDTYLDPGTHVFEIRYTIDGVLDPPTTGAN
KTFADSTGDPVESRSVFYWNVVAQAWNNEIERAEITVSMPGRVGQAQCSV
GFGVGRACEDLTIAGNKVELSATDLAPRTPVTLRAGVDVPTPPRSEVPWS
FAWDRVLGQSVTGVLWVLALTLAGALGAILYYRSTVEPSPGFPLQYAPPP
GLGPVQTEYIRTESVPKKGLTATLFYLAERNLIDMRQISEKHWKLRSKVD
DWGPWADVDPVSVAVASALNVMGPGREFEAKATVKAGKKLDKAKTDMSAA
VQKWAFDDGFMVKRKKELWVRTANAIAFLLMIFGFFRWLFPETMWALPFA
AFFLFSAASWKDGVGIRRTAAGRELWSRAGGFHRMLTTDSAEARFDFGAR
KDLYSAYVPFAVAAGAAALWAKKYETTTGTAAPQPDWYHSSSPYSGAAFA
SGSSGPSFDSFESALSSSIGAYTASQSSSSSGSSSGSSFSSGGGGGGGGG
GGGGSW
375142401YP_005003050.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVRLLLVIVLALALAALVIFVLGYNRIRSAEVRVAEALSGIDVELTRRAS
LIPSLVHTVQTFAVHEKGILDHVTSARAAVTSATSGKSVAQRSAAEKDLD
TALVPLLALGQSYPQLNSSNNFLNLQDNLADTENKLAFARQYYNDSVATL
NGLLSTIPWMFVAPLTGVAEHEYYQTPR
375142400YP_005003049.1 methionyl-tRNA formyltransferase [Mycobacterium rhodesiae NBB3]MRLVFAGTPEPAVPSLARLVESPRHDVVAVLTRPDAASGRRGKPSPSPVA
RFAAEHDIPVLRPTKPNSDEFINELAALEPECCAVVAYGALLREGLLAVP
THGWINLHFSLLPAWRGAAPVQAAIAAGDTVTGATTFQIEPALDSGPVYG
VVTETVRPTDTTGELLERLSISGAALLATTLDGIADGTLTPVPQPPDGVT
IAPKVTVEEARVRWHLPAHVVERRIRAVTPNPGAWTMIGDLRVKLGPVAP
ADTAEPLPPGAIRVERKAVLVGTGSQPVALGVVQPPGKKPMNATDWARGA
RLDESTRAE
375142399YP_005003048.1 tRNA/rRNA cytosine-C5-methylase [Mycobacterium rhodesiae NBB3]MTKPRNNKRPTRRKQLDPARRAAFDVLRAVSEKDAYANLALPALLRDRGI
TGRDAAFATELTYGTCRTRGLLDAIIAAAAGRSTDKIDPVLLDLLRLGAY
QLLRTRVEQHAAVSTTVEQAGIEFDSARAGFVNGVLRTIAGRDEQSWVAE
LAPDVAADPIGHAAFVHAHPRWIAQAFADALGTDAGQLNALLASDDERPS
VHLAARPGVLTAEQLAEQVDGTVGRYSPYAVYLAGGDPGQLAPIRDGVAL
VQDEGSQLVARALTHAELDGPDGGRWLDLCAGPGGKTALLAALADGGRVT
AVEPAERRAALVEQNTAGLPVDVVRVDGRDPGLDAGFDRVLVDAPCTGLG
ALRRRPEARWRRVPADVPQLAKLQRELLASAIRLTRPGGVVLYATCSPHL
VETVGIVADALRRHPVTALDTRPLFDPVDGLGDGPYVQLWPHRHGTDAMF
AACLKVG
375142398YP_005003047.1 ribulose-phosphate 3-epimerase [Mycobacterium rhodesiae NBB3]MPKPLIAPSILAADFAELGDEAAAVAGADWLHVDVMDNHFVPNLTIGLPV
VEALLKRTDIPMDCHLMIDNPERWAPPYAEAGAYNVTFHAEATDNPVGVA
RDIRAAGAKAGLSVKPGTPIDPYLEILPEFDTVLIMSVEPGFGGQKFIAE
VLPKVGIVRRLVDSGELTIVVEIDGGINADTIEQAALAGVDCFVAGSAVY
SADDPAAAVESLRRQAGAASKHLQL
375142397YP_005003046.1 riboflavin biosynthesis protein RibD [Mycobacterium rhodesiae NBB3]MNLDAAMRLAIEQADRVKGSTYPNPPVGAVILDSDNDVAGVGATEPPGGP
HAEVLALRRAGERAVGGTAVVTLEPCNHHGRTPPCVDALVAAGVSAVAYA
VADPNPVAAGGASRLTEAGLQVTAGVLADQVVGGPLREWLHKQRTGSPHV
TWKFATSVDGRSAAADGSSQWITSDAARADVHRRRAVADAVLVGTGTVFV
DDPLLTARLPDGSLAERQPLRVVVGEREISPEAKVLNDDSRTMVIRTRDP
HEVIKALSDRTDLLLEGGPTLAGAFLRAGVIDRILAYIGPILLGGPITAI
DDVGVLSIAHAQRWRFDGVESIGPDVLLSLVPG
375142396YP_005003045.1 antimicrobial peptide ABC transporter ATPase [Mycobacterium rhodesiMGDLSIQDLVVEYASGADTVRPIDGFDLDVAAGSLVILLGPSGCGKTTLL
SCLGGILKPSGGAIKFGDVDVTSLQGHELSNYRRETVGIVFQAFNLVPSL
TALENVMVPLLAAGESRRAARKRAGQLLSRVGLEDRVSHRPGDLSGGQQQ
RVAVARAIALDPPLILADEPTAHLDFIQVEEVLRLIRELASGDRMVVVAT
HDSRILPLADRVVELVPDFAVTERPPDTVELKAGDVLFEQGTMGDLIYVV
ADGELEIVREMASGGEELQKVAKSGDYLGEIGPVFHLPRSATVRARTDAT
VIGYTVRAFRERLGVGGIRDLIEHRPLEPANPEPD
375142395YP_005003044.1 lipoprotein release ABC transporter permease [Mycobacterium rhodesiMLMAALRDMQWRRRRFVIAILSTAIIFAMTLVLTGLANGFRVEADKTVNS
LGVDLFLVKAGASGPFVGATPFAPVELRRVAQAAGVDSAAPLAYAGGTAT
LDGSTRNVDIFGAPENGPGMPTVSAGRPPSTRDEVAVSSTLDRGIGQEVE
IASRTLRIVGIVENSTALANLPNVFLTTEGAQQLVYGGEPLVASIGIRGT
LEQAPPGYRAIDRNGAVEDLLRPLKVAVNSITIVAILLWVVAALVVGSVI
YLSALERLRDFAVFKAIGVPTKSIAAGLAMQAIIVALLAALVGAGLSMLL
GPLFPMQVIVPVQAFIALPVIAIVIGLIASASGLHRAVAVDPALAFGGP
375142394YP_005003043.1 Pfpi family intracellular protease [Mycobacterium rhodesiae NBB3]MANSLDGKKIAFLVAPEGVEQVELTEPWKAVEQAGGTPELVSTETGTVQG
FNHLTPADTFEADKAAEDVSASDYAALVLPGGVANPDFLRTNSDAVAFAK
GFFDEGKPVAVICHGPWTLVEADVVRGRTMTSWPSVKTDLVNAGANWVDD
EVVECSRGPNTLVSSRKPDDLPAFCKTLVGAFSKVTS
375142393YP_005003042.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALQDWLSDRPMDPRTITTLIRDAIRGLSGDGPEPLAEPTLMGRGLERC
375142392YP_005003041.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMPTSAETVQPVTSGRRIAISAGSLAVLLGALDTYVVITIIRDIMYDVGIG
INQIQRVTPIITWYLLGYIAAMPLLGRASDRFGRKLLLQVSLAGFAVGSV
ITAMSSDLDILVIGRLIQGIASGALLPVTLALAADLWASRNRAAVLGGVG
AAQEFGSVIGPMYGIAMVALFHHWQAVFWVNVPLAVIAMVMIHFSLPSKV
KPEKPEKVDVVGGLLLALTLGLATFGLYNPAPDGKQVLPSNGIPLLIGAA
VAAVAFFVWERFARTRLIEPAGVHFRPFLAALGASLVTGAALMVTLVNVE
LFGQAVLGQDQNQAAFLLLRFLVALPIGALLGGWIATRIGDRIVACVGLL
IAAGGYYLVSGWPANVLSATHDLGFVTLPMLDTDLVIAGLGLGLVIAPLT
SATLRVVPAAQHGIASAAVVVARMIGMLIGVAALSAWGLYKFNQYLQERL
AALPPVNADTPGGLLIAQTTRTAQASVEAYVMQYGEIFKITVVVCVVGAA
LALLISGRHEHADEPDEPAETVTRRPGSAGSPADDNPTQALETPTQQIPS
HASDETARLEQPRGQHRPN
375142391YP_005003040.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPGRPVATGRPTTMQVMQTRLLAIFAALFTAVALLAGCGSSEDTKNLPDA
ATLLKQSVDTTKSQSSVHLLLTVNGEIPEFPIESLEADLTTKPAVAAQGK
ANILLGGQRLEGVGFVVVDGTLYGALTAGSAYQDFGPAADIYDASVLLSP
DKGLANVLSNFSDPKAEARETINGVKTVRVKGSVSQDAVNKIVPQVGATG
AVPGTAWIAEEGNHELIQAKLEPKPDTSLTMTLSDWGKPVTVTKPAA
375142390YP_005003039.1 riboflavin synthase subunit alpha [Mycobacterium rhodesiae NBB3]MFTGIVEEMGEVVGKEDMGDFARFAIRGPVVTSDAGHGDSISVNGVCLTV
VEVRADGAFTADVMGETLNRSSLRGVGVGSRVNLERAAAVNSRLGGHIVQ
GHVDGTGHVIARTPAQHWEVVRIALPMALTRYVVEKGSITVDGVSLTVSA
VGHDWFEISLIPTTLELTTLGRAAVGTSVNLEVDIIAKYVERLLDARDGL
IGE
375142389YP_005003038.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTTPGSQWTDERDEPKQPKKAIHVKHLLVGGISAALLATALAIPAAAEP
SWTMPDLIGSDLQGAQDAIQSVSNGEVWLSTSTDLSGEGRAQIMDRNWTV
CSSTPAPGATFTGTTAIDFGVVRDSETCP
375142388YP_005003037.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIGPTGWFPDPHGQPGQRYFDGQRWTEHFTPGPSPALPVSVVVNNNIATP
APAVAVAVSGGGTNHALHLVLTVLSCGLWLPIWILVAIVGSVGRPTASVA
VGGPGGTVVSTRRPGTALIVGGVFLALVILGQAIAHPWLFVPILLVAGAG
GALIWKQKVAKEARKLEVLESYRRDVIAHRADTQHNLAKEGDPRGTYGAF
PPAPDLR
375142387YP_005003036.1 GTP cyclohydrolase II/3-4-dihydroxy-2-butanone 4-phosphate synthaseMTRLDTVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMV
RYTSGYLCVPLDGSVCDKLGLLPMYAVNQDKHGTAYTVTVDAKKGVGTGI
SASDRATTMRLLADPTAVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVD
LARLAGLQPAGAICEIVSQKDEGAMAQTDELRVFADEHDLALISIADLIE
WRRKHEKHIERIAEARIPTAHGEFRAVGYSSIYEDVEHVALVRGEIAGPH
SDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGIVLYMR
GHEGRGIGLMHKLQAYQLQDAGEDTVDANLKLGLPADARDYGIGAQILVD
LGVRSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDR
MGHDLIGLDEYHEAVTMDSYEEGVYLLGDRTPPAERDLGGAL
375142386YP_005003035.1 6-7-dimethyl-8-ribityllumazine synthase [Mycobacterium rhodesiae NBMSPAVGVPDLPQVDASGLTLAVVASTWHGTICDALLEGALKVATDAGVAD
PTVVRVLGAIEIPVVAQALAANHDAVVALGVVIRGQTPHFDYVCDAVTQG
LTRVSLDSSTPVANGVLTTNNEEQALDRAGLPGSTEDKGAQAAAAAITTA
LTLRDLRARS
375142385YP_005003034.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDWDVEIRPHLTPYFAYAAAALILVAHVAVGVLLKIASTGVIFQTADQV
AIALLGVVIASVVLLFARPRLRVGPQGIAVRNLLTYKLIPWSEVVDVSFH
RGARWARVDLPDDEYVPVLAIQAVDKERAVDAMTTVRGLLGRYKAINSR
375142384YP_005003033.1 acetyltransferase [Mycobacterium rhodesiae NBB3]MTARITRLTESDWRAFAVIRLRALADSLGERDPQYQKEIAFTAAQWRRRL
RDHAQFAALTGDRVVGLIAAQQESPDSIYLYSLWLDPIARGQGLARSLVA
AAVDWARDQRVRTVRLRVATDNSAARAVYESLGFAEAAVAGTVEPRDEVA
MSLSVS
375142383YP_005003032.1 gamma-glutamyltransferase [Mycobacterium rhodesiae NBB3]MNYRRVMRFSSLTKVMAPLTGIAVVLAGCAAEENPEPGAAGPCAIVANGT
PTPKTAANPTVTTSHNMSTNPEVAAGYRKDMTAVRTSSYSVATANPLATH
AACEVLRDGGTAADALVTAQMVLGLVEPQSSGIGGGGFLLYYDAAADSVQ
AYDGREAAPASATENYLRWISDTDRTVPKPDARASGRSIGVPGIVRLMAE
VHAEHGKTGWGDLFSPAVTLADDGFDISPRMATAIADSAPELKMDPRAAE
YFLNPDGSPKIAGTRLTNPAYAKTLGAIASDPQSFYTGAIADDIVDAVAD
TAGGRTPGLMTRDDLAGYSVKMREALCTPYRGKEICGMPPPSSGGIAVAA
TLGMLEHFAMADHKPSGTDLNGGRPSVLGVHLISEAERLAYADRDKYVAD
TDFVALPGGSPNTLISSDYLAGRATLISEQRSMGTAKPGEFGPPTAPVPP
PPEHGTSQVSIVDARGNAASMTTTVESSFGSFHMVDGFILNNQLTDFSAE
PVGPDGAPVANRIEPGKRPRSSMAPTLVFDAAGQPGRRGPLYAVLGSPGG
SVIIQFVVKTVVGMLDWGLDPQQAVSMVDFGAANTPKTNVGGEHPVIDTS
DDGDHDPLVVGLRKLGHQVDLADQTSGLSAIIRDGSSLIGGADPRREGLV
MGDTR
375142382YP_005003031.1 excinuclease ABC subunit C [Mycobacterium rhodesiae NBB3]MPDPATYRPAPGTIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADL
SGLAPRTRQMVRTAAGVEWTVVNTEVEALQLEYNWIKEFDPRFNVRYRDD
KSYPVLAVTLNEEYPRLMVYRGARRKGVRYFGPYSHAWAIRETLDLLTRV
FPARTCSAGVFKRHRQIDRPCLLGYIEKCSAPCVGRVTAEEHRQIVEDFC
DFLAGKTDRLIRDMEQQMNQAAESLDFERAARLRDNIGAMKRAMEKQAVV
FGDGTDADVVAFADDDLEAAVQVFHVRGGRVRGQRGWIVEKSGEPGESGQ
EHLVEQFLTQFYGDQAELDGAADTSLTPVPRQVLVPCLPGNAEELETWLS
QLRGSRVSVRVPQRGDKRALAETVRRNAQDALNQHKLKRAGDFTARSAAL
QSIQESLGLADAPLRIECIDISHVQGTDVVASLVVFEDGLPRKSDYRHYA
IREAAGEGRSDDVGSIAEVTRRRFHRHLHDLQEPTELAAQDNIAADAAPP
AKPRKFAYPPNLFVVDGGAPQVNAAQAVLDDLGIGDVAVIGLAKRLEEVW
VPSEPDPLIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRMTASALDS
IRGLGEHRRKALVTHFGSVARLKEASVEEITAVPGIGVATAKAVLEALGV
PSDSGAPEPGIDEDQSRASG
375142381YP_005003030.1 putative P-loop-containing kinase [Mycobacterium rhodesiae NBB3]MTDRGMREELQDGTTPGDSAESGIDVVLVTGLSGAGRGTAAKVLEDLGWY
VADNLPPELIARMVELGLAAGSRITQLAVVMDVRSRGFTGDLDWVRNDLA
TRNITPRVLFLEASDDILIRRYEQNRRSHPLQGTQTLAEGIAAERAMLAP
LRAVADLVIDTSTLPVPALRESIERAFGGETVAHTNVTVESFGYKYGLPM
DADTVMDVRFLPNPHWVDSLRPHTGQDQAVRDYVLGQPGAVEFLETYHRL
LDFVIDGYRREGKRYMTVAIGCTGGKHRSVAIAEALAARLQGGDGLTVRV
LHRDLGRE
375142380YP_005003029.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSQRIVALGGGHGLYATLSAARRLTPHVTAIVTVADDGGSSGRLRGELDV
LPPGDLRMALAALASDTPHGRLWATILQHRFGGNGALAGHPIGNLLLAGL
NELLADPVAALDELGRVLGIHGRVLPMCPVPLEIEADVAGLESDPRMSRV
IRGQVAIATTVGKVRRVRLLPGDPPATRQAVDAIMAADLVVLGPGSWFTS
VIPHVLVPQLAAALQATTARRALVVNLVAEPGETAEFSAERHIHVLSQHA
PGFKVHEIIVDANRVPSEREREQLRRTAKILDAQVEFADVSRPGTPLHDP
ARLAAALEGVRLRGTAPPAPAVPTVPTPTANGPRGDDQWR
375142379YP_005003028.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAMTAEVKDELSRLVVNSVSARRAEVASLLRFAGGLHIVSGRVVVEAEVD
LGIIARRLRKDIYDLYGYNAVVHVLSASGIRKSTRYVLRVAKDGEALARQ
TGLLDLRGRPVRGLPAQVVGGSVADAEAAWRGAFLAHGSLTEPGRSSALE
VSCPGPEAALALVGAARRLGVSAKAREVRGADRVVVRDGEAIGALLTRMG
AQDTRLTWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERAL
EILADTVPDHLAAAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLL
SMADRKAKQDGIPDTESAVTPDLLEDA
375142378YP_005003027.1 putative ATPase [Mycobacterium rhodesiae NBB3]MCHSVQVSAGDPPSGVVTFLFTDIEGSTHRWESDADAMRVALAAHDKVLR
TAIDAHGGYVFSHSGDGIAAAFSSPMSAVGAAIDAQRDLQLPVRMGIATG
EAELRDDDYFGTVLNRAARLMAAGHGGQVLVAESTAGLLSGVDLVDLGSR
QLRDVPNPLNVFQVKCSGLRTDFPPLRTVDRTPGNLPRSSTAFVGREADV
AEIVAALESRPMVTLTGVGGVGKTRLAMETAAYMSSQFADGVFYFELAAV
TDENAVPDAVAGVLGITQQPGKSMTESIAAALEGRSRLLVFDNCEHVLDA
AADLAEAILASADSVRIIATSREGLALAVEQVWPVRSLALDAAVQLFSER
AHRVAPGAVLDDIDAVAEICRRLDGIPLAIELAASRMASMTAVEVRDHLD
HRLKLLVGSRRALGRHQTLRHAVAWSYNLLDDAEKRLLERCSVFAGGFDL
ESACAVAGRPDADRYVIVDLLDALVRKSLIVVEHSSGRTRFAMLETIREF
ADEQLADRGDVAQARDAHARHFAGREADILDLWNSPRQREAYVWYMTELG
NLRSAFRWAADSGDLDVAATIVTYLGILAYALENPEPTVWAEELMDSARA
AAHPRLVGLYVVAALCWLTGRLEEAIAYTKAGTIAMQSPHRAVPFSSDGL
FGGLYVSLGDVDRGISWYDTYLENHEDPIGIVRANRVLALAFAGRVDEAM
AAAPDVVDVADASGNPYALSFALLAYGITFREADPEAALEGMRRGLVIAH
ESGARSNEAYLANNIGRLEASQGDMVAALDHLKLGIRINHSSGAIVALRS
PLAILANILDRLQLHDQAAVIAGFAASELTAVVFPEFRDAVTRLREVLGD
DRYEALARQGATMTTAAIATYALENVEDLRAALEPSP
375142377YP_005003026.1 periplasmic component of amino acid ABC-type transporter/signal traMETLRVGAAFPDPPFNGMPDDSGLDIDLMQAIAEKLGAAVEFVSYDGADF
NGIFNGLGSAYDCVTAGTTVTPEREQQATFVPPYLISGQALAVDTTRLPQ
VRSVDDLEGLTIGVQQGNTSQPIAERLVAEGKAAAVRVYDYGAIRTALTD
LTTGACDAFMKLAPVLTELVKAVQGVEVVQRGISVENIAIAVAIGDQALL
GRLTLAQAELEDDGILQRIRGKWLGNPYADQNLAVL
375142376YP_005003025.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTALYDASHRHDTAEETGQAHARARRAHLASADHHVAAAETHDRAAQTHR
RAAEAGIGDVKTHWEAVVVHEAARDDDYHAAEAARRLARSE
375142375YP_005003024.1 glyceraldehyde-3-phosphate dehydrogenase- type I [Mycobacterium rhoMTIRVGVNGFGRIGRNFYRALAAQKAEGKSTDVEIIAVNDLTDNASLAHL
LKFDSILGRYPEDISLEGEDTIVIGSTKIKALEVKEGPAALPWGDLGVDV
VVESTGIFTARAKAQGHLDAGAKKVIISAPASDEDITIVLGVNDDKYDGS
QNIISNASCTTNCLGPLAKVLNDEFGIVKGLMTTVHAYTQDQNLQDGPHK
DLRRARAAALNIVPTSTGAAKAIGLVLPELKGKLDGYALRVPIPTGSCTD
LTAELSKSATADEINAAFKAAADGPLKGILKYYDAPIVSSDIVTDPHSSI
FDAGLTKVIDNQAKTVSWYDNEWGYSNRLVDLVALVGKSL
375142374YP_005003023.1 3-phosphoglycerate kinase [Mycobacterium rhodesiae NBB3]MAVKNLDDLLAEGVSGRGVLVRSDLNVPLDNGNITDPGRIIASVPTLKAL
SEAGAKVVVTAHLGRPKNGPAPEFSLAPVAAALSDQLGRHVQLAGDVVGT
DALARAEGLTDGDILLLENIRFDPRETSKDDAERLALARQLVELVGDDGA
FVSDGFGVVHRKQASVYDVATLLPHYAGTLVAAEIKVLEQLTSSTDRPYA
VVLGGSKVSDKLAVIENLATKADSIVIGGGMCFTFLASQGVSVGKSLLEE
SMIDTCRKLLEDYGDVIHLPVDIVVADEFSADSTPEVVRADQIPDGKMGL
DVGPGSVERFTSLLSNAQTIFWNGPMGVFEFPAFAAGTKGVAEAIIGATG
KGGFSVVGGGDSAAAVRQLGLPEDGFSHISTGGGASLEYLEGKTLPGIQI
LQ
375142373YP_005003022.1 triosephosphate isomerase [Mycobacterium rhodesiae NBB3]MSRTPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVAVLPPFTDL
RSVQTLVDGDKLRLTYGAQDVSQHESGAYTGEISGAFLAKLGCTYAVVGH
SERRTYHHEDDALVAAKAAAAFKHGITPIICIGEQLEVREAGNHVEYNVE
SLRGSVAGLTAEQIGEAVIAYEPVWAIGTGRVASAADAQEVCKAIRDELG
KLSSPQLAAGVRILYGGSVNAKNVGEIVAQEDVDGALVGGASLDGEQFAT
LSAIAAGGPLP
375142372YP_005003021.1 protein translocase- SecG subunit [Mycobacterium rhodesiae NBB3]MVLALQITLIITSLLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTYFVVGIWVVSIVGVALQIKYS
375142371YP_005003020.1 phosphoenolpyruvate carboxylase [Mycobacterium rhodesiae NBB3]MAEVGGLEPIGAVQRTKVGREATEPMREDIRLLGTILGETVREQNGEAVF
ELVERARVESFRVRRSEIDRAELASMFDGIDIHQAIPVIRAFTHFALLAN
VAEDIHRERRRVIHVAAGEPPQDSSLAATYAKLDTARLDAATVSDALAGA
LVSPVITAHPTETRRRTVFDTQHRITELMRLRMKGHEHTDDGRGIERELR
RNILTLWQTALIRLSRLKIQDEIETGLRYYAAAFFEVVPRVNAEVRNALR
YRWPDTDLLAEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAYTALEHY
FTEITALEEELSMSARLVKISDALTALADQCREPARADEPYRRALRAIHA
RLTTTAYDILDRQPEHELDLGLDRYDTPAELLADLDVVDESLRTNGSAVL
ADDRLARLREAVHVFGFHLSGLDMRQNSEVHEEVIAELLAWAGVHPDYAS
LSEPDRVELLAAEVATRRPLTSDGAELSELARKELDIVAAAARAVRVLGP
AAVPNYVISMCQSVSDMLEVAVLLKEVGLLDVSGSQAYAPVRIVPLFETI
DDLQRGSSILEQALDLPVYRALVSARGDSQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAIRAQPPGAVR
GSLRITEQGEVIAAKYAEPQIAHRNLETLLAATLEASLLDIEGLGDAAGP
AYDVLDDIAARAQRSYAELVHETPGFVEYFKASTPVSEIGALNIGSRPTS
RKPTTSISDLRAIPWVLAWSQSRVMLPGWYGTGTAFEDWINQGDGRLEVL
RDLYQRWPFFRTVLSNMAQVLAKSDMGLAAHYSELVDDTELRRRVFDKIV
AEHTRTIRMHKLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDDDELVQRGILLTMSGLATALRNSG
375142370YP_005003019.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGEPNPMAWLPFSIAEAALSGNGGGVGDLPDAWAYLLDRLTAAGELVASS
EVNRNSVDYASGMRHLMVLLAVGIDEALRVDPDPVLAVTRTSTDDILTWG
MECPDCIYLRATLRGGETYRLFGNRGTARYVGLQTMNGIASTANTLVDEL
EVDADGDFEVVLSADEHEGNWMRVEGDHPTLVVRHFFYDWDAEQPSVLQI
ERIGDETAPKNRSVAADVAVSRQIRALGEFVHDNLKFFLDFNAGPPVNGF
MPPIDRSAMGAAAENRPVIGRYELQPDEALILEVEPPEGVYWSYSLGNQW
WETIHYGRHQSSLNAHQAKIDADGVLRVVVSSRDPGVANWLDTAGHSNGA
MILRCVRTETAPTPSARVVKVADVSAELPADTAMVSPAERAAIIEARRRA
VHERFS
375142369YP_005003018.1 sulfotransferase family protein [Mycobacterium rhodesiae NBB3]MTFTVEKLEDGARAATGLDDFGSPYYREGLERTVDALNNEADLNEMGGII
QHATISNALIQRLRIVDTYKQHPEIDDEVIQGPVFVIGLPRTGTTALSQL
VASDPQFRSLRMWESQACTPPPETATQHDDPRIAQAAEGIAMMDSMFPRM
RTMMNSEPEAATECQDLMGMSFRTFHFDGVVRVPGYLAWLMQCDMRETYT
FHRQVLKLLQWHCPPNLWHLKTPVHMFSLDALVEAYPNAKFLWSHRDPAK
VLASVCSLIQYVRSWSSDRDDAHELGAEQLECWAEGIRRAMDFRKRLGDN
RFVDVSFADLNADPIGTLERGYDRLDLVFTGEARRRVQEWADGHRPGSRG
EHAYDLADYGLTREQVHDAFADYLATYDATA
375142368YP_005003017.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MDTVVRRNRKKLDPDPGIRDALVKAAAEIVREEGIASVYVARVLDRAALS
TRAFYRHFDSKDALASAVFLQMAQIEVRRLKRKMASASTPVEAVVAWIDG
RLDLAFNDQVRSDLRRMSLEAQSQMFAAPELIGDAYAEILKPLVEQLEKG
RAEGLFPDIDPTADALSIHGAIWASTERQWATGDCDRHGVREQVVRFCMR
GIGAAQPLRKVT
375142367YP_005003016.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MDLGLAGSTAVVTGGSKGMGLAIATTFAEEGAKVAVMARGAEALEEATAK
LRDAGAPDAVGISVEMSDASSIAAGFEIVAQRWGELNSLVHTIGPGDGYF
EEMDDAQWEETFALGTMSGVRSIRAALPMLRAAQWGRIVTLSAHSIQRQN
PRIVAYTASKAALSSVTKNLSKSLAKDGILVNCVCPGTIVTASFTEALKD
ILAADGLDATDPTDVMTWIDNNFHQPCDLGRAGLPEEIASITVYLASRRN
GYVTGATVNVDGGSDFV
375142366YP_005003015.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MSANDPVPAPPLAVGTGLPWDVCVDDAVAAIASARARHGDTFAVASGNDN
YLFTFSPAGVEAFYRLPEDKASKGVADYLMLRRKLPDEIFDGRRLLPTSL
FRRDDVASYLKNLDCALTETVAELGPDGTVDLFGLTRRLGHRMGLASWAG
PGSAQGTPFDRLVAAFETLDGSDAFVHPDSMAAVAAGGKQAERAALDEIV
AVIETAVHATASDQVDESDLFGRIVRAWSQEPDDVRMRGIALDVALIHIA
SMSNLMAALGWALVDLLEHPDEQKRVASGDSEFAQRCALESTRLAQRSIM
SRAVLAPVDLDTGDVIYRVPAGWTIATLLPLLNTSAAPGLRTWDPDRWQR
HRLADTAALPSPMLVTAFGHGKHSCPAQPFSLAAMSVAMTRLLNIYEMTP
GWTSYPKPVPAQIGGVARSVDPCPVSYVRR
375142365YP_005003014.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTLMADKGVSKTAPRTGRERIQKLAQAALNADVTVEQVDTILDGLSETLV
DLNSSTGKLDDTLERFNDTISRINELAPRLIAVVDRLEGIVDRVERIVGI
GESVIGPLAATEQAVRGAVNKVRKSTGL
375142364YP_005003013.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGEATREESTCIAQRLLAVAELYTRHQGALADMEWCLVDYCAATAADVSA
VQNISHARAVGQVQFACALAYRLPAVAKVFVRGTIDFRMVSTIINRTDNV
DDALMPAVDEAIARHCEKWMKLSRPKLRDRVDQWVAKFDPAGVRVPPKVE
QNRYFDVDEAAPGMAFASGHLRAADGAALDARLEALAATVCEHDPRSRNQ
RRADAAGALSRLETALVCECGRQDCTAGASPADATAGSTVVIHVLAEQGT
LDGSSDNPGYLRGFGILPAESVRAVAQTATLKPLTVPSGVRADPGYRPSV
KTKEFLAWRDLTCRWPGCDKPVDNCDVDHTVAYPVGPTHPSNTKHYCRIH
HLIKTFCGWNDQQLPDGTIVLTSPTGYTCTTEAHGAALFPTLATPTGDLD
LPPADPDPARIAMMPRRKQTRAQDRRERINAERRERTELIAEQQRQHQAW
LAANYKPPPF
375142363YP_005003012.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MYVIRAAILAAGVGLFSAVAADPTAWADTTLALFEHDTVQYQVDLAEPGP
GPGDQFIFAGDVFDRPGGTWLGTVGGSCTRLDGDDKTGRQACNSTFNLAD
GQIVTQGVADTAALFVRGDTVPQSIVGGTGIYQNAHGTGTVQVPPDVPNQ
TDANFVLNVVTG
375142362YP_005003011.1 6-phosphogluconolactonase [Mycobacterium rhodesiae NBB3]MSTVVEKYPDTDALVVGAGDRLVAAITGAIDKRGRALIVLTGGGTGTGLL
KRVREQADGIDWSKVHLYWGDDRFVPADDDERNEKQARQALIDHVDIPAA
NVHAMAPSGGEFGDDLDAAAQAYEQVLAADADDGSIPDFDVHLLGMGGEG
HINSLFPDTPAVKETSRTVIGVTDSPKPPPRRITLTLPAVQRSREVWLVV
SGEGKADAVAAAIGGANPVDVPAAGGVGREATVWLLDEAAASKL
375142361YP_005003010.1 opcA protein [Mycobacterium rhodesiae NBB3]MIVDLPDTNTNDINKKITGLREEGGAITLSRVLTLVISLHTDDLLEDSIE
AATFASREHPCRVIVVVAGDRDATEARLDAQLRVGADAGAGEVVALHLHG
EMADHANSVVLPFLLPDTPVVAWWPAGGPDDPSRDPLGQLAVRRITNATD
CADPMAAIKGRLAGYTAGDTDLAWARITYWRALLTAALDQPPFEPVTSAV
VSGLHDEPSLDVLAGWLAARIDGPVQRKVGDLKVELIRSSETITLRRPQT
GVTATISRTDKPDSLVPLGRRDAKECLAEDLRRLDADEIYHEALKGIEKV
QYV
375142360YP_005003009.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium rhodesiae NBB3]MTAWRNPLRDKRDKRMPHIPGPCVVVIFGVTGDLARKKVMPAIYDLANRG
LLPANFALVGFARRDWSDEDFAKLVFDSVKDHARTPFRQEVWDRLAEGIR
FVQGTFDDDKGYERLAESLDKLDAERGTGGNHAFYLSIPPNAFPVVCEQL
KKSGLAEKPEGSWSRVVIEKPFGHDLQSAQELNGVVNSIFPEESVFRIDH
YLGKETVQNILALRFANELYEPIWNNNYVDSVQITMAEDIGLGGRGGYYD
GVGAARDVIQNHLLQLMALTAMEEPVNFGPGDLQAEKIKVLSATQVMQPL
DQTTARGQYAAGWQGSEKVVGLLEEEGFSKDSTTETYAAIALEIDTRRWA
GVPFFLRTGKRLGRRVTEIALIFKRAPHLPFDKTMTEELGQNALVIRVQP
DEGITTRFGSKVPGSAMEVRDVNMDFSYGSAFADDSPEAYERLILDVLLG
EPSLFPVNREVEFSWEILDPVLDYWASHGKPQAYESGTWGPESADEMLHR
MGREWRRP
375142359YP_005003008.1 transaldolase [Mycobacterium rhodesiae NBB3]MTQNQNLAALSAAGVSVWLDDLSRERLQTGNLQELIDTKSVVGVTTNPSI
FQAALSKGDSYDGQVKELAERGADVDATIRTVTTDDVRNACDVLAKQYEL
SDGVDGRVSIEVDPRLAHDTDKTILQAIELWKIVDRPNLLIKIPATEAGI
PAIASVLAEGISVNVTLIFSVERHRMVMDAYLKGLEKAKDAGHDISKIHS
VASFFVSRVDTEIDKRLEKIGSDEALKLRGKAGVANAHLAYAAYEEVFVG
GSRFEALKADGARVQRPLWASTGVKNEDYSDTLYVTELVAPNTVNTMPEK
TMDAVADHGVITGDTVTGKAEEAQGVFDKLDAVGIDLPDVFRLLEDEGVE
KFEKSWQELLDATQEQLDSNKPSAKK
375142358YP_005003007.1 transketolase [Mycobacterium rhodesiae NBB3]MTTLEEISTLTRPHHPDDWADVDSVAVDTVRVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRQMRHDPSDVHWLGRDRFVLSCGHSSLTLYIQLYLGGFG
LELSDIESLRTWKSKTPGHPEFRHTKGVEITTGPLGQGLASAVGMAMASR
YERGLFDPDPAWGESPFDHYIYVIASDGDIEEGVTSEASSLAGTQQLGNL
IVFYDHNQISIEHDTNIALSEDVPARYRAYGWHVQEVEGGENVVGIEQAI
EEAKKVTDKPSFISVRTIIGYPAPTKMNTGGVHGSALGDEEVAATKKVLG
FDPDKTFEVRPEVIEHTRKLVERGKEAHEKWQPTFDAWAEREPERKKLLD
RLTAEELPEGWDADLTYWEPGSKAVATRAAFGQVLNDVAPKLPELWGGSA
DLAGSNNTTIKDVKSFGPPSISTDDFSADWYGRVLHFGIREHAMGSILSG
IVLHGPTRAFGGTFLQFSDYMRPAVRLASLMDIDTIYIWTHDSIGLGEDG
PTHQPIEHLAALRAIPNLSVVRPGDPNETAYAWRSILARGNGSGPVGFIL
TRQGIPVLEGTSAEGVEKGGYVLGGGNPADDADVIIIGTGSELQLAVEAK
KLLAEKDITAYVVSMPCVEWFESQPKEYRDSVLPPTVSARVAVEAAVAQS
WYKLVGDTGEIVSIEHYGESADDKTLFREFGFTPEAVAAAAERSIDN
375142357YP_005003006.1 protoheme IX farnesyltransferase [Mycobacterium rhodesiae NBB3]MDIRESQLPAGVHGRVRTTLLGYLSLTKPRVIELLLVTTIPAMLLAHRGT
VDPLLILNTLVGGLLAAAGANTLNCVADADIDKKMKRTERRPLARDIVPR
SHALVFGLALSVASFFWLWWTTNMLSAHLAAATIAFYVLVYTLLLKRRTT
QNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFLIIFFWTPPHTWALAMR
YKEDYAAAGVPMLPVVATERQVTKQILVYTWLTVAATLALALATGWLYAS
VAILAGAWFLVMAHQLYGGVRRGEPVKPLRLFLQSNNYLAVVFLALAIDS
VLALPTLFTV
375142356YP_005003005.1 Zn-dependent oxidoreductase [Mycobacterium rhodesiae NBB3]MYVIEVAETGGPEVLTYVEKPQPSPGPGEVLIKAEAIGVNFLDTYFRSGQ
YPREVPFVLGNEVCGTVEAVGDEVAALSVGDRVVTAQANGAYAEYAVATA
DFCAYVPDGVSSDVAAAALLKGMTAHYLIKSTYPVQQGDAVLVHAGAGGV
GLILTQWATSLAARVITTVSTPEKAELSRQAGAVEVLDYPEDAADFGAKI
KDLTDGGVAVVYDGVGANTFDASLASLAVRGTLALFGASSGPVPAFDPQR
LNASGSLFLTRPTLVHYTRTPDEFAWRAGELLDAIASGTITVTVSERYRL
QDAAQAHRDLQGRKTVGSVVLVP
375142355YP_005003004.1 glutathione synthase/ribosomal protein S6 modification protein [MycMKLARPDVFHPRVVLAGCQALPEGDGDDADLISALRKRGLHARWLAWDDP
ETLEADLVILRATWDYIERLDEFLAWTTTVRSLVNAPEVVVWNTDKTYLL
DLAKAGVPIVPSQFIAPGERARVPDGEVVVKPAVGAGSVGAQRFTDSDAA
GRHVLALHADGRTALIQPYDRRVEQGETALVFLGGRQSHAFTKGPILPSP
GNRPAFDDSGTYAEESLAPADPDFELWDIGHAALAAAAAHLGIDVAELLY
ARVDLIGGRSDAQLLELELVEPSLGWRQLDAATRARRQRDFVVALEGILE
RRGLGPLSHRRP
375142354YP_005003003.1 cytochrome oxidase assembly protein [Mycobacterium rhodesiae NBB3]MPVGRIFLRLVDLLPLPSVRVQRVIAAAVILTQGGIAVTGAIVRVTASGL
GCPTWPQCFPGSFTPIPHPEVAGIHQAVEFGNRMITFLVVLTAALAVLAV
TRARRRREVLVYAWLMPASTVLQAVIGGITVLTGLLWWTVAIHLLASMTM
VWLSVLLYVKIGEPDGGVVRHRVPKPLRQLTILSALTLAAVLVTGTLVTG
AGPHAGDKSITQPVPRLQVEIVTLVQAHAMLLVIYLSLLVALVFGLRAVS
APRTVVRRLAVLLILVAGQALVGRVQYALDVPAALVALHVAGAAACTAAT
AALWASMRERAEATSLEDALQGDDEIALPTRPRSGV
375142353YP_005003002.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MARRHGEQLDAAIRSAVLDLLAEHGPGGVTMEAVAAAAQTSKPVLYRRWP
DRAALLRDTLLQIATTAIPHQDTGSYRTDMLAVLRGWAALFTGPQAAVLR
AAIAAAAHDPELSAAFQQDVIGWRKEEMAALLARGIDRGDVRPDVPVEIA
RELGQSVLWHRLLITGDPITDDLVVQLVDDVLVPFVSPRE
375142352YP_005003001.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTRSVLYPLRSTDTATVTYSMHPHGRRRVTIDHQPLAGVTPAMLLDWFSN
LGGTIAYGGEVIDMYLAWHPIDHIKWELARSAPTGGAAEGARFHMVEAFG
ARPEYLVDEIARVEKLDETGIRLVLRVAGVIVFQLEHTWSAGVEGAHYVT
VMDLGPRAAVLAPVNRVLRRRFSDEKARAWVKHNIEEVGQLEYLLPQLEP
SGETEPAQRAKGCDRAPYREHRQAEPVN
375142351YP_005003000.1 multidrug ABC transporter permease [Mycobacterium rhodesiae NBB3]MTNRFAPGTFTPDPHPATVQKMLAAQFGLELKLLLRNGEQLLLTMFIPIT
LLAGLTLLPLGSFGDNRAATFVPAIMALAVISTAFTGQAIAVAFDRRYGA
LKRLGATALPVWGIIAGKSLAVLAVVFLQSIILGAIGFALGWRPSIAGLA
LGAVVIALGTAGFAALGLLLGGTLRAEIVLALANLLWFVFAALGALTLEG
GMVPSALASIARLTPSGALTEALSQAMTPSVDWFGLAVLAVWGAVAALGA
LRWFRFT
375142350YP_005002999.1 multidrug ABC transporter ATPase [Mycobacterium rhodesiae NBB3]MTRPSVPVRLRGVSKRYGTTTAVAGLDLDVEAAEVLALLGPNGAGKTTTV
EMCEGFTKPDSGTIEILGLDPFGDNAAVRERIGVMLQGGGAYPAARAGEM
LDLVASYAANPLDPKWLMDILGLTDSARTTYRRLSGGQQQRLALACAVVG
RPELVFLDEPTAGMDAHARIVVWELIDGLRRDGVTVVLTTHQLAEAEELS
DRIVIIDHGVAVASGTPEELMRSGAENQLRFRAPRMLDLSLLMSALPETY
KATETAPGEYLVEGHIDPQVLATVTAWCARVNVLATDMRVEQRSLEDVFL
DLTGRELR
375142349YP_005002998.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAARPRSLSSSIARWHADERAVGSPLNDAEVIAMRRTRLFGATGTVLMAI
GALGVGARPVVQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWLMLG
RFALGQRRMSRSQLDRTLLLWVIPLLIAPPMYSRDVYSYLAQSEIAMKGL
DPYRVGPAPGLGLDHVFTLSVPNMWRETPAPYGPLFLWIGKGISAITGED
IVAAVLCHRLVVLMGVGLIVWATPRLARRCGVAEVSALWLGAANPLLIMH
LVAGIHNEALMLGLMLAGTEFALRGIAAARPLIPRPLAWPQGPEAWAHWR
PSLMLLIGVVLITLSSQVKLPSLLALGFVAMALACRWGGTFKAFILAGGS
LTAVSVAVMALIGWASGLGFGWLFTLGTANVVRSWMSLPTLAALGTGQVG
ILLGLGDHTTAVLGLTRAIGVVVIAILVTWLLLAVLRGRLHPVGGLGVAL
GLTVLLFPVVQPWYVLWAVIPLAAWATRPAFRTTTIVVTLVVGIFGPTAN
GDRFTLFQILLAVVASTVIVVLLIALTYRHLPWRAMPVEDAGESGDTAGD
VRPPAERRSQPRTPPVKPDAYAESP
375142348YP_005002997.1 putative NADP-dependent oxidoreductase [Mycobacterium rhodesiae NBBMSETNRRIVLAKRPSGLVDDETVRLESEPAPQPADGEALVKVRYLSIDPT
IRTWMDDVPSYLPPIQIGEVIRSGGVGEVVESRTDAYQPGQLLFGMTGWQ
DYVIADAGERAMTVLPEGVPPGVAIGILGVTGMTAYFGITDVGQVKEGDV
VVISGAAGATGSAAGQIAKIKGAKKVVGIAGGAQKCAHIVDELGFDEAID
YKNEDVAARLREACPDGIDLYFDNVGGSILNDCLANLAQRGRVVLCGAIS
TYNDDGPPVGPSNYLTLLVRRGRMEGFIILDYLDRFPAAQMEMAGWIAEG
KIKSTEHIVEGLEKAPDALNLLFSGGNTGKVIVAL
375142347YP_005002996.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MTLLDRLSEFRHNSVVKLNPDTTDRHTRGAIVQHLLESGPITAGEIGEQL
GISAAGVRRHLDALMDAGDAQCSAAAAWQHNGRGRPAKRYRLTAAGRAKL
GHAYDDLAAAAMRQLREMGGDDAIRTFARRRIDTILSGVTEGSDDVESTV
DRMAEALTEAGYATTATKVSGPLHGIELCQHHCPVSHVAEEFPELCETER
EAFAEILGTHVQRLATIVNGDCACTTHVPLAETNTLRRTARAEATTSKLG
AST
375142346YP_005002995.1 FeS assembly protein SufB [Mycobacterium rhodesiae NBB3]MTTTPEALTQEQTIESLGRYGYGWADSDVAGASAQRGLSEAVVRDISGKK
SEPAWMLEMRLKALRTFDKKPMPNWGSNLEGIYFDNIKYFVRSSEKQAAT
WDDLPEDIRNTYDKLGIPEAEKQRLVSGVAAQYESEVVYHSIREDLEAQG
VIFLDTDTALKEHPELFKQYFGTVIPAGDNKFSALNTAVWSGGSFIYVPK
GVHVDIPLQAYFRINTENMGQFERTLIIVDEDAYVHYVEGCTAPIYKSDS
LHSAVVEIIVKPGGRCRYTTIQNWSNNVYNLVTKRARAEAGATMEWVDGN
IGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEGQHQDTGAKMLHLAPNTSS
NIVSKSVARGGGRASYRGLVQVNKGAHGSRSSVKCDALLVDTISRSDTYP
YVDIREDDVTMGHEATVSKVSEDQLFYLMSRGMTEDEAMAMVVRGFVEPI
AKELPMEYALELNRLIELQMEGAVG
375142345YP_005002994.1 FeS assembly protein SufD [Mycobacterium rhodesiae NBB3]MTQNLTNAVEGANKGELFTSFDVDAFEVPGGRDEIWRFTPLKRLRGLHDG
TAVATGTASIEVSECAGVSVETVRRGDERLGQGGVPADRVAAQAFSSFNS
ATLVTVPRNVVCEQPIEIGITGPGKGATAYGHLQVRVGELGEAVVVIDQS
GSGTYADNIEFVVEDAARLTVVSIADWADDAVHVSSHHATLGKDAVLRHV
AVTLGGDLVRLTARTRFCAPGGDAELLGLYFADDGQHFESRLLVDHAQPN
CRSHVTYKGALQGDPDSAKPDAHTVWVGDVLIRAAATGTDTFETNRNLVL
TDGARADSVPNLEIETGEIAGAGHASATGRFDDEQLFYLQARGIPEDQAR
RLVVRGFFGELIQKIAVPAVRERLTEAIEHELEITESRTATS
375142344YP_005002993.1 FeS assembly ATPase SufC [Mycobacterium rhodesiae NBB3]MTTLEIKDLHVSVVSKEDGTDIPILKGVTLTVNSGETHALMGPNGSGKST
LSYAVAGHPKYTVTSGSITLDGQDVLEMSIDERARAGLFLAMQYPVEVPG
VSMSNFLRTAATAVRGEAPKLRHWVKEVKGAMEGLDIDPSFSERSVNEGF
SGGEKKRHEILQLELLKPKIAILDETDSGLDVDALRVVSEGVNRYAEAAD
GGLLLITHYTRILRYIQPQFVHVFVGGRIVESGGPELADELDANGYERFT
QAVGA
375142343YP_005002992.1 cysteine desulfurase-like protein- SufS subfamily [Mycobacterium rhMTAAKTIDLTRVRADFPILARVMRSGNQLAYLDSGATSQRPVQVLDAERE
FLTTSNGAVHRGAHQLMEESTDAYEQGRADIATFVGADTDELVFTKNATE
AINLVSYAVGDDRFPRAIGPGDVIVTTELEHHANLIPWQELARRTGATLK
WYSVISEGPEAGRIDLDSLELDDRVKLVAFSHHSNVTGAVAPVGELVARA
KAVSALTVLDACQSVPHQPVDFHALDVDFAAFSGHKMLGPNGIGVLYGRR
DVLGKLPPFITGGSMIETVTMEQATYAPAPQRFEAGTPMTSQVVGLAAAA
RYLTEIGMPAVEAHEAELVAAALNGLSAIDGVRIIGPASLENRGSPVSFV
VDGVHAHDVGQVLDDEGIAVRVGHHCAWPLHRRFGIAATARASFAVYNTH
DEVDRLIAGVKRAVEFFA
375142342YP_005002991.1 NifU family SUF system FeS assembly protein [Mycobacterium rhodesiaMYQEVILDHYKHPHHRGLREPFNAESYQVNPTCGDEVTLRVTLSDDGERV
TDISYDGQGCSISQASTSVLTDQVIGQDVGAALKTLAAFTEMVSSRGTIE
GDEDVIGDGIAFAGVSKYPARVKCALLGWMAFKSALAEASASSGVLAPMN
EEISNERHRSA
375142341YP_005002990.1 putative metal-sulfur cluster biosynthetic enzyme [Mycobacterium rhMSDTAVPSEEMLADLEEAMRDVVDPELGINVVDLGLVYGLNIEKGEQGDV
ALIDMTLTSAACPLTDVIEDQSRTALVGSGLVKEIKINWVWNPPWGPDKI
TEDGREQLRALGFTV
375142340YP_005002989.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTTRILAGALASVGLAAAGLGVATGTVVAGPSVPHQWCPGQSMYPPSGP
GAVYVWDMNVCHTWQYVRMGMGNVATTNLDGSIDYSPSNVFDGPAIPPGS
AFECGTGLFGGSIVC
375142339YP_005002988.1 2-haloalkanoic acid dehalogenase- type II [Mycobacterium rhodesiae MNPAVLIFDVNETLIDIESLRPHLERILGDGDVLREWFNQLVMYSMTTTM
SGAYVDFFTLGQAVLRMVGDTRQVQVTDGDLDEFAHGMRTMPAHPDVADG
LAQLRAQGHRLVTLTNSPSKPGVPTPLENAGLAQHFDKQFSVDTWGVFKP
SPQLYTGVAADLGVTPSACMMVAAHVWDTIGAQSVGFRGALITRPGNAPL
PTDALPQPDIVVSDTLELAERLLTWDR
375142338YP_005002987.1 flavodoxin reductase family protein [Mycobacterium rhodesiae NBB3]MSVNVGMPADVQWHGKTVHTGIFKNPVLGPVMARRLNIDGDGQGDLNGHG
GEQRAVMVYQTESYDHWQRHLGRDDLRPGMFGENFTITGLSDDDVCIGDR
YRIGEAEFEVSQPRVTCFRVGMRLGEPDMPNLLVAHHRPGFYLRVITEGL
VAAGDEIVRTRRGRHELSVADVDALLYLPDRDVSMLRQAVDVAALSPGWQ
QSFAELLAAGENRSGVTPKLGVEPGWTGFHPLRVAETRRESPTVLSIELE
SIDGEVLPTPRPGQHLTVRVPAGDPAPLRSYSISRGGAATRYRISVKREE
QGLVSSWIHANVHTGTVIEAAAPRGDFYLGDDPVPVVFVSAGIGITPVLA
MLHALAAQHSERDIWWLHVTRDAQSLAFGGEVGELLDSLSAARRRVFYTA
ENGRPDESAIGALDLPQDAVAYLCGPHPFMTDMRSALVRADIDESRVHSE
LFGALPPINPGISDDATRPPHLPDGPPGTGPTVSFARSGLTVNWSDDYGS
ILELAEACDVPTRFSCRSGVCHICVTPLVDGAISYRQPPLELPGAGSALI
CSAQPSQDVVLDL
375142337YP_005002986.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVTIPAAAWRGEFAVRALTIGPVVGLCLGALAWLDSGFWLSGVVVFVVVG
TLYGVLMARRMARYWPGARDLNGEQRVAVARAVRRGEAVGAAPAGTSDAD
DARLSQPVIDYRDGLRAAAETGWWLRWLLIFILVVAVGTAVWDWQYGSWG
NAIASAIYLVALLAEVFWMPKYQTRLLANADQAAALARKAL
375142336YP_005002985.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSFEAKYVRTRRQLRGVAESLIAGPQYRSSGTVRLAVRPDGFAAVTIPVA
VRGTELVLPNDAVALEGPMSLVAEAAGIVAGPPEGAYTIADPLPPDTDLQ
LDAEAAEWVNRSHYAGGYALKSFLPECHPVLWPEHFDVAVTEDEVNYGVS
AGDEQHRMPYAYVGPWALPKGEFWNAPFGALYPLDHTIDVDDLAERIADF
FERGRRELSRQP
375142335YP_005002984.1 thioredoxin [Mycobacterium rhodesiae NBB3]MATKDITAEQFNDTITGNDIVLVDFWASWCGPCKAFAPTFAASSEQHPDV
VYAKVDTEAEQQLAAAADIRSIPTLMAFKKGKLVFNQAGALPPAALEDLV
QKVKEFDVDAAVAAQENGQPD
375142334YP_005002983.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMQSVSEHASPAEEQFVLVDRPRPNVALVTLNRPERMNSMAFDVMVPLKRV
LDELTYDNSVRVIVLTGAGRGFSSGADHKSAGSVPHIDGLTRPSFALRSM
QVLDDVILALRKMHQPVIAAVNGAAIGGGLCLALACDIRVAAAGAYFRAA
GINNGLTASELGLSYLLPRAIGTSRAFELMLTGRDVDADEAQRIGLVSRS
VPEADLLETCYDMAEGIAAFSRPGIELTKRTLWSGLDAGSLEAHMQAEGL
GQLFVRLLTANFEEAVAARAEKRPPVFTDDK
375142333YP_005002982.1 ABC transporter ATPase [Mycobacterium rhodesiae NBB3]MITATDLEVRAGARTLLSTEGAALRVQPGDRIGLVGRNGAGKTTTMRILA
GEGEPYAGTITRIGDVGYLPQDPREGDLDILARDRVLSARGLDSLLADLE
KQQALMAEVADDAARDKAVRRYGQLEERFAALGGYAAESEAGRICASLGL
AERVLTQPLRTLSGGQRRRVELARILFAASESGAGSATTLLLDEPTNHLD
ADSVGWLRDFLQQHKGGLIVISHNVDLLADVVNRVWFLDAVRGEADVYNM
GWQKYLDARATDEQRRRRERANAERKATALRTQAAKMGAKATKAVAAQNM
LRRADRMMAALDEERVADKVARIKFPTPAPCGRVPLVAKGLTKNYGSLEV
FTGVDLAIDRGSRVVVLGLNGAGKTTLLRLLAGAETADSGTLEPGHGLKL
GYFAQEHDTLDDHATVWENIRHAAPDTGEQDLRGLLGAFMFSGPQLEQPA
GTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRSYIG
AVVLVTHDPGAAEALDPQRVVLLPDGTEDFWSADYRDLIELA
375142332YP_005002981.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKKLTKDRDELITELRSAYEGGASIRTLVASTGRSYGSIHSMLRESGTTM
RSRGGPNHRSRRHYG
375142331YP_005002980.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPRVTDDHLAARRRQILDGARRCFAEYGYDKATVRRLEQTIGLSRGAIFH
HFRDKDTLFFELAREDAERMADVASREGLVQVMRDMLAAPEQFDWLATRL
EIARKLRNDPEFHRGWMERSAELSAATTARLRRQKQAGRLRDDVPSAVLQ
TYLDLVLDGLVARLASGDDPEKLSGVLDLVEASLRQVQSEIQP
375142330YP_005002979.1 aconitate hydratase 1 [Mycobacterium rhodesiae NBB3]MSSKDSVNSFGAQDTLKVGDQSYEIYRLDAVPGTEKLPYSLKVLAENLLR
TEDGANITKDHIEAIASWDPSADPSVEIQFTPARVIMQDFTGVPCIVDLA
TMREAVGELGGDPDQVNPLAPADLVIDHSVIADLFGTANAFERNVEIEYQ
RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMERNGVAYP
DTCVGTDSHTTMENGLGVLGWGVGGIEAEAAMLGQPVSMLIPRVVGFKLS
GERKPGVTATDVVLTVTEMLRKHGVVGKFVEFYGDGVAEVPLANRATLGN
MSPEFGSTAAIFPIDDVTIDYLRMTGRSEKQLALVEAYAKEQGMWHDPSR
EPKFSEYIELDLGDVVASIAGPKRPQDRIALSDAKTAFRKDIHNYVEENL
PAEHTKLDEAVEESFPASDPAVLSFDDSDASVPSAAVNSNGRPTNPVEVK
NSERGDCIVDHGAVVIAAITSCTNTSNPEVMLGAALLAKNAVDKGLTSKP
WVKTTMAPGSQVVTDYYNKAGLWPYLEKLGFFLVGYGCTTCIGNSGPLPD
DISKAINDADLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVIAYALAGT
MDFDFESEALGKDDAGNDVFLKDIWPSQKDIDDTIANAINTEMFVKNYAD
VFKGDERWRNLPTPSGNTFEWDDQSTYVRKPPYFDGMPAEPEPVTDIHGA
RVLALLGDSVTTDHISPAGSIKPGTPAAQYLDSHGVEKADYNSYGSRRGN
HEVMIRGTFANIRLRNQLLDDVAGGYTRDFTNGGEQAFIYDAAQNYAEQN
IPLVVLGGKEYGSGSSRDWAAKGTSLLGVRAVITESFERIHRSNLIGMGV
IPLQFPEGESAASLKLDGTETFDITGIEALNDGKTPKTVKVTAKKDNEAG
GSDDVVEFDAVVRIDTPGEADYYRNGGILQYVLRNMLRS
375142329YP_005002978.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIGPQVIPFLPAYIPPDVCGPVGKDPATTSVDECLNLVITDVRDDGFSAA
PTADNAGLADVIAEAKQKGIDLKVVVVDRNPPIDTPLRDIATEVGEAFPG
STVLVLSPTESGTFSTTFDRATLEAGQDVAEGRGSIQGSKNFVSELTTQH
FPWTTFTIVVVLAVIAAVVATRMLQNRAKRQKV
375142328YP_005002977.1 cell wall-associated hydrolase- invasion-associated protein [MycobaMRRTSSASASQLCGRVCAIPLTAGMLFITPPLAIAQPADPNSVGALVAAV
ANVNQKLQDLGAAIQAKQEGVNKAIVDVQTARDNAAAAQRELDASAQRVK
DANVAIEAAQDRFDTYAVATYVNGPSSSYLTASDPSDILDTAATGQTLAV
STQRVISDLQRARTEQVNKESAARLAKQNADQAVVDAEASQQTAVSALTE
AQQSFRDQQAELDKLTAERTAAQAKLAEVRKFSAPAAGAPARPASAPTGS
SNPAADWDRGPQKVDPETGNWATPWDPFLPAIPSAFVSGDPIAIINTVLG
YASTSAQVTQDLGRKFLQSLGLLPQPAAASTGYTNGAIPKVYGRQATEYV
IQRAMSQIGVPYSWGGGNAAGKSLGIDSGSNTVGFDCSGLMLYAFAGVGI
KLDHYSGSQYNAGRKVPSSEARRGDMLFWGPNASQHVALYLGNGQMLEAP
YTGSTVKVSPVRTSGMTPYATRLIEW
375142327YP_005002976.1 cell wall-associated hydrolase- invasion-associated protein [MycobaMQFKRFRFLSGILTTVAAVAVAVCAAMPAAAAPDDGQWDPTLPKILSAGA
PGDPLSVANASLAATAQATEATLNLGRSFLSSLGFGPPATASVAPGRVRG
PQAIEYVLRRGASQIGTPYSWGGGKPTGPSTGVDSGANIVGYDCSGFTQF
SFAGVGVLIPKYSGDQYNTGRKVPLNQAKRGDLLFWGPGGSQHVAIYLGG
DKMLESGGTAGGVGISQVRRAGLQPYVARIIET
375142326YP_005002975.1 MoxR-like ATPase [Mycobacterium rhodesiae NBB3]MTSPSGSPQGAGGFSGQAPSGQQGPAQGYPPGQGGTHAAPINNGGLQQEV
HTLERAIFEVKRIIVGQDQLVERMLVGLLAKGHVLLEGVPGVAKTLAVET
FAKVVGGTFARIQFTPDLVPTDIVGTRIYRQGKEEFDIELGPVVVNFLLA
DEINRAPAKVQSALLEVMAERKISIGGKTFPLPAPFLVMATQNPIEQEGV
YALPEAQRDRFLFKLNIDYPTPEEEREIIYRMGVKPPEPKQVLGPGDLLR
LQDVAANNFVHHALVDYVVRVVTATREPEKFGMPDAKAWIAYGASPRASL
GIIAASRALALVRGRDYVIPQDVVEVIPDVLRHRLVLTYDALADEISSET
VINRILQTVGLPQVNAIPQQGNSVPPVMPAAAAAASGR
375142325YP_005002974.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSSRRAVDLPSLKRGEIRDPALTAALRKLELTVRRKLDGVLHGDHLGLL
PGPGSEPGESRLYQPGDDVRRMDWSVTARTTHPHVRQMIADRELETWLVV
DVSASLDFGTVGCEKRDLAVAAAAAITFLNSGGGNRIGAIIANGDTVRRV
PALSGRMHEQEMLRAIATMPKAPPGVRGDLAATIDALRRPERRRGMAVII
SDFLGPIDWMRPLRAIAGRHEVLGIEVLDPRDVELPPVGDVVLQDTETGR
TREFTIDPQLRDDFAKAAAAHRAEVARTLRRCDAPLLSLRTDRDWIADVV
RFVATRRLALAGRA
375142324YP_005002973.1 Mg-chelatase subunit ChlD [Mycobacterium rhodesiae NBB3]MTLPILGPITLSGFEHAWFFLFLLVVLGVVALYIIVQLARHRRMLRFANM
ELLESVAPKRPTRRRHLPAILLVIALVFLTVAMAGPTHDVRIPRNRAVVM
LVMDVSQSMRATDVSPNRMAAAQEASKQFADELTPGINLGLIAYAGTATV
LVSPTTGREATKAAIDKLQFADRTATGEGIFTALQAIATVGAVIGGGDEP
PPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPISTISFGTPYGY
VEINDQRQPVPVDDEMLKEIADLSGGEAFTASSLEQLRQVYANLQQQIGY
ETIKGDASIGWLRLGALALALAALSALFINRRLPN
375142323YP_005002972.1 Mg-chelatase subunit ChlD [Mycobacterium rhodesiae NBB3]MTLPLLGPVSLTGFQHIFWLLFFLVVVAGLIGLYVAAQLARRRRLQQFAN
TELLDSVAPHRPSPWRHAPAALLAISLLLCTIALAGPTYDQRLPRNRAVV
MLAIDVSQSMKATDVEPSRLAAAQEASKKFVDELTPGINLGVIAYAGTAT
VMVSPTTNRDASRRAIDNLQVADRTATGEAIFTALSSISTVGAVIGGGDT
PPPARIVLFSDGKETVPNNPDNPKGAFTAARTAKDQGVPISTISFGTKNG
SVEVNDERVPVPVDDEMMRKIAQLSGGESYTASNIDELNKVYATLQDQIG
YETVRGEATTGWLRLAALTAALAAVASLLVNRRLPL
375142322YP_005002971.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MAEFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPEGLFGVV
CDVTDNEAVDRAFKEVEEHQGPVEVLVSNAGISQDAFMIRMTEERFENVI
NANLTGAFRVAQRASRSMQRKRFGRIIFIGSVSGMWGIGNQSNYAAAKAG
LIGMARSISREMAKAGVTANVVAPGYIDTEMTRALDERIQEGALDFIPAK
RVGTAEEVAGAVSFLASEDASYIAGAVIPVDGGMGMGH
375142321YP_005002970.1 enoyl-(acyl carrier protein) reductase [Mycobacterium rhodesiae NBBMAGLLEGKRILVTGIITDSSIAFHIAKVAQEAGAELVLTGFDRMKLIQRI
ADRLPEKAPLLELDVQNEKHLDTLADRIAEAIGEGNKLDGVVHSIGYMPQ
TGMGINPFFDAPYEDVAKGIHISAYSYASLAKAVLPIMNPGGAIVGMDFD
PTRAMPAYNWMTVAKSALESVNRFVAREAGPHGVRSNLVAAGPIRTLAMS
AIVGGALGEEAGAQMKLLEEGWDQRAPIGWNMKDPTPVAKTVCALLSDWL
PATTGTIIYADGGASTQLL
375142320YP_005002969.1 ferrochelatase [Mycobacterium rhodesiae NBB3]MDVDAVLLLSFGGPEAPDQVMPFLENVTRGRGIPRERLESVAEHYLHFGG
VSPINSINRALIDQLRGLIDVPVYFGNRNWEPYVEDAVTAMANDGIRTAA
VFATSAWGGYSGCTQYVEDIARARRAAGDAAPRLVKLRQFYDHPLFVQMF
SDAITAAAQTVPGNARLVFTAHSIPLSARSRCGTDLYERQVAYAASLVAA
AAGYAEHDQVWQSRSGPPQVPWLEPDVADHLASLAESGTGAVIVCPIGFV
ADHIEVAWDLDHELRLQAEGAHIAFARATTPNADLARVVADLLDELRNDR
DPVRVTGPDAPPLQGFSIDGVVCTDRCDTR
375142319YP_005002968.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWCPSVSLSVWANAWLAGVAAPDDVLDALSQWAPRHSVTAYDSVAAGRTG
LPWPDLTDAGAVSLLQTLRSGAGRGNSGPTVGVALPVPGDVRGLPAGTQF
QRDAVTVGEALIVAGDSAEAIGLVPDYEYPDVDDTEGDPDAAPDPCGLSW
TVYSVPGAAPAVGLDLGEAEYTMRSAVRSAADALGALHAEAAGGDIEDPR
SLVEQVVESERQHSIPDHAPTRALRVLENAAYIDAIITVSSGLIPIGLNS
SADVQTASEALRPLSGVVRSARLAAVSAILHSAWQH
375142318YP_005002967.1 membrane protease regulatory membrane protein [Mycobacterium rhodesMPAALIWLIAALALAGAEALTGDLFLLMLGGGALAAAGSSLIFDDLWVHG
AVFAVVSVLLLVLVRPALRRHFMSGKGLPEPAKALEGKSALVLDRVGRHE
GQVKLEGEVWTARPLNESDVFEPGDHVTVVQIDGATAVVQKVV
375142317YP_005002966.1 membrane protease subunit- stomatin/prohibitin [Mycobacterium rhodeMDGAVAGLILVAVLVVFAAIIVAKSVALIPQAEAAVIERLGRYSKTVSGQ
LTLLLPFVDKIRARVDLRERVVSFPPQPVITEDNLTVNIDTVVYFQVTNP
QAAVYQISNYIVGVEQLTTTTLRNVVGGMTLEQTLTSRDSINGQLRGVLD
EATGRWGLRVARVELRSIDPPPSIQESMEKQMRADREKRAMILMAEGNRE
ASIKQAEGQKQAQILSAEGAKQAAILAAEADRQSRMLRAQGERAASYLQA
QGQAKAIEKTFAAIKAGRPTPEMLAYQYLQTLPQMAKGEANKVWLVPSDF
GAALQGFTKMLGAPGDDGVFRYQPSPVEEDLPKPEDDSDEVAEWFTTQTD
PAIAQAVAKAEAEARSTTPGIGALPASPENDPLPPMQYPPLSQQSQNYPP
PRGGGSHSL
375142316YP_005002965.1 acyltransferase- WS/DGAT/MGAT [Mycobacterium rhodesiae NBB3]MDELTALASGFLSAEDSDHRVSLAIGSVVTLDGPMPDFDSLLSNLGERIK
TCPRFAHRLRSHAFDHDAPEWVDDVDFDVARHVKRLSLPSPGDEHELHRL
VAEVMAWRMDRSRPLWEIWVMEGLRDGRWAMLLKVHSCIAHAVTIAHIVA
GLSDEGIHLAPGGQLDSARRGEQCDVRPSASSLNPITWMRGLWHVSKDVS
RLASAVFDLLPSSATTPLNGPMTNLRRYSAARVSLDDVHQVCRVFDVTVA
DVALAALTDSYRAYLIRHGHQPSAESLRTLMPDNASAMLALLPVDDADSV
GQLRVVHSRLSRARHAGREIGSAANHVPFPVAAWAMRLLTRLPQHSVAAV
VTTASGPREPLHIMGRRVAAVTPVPPIAMQLRSGVAVLSYAGDLFFGILA
DYAAVPDADELARGIESAVRRLVARSKRRNPTRDRKGLSLVVSA
375142315YP_005002964.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPAGSQLTGHVVLVGVNTVVSTLRTVRSSVLVTAAALPRRRVFTILAAVV
ILVAIALLVDLPNAVQLRDWATSVGPWFPLAFLGAHIVVTIFPFPRTAFT
LAAGLLFGPALGVPLAVAAATVSAVIALLLVRAAGWQLIKLVPHPRIESL
DTRLRQRGWPTIVSMRLIPAVPFSVLNYAAGASAVRVLPYTFATLIGLLP
GTSAVVILGDALTGNVSPLLVLISFCTACVGVAGLVYEIRTHRRHHRERL
DRAEQVAEPTTAS
375142314YP_005002963.1 methylmalonyl-CoA mutase- heterodimeric type- beta chain [MycobacteMPVDTSVGSESDREQWRAAVAGVLAKSSRKDPAELGEAPEQLLDSPTYEG
FPIRPLYTVLDSQPEAPLPGSWPFIRGSDGLRDVKSGWKVAESFPAPGQV
AVTDGNGAVLSALTEGTSALIIDVGPAGVNAGELDRLLEGVFLELVPVVL
DAGTDFAAAADAVLALVTDLDDERRARLSVDLGADPLTAALSGRGAPSID
EVLATAAKTIAYDGGVRAITVDGPAFHDLGANASWELAGAIAAGVSYLRL
LVDSGVPARDALRQISFRFAADDDQFMTIAKLRAGRQLWARVAEVVGAPD
AGAATVHAVTSKPMMTQRDPWVNMLRTTVAAFAAGVGGADTVAVHAFDSA
IPGGWPGTAASFARRMARNTQLLLLEESHIGRVLDPGGGSWFIEDLTREL
AVQAWTQFRDIESRGGFAAARDFLAEQIAQVSRQRSEDIAHRRTAITGVS
EYPNLAEMPLPAIQPLPAVPAIQPLPAVHCDPDPGVQRYASAFEALRDRS
DAYLAEHGSRPTALLLPLGPLAEHNIRTTFAANLLASGGVEALNPGPLDA
AGVAQAVSDAGGAVAAVICGTDARYAEEASGAVEAARAAGVSHIYLAGPE
KAVADAANKPDEYLTAKIDAIAALSALLTRLGA
375142313YP_005002962.1 methylmalonyl-CoA mutase [Mycobacterium rhodesiae NBB3]MTVSNVAGQPAPEVKPLIASFADVPLDGEKTAEPATNATVAEHVAAAAVA
HGYTAEQLDWATPEGIDVKPVYIAADRDAVVEAGYPLDSFPGAPPFVRGP
YPTMYVNQPWTIRQYAGFSTAAESNAFYRRNLAAGQKGLSVAFDLATHRG
YDSDHPRVAGDVGMAGVAIDSILDMRQLFDGIDLSTVSVSMTMNGAVLPI
LALYVVAAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPKPSMRVISDI
FGYTSAKMPKFNSISISGYHIQEAGATADLELAYTLADGVEYIKAGLDAG
LDIDKFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAQFGPRNDKSLS
LRTHSQTSGWSLTAQDPFNNVARTCIEAMAATQGHTQSLHTNALDEALAL
PTDFSARIARNTQLLLQQESGTTRPIDPWGGSYYVEWLTHELAEKARAHI
REVAEHGGMAQAIGEGIPKMRIEEAAARTQARIDSGAQPVIGVNKYQVDE
DHEVEVLKVENSRVRAEQIAKLEQLRAERDESATQAALAELTRAAGEFEA
KGEDGLGNNLMALAINAARAHATVGEISDALEKVYGRHQAEIRTIAGVYR
DEVGTVSNISTATELVSKFAEADGRRPRILVAKMGQDGHDRGQKVIATAF
ADIGFDVDVGSLFSTPEEVARQAADNDVHVVGVSSLAAGHLTLVPALREA
LAEAGRPDIMIVVGGVIPPGDFDELYAAGATAIFPPGTVIADAAIGLLQK
LAGRLGYDLK
375142312YP_005002961.1 LAO/AO transport system ATPase [Mycobacterium rhodesiae NBB3]MNLPVSELAEAVRSGDRAALPKAITLVESTRADHREQAQQLLLELMPDSG
SAMHVGITGVPGVGKSTTIEALGMYLIAQGHRVAVLAVDPSSTRTGGSIL
GDKTRMAKLAVHPDAYIRPSPTSGTLGGVARATRETIVLLEAAGFDVILV
ETVGVGQSEVAVANMVDTFVFLTLARTGDQLQGIKKGVLELADIVVVNKA
DGEHAVEAKAAARELTGAIRLIYPRETLWRPPVLTMSALSGDGLVELWET
VLKHRQVLTDAGEFEARRRTQQVDWTWSMVRDAVLDRVLSHPAVKNIQAE
VERKVRNGELTPALAAQELLNASDLK
375142311YP_005002960.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium rMTGVKSAERSAALPHGIQGAADSNFACTLQAFSKLFPGRRFGGGALSVYL
HGEPVVDVWTGYTDRRGTQFWTADTGAMVFSVTKGLASTVIHRLADRGLV
DYDTPVSEYWPEFGANGKADITVREVMRHRAGLSQLNGVSKAELLDHLTM
EQRIAAAPVNRLLYGRQAYHALTYGWLMSGLGRAITGKGMRDLIREELAE
PLDTDGLHLGRPPVGAPTEAAQILAPQGTLANPIFNFIAPRLAALAGSGG
FGSMYFPGMKSVVQGETPFLDAEIPAANGVTTARALARMYGAIANGGRVD
GTQFLSPERVEGLTGERSFAPDRNIFVPLSFHLGYHSVPIPGVMPGFGHA
GLAGSVGWADPESGMAFGFVHNRLLTRMVLDQATFAGLQTLIRRDAARAR
KRGYQTMPALGAAYKKITRSVAG
375142310YP_005002959.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALTSLIAITLCCIAWSLWIRRVTWSSRWEFAATLNIALQGGAVLLMSPW
ASETLGVFLHSLTGKWNLEDYIGHDLYIVAASAVVYNALGRLQQDHDLRQ
SFKQYVELPATLCIPLLLVAFTLGNGAKIYKADFFEVPTDFWLNVYWLLL
CGTLIYLLGYGSRALLVLRKDPRSRTVANVYLVSCAAGIVACVVRLATAF
IPALQELDAGSTLVWVFACMCGAGFALTSAESWRKKTRWFSTADR
375142309YP_005002958.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSIKAKAYSLRLPLPNGRNLLYRKCVPRTDENGRQLKALLDYLLDGDIDA
KDIYDALGTSSSTYYRRIKEADYPHAEELRRVADRFGLSYPDLQIRFGLM
SEQEVWSYIESSPFAGRAVRQMTMAPTAPTTHRTRAPKLSELKPRSDAPP
L
375142308YP_005002957.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVAPQLPVSANEAFKSVTQCALATIHVVDYDTPDATRPAGMVRLSTPDTE
ELTAELDGASEYLGVPSDELLLAALARTIAKTLGDGVVPVDVASERGSLL
DAVPLLCATAQQADATELLGGVHRLLTSATERIADGMSEVYFNYLGEVPE
DSVPVPVQKAPPGLGHALELRIYRTEDRVHVDWWYDTSHFEPYTVEELAE
QFPLALFEMTTDALPAA
375142307YP_005002956.1 isoleucyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MTAYPKPAAGAPNFPALESEVLDYWDSDDTFRASVARRDGSPEYVFYDGP
PFANGLPHYGHLLTGYVKDIVPRYRTMRGYKVERRFGWDTHGLPAELEVQ
RQLGIADKAQIEEMGIEKFNEACRASVLKYTDEWQAYVTRQARWVDFDND
YKTLDLGFMESVIWAFKQLWDKGLAYEGNRVLPYCWNDETPLSNHELRMD
DDVYQMRQDPALTVGFQVSEGDLAGAYLLIWTTTPWTLPSNQAVAVGPDV
TYVLVQGPDERRFVLAQARLSSYARELGEEPEIIATYTGRDLLGVRYLPP
FPYFMDSDGARNAFQVLPADFVSTEDGTGIVHMSPAYGEDDMTTARAADI
VAVTPVDTKGRFDATVGDYAGQHVFDANPQIIRDLKNQARSAATNGAVLL
RHETYDHSYPHCWRCRNPLIYRAVSSWFIKVTDFRDRMVELNQEITWYPE
HVKDGQFGKWLQGARDWSISRNRYWGSPIPVWKSDDPAYPRLDVYGSLDE
LERDFGVRPDNLHRPYIDELTRPNPDDPTGKSTMRRIEDVFDVWFDSGSM
PYGQVHYPFENADWFAGVDSADPDKQVDGHFPGDFIVEYIGQTRGWFYTM
HILATALFDRPAFKTCVAHGIVLGNDGQKMSKSLRNYPDVTEVFDRDGSD
AMRWFLMASPILRGGNLIVTEQGIREGVRQVQLPLWNAYTFLALYAPKKG
TWRVDSANVLDTYILAKLAELRDDLTESLDVCDISGACDQLRQFTDALTN
WYVRRSRSRFWEEDPDAIDTLHTVLEVTGRLAAPLLPLVTEIIWRGVTDE
RSVHLTDWPAEDLLPKNPQLVADMDLVRVVASAGSSLRKAKKLRVRLPLP
KLTVAVADPQRLEPYRDLIADELNVKTVALTDDIATYGRFELTVNAKVAG
PRLGKDVQAAIKAVKAGEAVANDDGTLKAGPAVLLPGEYSSRLVAADPEY
TAALPDGAGLVVLDGTVTEELEAEGWAKDRIRELQELRKSTGLDVSDRIS
VVMSVPSAHEGWARTHSELIAREILATSFEFGEPVDGSEIGDGVQVAIAK
VN
375142306YP_005002955.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDDVPIRDETIRLGQFLKLSGLIDSGADAKAVVADGLVVVNDTVERRRGR
QLRSGDIVEFDGRRARVS
375142305YP_005002954.1 putative F420-dependent oxidoreductase- MSMEG_2256 family [MycobactMITSLPASTPLSEVAEDVQRVEALGFDCVHVSETVRDPFGVCALALEHSS
FITVRTSMVVAFARSPMVTAYAAWELARFSGGRFQLGVATQVRGNIVGRF
SMPWTDPAAQLRDYVASLRAIFAAFADEQSLDHHGSHYTFTRLQPYFNPG
PIDAAPPAIWTGGVNRRMCTLAGAVADGFVAHPTSSHPAVLREYVLPALA
DGAARQGRTDGGPALVVVPRVISGRDEAAVAAARDEFRSELAFLYSTPAY
QRTLKLFGLDEIAQRLSDRARRKEWSALADVLTDDVVSQLVPQGTYAQLP
DVLASRYDGICDGISLDAPSDPADDDQFAAMLERVKAIPARVT
375142304YP_005002953.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDHFEANVAVHAEVDAAIDFGAECPVEERARRPLIASVRRFQLGESGDGQ
QLLRNAERAGDPEYVRAIGLFVAEEQQHAALLLRLLAYLGGTPMSSHWSD
AVFVRLRRVLGLRTELMVLSVAEAVALSYYGGLSAAGPDPVTRAVAARIV
DDEQAHVRFQRDRLHIGFADSPAPLRLLALALWWVVAVGATAVVALDHRG
VLDAIGYRPTRFVRDVLIDFAGLSAAVLLRRKSTSWT
375142303YP_005002952.1 nucleotidyltransferase/DNA polymerase involved in DNA repair [MycobMDGRWVLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVVAGASYESR
VFGARSAMPMHQARRMVGAAAVVLPPRGVVYGVASRRVFDTVRGFVPVLE
QLSFDEAFGEPAELAGASAHDVEAFCRAVKARVLDETGLIASVGAGSGKQ
VAKIASDLAKPDGVRVVSRTEERTLLDALPVRRLWGIGPVAEEKLHRLGI
DTIGAFAALSDAEAADILGGAVGTALHRLAQGIDDRPVAENSPAKQISAE
STFPEDLTTLDQLREAVARIGEHAHNRLLKDGRGARTITVKLKKSDMSIL
TRSATLPYATTDAATLIATARRLLLDPIEVGPIRLVGVGFSGLSEIQQES
LFPDLELVAEEVSNTRLPPTLTEAAATAPAWRIGDDVAHTTHGHGWIQGA
GHGVMTVRFETRGTGPGPVHTLPEHDPDIARANPVDSLDWPDYVDALAGA
SAPAGEDVGDG
375142302YP_005002951.1 L-asparaginase/glutRNAGln amidotransferase subunit D [MycobacteriumMGRLVVITTGGTIATSTGDDGVKRPTRSGSDLTAGLDVQVIDLMAVDSSM
LTPADWDRIGAAASATSDADGVVITHGTDTMEETALWLELTYDGRVPVVI
TGAQRSADAPDADGPANLRDALTVAASPDAQGLGVLVSFAGTVWQPLGLH
KIATSDLQGFAGTALGSVSDATFDVHQPKIRPFLAAGLAADAPRVDTVAV
YPGSDTVAMDACVVAGARGIVLEALGSGNAGAAVIDGVRRHCRDGVAVAV
STRVPDGRVSAAYGPGRELADAGAVLVPRLRAPQARVLLMAALATGSSIA
DVLARWG
375142301YP_005002950.1 lipoprotein signal peptidase [Mycobacterium rhodesiae NBB3]MTGTEASPEEQRPPKRRLRMLLTVAGIVLAADIVTKVLAVRLLTPDQPVS
VIGDTVTWRLVRNSGAAFSMATGYTWVLTLIATAVVIGIIWMGRRLVSPW
WALGLGMILGGAMGNLVDRFFRSPGPLRGHVVDFFSVGWWPVFNVADPSV
VGGAILLVALSVFGYDFDTVGRRTGDSAQ
375142300YP_005002949.1 RluA family pseudouridine synthase [Mycobacterium rhodesiae NBB3]MPVPEGLAGMRVDAGLARLLGLSRTAAAALAEDGGVDVDGVRAGKSDKLT
AGAWLEVRLPEAPAPVENTPVEIEGMSILYSDADIVAVDKPPGVAAHATV
GWSGPTVLGGLAAAGFRISTSGIHERQGIVHRLDVGTSGVMVVAISERAY
TVLKRAFKQRTVEKRYHALVQGHPDPSSGTIDAPIGRHRGHDWKFAVAEG
GRHSVTHYDTLEAHQAASLLDVELETGRTHQIRVHFAALHHPCAGDLTYG
ADPTLAKRLGLERQWLHARSLAFAHPDDGRRVEITSPYPADLQHALDVLR
DH
375142299YP_005002948.1 rarD protein [Mycobacterium rhodesiae NBB3]MRTSGLLYGIGAYAMWGVFPAFFPLLKPATALEVLAHRIVWTFLLMVVVV
AAARRLRDIGLITGRVWLLLVCASALISINWGIYIYAVNNGHVVDAALGY
FINPLVTVALGLLIFRERLNRAQLIALAIAVIAVVVFTVEVGAPPYIGLG
LALSFGLYGALKKVVPTDPRVSVGIEALVAAPLALAYIVVLERGGPGTFT
DFGASHVVLLILSGIVTALPLLLFAAAAQRLPLVTMGLMFYLTPAMQLTW
GVLVGHEPMPPARWLGFALIWLALLVFSIDALWRARAAAAADRIDAT
375142298YP_005002947.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNGVWFAAMIAGVMVAGVAAQLGWQLPEMAEFKRVFRRERLRLGRPPSHQ
PTPVGVAEPR
375142297YP_005002946.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVSPEIGIAARGSSSGRPIMVALDVLGRRGALRLLWELRGGPLTFRALQT
ACGSNPGSMNTRLKELRALGIVEHDAGGYRLSRHGRSLIEALRPLQAWAD
GWAADPTAAAHAEKPA
375142296YP_005002945.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVCYKSDSARIEPAPLPLQRDMQAAVDAIMRGAPPLALFTTMARDRRLFF
KFFNSGLLDRGHLTIRQREIVIDRVTASCGAEYEWGVHVSVYAGKAGLTD
EQVASLVSGGPDDACWDEADGLLIRLCDALQETCTIDDALWSALAANHSD
EAILELIMLAGTYRTVSYLVNGLRLPLEPGAKRFPVN
375142295YP_005002944.1 DNA-directed DNA polymerase III PolC [Mycobacterium rhodesiae NBB3]MNSQSFVHLHNHTEYSMLDGAAKVKPMLAEAQRLEMPAIGMTDHGNMFGA
SEFYNAATEVDIKPIIGVEAYIAPASRFDTKRVLWGDPSQKSDDVSGSGA
YTHMTMVAENATGLRNLFKLSSLASFEGQLGKWSRMDAEIIAENSEGIIA
TTGCPSGEVQTRLRLGHEREALESAAKWREIFGPENYFLELMDHGLDIER
RVREGLLEIGRKLGIPPLATNDCHYVTRDNARNHEALLCVQTGKTLSDPN
RFKFDGDGYYLKSAAEMRALWDGEIAGACDSTLLIAERVQSYAEVWTPKD
RMPIFPVPEGHDQASWLQHEVDAGLQRRFPGAEVPTEYVDRAAYEIKVIC
DKGYPSYFLIVADLINYARSVDIRVGPGRGSAAGSLVAYALGITNIDPIP
YGLLFERFLNPERVSMPDIDIDFDDRRRGEMLRYAANKWGSDRVAQVITF
GTIKTKAALKDSARVNYGQPGFAIADRITKALPPPIMAKDIPLSGITDPN
HERYKEAAEVRGLIDTDPDVRTIYETARGLEGLVRNAGVHACAVIMSSEP
LVDAIPLWKRPQDGAIITGWDYPSCESIGLLKMDFLGLRNLTIIGDCLEN
IRANRGIDLDLESVPLDDPAAYALLGRGDTLGVFQLDGGPMRDLLRRMQP
TGFEDVVAVIALYRPGPMGMNAHNDYADRKNNRQAIKPIHPELEEPLREI
LAETYGLIVYQEQIMRIAQKVASYSLARADILRKAMGKKKREVLEKEFEG
FSEGMKANGFSAAAIKALWDTVLPFADYAFNKSHAAGYGLVSYWTAYLKA
NYPAEYMAGLLTSVGDDKDKAAVYLADCRRLGITVLPPDVNESSLNFASV
GEDIRYGLGAVRNVGANVVASLIGSRTDKGKYIDFSDYLNKIDIGACNKK
VTESLIKAGAFDSLGHPRKGLFLIHTDAVDSVLGTKKAEAMGQFDLFGGA
DTATDAVFTIKVPEDEWEDKHKLALEREMLGLYVSGHPLNGIAHLLAAQV
DTAIPAILDGDIPNDTQVRIGGILASVNRRVNKNGLPWASAQLEDLTGGI
EVLFFPQTYSTFGAEITDDAVVLVGAKVAIRDDRISLIANDLIVPDFSSA
QANRPVAVTLPTRQCTVDKVTALKQVLARHPGTSQVHLRLISGERITTLE
LDASLRVTASSALMGDLKALLGPGCLG
375142294YP_005002943.1 PEP phosphonomutase-like enzyme [Mycobacterium rhodesiae NBB3]MSFRELHAHGCFVIPNPWDRGTAIALAAMGFQALATTSAGACFAQGLPDT
PSALGVDGALRNIAEIVDAVELPVNADFQAGYASDLDGLAANVRRCVATG
VAGLSIEDARGGAEDPLYSLSEAVERVRVAYAAIDGADVLLTARAECFLY
DHPDPLREAITRLQAFVDAGADVVYAPGVRTREDISAIVDALSPSPVNVL
MTSDTGLTVNDLADLGVRRISVGSALTRVAWGAFLSAARRIAHDGSFAGL
SDAESFGALNDLFEAQRRR
375142293YP_005002942.1 O-methyltransferase involved in polyketide biosynthesis [MycobacterMGIATAGLSPIEQTAFLTEYARALDSQWPRSILGDALAFDVVSKVDYDFV
GLGVPTSVVCQTALRAKMLDDRVRAFIADHPDAVVVDLGAGLDSGFYRVD
PPSSVDWYSVDLPGIIAVRDAALPARAHSHSVPVSVADVHWPDTIPADRP
AMLIADGLFAFLPETQIAAIFTRITDHFVSGEMAFNDYGRIGWFSRVAVK
LAPQRMFKAVGSQWGYAGFKDACYPLTWNPKMTLVEETSLTHQPEVDLFP
SWIRVATKMAGKSKSGARKARILRYAF
375142292YP_005002941.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDTTPEPGNPVEEFVRRAERLASDAEYRIPSWLRPGDPENRMPVLVALVL
AIALQLAIPKSYTVVPRWPLIALEILLVVVLVGLNPLRLSRRTKFGTWAS
YVLLAAITLDNSLSALILDIRILSGQVSNNAAVLLGSGAAIYVTTVIVFG
IWYWEMDRGGPFARRVGSRPYPDFMFPQMTERELAPPNWRPLFFDYLYVS
ITNVVAFSPTDTMPMTRRAKLMMTAQALISFTTLALVIARAVNVLA
375142291YP_005002940.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMDSRHVSIWIDAAPEVVYEFAADPQTWPRWAAGLAEGGLRRGADGWVADS
PMGVVTVEFSPPNRFGVLDHVVRMPSGERVYNPMRIVPAGVDENSCEVLF
TVRRRDGMTAEQFDADARAVAADLATLKGLVEA
375142290YP_005002939.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTNNTFSRRMTRYIALPIMSAGIIGGAALGMAGMANATTSTPSGPGYSYA
PAVKAPAAAAGQTHHHSGVTHVQTVVPGYTR
375142289YP_005002938.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTVRDQVSIAGVPWPVYKLLALAVATIVLLIVAFATASAAPAVLAAAAAG
TVVWLGLGAFQRTD
375142288YP_005002937.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MPLSGEYEASPWDWVRDHADKIMESGSTEGIEMKDKPLILLTTVGAKTGK
IRKTPLMRVEHDGQYAIVASLGGAPKHPVWYHNVKAHPRVELQDGSTTRD
YEAREVFGDEKATWWERAVEAWPDYAEYQTKTDRQIPVFVLTPIA
375142287YP_005002936.1 threonine dehydratase [Mycobacterium rhodesiae NBB3]MSAELSQDSRRTPLTNSISAADIDEAAQRISGVVLRSPLQFSERLSEATG
ANVYLKREDQQAVRSYKLRGAHNLLMQLSAEEMAAGVVCSSAGNHAQGFA
MACRSMGIHGRVYVPAKTPKQKRDRISYHGREFIELIVGGRTYDEAAAAA
LDDVARTGATLVPPYDDLRTIAGQGTIAAEILDQLDGEPDLVIVPVGGGG
CIAGITTYLAERTNNTSVLGVEPAGAAAMIAALAAGEPVTLDDVDQFVDG
AAVNRAGTLTYAALAAAGDMVSITTTDPGAVCTAMLDLYQNEGIIAEPAG
ALSVAALREAELGPGSTVVCVISGGNNDVSRYGEVLERSLVHLGLKHYFL
VDFPQEPGALRRFLDTVLGPNDDITLFEYVKRNNRDTGEALVGIELGSAT
DFDGLLDRMRASDIHVEALEPGSPAYRYLL
375142286YP_005002935.1 malto-oligosyltrehalose trehalohydrolase [Mycobacterium rhodesiae NMAEFSVWAPIPERVRLDLDGTLHDMTRSDDGWWRAEVEAGEGARYGFVLD
DDPTVLPDPRSPRQPDGVHERSALWRPDAGAWTDNGWAGASIEGRVIYEL
HVGTFTPGATFDSAIEKLDYLVDLGVDFVEVMPVNAFGGTHGWGYDGVLW
YAVHEPYGGPGALVRFIDACHHRGLGVLIDAVFNHLGPSGNYLPRFGPYL
SSGSNPWGESINISGPDADEVRRYIIECALRWMREFHADGLRLDAVHALV
DTTAIHILEELSAETDALAEELGRPLSLIAESDLNDPRLITPRDRGGLGM
TAQWDDDIHHAIHAAVSGERQGYYNDFGSMEALAQTLKHGYFHAGTYSSF
RHRRHGRPLDTATIPATRLLAYTLTHDQVGNRACGDRPSQNLTFGQLAVK
AALAIGSPYTAMLFMGEEWGSSSPFQFFTSHPEPDLARATAEGRKREFAE
HGWDADEIPDPQDPDTYERSKLNWHEIGEGEHGRLAQIYRELIALRHDEP
DLADPWLDHMRVDYDEDRQWIVMERGSLVVAANLGTDAVDIPVTGDVVLA
WEDPTVESQSTTVPGRSFAILRRSQSR
375142285YP_005002934.1 malto-oligosyltrehalose synthase [Mycobacterium rhodesiae NBB3]MTSRPTSTYRLQMRGDAFTFADAENLLDYLDALGVSHLYLSPILTAAEGS
THGYDVTDPLTVSAALGGAEGLARLSSAARQRNIGLIVDIVPNHVGVDDP
QQNKWWLDVLTHGRDSVYASYFDVDWDLDQDGRIVLPVLGEDGDDPPPGY
PADSTHYRAIGWRNGICGYRRFFSITSLAGLRQEDRAVFDATHKEVKRWF
DEGLVDGIRIDHPDGLSDPAGYLAWLRELVGPQAWIVVEKILAVDEALEP
TLPVAGTTGYDALREIGGVFIDPAGEDALTDLFDSAGSPYADMPALARRL
KAEAVTETLKSELARVCRTITAATGTEHPDVPAAVAALLSHVEVYRSDYR
GLPVVLPIAFSDAEAERPDLATAFALIAAALAVSTETNVRLQQLCGAATA
KSMEDCLFYRDARLVSLNEVGGEPRRFGVGVGEFHQRAAVRAREWPLAMV
ALTTHDTKRGEDVRARIGVLSQVPSLWAELVGKWALAAPPPDAATGLFLL
QNMFGVWPVDGSVGDALRERLHAYAEKAIREAASHTTWNDPDDEFETAVH
RWIDTVCDGPVGAEMTSLVGRLDLHARSDSLGQKLIALTAPGVPDIYQGT
ELWGDSLVDPDNRRPVDYATRVQALDTLRHPKIRVVAAALRSRRERTASY
TDGGYTPVLAEGPAAGHLLAFLRGGDVLTAVSRHTVVLSETGWGDTALAL
PEGQWIDRLSGARFTGRVLAVELFAELPVALLERIDG
375142284YP_005002933.1 glycogen debranching protein GlgX [Mycobacterium rhodesiae NBB3]MPPDAPASVPTVWPGTSYPLGATYDGAGTNFSLFSEVAERVELCLVGKDG
SEERINLDEVDGYVWHCYLPTVTPGQRYGFRVYGPWDPSAGLRCDPSKLL
LDPYGKSFHGEFDFSQALFSYDLTAEDLASGGTPPMVDSLGHTMTSVVIN
PYFDWASDRAPRTPYHQTVIYEAHVKGMTQTHPGIPEDMRGTYAGLAHPV
IIDHLKSLNVTAIELMPVHQFMHDHRLLDLGLRNYWGYNTFGFLAPHYQY
AANKHAGGAVAEFKAMVRAFHEAGIEVILDVVYNHTAEGNHLGPTINLRG
IDNAAYYRLMDDDKRLYRDFTGTGNSLNPRHPHTLQLIMDSLRYWVLEMH
VDGFRFDLAAALAREFFEVDRLSAFFDLVQQDPVISQVKLIAEPWDVGEG
GYQVGNFPGLWTEWNGKYRDTVRDYWRGEPATLGEFASRLTGSSDLYEAT
GRRPGASINFVTCHDGFPLADLVSYNEKHNEANGEDNRDGESHNRSWNCG
VEGPTDDPDILALRAKQMRNIMGTLMMSQGTPMISHGDEIGRTQRGNNNV
YCQDSEISWMDWSLCETNAEQLAFTRKVTKLRRKHPVFRRRRFFEGKPIR
SGDQFRDIAWLTPSGNEMTPEDWESGLDKCVAVFLNGEAITAPDERGERV
VDDSFLLCFNAHDKQVDFSAPDNGYASQWTAAVDTAHPAGDSDLVVAAGE
KIPLQPRSLLVLRKTA
375142283YP_005002932.1 putative acyltransferase [Mycobacterium rhodesiae NBB3]MMTLAPPRPAPSAEPGHPPREAKASQGARASDFYRHDLDGLRGVAILLVA
VFHVWFGRVSGGVDVFLALSGFFFGGRILRTAMTPGASLWPVPEVTRLVR
RLLPALVVVLACAAVLTILIQPETRWETFADQSLASLGYYQNWELATTAS
DYLRAGEAVSPLQHIWSMSVQGQFYIAFLALIFGSALLFRRIFGRHMRIA
FIALLSALTVASFVYAIFAHNADQATAYYNSFARAWELLLGALVGAVVSR
LSWPMWLRTITAVIGLAAILACGALIDGVHEFPGPWALVPVGATMLFILS
AANRVADPHTAGRMPAPNRLLATAPFVALGAMAYSLYLWHWPLLIFYLSY
TGHPRVNFVEGAAVLLVSGVLAWLTTKFVENPLRYKTAAASAPAVPLRAR
LRRPTMALGSVVVLLAVALTATSFTWREHVTVERSSSKELTGLSSRDYPG
ARALLDKAKVPKLPMRPTVLEARNDLPRTTEDGCISDFDNVGVITCNYGD
DQATRTIALAGGSHAEHWITALDLLGRMHHFKVVTYLKMGCPLTTEEVPL
VMGDNRPYPKCHEWNERVMAKIIADRPDYVFTTATRPWNIKPGDVMPGTY
TGIWRQLSDNDIPILAMRDTPWLVRNGQPYFPADCLAEGGNAISCGVKRS
DVLSPRNPTLDWVAQFPLLKPLDMSDAVCRKDICRAVEGNVLLYHDAHHI
STTYMRTMTTELGRQIAAATGWWAD
375142282YP_005002931.1 adenosylmethionine-8-amino-7-oxononanoate transaminase [MycobacteriMPALTPAEISAIDAAHVWHPYSTIGAETLAPLVAVGAHGAWLTLHRDGHE
VRALDGMASWWTAVHGHGHPALDAAISAQLATMNHVMFGGLTHEPAARLA
QLLVELTPERLDTVFFSDSGSVSVEVAIKMALQYWRSIGRGEKFRLMTWR
GGYHGDTFTPMSVCDPDGGMHSLWTDVLAHQEFAPAVPSEYDAAYIATFE
KQLADHAHELAAVIVEPVVQGAGGMRFHDPRYLTDLRDICTRHDVLLIFD
EIATGFGRTGELFAADHAGVSPDIMCVGKALTGGYLTLAATLCSGEIAQT
ISSHEPGALMHGPTFMANALACAVSVASVELLLAGDWRSSVRTIEKGLRD
GLSPAAELPGVADVRVLGAIGVIEMDQPVDLAVSTPVALDHGVWLRPFRN
LIYAMPPYICTAEEIGQITSAMVGVARALT
375142281YP_005002930.1 7-keto-8-aminopelargonate synthetase-like enzyme [Mycobacterium rhoMTRTGLSPLAWLDEVEQQRRAAGLRRSLRSRPPVGADLDLASNDYLGLSQ
HPDVIEGGVAALRTWGAGSTGSRLVTGNTEIHEGFEQALAGFVGAESALV
FSSGYTANLGAVVSLSGAGSLLVSDALTHASLVDACRLSRARVVVTPHRD
VAAVEAALAARAEERAVVVTDAVFSADGVLAPLRALHDVCRRHGALLLVD
EAHALGVRGTGGRGLVHEAGLAGAPDVVMTTTMSKALGSQGGVVLGPAAV
RDHLIDAARPFIFDTGLAPAAVGAAWAALDVLMAEPWRAQAVLDHAAALA
AVCGVDEIPESAVVSVILGEPEVALAAAVACLDRGVRVGCFRPPTVAPGT
SRLRLTARASLSDDEMALAREVLTAVLAAGA
375142280YP_005002929.1 dethiobiotin synthase [Mycobacterium rhodesiae NBB3]MSTLVVTGTDTGVGKTVATAALACHARLAGIGVAVCKPVQTGSPVDDDLA
DIARLSGVTDLHGSWRYPEPLAPVAAAQRSGRPLPTRAELVGSVHEARAE
LVLVEGAGGLLVELGQDGVTLRDVAIDLAAPVLVVVAAGLGTLNHTALTL
ESLASQGIPCAGLVIGAWPSDPGPAEEGNREALGRLAPVRAVLPAGLGAV
SAADFEAVCSAAFDPAWVSSLAR
375142279YP_005002928.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MMVHSVELLFDADTEAAIRRIWDDLADTGVRSQAGHKAPSNRPHVTLAVA
ETMDTAVDDALRPLLRQLPITCTVGAPMLFGRRQFTLVRLIVPSVPLLSL
QADIHDACLPHAPQGPLPHSQPGQWTPHVTLARRVPAEQLQSALTVQSVS
RELSATGVGIRHWDGNAKREYSI
375142278YP_005002927.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MITVDDVRRIASTLPRSSEVVVRDSIRFRAGRLVYAAFSRDETVMGVGFP
KEERAGMVAAQPDKFMLPRKSELRYNWILVRLDAIELDELRELVIDGWRM
CVPKSVGETVS
375142277YP_005002926.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MQLHKCDVVEAAANLLDEYGIADLTMRRLARELNVSPGALYWHFANKQEL
LGAISDRILDGVPSARGVADVCHRLRDALLSHTDGAELVSASFAAGQSSA
MKQILAVLTEAVSEVGVDSAHAELAARTVVYYVLGFTVDEQSRLQWDAAG
AELPEWQSVLTDDANARFGFGLRLFVDGINVSQAIFE
375142276YP_005002925.1 biotin synthetase [Mycobacterium rhodesiae NBB3]MSDILAKARDQVLERGEGLDQDQTLQVLRLPDENLDELLELAHEVRMKWC
GPDVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDIPSLVEAAKQ
TAKSGATEFCIVAAVRGPDERLLAQVAAGIEAIRNEVDIQIACSLGMLTA
EQVQRLSDMGVHRYNHNLETARSFFTNVVTTHSWEERWDTLQMVREAGME
VCCGGILGMGETLEQRAEFAANLAELDPHEVPLNFLNPRPGTPFGDLDVL
PASEALKAVAAFRLALPRTMLRFAGGREITLGDLGAKQGILGGINAVIVG
NYLTTLGRPAEADLELLEDLQMPIKALNASL
375142275YP_005002924.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAFNVYTGEPDGTALPPAAQLGLEPPRFCAECGRRMIVQVRPDGWSAKCS
RHGLTDSKDLEQR
375142274YP_005002923.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSEVAPPRISRGRAAITVVAALTLTGALIGALWAWLAPPVHGVVALTKSG
ERVRAHLGTEADNFFVASFLVVGMLCVMAVVAAVLVWQWRAHRGPMMVAA
LALGGAAAAGAATGVGAALVHWRYGSIDVAAAPISAEHRVHYVTEAPPVF
FGHSPLLVAVTILFPAAIAALVYALTAVAIARDDLGAWPPIERDELDPTA
KAGSALPSGQ
375142273YP_005002922.1 lysophospholipase [Mycobacterium rhodesiae NBB3]MDLGSVAPAAGAEWIGHVPHEELVRGTRPALPSDDPFYEPPTGYQHATPG
TVLRSRDVELAFMGLIPQRVRATQLLYRTTDMHGSADAAATTVIVPAERA
PAAVTPVISYQCAIDAVTSRCFPSYALRRHAHATGSVAQFEFLLVAACLA
EGWAVSVPDHEGRLGMWGAPYEPGYHVLDGLRAAVSTKRLGLSPDAQIGL
WGYSGGGLATAWAAEMSGSYAPELNVVGAVLGSPVGDLGHTFRRLNGSHM
AGLPALVVAALSDIYPELNKIIEQHVTDEGRTLLQRLHTMTTAEAVVRMF
RKDMGDMLDAPLEQILGTPEVQHVFSDIKLGVAVPTPPVLIVQAVHDLLI
DVHDIDELAETYKSGGASVTYHRDMFSEHLLLHPMSAPMALRWLIDRFAG
KPASEHMVRTKWPTLLNPMTYVGMARLAKIVAKVVTGRTVERTPL
375142272YP_005002921.1 ADP-ribose pyrophosphatase [Mycobacterium rhodesiae NBB3]MVYISTEHEVLAAVFQVRAVDSPKPALHVLLWQRALDPEAGKWALPGGRL
RDDEDLTSSVRRQLAEKVDLREVAHLEQLAVFSDPERVPGARTIASTFLG
LVPSPATPELPSDTRWHPVDDLPAMAFDHGPMVEHASARLVAKLSYTNIG
FALAPTEFAVSTLRDIYSAALGHPVDATNLQRVLERRNVITRTGTTARSG
RSGGRPAALYRFTDSRYRVTDEFAALRPPG
375142271YP_005002920.1 quinolinate synthetase complex subunit A [Mycobacterium rhodesiae NMTVLDRMPANDLADRIIAGPAGFSGVDGDQEWAEEVRRLADLRGATLLAH
NYQLPAIQDVADHVGDSLALSRIAAEVPEDTIVFCGVHFMAETAKILSPD
KTVLIPDQRAGCSLADSITADELRAWKAEHPGAVVVSYVNTTAAVKAETD
ICCTSSNAVEVVASIPADREVLFCPDQFLGAHVRRVTGRENLHVWAGECH
VHAGINGDELADQARAHPDAELYVHPECGCATSALYLAGEGAFPEDRVKI
LSTGGMLDAARETRARQVLVATEVGMLHQLRRAAPEVDFRAVNDRASCKF
MKMITPAALLRCLVEGKDEVHVDPEMARLGRASVLRMIEIGQPGGGE
375142270YP_005002919.1 L-aspartate oxidase [Mycobacterium rhodesiae NBB3]MTGSVSCGGRGYWQQRADVVVIGTGVAGLVAALAAHRRGRKVMVLSKAGD
TATFYAQGGIAVVLPAALRAGGDSVEAHVADTLAAGAGLCDPEVVRSIVA
DGYRAVRDLVDNGARFDEATPGQWALTREGGHSKRRIIHAGGDATGAEVQ
RALDHAAATLDIRRNHVALEILHDEGAVTGVLVLNDDGPGIVHARSVILA
TGGLGHLYSATTNPEGSTGDGVALAMWAGVPVSDLEFIQFHPTMLFDGHA
GGRRPLITEAVRGEGAVLVDSQGRSVTEGVHPMGDLAPRDVVAAAIDARL
TETGDPCVYLDARGIKGFKKRFPTVTAACRAAGIDPTRQPIPVVPGAHYS
CGGVITDMHGRTELAGLFAAGEVARTGMHGANRLASNSLLEGLVIGGRAG
IAAAAHALDAGVSTAVLPETGLRRALPRPDLQRTMTRNASVVRDDRGLRT
LSQDLEAATSRKLNSRRDFEDVALTTVAGAVMSAAFARTETRGCHHRADY
PDTDPAMARSLVPAVACA
375142269YP_005002918.1 nicotinate-nucleotide pyrophosphorylase [Mycobacterium rhodesiae NBMELNADELTEARRVIARGLEEDLRYGPDVTTLATVGADATTTASMVVRQP
GVIAGVDIALLVLDEVLGVGNYVVKHRVDDGERLDAGGVVLAVEAPTQGL
LTAERTMLNLVCHLSGIATVTAEWVAAVEGTNAKIRDTRKTLPGLRALQK
YAVRVGGGVNHRMGLGDATLIKDNHVAAAGSVVAALQAVQAAAPDLPCEV
EVDSLEQLDEVLAQNLGAQALVLLDNFPVWQTQIAVQRRDSRSPATKLES
SGGLSLDTAAEYAGTGVDYLAVGALTHSVTVLDIGLDL
375142268YP_005002917.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPRPDRSRAALVDAAALLFRRQGYAATGVNQILERADVKAGSLYHHFPEG
KQQLAAAVVDSAGSDIEARLRQFLDSDMPVTDIVDGWIDLMSAGLASDRR
DGCPIEPIATESVNASPLVREASARAFRGWHTAIADRLRKDGWADANSEQ
TALAVLALLEGALILSRIAADSAALVAAKAAARTLLNA
375142267YP_005002916.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMRQLMFSDVGTYVWRETADPEITAPEQAIVRPLLVACCDLDVAVAEGRLP
LPPGHAVGHEGIGEVVAVGDAVRGVVPGDRVVIPFQISCGQCRECRRGVT
GSCAALPLMAMYGMAPLAGLDGGGFMADLVHVPYADAMLVPVPRGVDLVG
VASLSDNIVDAWRAVGPYQSEIDALDEADRRVLVAGRQSIGLYAVGLAAA
LGYAVDYVDTDPQRMAAAEKLGATVHDTPKPDKALGPYPITVHTSADPAV
LAATLRVTWPDGVCTDTGIYYQGTVEMPLLPMYTRGVRFVTGRVNARAVI
PDVVELLEAGCDLAPAVDRVVPWDAAPDVWPAMTGKTVFTR
375142266YP_005002915.1 deazaflavin-dependent nitroreductase family protein [Mycobacterium MPVPLWGGHRHVMSEIMSAKDHPNNAPGVPMIYPPTFERLQIKYMNPLVK
RITGILPGVAKIQHRGRKSGKTYETVVTPFRKGNTLAIALGHGKTDWVKN
VLAANEADVLYGKRTVHLVNPRILPAGSGGADDLPFMARTQAKKMAIFVA
NIT
375142265YP_005002914.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSRKSAAGKHRADSSRGTVARRAVGGAMLGGAMTATFVGFGSIGTAEAAP
CTALDCLIPTNLVGGLFGNGADTSSSSSASRLYDPSGFINAFDPILDNPL
TMLFTFGAIGNGADGNAVHPDGFNGGWLFGSGGDGYSPTGQELIPTRPGN
GGNAGFFGGNGGRGGNGRDAAYVTDPITGTSVQVQAAEDGGNGGSAGAVG
SGGAGGAGGNDKNPGGVILGGDNNAEAGQGGAGGSGGYYGVGGDGGAGGN
ASATGNNDATAGNGGAGAGGGTGGGDGGNGGTAKTPNGTATSGTGGDAGD
ADFVGNGGKGGNAGNSETKNGTAIGGNGGQAGNGGVVFGDGRNGGTGGNA
TATGPNGTTSAGNGGNGGNGGIVASDGGNGGNGGNAVGGKPDTDNGGSGG
SGGSGGFGGNDGNDGKDGSNSP
375142264YP_005002913.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSEHAESSRGSVVSILALVVALVAVGVAVWALVKEPSAPSGSAESSKSSS
VFTGNTTDDPKASVCEAFTLVRNGVQLNTNLAPAGGPSDVTGVLAVAANA
RISLIDGGQYLMARLQPDTPAELADPVRKFANQLMDIGARSVAGIANADP
DQASRLKDADATSAQITNLCK
375142263YP_005002912.1 histidinol dehydrogenase [Mycobacterium rhodesiae NBB3]MARIDLRGTELSAARLRSALPRGGVDVDTVVPKVRPIVDAVAERGAEAAL
EFGESFDGVRPAQVRVPTAQLDSALEELPSDIRTALEVAIDRARAVHADQ
CRTDSTTTLAPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTA
GVESLVIASPPQAQSGPYQGLPHPTILAAARLLGVDEVWAVGGAQAVALL
AYGGVDTDGGELAPVDMITGPGNIYVTAAKRICRSQVGIDAEAGPTEIAI
LADHTADPVHVAADLISQAEHDEMAASVLVTTSPELADATDSELAKQLET
TVHRERVTAALSGKQSATVLVDDLDAGIRTVNAYAAEHLEIQTVDARDVA
RRIRSAGAIFVGAYSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRG
VHVVDYDEAALKDVSGYVITLANAENLPSHGEAVRRRFET
375142262YP_005002911.1 histidinol-phosphate aminotransferase [Mycobacterium rhodesiae NBB3MTPGRKVTLADLPLRADLRGKSPYGAPQLEVPVRLNTNENPHPPTKALID
DVTSSVQAVAGELHRYPDRDAVALRTDLAAYLSAQTGVALDVENLWAANG
SNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTQTKWLVANRADDFS
LDADVAVQAIKEHNPDIVFVASPNNPSGQSISVDDLRRLLEAMTTGLLIV
DEAYGEFSSERSAVSLIDEYPAKLVVTRTMSKAFAFAGGRLGYLIAAPAV
IDAMLLVRLPYHLSSITQAAARAALRHADDTLASVAKLISERKRVTEALT
GMGFRVIDSDANFVLFGEFADAPATWQHYLDAGVLIRDVGIPGYLRATTG
LAEENDALLDASARIAATELVSIGAQ
375142261YP_005002910.1 imidazoleglycerol-phosphate dehydratase [Mycobacterium rhodesiae NBMTTSRIAKIERRTKESDIVVELDLDGTGNVSVETGMAFFDHMLTALGSHA
SFDLTVRAKGDVEIEGHHTIEDTAIVLGQALGQALGDKKGIRRFGDAWIP
MDESLAHAAVDVSGRPYCVHTGEPDHMLHFTIAGSEAPYHTVVNRHVFET
IAMNARIALHVRVLYGRDPHHITEAEYKAVARALRQAVELDPRVTGVPST
KGAL
375142260YP_005002909.1 imidazole glycerol phosphate synthase- glutamine amidotransferase sMTARVVILDYGSGNLRSAQRALERTGADVDVTADVDAAMNADGLVVPGVG
AFEACMTGLRQIGGEKIIAERVALGRPVLGVCVGMQILFARGVEFGVESA
GCGQWPGSVIRLDAPVIPHMGWNVVDAAEGSRLFQGLEPDTRFYFVHSYA
AQQWEGNPDAKLTWATHTVPFLAAVEDGPLAATQFHPEKSGDAGASLLGN
WVEGL
375142259YP_005002908.1 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino) imMTRVRLILLPAVDVVEGRAVRLMQGKAGSETEYGSALDAAMTWQRDGAEW
IHLVDLDAAFGRGNNRELLAEVVGRLDVAVELSGGIRDDDSLHAALATGC
ARVNLGTAALENPQWCAKVVAEHGEKVAVGLDVKISGDDHRLRGRGWETD
GGDLWEVLERLDREGCSRFVVTDVTKDGTLNGPNLDLLGKVTDRTNAPVI
ASGGVSSLDDLRAIATLTDRGVEGAIVGKALYAGRFTLPEALTAVAQ
375142258YP_005002907.1 inositol monophosphatase/fructose-1-6-bisphosphatase family proteinMAHDTADLDGLVAVAARILDDAAKPFIEGHRADSAVQKKGNDFATEVDLA
IERQVVEALTRETGIEVHGEEFGGADVESPLVWVLDPIDGTFNYAAGSPM
AAILLGLVRNGEPVAGLTWVPFTGERFTAVVGKPLRSNGIEQPALESVQL
ADSVVGVSTFNIDSRGKVPGRYRLAVIENLSRKCSRMRMHGATGIDFAYT
ASGILGGTISFGAHVWDHAAGVALIRSAGGIVTNLDGSDWTTDSRSALAA
APGVHAELLELLQSVGAPEDF
375142257YP_005002906.1 Imidazole glycerol phosphate synthase cyclase subunit [MycobacteriuMDLAVRIIPCLDVDDGRVVKGVNFENLRDAGDPVELAAAYDAEGADELTF
LDVTASSAGRATMLEVVKRTAEQVFIPLTVGGGVRSVADVDVLLRAGADK
VAVNTAAIARPELLAELSRQFGSQCIVLSVDARTVPPDQERTPSGWEVTT
HGGRRGTGIDAIEWATRGAELGVGEILLNSMDFDGTKAGFDLPMIHAVRG
AVNVPVIASGGAGAPEHFAPAVVAGADAVLAASVFHFRELTINQVKAAMA
AEGIVVR
375142256YP_005002905.1 phosphoribosyl-AMP cyclohydrolase [Mycobacterium rhodesiae NBB3]MTALDPRVASRLKRDANGLLTAVVQERGTGRVLMVAWMDDDALARTLETR
EATYYSRSRGEQWIKGATSGHTQHVHSVRLDCDGDTVLLEVDQVGAACHT
GDHSCFDADVLLTSEQ
375142255YP_005002904.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MKRSATFLGLAIVAAVVRSHLKIRDAVAAVAPELRSPVLPLIAQSLTAGK
LPAFRAIFKVRTKPGPGVTVTHRFAGEPPVRVMVFTPEHRAQSCPAVLWI
HGGGYVVGNPEFEAAGTGRLVSDLGVVAVSPDYRLAPEHPFPAGFDDCMA
ALRWMLSNADELGIDPSRVAVMGASAGGGLAAAVAQRCHDEGIGLRAQVL
VYPMLDDRCTLRSDHNGQGRFAWTPDSNLFGWSAYLGRVPRTSDAPEYAS
PARRVDVSGLAPAWVGVGTLDVFHDEDVDYAKRLKASGVPCELVTVDGMY
HGADGIKPGAPSMRAFRNSMLDHLRKYLEV
375142254YP_005002903.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGWFERARKASAAQRVTRADERQAAATFGELAALGAERERLMRDGLAGVA
TIVGIREGVATTALGVWHELALDVQLPDRAPYRASRRVALELSTAPHIAV
GASVPVRVDPADRSTVLVVTHP
375142253YP_005002902.1 peroxiredoxin [Mycobacterium rhodesiae NBB3]MKRGDQVAEFELPDQTGTVRSLTELLAAGPIALFFYPAAMTPGCTKEACH
FRDLASEFAAVGASRVGISTDAVEKQAQFADKQSFDYPLLSDVGGAVASQ
FGVKRGLLGKLSPVKRTTFVIDTDRTVLEVISSEVNMDTHADKALEVLRQ
RQSA
375142252YP_005002901.1 mitomycin antibiotics/polyketide fumonisin biosynthesis protein [MyMLDLDAFMSAGYVKIETAAPRSVADEARALLWRRLGLSPDDPDGWSAPVR
WTSDITGQGPFGDLIRSPDLATALDAVCGRAGWVPRGSLGNIPVRFPVSP
PDDDRGWHVDANTPLPDGTWTVSGRPHTVLLLTLLSEVSVTDAPTRIRVG
SHHDVARVLGPDHLELAEMGRLVDEASAGRAVVHATGEPGDMYLVHPFTV
HAADEHRGSTPRFMAQAPVMLTSPLTPTSSSPLARVWENR
375142251YP_005002900.1 anthranilate synthase component I [Mycobacterium rhodesiae NBB3]MQTTANLALTTSREDFRALAAEHRVVPVTRKVLADSETPLSAYRKLAANR
PGTFLLESAENGRSWSRWSFIGAGAPSALTVRDGEAVWLGTTPKDAPKEG
DPLQALRATLELLKTEPVPGLPPLSSGLVGFFAYDMVRRLEKLPTLAVDD
LGLPDMLLLLATDVAAVDHHEGTITLIANAVNWNGTDERVDWAYDDAVAR
LDVMTAALGEHLPSTVATFSRPEPVHRSQRTVEEYTAIVEKLVGDIAAGE
AFQVVPSQRFEMDTDTDPLDVYRMLRVTNPSPYMYLLNVPNHAGGLDFSI
VGSSPEALVTVKNGRASTHPIAGTRWRGETEEEDQLLEKELLHDDKERAE
HLMLVDLGRNDLGRVCRPGTVRVEDYSHIERYSHVMHIVSTVHGELAEDK
TALDAVLACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVLGYLDFAGN
ADFAIAIRTALMREGTAYVQAGGGVVADSNGPYEYTEAANKARAVLNAIA
AAETLTEP
375142250YP_005002899.1 trp region conserved hypothetical membrane protein [Mycobacterium rMIRIAQLGLVLAAAALWGASRMTWVNVTSFDGLGQPRTAELSGGSWSTAL
VPLAVLLLATAVAALAVRGWPLRVLAVIAAITSAGMAYLAITLWVMRDVG
VRASHLADVPVADLVGTQRHYWGAVITVVAAVVTLTCAALLLRSAGKEGS
GAARYARRGGLSPDKAENAMSERQLWDELDEGRDPTNTDKGR
375142249YP_005002898.1 Indole-3-glycerol phosphate synthase [Mycobacterium rhodesiae NBB3]MSSATVLDTIIEGVRADVAAREAAVPLAEIKEKAKAARSPLDVLAALREP
GIGVIAEVKRASPSRGELADISDPAKLARAYEDGGARIISVLTEERRFNG
SLADLDAVRAAVSIPVLRKDFIVGPYQIHEARAHGADMLLLIVAALEQQA
LESMLDRTESLGMTALVEVHTEEEADRALQAGAKVIGVNARDLKTLDVDR
DCFARIAPGLPSGVIRIAESGVRGTADLLAYAGAGADAVLVGEGLVTSGD
PRGAVADLVTAGTHPSCPKPSR
375142248YP_005002897.1 tryptophan synthase subunit beta [Mycobacterium rhodesiae NBB3]MADLAGPELPRSSAAVAEPTIHDPDERGHFGAYGGRFVPEALMAVIEEVT
AAYDKARGDQTFLDELDRLQRHYTGRPSPMYEASRLSEHAGGARIFLKRE
DLNHTGSHKINNVLGQALLARQMGKSRVIAETGAGQHGVATATACALLGL
ECIVYMGAVDTARQALNVARMRLLGAEVVSVESGSKTLKDAINEAFRDWV
TNADNTYYCFGTAAGPHPFPTMVRDFQRVIGLEARAQIQAQAGRLPDAVT
ACVGGGSNAIGIFHAFIDDPGTRLIGYEAAGDGVETGRHAATFAGGTPGA
FQGSFSYLLQDDDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPIT
DTEAMDAFGLLCRTEGIIPAIESAHAVAGALKLGSELGRDAIIVVNLSGR
GDKDVETAAKWFGLMDGDS
375142247YP_005002896.1 tryptophan synthase subunit alpha [Mycobacterium rhodesiae NBB3]MSRLAEMFDTCRAENRAALIGYLPTGFPDIPISISAMTALVESGCDLVEV
GIPYSDPGMDGPTIAAATEVALRGGVRVRDTLTAVEAISNAGGRAVVMTY
WNVVLHWGVDAFARDLATAGGLGMITPDLIPDEASEWIEVAEAHNLDRIF
LVAPSSTPERLASTVEASRGFVYAASTMGVTGARDAVSTAAPELVSRVRA
VSDIPVGVGLGVRSREQAAEIGAFADGVIVGSALVSALQDGVDAVRTLTA
ELADGVRQRITA
375142246YP_005002895.1 prolipoprotein diacylglyceryl transferase [Mycobacterium rhodesiae MTTTVLASFPSPSQGVWYLGPVPIRAYALCIIAGIVVALIIGDRRWAARG
GERGVIYDIALWAVPFGLIGGRLYHVITDWPKYFGEGGAGFVGALRIWDG
GLGIWGAVALGGVGAWLACRQRGIPLPAFGDAIAPGIVLAQAIGRLGNYF
NQELYGRPTDVPWALEIYDRQNAAGVVSPDLANGVSTGQVFATVHPTFLY
ELLWNVLIFAVLILVDRRFKIGHGRLFALYVAGYCLGRFWIELLRSDHAT
LIADIRVNSFTSTFVFIGAVVYIMVAPKGREDPATLKGKPREESLIDEVA
DELVAVAATSGVVAAAKAAGDDEDEDAGGADTRTDDELEEPDDDSAKPES
AAIAEMLAAAAAEESVDLDEADSEDVVKADESEDADAEDFEPDELEEEAE
TDADAVGGVGAVEGEDAVAAQEGAAEAHEAAVEGADEAEGADEEVAAEDA
DEAETDADAVGGVGAVEGEDAVAAQEGAAEAHEAAVEGAEDAEEAAEEVA
TEESEAADAEEPDDADAEAEPDADAVGGVGAVEGEDAVAAQQGALEAHEA
AVEGAEDAEEAAVEVASEEPEDVDAGTEPDAGDADAVGVVGAVEGEDAVE
AAAEEPDDADAEAEPDADAVGGVGAVEGEDAVAAQEGAAEAHEAAVEGAE
DAEEAAVEVASEEPDDADAEAEPDGDAVGGVGAVEGEDAVEGTEAETEAA
EDPAEDSPEEVADSVGGEPAEEDEDKSDVKPADSDAPVSDTAATVVRPKA
EPPAAAQPEERGGRLRRIFRRRNR
375142245YP_005002894.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFDTKALTSIDPLADEAKLIAMIADLERIKSAAAAGQARATAALDERRRA
AEAAAGVPAKQRGRGVSSEVALARRDSPSCGNRHLGIAKALVHEMPYTLA
ALECGALSEWRATLIVRESACLSVEDRRTLDTEMCADSANLEGKGNNRIA
ADAKAIACQLDVRSVVERAAKAEADRNVTCRPAPDAMTYVTALLPVKEGV
SVYAALKRAADTTFDNRSQGQVMADTLLERVTGRPAEVPEPIAVNLVMTD
QTLLGGDNCPAVIDGYGAVPAEIARRMVSSAVGDERSKATLRRLYRHPKS
SALVAMESRSRCFPKGLAKFIGLRDQTCRTPYCDARIRHRDHAVPRSRGG
PTHALNGLGMCAHCNYTKESPGWEVRTCEEDGVHAAEFVTPTGAHYRSTA
PPLPGAPMITVSDVELRIGVELADLHAA
375142244YP_005002893.1 response regulator of citrate/malate metabolism [Mycobacterium rhodMRDVLIVDDDFMVAEIHRRFVEQVDGFRAVGLARTGAEALTAVQDLQPHL
VLLDVYLPDMTGLDVLQQLRSDGNLVGVIMITAARELDTVKGALDGGAAD
FLIKPFEFAQFKTKLEAFAARADTLESAGGIDQSLVDSLFGSPGGTAPTL
PKGLGIETGRLVLDAVRGAGEVSAAECADLVGISRVSARRYLEHYLSTEV
LDLRLQYGAGRPERRYHLRGV
375142243YP_005002892.1 signal transduction histidine kinase regulating citrate/malate metaMIQVTHSYAKDVLVVVKLIKSPARGFRSLAGQFLVFQLLVVAIVLIAVAA
VSVAQSTREFREVRGARMIAVAENMASTPIVRDRYADVGASKVLAPEVDR
AVALSGAGLAEIITPSGTVRVSSDPLRIGREVDMGPTRADEGRAWFGDLT
IDGVHSLVGEVPILADSGDVVAVASVSERYPSVWELMGASGERLLFYLSL
GAALGLLTSWLLSRRIKRHTRGLEIAEIASLADHREALLHSIREGVVAVN
NEGDITLLNDSAQDLLGIAGDAVGRPVAGVGLDPAVVEFLLSGEDGRDIV
IVTRTRVLAMNRRAATSQGQRIGTVTTMRDSTELAALQGQLSSHKSVTDT
LRAQTHEFANQLHTISGLVQLGEYDAVRDLVGTLTRRRAEISDAVTQRIS
DPAVAALLIAKTTLAAESGVSLEIASASHLEALPPALATDVITLLGNLID
NAVDVSVGSKPARVTVSVDDHEGLTLSVADSGPGVPEHLRESIFARGVTS
KSEVPGGRGIGLALVRIVTTQHGGTVEVIDDPSGGALFVVRLPAGVIAEK
AAHA
375142242YP_005002891.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLSITTEVIGDDVKSTHTRPLLVIAALVALLVTSCGVTRDGGELGLHRLR
MMVPNSPGGGYDLTARTAVKIMEDDDITGRVEVFNVIGAGGTVAMARLMN
EKGNDDLMMTMGLGVVGATYTNGSKIKASDATALAKLIEDPGAIFVPADS
PFKTVQDFVAAWKADPAKVTIGGGSSPGGPDHLFPMEVARAVGIDPKSVN
FVTYDGGGDLLTALLGKKITVGTSSPGELIDQIEAGQLRVLAVSSDERVE
GVDAPTLKESGIDMTFANWRGVLAPPGISDDARNSMIKVLEDLHATQGWK
DALAKNGWTDAFVTGEAFEKFLVEQDNRVSTTLTELGLL
375142241YP_005002890.1 Tripartite tricarboxylate transporter TctB family [Mycobacterium rhMTTTEDAATAEPEKRVDRAQYLVCVVLVAVGAFVIYDAITLEAGFAKVDP
VGPKMFPVVIGVVLIALAVVLAIAIPRGSVGEADAGEDVDPDAPADWRTV
GLLVGIFVATILLVQPLGWAITGALLFAGTATVLGSKHYVRNILIGALLS
VGSFYAFYSGLGIPLPAGILDGIL
375142240YP_005002889.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MENLDWLIQGFEQAATPMNLLYAVIGVLLGTAVGVLPGIGPAMTVALLLP
VTYNVSPSAAFIMFAGIFYGGMYGGSTTSILLNTPGESSSVITAIEGNKM
AKAGRAAQALATAAIGSFVAGTIGTALLAAFAPAISRFAVTLGAPSYLAI
MLFALVAVTAVLGSSKLRGAISLFLGLAIGCIGIDFLTGQPRATFGIPLL
SDGIDIVIIAVAIFAVGEALWVAAHLRRRPAEVIPVGRPWMGKSDWQRSW
KPWLRGTAYGFPFGALPAGGAELPTFLSYITEKRFAKRSGHDAEFGKGAI
EGVAGPEAANNASAAGTLVPMLSLGLPTNATAAVMLTAFVSYGIQPGPTL
FEKEPLLIWTLIASLFIGNLLLLLLNLPLAPLWAKLLRTPRPYLYAGILF
FACLGALAVNVQPLDLALLLVFGLLGLMMRRFGLPVLPLIIGVILGPRIE
RQLRQSLQLGGGDWGSLFTEPVAIVVYVLMVILLLIPLVLKLMHRNEETL
LVVEDDRDQREKAAQS
375142239YP_005002888.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMIVVGYSADPFGRAALEHGIAEAKLRGTTLLVVNSTSGEAYSDPRFAQSG
EVHDVEQHLGECGVEFELTQPVGVDTAKELLKAMDRDDADLLVIGIRHRS
PVGKLLLGSVSQQVLLECPKPVLAVKPDDS
375142238YP_005002887.1 nitrate/nitrite transporter [Mycobacterium rhodesiae NBB3]MESQHANLVLVKTLSRSRTIEHWDAEDVEAWETTGKRIANRNLIWSIFAE
HVGFSVWSIWSVMVLFMPQNVYGIDAAGKFYLVAVPTLVGAAMRIPYTIA
PARFGGRNWTIVSATLLLIPTLLTLWVMQRPGTSYTTFMVVAAFAGLGGG
NFASSMTNINAFYPQRLKGWALGLNAGGGNIGVPVIQLVGLLVIATVSNT
APEVVCAIYLVLIGLAALGAALFMDNLGNQRSNIGAMAEALRFKHSWVMS
FLYIGTFGSFIGFSFAFGQVLQINFLAGGDSAAEASLHAAQIAFIGPLLG
SISRPFGGKISDRIGGGKVTMYTFVAMIFAAGILVATGMIDDGMAGAATG
GQMIAYVVGFILLFILSGLGNGSTYKMIPSIFEAKAQGHDDWSRDEKAAW
SRSMSGALIGFAGAIGALGGVFINVVLRASYVSDAKSATNAFWVFLGFYV
ICAIVTWVVFLRVQTSRVDAGEQVGRATAPVPA
375142237YP_005002886.1 sulfite reductase subunit alpha (flavoprotein) [Mycobacterium rhodeMVTRTACSYCGVGCGIEVHSAVNSDTGRPVIARVTGDKLHPTNFGRLCTK
GATHAEMMAAVNGRLSTALVRTARGEEPVPILVDDAVAEAGRRLRAIVDE
HGPDAVALYVSGQMSIEAQYLATKLAKGFLRTVHIESNSRLCMASAGTGF
KQSLGADGPPGSYTDFDCSDLFFVIGSNMADCHPILYLRMADRLKAGAKL
IVVDPRRTATAERADLFLQIRPGTDLALLNGLLHLLLEDEANNGAIDFDF
IAEHTEGWDSMPAFLADYTPEVVAQLTGLAEEDIRTAARMIAEAGEWMSC
WTMGLNQSTHGTWNTNAICNLHLATGAICRPGSGPMSLTGQPNAMGGREM
GYMGPGLPGQRSVVSAADREFVEQQWALEPGTIRPDVGPGTIDMFGQLAD
GRIKACWIICTNPVATVANRKTVIAGLEAAELVITQDAYSATATNRYADI
VLPATLWAESDAVMVNSERNLTLLAQSIPPHGDSRPDWQLICQVAAHLGY
GEHFDYESSEQIFDEIRRFSNPKTGYDLRGVSYARLRETSLQWPCPPDDE
NDRHPIRYLNDGVSQDHFVDENGHMPRLAFPTPSRRAVFHARPHMDAREL
PDDDYPFVLNTGRLQHQWHTMTKTGKVDTLNKLNGRPFVEIHPLDAAALD
ISDDQPVELTTRRGRAVLPAVVSDRVREGTCFVPFHWNDEDGEYLAVNAL
TNDAVDPDSLQPEFKACAVTLRPVGAAVRANAALTRPDLTDGPLVLWASQ
TGRAEEFAGKVAAAIGAPNLVNMNDLALAELAARDVLIVTSTFGDGGPPD
NGAEFWKRLNSPNAPTLTGMRFAVLGIGDRTYDNFCGHAKMLDARLAALG
AARLLDRVECEAYDDAPMGRWVDQAAALLGRSVSSKPAPVAEPFTRAHPI
VAPLVRNVVLTTGASRKEVRQFGFDVSEHDVDYAAGDSLGVCPTNDPATV
DAWLAATGMRGQHVVEVDGVEQTLRDALMSRYDICRITPDLLRFIADHSR
DAKALRAPKHKLDRWLAGRDGLDLVQEFVVHADPVEWLDVLVRLTPRNYS
ISSSPLVSPNEIQLTVSVVRYHGADGRRRGGVCSTFLADRAASAPVFLQR
SPHFRPPADSGTPMIMVGPGTGIAPFRGFLQERRALGHAGRNWLFFGDQH
RNENFYYRHDLEDMARDGFLSRLDLAFSRDQSDRVYVQHKMLDRGADVWR
WLDDGGHFYVCGDATRMAKDVDAALTTIIETHGRMSREGAHDFKRELVAA
KRYVRDVY
375142236YP_005002885.1 cytochrome c oxidase subunit I [Mycobacterium rhodesiae NBB3]MTAEAPPVAALEPRRPFPARLGPKGNLVYKLITTTDHKMIGIMYCVACFI
FFFIGGLMALFIRTELAMPGLQFLSNEQFNQLFTMHGTAMLLFYATPIVF
GFANLVLPLQIGAPDVAFPRLNALSFWLFLFGALIALSGFITPNGAADFG
WTAYSPLTDAIHSPGPGGDLWILGLGVGGLGTILGAVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILVLLIFPLLTAALFGLAADRHLGAHVYDPANG
GVILWQHLFWFFGHPEVYVIALPFFGIISEVVPVFSRKPIFGYTTLVYAT
FSIAALSMAVWAHHMFATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWK
GQLTFETPMLFSVGFLVTFLLGGLSGVLLASPPLDFHVTDSYFVVAHFHY
VLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQH
WVGDEGMPRRYADYLPSDGFTTLNVVSTIGAFILGVSTIPFVWNVFKSWR
YGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
VDRIRAEAHVGRDHATAVTASSDSQ
375142235YP_005002884.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MYTPSFNRIDDDDEIRRFVAAARSAQFVTVCPDGLPVATLLPIMWDGNTI
VAHMARANPQWKTIADDSPALLICSGPQAYISPSWYAAKAEHGRVVPTWN
YTAVHLSGTVRVHEDRDWLRNVVTRLTAVHEGGRRDPWQPSDAPERYIEG
QLAGIVGLEITVTRVEGKAKLSQNRSEADRRGVINGLLGEGHYEAAEVAA
AMGPDH
375142234YP_005002883.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTMAERVPMLDREQAQLRAAECGLPEELADLSVFRVALHQPRVAVALYGL
LDALLFRGSLDARLRELVIMRIGWITGSEYEWTQHWRIATLLGVPEHDLL
AVRDWQNSESLGPVERAVLAATDDVVRDGVISEENWAGCQKAFNSDHAVL
VELVGAIANWRLFSILLRSLNIPLESGTDGWPPDGRAPRRGD
375142233YP_005002882.1 theronine dehydrogenase-like Zn-dependent dehydrogenase [MycobacterMIAEAMVLTGPRSLQRRQMTIPDVGDRGAILRVEACGLCGTDHEQFTGHL
PAGFSFVPGHEIVGIVEHVGTSASQRWGVQAGQRVAVEVFRSCRDCPECR
RGEYRRCAVNGIATMFGFVDVQIGAGLWGGYATHVELPWDAMLLPIAEDM
DPVLATLFNPLGAGIQWGATLPDTKAGDVVAILGPGIRGICAAVAAKEAG
AAFVAMTGVGPRDEQRLAIARSFGVDLPIDVSQDNAVTALQRETGGQLAD
VVVDVTAKAPSAFADAVDLARPGSTVVVAGTRGGGGAPGFEPDLLVYKEL
RVVGALGVEYPAYRAALEILAEGRWPFDRITRESTGFAGLAPLLNSLADE
NARSSAALHNVFLPTP
375142232YP_005002881.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MSVGARTPVVVGVGEVTHRGDDFVDPIDLAVEAARLAVRDAGRAVERRID
TVSTPGILVIPRDNPASRIAEAMRIGPARRISCPVGGNTPQYLVEVLGGE
IAKGRADVVLVVGAESGHSARKLQGGALLNSPPPPRSGDESLGDARPGLS
QAELSVGLSWPHEVYPIFESAIAARHGRDFDAQREWLGTLMAPLTAEAAR
HPEQAWFPRARSATELSEVTAENRMVCVPYPKLLNSIMSVDMAAAFILMA
AEVADELGVSRDRWVFPWSAATCNDVYFPVERPDLSRSVGIEVAATKALD
AGGLTTDDIRWFDLYSCFPSAIQMAAEALDVDPLDDRGLTVTGGLPYHGG
PGNNYVSHSIVEMVRRCRRDPTDAGLVTGLGWYSTKHSVGVWSATPPPAG
WRLLDTAVEQAQIDSSRLAVAGVDEATGRATVDGYTVVYDRDGRPRWTPI
IAHLSDGRRVVARSDDPQIAEAMAGEMHLGRTVCLQNTGPFPGFELP
375142231YP_005002880.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MRSRHTGCVSTKLLRWGAAAPTDRGSARDRLLDAAERCLESCGVAGTTME
DIGRTAGVSRATVYRYFPSREAVMSGVIIRAAERYLDRISPRIAAHADLG
SALVDFVEYTVEAARREEIIGLLFGSDEELACVGLAAGTSTSLFEIVTEF
LRPIFTRHWSCVEPGVSVDDAAEWVVRTILSLLTVRGPRERSRDGLRAFL
SRFLLPAILAGDHRRPV
375142230YP_005002879.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSVQFTTFNEEVAEQLKSAAETTGGLAGYLGFRHTEFTAGRLVAEMDARD
DLKTPFGNLHGGCLSAMVDHCLGVVFYPVIPMGSWVATTEFKLNLLRPVS
SGTCVAMAEIISLGRTSGVARIDISNDGRAVCAAQGTVTVVAPKTNS
375142229YP_005002878.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MPAHRASDSSVPVVERVPTADGLSLAVDLYRCDAPRAVVLLLHGGGQSRH
AWDVTAQRLHQRGYTVATYDTRGHGDSDWDPDGRYDMDRLGSDLLAVRSY
ADSGRPVAAIGASLGGLTILGTHLLASPELWRAVVLVDVTPRMEMHGARR
VVAFMAAHPEGFDSLESAADVIAAYNPHRPRPENVDGLQKVLRLRTDGRW
VWRWDPAFVTSNFQFLQGDPDEGARDFEMMSAFLLDGARQVSAPTLLVRG
LLSDIVSEETVKDFLTLVPHAQTVDVSGAGHMVAGDNNDEFSTVVVDFLD
RTI
375142228YP_005002877.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSFRRHVREQVLRATRELTIEKGWDQVRMSEVAESVGVSRPTLYKEFGDK
KGLGDALVVSEGQRFVEGIRAVLAEHVGDVQGGITAAVQFTLSEAEGSPL
LKAVLTSNPSGNDGGGSSSTGVLPLLPTSASLLQLCSGALTTWFNDHFAD
LDPEDVEDVADVLVRLTVSHVVLPAADIATTGERISRVALRYLGVVHSL
375142227YP_005002876.1 NAD(P)H-nitrite reductase [Mycobacterium rhodesiae NBB3]MTPERAVIVGASHAGAQLAANLRREGWAGEVVLIGDEGGLPYHRPPLSKG
YLAGKNGLDDLLIRGADFYEKQNIRLFNATVEAIHRSAKRVSLSTGDTLT
YTKLALCTGARARRLPTPGVDLPGIHYLRTAADVELIRAAAAPGRRVVIV
GGGYIGLETAASLCSLGMNVTVLEATERVLERVTAPEVSAFYTRIHRGEG
VEIRTHALVEAFSGNGGVQEVVLADGESIPADLVIVGVGVVPNTELAAAA
GLFIDNGIVIDDQARTSDPDIVAAGDCTSHTMARYGSRIRLECVPSAGEQ
AKIAAATICGKHSAIAALPWFWSDQYDLKLQIAGLNAGYDEVLLSGDPSR
DRDFSCFYFREGELIAADCVNRPRDFMSSKRAISQQLRVDRSDLLAGSI
375142226YP_005002875.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MSIPATVTAKAQSAVPLELQIRGAHLYDKTRRWVTGANGKKIFTETPIPP
VEDVDIADIDLSNPFLYRQGRWKSYFERVRNEAPVHYQANSPFGPFWSVT
RHADIIAVDKNHEAFSAEPFIIIGRPPRFLDIAMFIAMDPPQHDLQRASV
QGVVAPKNLREMEGLIRSRVQEVLDNLPVDQPFNWVHHVSIELTARMLAT
LLDFPYEQRHKLVEWSDLATSMEQANGGPSDNDRVFRGMVDMAKGLSALW
HDKAARTANGEQPGFDLITMLQANEDTKDLIDRPMEFLGNLVLLIVGGND
TTRNSMSGGVLALNQFPDQFEKLKANPDLIPNMVSEIIRWQTPLAYMRRV
AKKDIMLNGQFIRKGDKVVMWYASGNRDERVFERADELIIDRSNARNHIS
FGFGVHRCMGNRLAELQLRILWEELLPRFENIEVVGEPEYVQSNFVRGIS
KLMVRLTPRPSA
375142225YP_005002874.1 ferredoxin [Mycobacterium rhodesiae NBB3]MAVVTFVSHDGEKYEAPLTEGQSLMQIAVNNAVPGIDGDCGGEAACGTCH
VIVAPEWSDTVGLCGANEEEMLAMNPERQPTSRLSCQMAASKAWDGLTVE
LPEFQL
375142224YP_005002873.1 DNA-binding domain-containing protein [Mycobacterium rhodesiae NBB3MKLDDSGMPALAFLQMLDSEALGHDASNALRSLMVRDHVTESMLVGRDAQ
VPLRWFREIYPDFDCDQGTRLGFAFAEHAKLTSFGALSVPLVSAGSVAEV
VELLAYLPVITTALSPSFHSTERGLTIGLTGRTGDAGLNCLAVTYGGLAL
LRLLDMLAGAVPNIELHLSHSAPESWVLHEEVLAGRIFFGAPSSFVHVPA
ATLEEVCRFSDPVAYRIAVTDLQRTLDQRRDTSFSEKVRDLLEKDPGQSN
ISRTAGELSISPSTLKRRLSEEGTTFRELRQSFLQERAILRLLDSSVSVS
EIAAELGYADLTNFTHAFKRWTGRSPRHFRKTRD
375142223YP_005002872.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MSHDQPAIIGAAELSPGRNVPYTSTELHVRAAVAALADAGVVPDEVDGLV
CAGPMTDEGSVFLSEDLMDYLGLHNLKLQMTCQLGGGTHLAMTRMASNVI
ARGEADTVLVVSAGKFPPIRDGGRELMALVCDHAFEMPYGPSVPALYGLI
AQAWMHETGQGKADIAEVTASQDRWAALNPAAIAHRSQRLSVEDVLSSRP
IAGPFHFYHCSIPCEGGGALVLGSARRAREGKHRPVHLLGFGEGHTHGFL
TSLARPGRTGAARSGPMAFERSGRAPADVDIALLYDAFASNPAMILEEVG
FVKPGGAGDFYRDGRADPGGDLPVNTDGGLIRFGHTGTSSGISQILEGYW
QLSGRAEGRQVLGADTAFVHSYGSMLCSHVSMVMEGAS
375142222YP_005002871.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMTAASSSLDGLHDPEALPPLTDVNRPYFAAAARGVLVFQRCANGHPFLYP
RLVCPVCHDGELAWETAAGTGEIVSFAPVYRPPWDSFPRSEPYVVVLVRL
DEGPQLLASLEGVAPDDVVIGARVRAVFERVNDNFGLVRFGPAAS
375142221YP_005002870.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMSTYGVSVLGADLATLVETAEAADLAGFDAAWASEFYSRSGSISMAAMAA
RTKRCRIGSSILYGVGRSPLVLATEARDLDELSGGRVVLGLGNGTRRMMS
DWHGVEDTSAPALRMEELVPLVRRIWNLHEGPVRHEGRFYRMNLVPTGDV
APPKRAIPIITAGVRPRMCEVAGRVADGLAGHPLFTTAYVEEVARPAVVR
GAERAGRDPADVEIVSMVICAVHDDPQIARREAAQQIAFYSSVKTYEPVL
DVSGFAAQGAAIRDAFARRDLPAMFAAVTDDMIDAMAVAGTAAEVRDGLR
RYEGVLDHIVLYSPSIGLAPERIAENIGSLIRDCAPAFAGGEGDQSG
375142220YP_005002869.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MADASLIGTRLGRTTFPVDRSKVREFALSLGDRDPIYQDAAAARAAGFSA
IPAPPTFVVSSAHWRADDDMFGALGLDLRRVLHGECGWEYFAPVFVGDEL
TETRRVSNVTSREGKRGGTMTMVTIETDFTNQRDELVVRQTDVLIETGGS
TQ
375142219YP_005002868.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MTTSSAPVALAAGDEMPTSQFGPLTRSHIVRYAGAGGDFNPIHHDEEFAR
AAGMPGVFGMGLLHGGVLAQRLTAWVGLANIRSFGIRFTGQVWPGDLLSF
AGRVTGVREAGGQQVADLELVVTRQTGEPAIKGSAVVLVAS
375142218YP_005002867.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAPTSDVTGLGMTFGTFDEGRAWIGHRSEPRRAWFPIDRSMVLYYCSLV
EDANPRYWEGEDCPPGLLMSLGFAPQWVPEYLARADMMFALSVPLPGHHI
INASTTTEFERRPRVGDHVSIVEEVDSISEPKTTRVGTGVFITTVSTFSD
QHGEVIGRNTNVLFRYDTADSEGAS
375142217YP_005002866.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MNDSTEHSMVRVPVRFEDITVGDTLTPVSIEISYKRICMNAASTWDWFPG
HHDPDYARSQGQRTIYLSTLFFHGFIDRGLNEWAGPDALIRRRKISMIRS
IYPGQTATLSGKVVGKRQDAGRRLVDLELLVSSEDGPCVPSEATVELADP
FVEVPG
375142216YP_005002865.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMGEQPIRYEVVDSVAWLTINRPEARNALNNAVRTGLFDAVRRFNDDDAAK
VLVLTGAGDKAFCAGGDLKEMAQNALKMPPKDFAPQFGRNIDVAKPTIAA
VNGVAFAGGFLLAQQCDLVVAAEHATFAVSEVKVGRGSPWATPLSWLVPP
RVAMQILLTGDPITAERAHQVGLVNEVVPADQLRGRTQRLALSIAANAPL
SVLASKRTVYLSAQHHLAAAYDLADEIWEPVYLSDDAQEGPTAFREKRAP
QWKGC
375142215YP_005002864.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQSVIADIEAETAALRELIAPLPEGPHGWDTPTPAVGWTIRDQISHLAFF
DDVALRSATDPDGFSGEYLPMMADGSISPDVVAERYRPLPAADVLAWFDT
SRAALVAAFANIDPATRLPWFGPPMSAVSSLTARLMETWAHGQDVVDALD
ATREATARLRHVAHIGVGARAFSYLTNGLDLPADPVRVELTAPDGTVWTW
GPADAANRVSGPALDFCLLVTQRRHRDDTALVADGPLADQWLAIAQAFAG
PPGSGRAAGQFTGRQR
375142214YP_005002863.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKVVTLDVGDARGEAETSGQLAQRGGQVGGIEPARVRDHLDAPVETGAQH
LLHLGEEGARVPAGRVLGLGLGQDEHGQLGQVVTAQDVDRSALDHLSGCG
DAVAVEPEQLPMRTRTLTADAL
375142213YP_005002862.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPDAPTNEQACAHLRATVKDADPRKVGRAFSGGVMEIALAGFAGFTPPRH
HPRRLPSASTGRPMRRARPSRTCSSTPTARGTRLPTGAVPPAGIAPPAEL
TAPSGPTRRAPLGRVLGARSGDKGGNANLGLWARDDPGYAGHASISASSG
CARCSGRRRRYLRIERFELPNLRARNVVVHGLLGHGVASSTRPDAQAKAS
GSTCDPEWWTFPNRCSIHAEQSGAAPAPSTCCVSPSPTTSADRS
375142212YP_005002861.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAGLRRKLLLEAAADLFARQGFHAVGIDDIGAAAGVSGPAVYRHFQNKDA
ILRELCDAAMTELLAGARRATAAGTPTEVLHALVDLHAAFGARRRGLLAV
YAREHRSLSPLATRALRRRQHSYESFWVDALVRARGDLDRERAQGLVAAV
LSLLNASAHMPASLDDATIEAMLAAAAISALFSGAP
375142211YP_005002860.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MQLGIGQWVTRRSLLNGGRTALISNGEHITYADLDRRTNQVAAALITLGV
RRGDRVAVLLVNSTEFIEVLLSCAKIGALAVPLNVRLAGLEIGYILADSG
ADILVFHEQLAAQATRAVTEPGVRVRHVVRAGGVPAPGELGYEDVVSAGA
PEPLGGDVDGRDPAFIMYTSGTTGRPKGAILTHDNLLWNAINVLGTDIGL
RGEDVTVAVAPMFHIGGLGVHILPLLYVGGASVIMPSFEPRATLQAMADH
HVTVQFMVPAMWTALTQVPDFDSFNLSALRFAMGGGSPVPLTVIDFMRER
GVPFTEGFGMTETAPLVTVLDAENISKRAGSIGRVAMHVDARIVDDDDRD
VATDTVGELIVRGPNVFAGYWMKAEASAEALRGGWFHTGDLGRMDAEGYI
TLVDRKKDMIISGGENVYPIEVEQVLFRHPAVLDAAVIGGKDSKWGERVV
AIVVADPATQAPSAEEIVAWCRERLAHFKCPRDVHFVAELPRNATGKLLK
TELRAQFTGITGGVVLR
375142210YP_005002859.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MELHETEERQDLRKAVAEIAKDFGHEYYLEKSLAGGKSTELWQAVGKQGF
LGVNLSEQYGGGGGGIYDMQIVGEELAAAGCPLLMTVVSPTICGTIIQAF
GSEELKQQWLPGIASGETIMAFAITEPDAGSNSHNISTTAKRDGDDWVIN
GTKYYISGVDEAEAILVVTRTSTNDRGRGLLSLLVVPTDAPGLTKSLIPV
QAVTPEKQFTLFFDDVRVPAASLIGAENEGLRQVFMGLNPERILGAALGN
GIGRYALDKAAGYARERHVWGAPIGSHQGVSHPLAHAKIQVELARLMTQR
AASLHDAGDPGSGEASNMAKYAAAEAGILALDQAIQTHGGNGMATEYGLA
TLWGPARLMRTAPISREMILNFVAQHSLNLPASY
375142209YP_005002858.1 acetyl/propionyl-CoA carboxylase subunit alpha [Mycobacterium rhodeMAMPKIRKVLVANRGEIARRVFRTCRDLGIATVAVYSDADADAWHVADAD
EAVHLPGSSAAETYLDIHRIIAAASLTGADAVHPGYGFLSENAGFARACA
AADLIFIGPPPGAIDAMGSKLQAKRTMSDAGVPVLPGGETTGLSAEQLAK
LAADVGYPVLVKASAGGGGRGMRVVASPDELDEAVASASREAAAAFADGT
VFLERYVRRPRHVEIQIMADTHGNVVSLFERECSVQRRHQKVIEEAPSPV
VDDALRARMSEAAIAAARAVGYVGAGTVEFVYDAAQDGKADSFAFLEMNT
RLQVEHPVTELITGLDLVRAQLLVAMGRPLPEEMHNPRIRGHAVEARLCA
EDPADDYRPHTGTLRTIDVPALAGVRVDSGFRAGSVISHYYDSLLAKVIA
WAPTRDEALASLSAALAGARIHGVTTNRNLLVRVLRHDEFAGRGTDTGFL
DRHDVAELGAALLDTQAEQLHAVAATVASVAARRAAATIQATLPAGWRNN
PSQSQITTWQTQDGREVRVGYTLRLTDTCLRIDDEALADVELVAGSSERV
VLRVNGVRRAYDIVLDRDIAHVDSVAGYSALRLAPRFVDPSTLNPPGSLT
APMPGSVIRLPVAEGETVSAGQTLVVLEAMKMEHTVASPIDGVLSALPVQ
VGHQVSSGDVLAVVEAVDGGEVASHATEL
375142208YP_005002857.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMVQVLPDRVDDTAPSYLKNREGLSAQLDTIAEQLALVNGGGGAKYVARHR
KRGKLLVRERIELMLDPDTAFLELCPFAAWGSKFPVGGSVVVGIGVVEGI
ESMIIAHDPTVRGGASNPYTFRKVFRGMAIARENRLPIINIVESGGADLP
TQAEIFVPGGQLFHDLTQHSAAGLPTLALVFGNSTAGGAYVPGMCDYVVM
VRNRSKVFLGGPPLVKMATGEVSDDESLGGADMHARTSGLADYMAEDEQD
AIRIGRRIMARLNWRKNGPGPTTPPHPPVHDPDQLLGIASVDPKVPFDPR
DVIARVVDGSAFDEFKPLYGTSLVTGWASIHGFPVGILANARGILFSEEA
EKGSQFIQLANQIDTPLIFLQNTTGFMVGAEYEQGGIIKDGAKMINAVSN
STVPHVTITMGASYGAGNYGMCGRSYSPRFLFAWPNSKSAVMGPAQLAGV
LSIVARESAADRGLPFDEEADAQMRAAVEEQIERESVALANSGRLYDDGI
IDPRDTRTVLGFCLSVIHNGEVRGQRGYGVFRM
375142207YP_005002856.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSPARVYGGLSAAQRDAQRRVMLIDAAVSIMGTHGAAACTVTAVCAKSGV
TSRYFYQQFRDRDALLRAVFAKISATFQAVITSAIPDDTVAPQELAYAPI
EALVQVIENDPSMARILFVESGAEPLLRQLRSELMTDFAELVLREARLHL
DIPSDVLQVADLAATYGVGGLFEILRRWIDGQLNLSTEMLIEHGAGFLGS
LGLYTLGQAPDQAAPRPAAADETR
375142206YP_005002855.1 putative metal-dependent hydrolase [Mycobacterium rhodesiae NBB3]MSEDQARTRTRVLPKPRRVRFPMPTSTKRQHFVDGDLVMSHFISVLSATF
PEGEDFFIRSVRNFQSSIDDPQLETAVKGFIGQEATHRHQHRLLNERLQA
MGYPTARIDCHVARLIKRLERRFSPEMRLSMTSALEHYTATLAEIILTSE
DAQKLIGQTEVRPILLWHAFEESEHKAVAFDVYRLVGGAERTRVRGMRIA
SVILFGELILQTALSMAADKASYNPVTLVRSLYRFSRTPMFTADALRRFR
SYNRPGFHPDDWDSAAVLERWSKELFDQDGSQRVIAQPG
375142205YP_005002854.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MRLLPFGGSPGRTHRADAVVTGAGSGIGRAFAVELARRGGRVVCADRDPV
TAKESAELVRHAGGEGFDIACDVTDLEQIRNLADVSEDWFGKAASLVINN
AGIGAGGNRIGATSIEDWKAAISVNLWGVIYGCETFVPRLRSNGHGGVIN
VASAASFGSAPRMAAYNVSKAGVLALSETLAAELSGTDVNVTVLCPTFVK
TNIVNNPQIDEAATRLATNLMKWTGISPQHVARTTLNAHDRGQIYVVPQL
DAKVLWQLKRALPGPFTRTLGLVERMASWNDSAE
375142204YP_005002853.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAFAYSDMLETIKNKQWALADIDWDAPGAELITDEQRPKLKQFMSDVVWI
EHVGARAFAAMAPKAPFEALGDIYRYFHAEEQRHANAELALMRRWGMIEE
GEKPVPNKNIRLVIEWLDRYAEALPLTVIGAAIPALETALDGALLKFLLD
EVDDPVCGEVFNKVNSDESRHLAVGFQVLNDLGASPMRIHAIQTAGALVD
PRILTGALLYIPLLTRMLMNLNAMGLSEEKLYNAVTRYANVGDRSEHTRR
VPGYHILKAHMSSSIKRSQPLHFVSQRLGNAIDVFPVQIFGRPPSWTDEL
TYEPVAK
375142203YP_005002852.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMTGTTTTLIVGAGFAGIGTAIRLLQEGTDDFVIVERSNRVGGTWRDNTYP
GAACDIPSLLYSYSFEPNPGWTRTYSGSAEILEYIDEIVTKYDLARFIQF
DTDVTALEFDEGAGIWVADTADGKRYQARSVVMASGPLADASFPDIRGID
SYEGKKIHSARWDHGYDLGDKRVAVIGTGASAVQIIPELVKSAASVKVFQ
RTPGWVLPRVNFKHPAWARSTFKQLPVSEQALRDAWFWAHEVMAVGMVWN
TAATSAIQLAAKGHLRRQVKDSWLRRQLTPHFRPGCKRMLMTSDYYPALQ
SDNCKLISWPIATLSPNGVRTADGVEHEVDCIVFATGFDVCKRGTPFPIS
GLGGRKLGDEWSQGRYAFKSVSVAGYPNLFFTFGPNSGPGHNSALVYMEA
AIDYIIKAIKLLQQNDIGTLDVREDRQDRYHSEIQRRLRRTTWNSGCSSW
YLTEDGYNGTMYPGFATQFMRELSRLDPHDYVITRRDDTHLELTQSL
375142202YP_005002851.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMDRKSDRNYEIIIIGAGFSGIGSGISLMKAGFTDFLMVDDADGVGGTWHW
NTYPGIAVDIPSYSYQFSYEMRSSWSRTYAHGNELKAYAERCVEKYGLRD
HIRFNTTIAEACFDETATRWRLISANGEEFTARFVINCSGVLSRPKWPEI
KGVRDFAGVTLHTARWDHTKDLSGQRVAVIGTGASAVQLIPEVAQKAESL
TVFQRTPIYCLPKPDFSVPKWAESFLHFVPGAQLATRTASQAFVEITFPI
AAHFHTVIPFADIMESAAKRYMRREVHDPTTREQLIPRYSLGCKRPSFHN
SYLATYNRSNVSLETSGITHIDHASVHSRDGKAHPIDVLILATGFKVMES
GNMPTYVLKGRGGLEQATWWDEHRLQAFEGVSVPGFPNHFNIFGPYGYNG
SSYFTLIEAQSRHIVRCLRRARALGANFVEVKKEANDRYFAEVISRRHRQ
VFWQPSCSNANSYYFDKHGDVPLRPSTTLETYWRSRTFRLSEYRFENRAE
EVCPR
375142201YP_005002850.1 esterase/lipase [Mycobacterium rhodesiae NBB3]MTRMDAPDWQPSLASHLVAMSSRTTLRPLAQLMPSNAYGLAVMDRVLRTA
LVASRPRRGVTVRKVDTVFGGGPIRGDWITSPVVKPHANPLLYIHGGAYS
MCSPDTHRGLLGELASASGRPIFAVKYRLAPRYPYPAAADDALNAYRWLT
SGGPSGSSERAVAVAGDSAGGQLTMATALGARAGGLPLPDAMLLMSPVLD
LKCELARARELRRRDPFASAQSAARALDLYVGGADRGDPRLSVLDADLTS
MPPILIQVGGREMLIDDSRRLAERLQSAGSHVEIQVYRGQIHVFQAMFRI
LPEARDAIHRAGRFLEASGVR
375142200YP_005002849.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMKSDFATARRACDPSIVIIGAGFAGVAMAHRLKKDGFTNFTILEKAADIG
GVWRDNTYPGAACDVPSALYSLSHKPNPRWSRRYAEQPEILQDLCGLVES
GGLDAHLRTHTEVVDMTFDEQSGRWTLATSSNETICCDVVVSAVGQLSLP
HIPDIADADAFQGPRFHSARWDRSVSLRGKQVAVIGTGASAIQFVPHIAR
EAAHVTLYQRTAPWILPKWDSRYGVLHHRLSEFLPVLLHLERFAVWLIFE
MLAVMLVDAKPLSRVLGAIARRHLHRQVASPSLREQLTLSDAPGCKRVLF
SNDYYPAIASDRVSLVPERDRKALRQGCQYRGRRISSCRCRDLRNRVSRH
RFSRPDVRARLSRSLLGRGVGDPGIRISGHHCVPMFPNLFLLYGPNTNVG
SGSILYMIESQLRHIATLIKVVAAHPGHAIDVKSEIAQRYNTRLRRRLRR
SVWALCASWYRTSSGEIPTNWPGPTLVYRLLTRKPRSSDYVLRKVGRLQV
SGPSCTEPDASSG
375142199YP_005002848.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTDHLLAPAHHVKDRLSSVIMVPAPRAVDDRWRRWSRDWPVRELAPAPAG
SGLKAVRGDAGLPFVGHTLDYIRFGSDFSRERYDRLGSVSWMGAFGTKMV
VIAGPNATREAFTSEAKAFSQDGWSFLIDAFFHRGLMLMSFDEHLMHRRI
MQEAFTRPRLTGYVEQVTPCVRSAVPTWPVGPSVRIYPLLKELTLDIATD
VFMGGRGKEESDAVNKAFVAAVRAASSLVRVPLPGTRFRAGVRGRRVLED
YFFRHLPAARAGETDDLFAALCQATTEDGERFSDGDVVNHMIFLMMAAHD
TSTITTTAVAYFLAKYPEWQEAAAAEAEAIGDGLPDIEALEKMTVIELVI
KEALRLLAPVPLVMRKTVRDVAIDGYHIPANILCAITPAVNHFDQTIWSD
PERFDPSRFDESRREDQHHRFAWVPFGGGAHKCIGMQFGTLEVKAILHRM
LRSFTWTVPENYHVRWDNTSLPIPVDGLPLEMKRR
375142198YP_005002847.1 transglutaminase [Mycobacterium rhodesiae NBB3]MTVDHGPYLEPTEFLDWQQDSVRDFVSSAIRGACGDTEKAIAIFTAVRDC
IWYDPYTVTDNPHAYRASTVATAERAYCVPKAVLLTAACRAAGIPARLGF
ADVRNHLQTKTLRERMGGTDVFVYHGYSLMFLNSAWVKATPAFNRELCAR
FGVSPIEFDGRSDALLHGFTADGTQHMEYLRDRGAYDDLPLADILQALKT
YYGTFIDQPNSRPDLFA
375142197YP_005002846.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MQSTMQNVPLTVSAIVQHAAAIHCDSEVITPTGDGYRRTPYRGVLPRVAR
LANALRSLGVTADQRVATFQWSNQEHLEAYCAIPSMGAVLHTLNIRLAPE
QLAYIANHASDQIVLVDASVAPLLARALPAMASVHTVIVTGEGDLAPLQG
CGKTVLRYEKVLAGQEESFEWPRLDELSAAAMCYTSGTTGDPKGVVYSHR
STYLHSLTACTANALSVSEADRVLAIVPMFHANAWGLIYAALMSGADLVL
PDRYLQAEPLVSIIEDTRPTVAGAVPTIWNDVDRYLDSHPGRDISSLRLV
ACGGSAVPLSLMRAFEEKYNVPIVQAWGMTETSPLATVARPASRADATRR
WEMRASQGRPICGVEIRLRDDDGKDVPWDGQSVGEIQARGPWITGSYFGD
NDTEKFDEGWLRTGDVGRIDAEGYLTLTDRSKDVIKSGGEWISTVELENT
LIGHPAVYEAAVVGVADDKWQERPLALVVVHPGTDVDIDQLRSFLSGKVA
KWWIPERWSFVSDIPRTSVGKYDKKAIRARHSAGEYLIEIETS
375142196YP_005002845.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MSSPISPWMNAELLELRDLAAKFFSAELAPHAQRFADQHHVDRELWNRAG
ELGLLCMSIPEEYGGGGGTFAHEAVVLEEQARIGDSSWGAGLHSGIVAHY
ILQYATEELRAKWLPKMASGEMIGAIAMTEPGTGSDLQSVKTRALLDGDE
YVITGSKTFITNGQQADLIIVVAKTDPSQGAAGISLIAVEADRAGFRRGK
VLDKIGQRGQDTSELFFDEVRVPRSHLLGQAEGQGFIQLMTQLPQERLIV
AVGAVAAMELALEQTLKYTREREAFGRPVFGFQNTKFTLAEAATETRIAR
VFLDYCIDLHLAGQLDVQTVAMAKWWTTERAMKVLDDCMQLHGGYGYMTE
YPISRLWVDQRVQKIYAGTNEVMKEIISRSL
375142195YP_005002844.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MASMVVPYRHDMGGHCGSGALRDLTEWAGIRWCDDTPDEGIVFALGGALD
FSYVRSAHLRPPIYLVGRSADLEDEYLTRLGARFECRSTDDPDLGWKWVT
EQIDAGTPVMVWTDIAELPYLRTRLSMSRHDVVIVGYDDDEELAFVVDND
RDTPQAVPYENLRKARASTGFPVPTRHTTYVVEWPRAAPDLGNAAQSAFR
RSADAMQGSFVSAPITEGSDCEIQVRGLPGVSTFVEDLKRWPEIFDDDTL
DGALFALSAFIEKAGTGGGLFRDLQARGCRRVAEELSFEPAFRAAEAAKS
ASELWTAVAHTAYERGADPRSRASGAASLAAQLPQTERRLAQALREAGNL
PL
375142194YP_005002843.1 putative sterol carrier protein [Mycobacterium rhodesiae NBB3]MAVFADAEEVYRYLAGIFRRGLENEDLANRLAGSGVVLRIHYTDPDAVVT
VDMPKKVIETGADSGVTPNVELFMSADTGNRFWLGKVNLTMAMAKGTVRA
KGPVTKLIKLIPQAKNLFPEYRAILEADKRHDLLDV
375142193YP_005002842.1 oxidoreductase- Rxyl_3153 family [Mycobacterium rhodesiae NBB3]MKTRAAVLWGLEQKWEVEEVELDPPGPGEVLVRLAATGLCHSDEHLVTGD
LPIPLPVVGGHEGAGTVVECGEGVEDLSEGDSVILTFLPSCGRCSYCARG
MGNLCDLGAALMMGPQIDGTYRFHARGEDVGQMCLLGTFSEYTVVPQASV
VKIDGGIPLDRAALIGCGVTTGYGSAVRTGEVRAGDTVVVVGAGGIGMNA
IQGARIAGALAIVAVDPVKFKREQASGFGATHAAASMDEAWSLVSDMTLG
KLADVCILTTDVAEASYTAEALALVGKRGRVVVTAIGHPDESSISGSLLE
MTLYEKQIRGALYGSSNAPHDIPRLVELYSAGLLKLDELVTREYSLDQIN
EGYQDMRSGKNIRGLVRF
375142192YP_005002841.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTDAGTTMASEDGAARFVVAPEVWTTPERRALSQMARSFVEREIAPKLAQ
WEQVGEIPRDLHLNAAEVGLLGIGFPEEVGGSGGNAIDSALVTEAILAAG
GSTGVCAALFTHGIALPHIAANGSEALIERYVRPTLAGKMIGSLGVTEPG
AGSDVANLRTRAVRDGDTYVVNGAKTFITSGVRADFVTTAVRTGGPGYGG
VSLLVIDKNSPGFEVSRRLDKMGWRCSDTAELSFVDVRVPAENLVGAANS
GFLQIMQQFQAERLGIAVQAYATAGRALDLAKSWARERETFGRPLTGRQV
IRHKLAEMARQVDVACTYTRAVMHRWLAGEDVVAEVSMAKNTAVYACDYV
VNEAVQIFGGMGYMRESEIERHYRDCRILGIGGGTNEIMNEIIAKRIGL
375142191YP_005002840.1 transposase family protein [Mycobacterium rhodesiae NBB3]MPDSTSLPAAVVADTIVRTVELGVTITDAAVDAEATVVFCNLLDDGRRQC
PGCGVDGVYRDTVIRRVTDVPVVGHPLRLHVRVPRYRCVAADCEREVFAH
NTDRLARRGWSTTRRCARYICRRLMIDRATVAAVARELGLSWDTVNTIAV
NATGMIVAADIGRLDGVRVIGVDEHRWSHVRRAGEDGYVTVIVDLTAVLE
GTGRARLLDLVPGRSAAALKTWLLAQSPAFRDRIEVVAMDGFGGYKTAAA
EQVPEATSVMDPFHVVALAGLKLDLCRQRIQQQTQGHRGRTGDPLYGVRR
TLRTRYPLLSTRQKTRLETVFADENHLSVEVCWGFYQKMIAAYAHPDRRR
GKAMMTTTITTLRSGVPEQLEELAQLGRTLWRRRSDVLAYFDHHASNGPT
EAINGRLEALRRNALGFRNLTHYRIRSLLHCGNLAHQIDAL
375142190YP_005002839.1 amidase [Mycobacterium rhodesiae NBB3]MSRHIIPDTNTKDPAATNTVAVLPIGSFEQHGPHLPLGTDTFIACAIATA
ISQHHDVFQLPPITFGCSHEHAAYPGTVSISATTLAAVINDITQSLTQQA
VHGLVIVNAHGGNAVLTNVVQQANQAATPINVGLYPSREDWTEARTAAGI
TSTNHDDMHAGELETSILLATYPRYLRNGWDTTDHSASDRRYLTTVGISA
YTPTGVIGYPSRATEAKGHALLDHLGRNAAALITLLTGAPQHQERQ
375142189YP_005002838.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAVDPHHALNAQRLRRARLEYGFSLQELAAEVENVRRMRSDRDVPPRES
LRQMIISIERGGPFGEMWRADLAAVFGRDPDEIFSVPTQSPLPHPLLLEL
PVDEEVLSVISAQRAAHIEADHAFGAQHARPLVERDLDTVEALIKTAPRR
LKRAMAEAAGTIAEVAGWIAQDLGDHSAAQTLTHKAFLHLRAASPELRAM
ILMRQSNILTRSDANLAVDLVTDAADLIEGRDAGRLTASIARQQALAALH
NEDERGFYRHATEALELGDIEPVTNDRAPYAHAAYVASDIASGYLRLGRP
EKALELLTNHHTEWTSQQHRDRAVADMRLLHAYIAIRDYRLALALADTAI
PAYLSAPSQRARRHLAQAGKLVRDRRRRDTNPVLQELAARIKKATQGAHT
375142188YP_005002837.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLKIDTSATQFIVTRAPEPRLNFETGSPKVDTSTGLPLFATQLLALDDT
GGEVLNVTVAGDPKLAVTQPVSVSGLVAIPWAQGDRSGVAFRADAITAIV
AGSSDQASRAPK
375142187YP_005002836.1 DNA segregation ATPase FtsK [Mycobacterium rhodesiae NBB3]MASNNKGTNNTQSSDDEWIEDLIVSLFKAAGYLLWWAILFPAISIPIIAC
IAVAITHGVRPGLIAAAVVSIGYMAWAWLDHRSFHAWVTGPVRRRWLTWW
RYTRSWNLVCALHGLTAKLGERTLTPALQSVQIGVRSDVLRLRVVTGQSL
QDWHKQAEALAAAWRADRLTITAIAPGELRITLMRGDVLAEPIALPMPTP
ATIVDLTSVRVGIMESRSGWQLPLLGHHILVAGATGAGKGSVLWSLIAGI
APDLRTGQVRLCVIDPKGGMELGAGAPMFAVFTHDATDPTLELLRQLVKV
MHTRANRLRGKTRLHTPTQAEPLFVVVIDEIAALTAYVTDRKVRTEIEQL
LGLLLSQGRAVGISVVAAVQDPAKDTLPVRQLFTVRIGLRLTEATQTAMV
LGQGARDAGAACDRISDATPGVGYMMVDGTGQPVRVRAFHVTDSDISNLA
ARFRLPCGANRTNQSNGERGDTDRGQR
375142186YP_005002835.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLALPGISATIDTTAVVDQMVRRASSMGFESWWRRAESVGFCAHPIQLTG
TDEFGRDRVVWTRCNNRRAQICPSCSDLYARDTWQLVHAGMAGGHHDIPV
AVADRPQVFVTLTAPSYGPVHTAVRAGDMRHRVCRDHHHIGGYRRCPHGK
PLWCNITHHEGDTHVGRPICADCYDYAGHVLFAWHLPELWRRFTITLRRT
LRRELRASGVDPDTVRVSFIKVVELQARLVPHIHAVIRLDPRDTDNCGGQ
EWQAPVTATELATTIQQAARTVAVTVTDSTSDAATQVIRFGTQVDTQPID
NRSAGTESRAVEEDSSQVRMLAGRRVARYLAKYVTKSLADVGISARRIST
EAIADLDVTDHVRAILTTISQLADRGLAGIGRWLHTLGYRGHITSKSRRY
STTMTALRERRATWTREQRLKNAGHQHGTDFDSTGGDDLVAWEFDGAGAT
SLGDRTLVHSAALQRIDARRIGLMEVRRQARHQHWDSPGGRDG
375142185YP_005002834.1 site-specific recombinase- DNA invertase Pin [Mycobacterium rhodesiMSLRFAFYGRVSTEDAQDPEASRSWQKRRAIDLITPHGGVLAADYFDVGQ
SRSLPWKRRPEASRLLADVISRDRGFDAVVIGEPARAFYGPQFALTFPVL
THYGVGLWVPEVGGAVDPGSEAHDLVMTLFGGMSKGERARIQMRVRTAMS
ALAQDTARYLGGRPPYGYRLVDAGPHPNPAKASLGQRLHRLEPDPATAPI
VERIYRMYADGAGLRYIAQQLTDDGVPSPSQYDPARNRHRDPRGWSHSAI
RAILDNPVYRGIRVWGKQEKYEVLVNPDDVAAGYETRMRWRDEADWIAPD
RRTHEALIPDELAQTVRLRKQARRGPGLVCSRESTVPYALRGLLFCAACG
RRMQGAARPGKQTTRILYRCEFGKSRSVPVDLSDHPRTVYLREDEVTARL
DEWIATLADPEDLARGQDVDPAAGPGYAGLQRQLSEANAKVAALITAVES
GVAVEDLTAALRQRTAERDELRARLERAERPRAMSAAQISELVEELGGLS
AVLGAATGPERAEVYASLGLRLDYDPHLRRVTATADLSRVAGRVRGGT
375142184YP_005002833.1 acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-lMVRMVTVSSQSAAEAEVVDLVSALIRFDTSNTGEPETTKGEAECAAWVVE
QLQAVGYETEYIEAGAPGRANVFARLEGADRERGALMLHGHLDVVPAEAA
DWSVHPFSGAVEDGYVWGRGAVDMKDMVGMIIAVARHFKRSGTVPPRDLV
FAFVSDEEAGGNYGCKWLVENRPDLFAGVTEAIGEVGGFSLTIPRREGGE
RTLYLIETAEKAMMWMRLTARGRAGHGSMIHDNNAVTAVAEAVAKLGKHQ
FPVILTDSVEQFLTAVSEETGYTFDVDSPDLEGAIAKLGPIARIVGATLR
DTANPTMLKAGYKANVIPGTAEAVVDCRVLPGRLAAFEREIDEIIGPDIT
REWITNLPSYETSFDGELLDAMNTAILSADPDARTVPYMLSGGTDAKHFA
RLGIRCFGFAPLKLPPELDFAALFHGVDERVPVDALKFGTRVLEHFLLHC
375142183YP_005002832.1 Raf kinase inhibitor-like protein- YbhB/YbcL family [Mycobacterium MAFDYNPYDFLPDLPKFEVTSQSFEDGQPWANEQVSGIMGAGGSDISPQL
SWSGFPEETRSFAVTVYDPDAPTASGFWHWAVANLPATVTELPAGAGDGS
GLPGEALTLANDAGLKRFIGAAPPAGHGHHRYIVAVHAVGVEKLDLPADA
TPAYLGFNLFGNAIARAIITGTYEQK
375142182YP_005002831.1 dihydroorotate dehydrogenase- subfamily 2 [Mycobacterium rhodesiae MYRALQRVLFLFAPERIHTWVFALLRAVTALAVTRRPLTRWLAPRDPVLA
STVFGVRFDAPLGLAAGFDKDGRGLRTWGALGFGYAEVGTVTAMAQPGNP
QPRMFRLTQDRALLNRMGFNNHGAGELAIQLTRHTAEVPIGVNIGKTKTT
PAESAVDDYAESARLLGSLASFVVVNVSSPNTPGLRNLQAVESLRPILAA
VRAETTTPVLVKIAPDLPDAEIDEIADLAVELGLAGIVATNTTVSREGLS
TPGVDELGAGGISGPPVAQRSAEVLRRLYRRVGDRLVLISVGGIETADDA
WDRIVSGASLLQGYTGFIYGGGLWAKRIHDGLAQRLHDGGFASLADAVGS
AVRD
375142181YP_005002830.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQRGRMPEGWDKDLSDDYEWIPLRLPPDLTRINASTRLSIEAEYRGWELT
RVRLYTDGSRRVLLRRKKSAIRGAAIAEQPDL
375142180YP_005002829.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPIRLNMSRQIIWFLTFALFIAGLSGCDSDSSDTPPPTIVPAEAAVSPPT
TGAPDGTVRPLADHALTALFDAKTSSLAVLSSAPAGQAVVTLITSAGGTR
TVPLPESGTAMTGDDAGQLYVSTRGGYFRVDLAVGSATLVGVEGQQGTDF
TAIARREDGKLVLGSADGTVFTLSSDTAVGARLKIFARVDSLVTQGNTAV
VLDRGQTSVTALSADGTSDEHALRAGEGATTMAADAAGRVLVADTRGGQL
LVYGLDPLILRQAYPVADAPYGLAGTSTLAWVSQTASNAVVGYDLSTGIP
VEKKRYRTVQQPNSLVYDESSGTLYVVSGSGAGVQVIPDAAVGS
375142179YP_005002828.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTIAAERELGSGEFAIEDISAGLHASGFGQVGDGRSFSFHVERRVLLVEV
YRPRLTGPVPHDEDVVAVASRKLTDIDLFDERSLAAAVRDAVAAAQPVAR
TNR
375142178YP_005002827.1 undecaprenyl-diphosphatase UppP [Mycobacterium rhodesiae NBB3]MSWVQVIVLAIIQGMTEFLPVSSSGHLAIASRVFFAEDAGASFTAVTQLG
TEVAVLVYFARDIARIVKAWFNGLFVAAHRNADYWLGWWVIIGTIPIGAF
GLLFKDEIRTGARNLWLIAIALIVFSAVIAAAEHYGRQTRRVEQLTWKDS
VIVGLAQCLALVPGVSRSGATISAGLFLGMNRELAARFGFLLAIPAVFAS
GLFSLPDAFHPVGEGMSASGPQLLVATAIAFVVGFAAVAWFLRFLVRHSM
YWFVGYRVALGTVVLILLGTGVVSAV
375142177YP_005002826.1 putative phosphomutase- MSMEG_4193 family [Mycobacterium rhodesiae MTVILVRHGRSTSNTAHTLAGRSDGVDLDDKGREQAQGLIGRIGALPIRA
IVRSPLLRCERTMEPLAAELGLEPVVDERISEVDYGSWTGRKIGELVSEP
LWSVVQQHPSAAVFPDGEGLAAVQARAVGAVREHDRRLAEEHEGDVLWIA
CTHGDVIKAVVADALGTHLDSFQRITADPASMSVIRYTAVRPFVIHVNHT
GDQLTAGLLAKPPKDASKDDSKEDEVPPEDAVVGGSTG
375142176YP_005002825.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MARAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDKRVVSVILEKQQVAVL
AERIAALLLEINRRFGTPIPPETADVDDLSPLVTPVDAEFRVGTMGLGWD
SEAQTVVVELLAVSETEFDASVVLDDAEEGPDAVRVFLTPESARQFAARS
NRVISAGRPPCPLCDEPLDPEGHICVRTNGYLRGEIAGSDDDADE
375142175YP_005002824.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPTSSGEPDEVLRRGELTVIGRIRSASNATFLCEAHLEGRQAHCVYKPI
AGEAPLWDFPDGTLAGRELGAYLVSGALGWNIVPYTIIREGPAGRGMLQL
WVDQPGESLGEVGDEPEAGPDLVDLLPAGEIPPGFLPILQAYDYAGNEVT
LVHADDARLRRMAVFDVLINNADRKGGHILSGVDGQVYGVDHGVSLHVED
KLRTVLWGWAGKPVDDPTLESVASLRDQLRDGLPETLSEHITEREIAALL
ARTLALLDDPIMPSPDRRRPIPWPAF
375142174YP_005002823.1 3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [MycobaMACVLGDTDSMTLTDAALAADVAKEAGEMLLAVREEIGFYDPYDLGDTGD
RSANTLILNRLRDERPNDAVLSEEAADDLSRVEADRVWIVDPVDGTHEFS
MPGRTDWAVHIALWQRYGAAGAATFHTRGPNGGITDAAVALPARGEVYRT
DTVTPPPPRKEGPILITASANRPPPVLWWLRDRLDIRLVRIGSAGAKAMA
VVRGDVDAYIHAGGQWEWDSAAPAGVVAAAGMHATRLDGSPLIYNRPDPY
LPDLLMCRAELADVLLEGILSAYRNR
375142173YP_005002822.1 cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside MNRPLAVSNPLMPKVDAMKSWPAPTLPALDGRGPQLRLYDSADGQVRPVS
AGQTATMYVCGITPYDATHLGHAATYLTFDLVHRVWLDSGHQVHYVQNIT
DVDDPLFERAERDGIDWRELGDRETELFREDMAALRVLPPHDYVAATEAI
AEVIEIVEKLLAAGSAYIADDAEYPDVYFRADATPQFGYESGYDHDTMMR
LFAERGGDPDRPGKGDPLDALLWRVQRPGEPSWPSPFGAGRPGWHVECAA
IALSRIGTGLDIQGGGSDLIFPHHEFSAAHAESATGERRFARHYVHAGMI
GWEGHKMSKSRGNLVLVSALRADGVDPSAIRLGLFAGHYRADRSWSPAVL
AEANDRLQRWRDAVALPAGPDAGDVVARVRRYLADDLDTPKALAALDGWA
TDALTYGGHDAGAPKAVATAVDALLGIEL
375142172YP_005002821.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MGSLYGKVVLITGAANGIGAEVARRLHHEGAKLVLTDLDEAPLKDLATRL
GGDDVLTAVADVRDLEAMQKATDAGIERFGGIDVVMANAGIATHGSLLAV
DPKAFQTLIDVNVMGVFHTVRAALPSIIERRGYVLIVSSAAAYAPAAGMV
PYDTSKAAVEQFANALRLELAHRGVDVGSAHMLWIDTPLVQETKDESTAF
QEMLRKLPGPLGKTTSVDKCGEAFVRGIEGRKRQINCPSFVGLLRWLKPL
LSSRLGESTTLKDVPELLQKMDAEVAAHGRSMSARTEALEKR
375142171YP_005002820.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRRIAALIAALALLAACSTEKSDDNATPTPSPESPSAVSLEQTRAIAKE
AYIYGFPLVDNYRVMYSYFVNKEDPEYKGGWNEIHNSAQVYTPADKAIQT
PNSDTPYSAVGADLRTEPLVLTVPPVEQDRYYSLQFIDLYTYNMAYVGSR
TTGNGGGKYLLTGPNWRGVKPEGIDEVITSDTDLALVLYRTQLFGPSDID
QVKKIQAGYQVTPLSVFLNQPGPPPAPAIDFVPPLTRDQQKTSPQFFDIL
NFALKFAPPLPDEQELRTRFATIGIGPDGGFDADKLTPEMRDAVEGGMAD
AWQEFDTFKKEKLDTGEVTSGDITGNRETIGTNYLYRMAAAVVGIYGNSK
DEAIYVGAFNDATGAPLTGANNYTYRFAKDQLPPVNAFWSLTMYELPQSL
LVENSMKRYLINSPMLPSLVPDPDGGYTIYIQNGSPGIEKESNWLPAPKG
PFQLVLRLYWPKPDALNGVWQAPKPEKV
375142170YP_005002819.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTPKLPELSDTIVVAAFEGWNDAGDAASDALEHLDAIWEAEPIVEIDDEA
YYDYQVNRPVIRQVDGVTRELVWPSMRISHCRPPGSDRDIVLMHGVEPNM
RWRTFCAELLAIADKLNVQTVVILGALLADTPHTRPVPVSGAAYSPESAK
VFGLEETRYEGPTGIAGVFQDACVQAGIPAVTFWAAVPHYVSQPPNPKAT
VALLRRVEDVLDIEVPLADLPTQAEEWESAVTEMTAEDDDISEYVQSLEE
RGDAEVDMHEAVGKIDGDALAAEFERYLRRRGPGFGR
375142169YP_005002818.1 5-methyltetrahydrofolate--homocysteine methyltransferase [MycobacteMTAVESTVSESNAFAPNIRPDCSDDLTAALRQRILVIDGAMGTAIQRDRP
DEAGYRGERFADWPSDLVGNNDLLTLTQPHIIEGIHREYLEAGADILETN
TFNANAVSLSDYGMAELSYELNYAGAALARKACDEFSTPDQPRYVAGALG
PTTRTASISPDVNDPGARNVSYDQLVAAYFDSARGLVDGGADLLIVETIF
DTLNAKAAIFAIETLFEERGRRWPVIISGTITDASGRTLSGQVTEAFWNS
IRHAKPIAVGLNCALGAPEMRPYLAEMSRIADTFVSCYPNAGLPNAFGEY
DESPKRQAGYVADFAEAGLVNMVGGCCGTTPAHIAEIAKVVEGMPPREVP
EVEVATRLSGLEPLNITEDSLFVNIGERTNITGSARFRNLIKAEDYDTAL
SVALQQVEVGAQVIDINMDEGMIDGVAAMDRFTKLIASEPDISRVPEMID
SSKWEVIEAGLKNVQGKPIVNSISMKEGEDKFIREARLCRKYGAAVVVMA
FDEQGQADNLERRKEICGRAYRVLTEEVGFPPEDIIFDPNCFALATGIEE
HATYGIDFIEACAWIKENLPGVHISGGISNVSFSFRGNNPVREAIHAVFL
FHAIKAGLDMGIVNAGALVPYDSIDPELRDRIEDVVLNRREDAAERLLEI
AERFNRKENSEDPQAAEWRSLPVRERITHALVKGIDAHVDDDTEELRAEI
AGAGGRPIEVIEGPLMDGMNVVGDLFGSGKMFLPQVVKSARVMKKAVAYL
LPFIEKEKEENGTADSKDTNGTIVMATVKGDVHDIGKNIVGVVLQCNNFE
VIDLGVMVPAQKILDAAKEHDADIIGLSGLITPSLDEMANFAVEMERAGL
EIPLLIGGATTSRAHTAVKISPRRSGPVVWVKDASRSVPVAAALLDDKQR
PALLEATEKDYASLRERHAQKNERPMLTLEKARANRTPIEWDGYAPPVPA
HGLGVREFLDYDMSELREFIDWQPFFNAWEMKGRFPDILNNPASGEAARK
LYDDAQQMLDTAIKEKWLTANGVIGFFPANVVGDDIEVYTDDSRSEVLTT
LHNLRQQGEHRDGIPNRSLGDFVAPKDTGLADYVGAFAVTTGLGSQEKIT
EFKAALDDYSAILLESLADRLAEAFAERMHQRVRKEFWGYQPEEQLDNDA
LIGEKYVGIRPAPGYPACPEHTEKATLWKLLDVKERTGIELTESMAMWPG
AAVSGWYFSHPQSQYFVVGRLAQDQVADYAKRKGWTLAEAERWLAPNLGY
NPED
375142168YP_005002817.1 haloacid dehalogenase superfamily protein [Mycobacterium rhodesiae MRGVLFDMDGTLVDSEKLWDISMHELYGRLGGVLTPEVRESTVGGSAESV
MATVYADLGLDPEPAAMAESADWLHDRTGELFEAGLPWLPGARELLDALL
ADGVPMALVTNTRRGLTEQALKSIGRHYFSASVCGDEVRRAKPAPDIYAR
AAELLGFAAGQCLAIEDSVTGTAAAEAAGCPVLVVPNDVEVPTSHRRTHV
SSLAGVSVTDLRRVYDDLSHGIGERSA
375142167YP_005002816.1 MFS transporter- sugar porter family [Mycobacterium rhodesiae NBB3]MAGSNAPAGDESALPIADDDFSSGGTAVRIASVAALGGLLFGYDSAVING
AVDSIQEDFGIGNAELGFAVASALLGAAAGAMTAGRIADMIGRISVMKIA
AALFLISAFGTGFAHEVWSVVLFRIVGGIGVGVASVIAPAYIAETSPPSI
RGRLGSLQQLAIVLGIFTSFAVNWVLQWAAGGPNEPLWFGLDAWRWMFLM
MAIPAVLYGALAFTIPESPRYLVASHKIPEARKVLSMLLGQKNLEITIDR
IKETLEREDKPSLRDLKKPTGGIYGIVWVGLGLSIFQQFVGINVIFYYSN
VLWQAVGFSADESAIYTVITSVINVLTTLIAIALIDKIGRKPLLLIGSSG
MAVTLITMAVIFANATIGPDGTPSLPGASGVIALIAANLFVVAFGMSWGP
VVWVLLGEMFPNRIRAAALGIAAAGQWAANWLITVTFPGLREHLGLAYGF
YGLCAVLSGLFVWRWVMETKGVSLEDMHGEVLHDASPKAAT
375142166YP_005002815.1 phosphoribosyl-ATP pyrophosphohydrolase [Mycobacterium rhodesiae NBMKQSRPVKTFDALFAELSDKARTRPAGSGTVAALDGGVHGLGKKILEEAG
EVWLAAEHEGDDELADEISQLLYWTQVLMISRGLTLDDVYSKL
375142165YP_005002814.1 ATP phosphoribosyltransferase [Mycobacterium rhodesiae NBB3]MLRVAVPNKGALSESAAEILSEAGYRRRRDQKDLTVIDPANNVEFFFLRP
KDIAVYVGSGQLDFGITGRDLAADSDAPVRERLALGFGNSTFRYAGPIGR
EWTAADLGGKRIATSFPNLVRKDLAAKGIDATVIRLDGAVEISVQLGVAD
VIADVVGSGRTLALHDLVAFGDPLCDSEAVLIEGAEAGNSAARDQLAARV
QGVVFGQQYLMLDYDCPRTVLDEATAVTPGLESPTIAPLADPAWVAVRAL
VPRRDVNAIMDKLAAIGAKAILASDIRFCRF
375142164YP_005002813.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTQVLVIVLALLIGVIAGLRALTAPAVVAWGAFLGWINVDGKWSEWVAHP
ITVTVLTIFLLVELVTDQLPKTPSRKTAPQFATRLIMGAFAGAVIGSAFF
HTFSATGAGIVGAVLGTLGGAAVRTKLYEANNGKDRPGAFIEDLVAVGGG
FLIAFLVSLV
375142163YP_005002812.1 pyruvate/2-oxoglutarate dehydrogenase complex- dihydrolipoamide dehMAEKFDAIIVGAGQAGPPLAGRLTEAGQTVAVIERKLVGGTCVNYGCIPT
KTLVASAHTAHTARRGAEYGIGTGDVTVEMSAVKARKDQIVRGDREGVES
WIEGMEGATLIRGHARFESPHTIRVDDRVLEADRIFLNVGGRAVAPDMPG
LSDIDYLTNVGILELDTLPEHLVVIGGSYIALEFAQMYRRFGARVTVIEK
GPRLTSREDEDVSATIKEILEAEGIDVVVDASDIRFAKRGSGFEVTPRDG
VQPIAGTHLLMAVGRQPNTDDLGLEAAGVETDRRGYIVVDDQLRTNVEHI
WAMGDCNGRGAFTHTSYNDFEIVAANLLDDDPRRVSDRITTYALYIDPPL
GRAGMTVDEVRKSGRKALVGKRPMTRVGRAVEKGETQGFMKVVVDAETEQ
ILGAAIFGVGGDEVIHSILDIMTAELPYTAISRTMHIHPTVSELVPTMLQ
ELKPLD
375142162YP_005002811.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIDCYYRRIGADGDWKIFDSTDGTRSNWDPEIQHGSPPLALMTQAIEDLA
AGSGLRVGRLTLDILGAIPVSRVKVRAWIERPGKRIALMVAEMSAARADG
ADRAVARVTAWLLATSDTADAATDRYPALTEGDAVPVPHSWIGAKGYLET
VMWRRQSETSETANVVWISSQIPLVDSEPTSALQRLAMVVDSSNGAGAAL
DPEEFMFMNTDTVVHLHRLPEGNDFALRARGSIGSDGIGVTTAELFDRRG
FIGTCAQTLLVMRR
375142161YP_005002810.1 recombinase B [Mycobacterium rhodesiae NBB3]MTEQRESSAIRRPALSPSRAADFKQCPLLYRFRAIDRLPEPSSAAQVRGS
VVHAALEDLYALPAADRGPATAMTLVDPAWQRLVETRPELAEDFAPALRA
ELLDEARALLAGYYRLEDPTRFDPQSCEQRVEVELEDGTLLRGFVDRIDV
APTGELRVVDYKTGKAPPEARALAEFKAMFQMKFYAVALLRSRGVLPARL
RLLYLADGQVLDYSPDLDELLRFEKTLIAIWHAIQSAGATGDFRPNPSRM
CDWCAHHRHCPVFGGTPPPYPGWPAVPDDGCAAEDDVVLRASEPAA
375142160YP_005002809.1 tRNA(1-methyladenosine) methyltransferase-like methyltransferase [MMNRTGPFAVGDRVQLTDAKGRHYTMVLAEGGEFHTHRGIIALDTVIGLPE
GSVVKSTNGDQFLVLRPLLVDYVMSMPRGAQVVYPKDAAQIVHEGDIFPG
ARVLEAGAGSGALTCSLLRAVGPEGRVVSYEVREDHGEHAVRNVTTFFGE
HPDNWQLVLADINDYAGPEVDRVVLDMLAPWDVLEAVANALVAGGVLMIY
VATVTQLSRTVEALREQKCWTEPRAWESMQRGWHVVGLAVRPQHTMRGHT
AFLINVRKLAPGAVAPMPLRRKRQLGGSV
375142159YP_005002808.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWIGWLEFDLLLGDVHSLKAKRSVIRPLIAELQRRFAVSAAETGSQELHR
RAAVGVSSVSADRAHVVEVLDAAERLVAARPEMELLSVRRGLRRSTDD
375142158YP_005002807.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSLSAVAIAAALGLGACSSDTEEKPAPTTVATPPPTVPVQDVPGPPGAAL
PPPTALSDVMNRLADSNVPGAEKTGLIESPVPGDAAALDKWGQALRQNGY
DPVTFEARDLRWVQGAPDKISAVVGLKTENPQAGDFSYPMEFILTGTSWQ
LARRSADELLGEDVPQGSPSETTPAAPPPPPAAPPTPPR
375142157YP_005002806.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTLKALVSGAAAAVAIAGAAAGVTYIASSSDALATPRVAPVVWDIPMPET
PAPDLQGPLLTTLQALGAPGLSASKAPFIQGGIGRIEGRVADSKLREAQA
DGKFPLSFSLANIDQNGPVVTADVTATAANGGVASQNIAFVPGPSPTGWQ
MSKQSLMALMSAVG
375142156YP_005002805.1 proteasome ATPase [Mycobacterium rhodesiae NBB3]MSESERSEGFGTPHESGMSSDEAAELEELRREAALLREQLESAVGPQSGL
RSARDVHQLEARIDSLAARNAKLMETLKEARQQLLALREEVDRLGQPPSG
YGVLLSVQDDETVDVFTSGRKMRLTCSPNIDTKTLKQGQTVRLNEALTVV
EAGHFEAVGEISTLREILSDGHRALVVGHADEERIVWLAEPLVAAEFLPD
EVEAADDEDDERPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPD
VSYNDIGGLGRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCG
KTLIAKAVANSLAKKMAEVRGDDAREAKSYFLNIKGPELLNKFVGETERH
IRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLS
EIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDI
FSKYLVEDLPVHVDDLAEFSGDKSLTLKAMIEKVVDRMYAEIDDNRFLEV
TYANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLL
DSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRA
IDTESNLGQYL
375142155YP_005002804.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKKLVVSALGALALGLAVAAPAHADQESFIVDLANNGWDGPVDAAVALGN
HICSDIAAGVPETETLQTISDNTTDGVEPKDAKTFYDAAAGHLC
375142154YP_005002803.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MASGNVTTVGDVFAKRYGEVLLVRVGESGPEACVYNTFPLNDCPAELWDK
LDANSIAEENNAVAALLNGPRYWLMSGIGKRDRDELEHKTFGGLEMLKQA
TVKLSSMNPAPYQPNRVDRKASFTFDAGREIYELIDPDDRHWVMQTWSQT
VDPTLSLADLPNLATRLSLPPGWRYQARTPASALHVDTTTTDASVTQDDL
ANSYSLLPLSISR
375142153YP_005002802.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAVPDMRSVHEWFLHRGLPLVLTRRVRSRALIERSAPMFSGIGALIALTM
TLAELTEDDPDYGIAIRLGVLTALLIAAPFVLYVLHRLGTTRGEAGRRTA
ALVVMAVFVFGLPFAGADFSGIAVAESVGFLVIAVVAIWMTYTGIGSIVL
WAFRFAWVQLGALGTLMSRALPLLMLTVVVYFTGELWQLAARMTRERLWQ
TIGFLALVAIVFMVTTIRDEVNALRDDRAGQTDPAKLLEGTPLATTEGHT
PERSPLSFAEQVNVVAVMVVAQAIQVVLFTAGLFVFFVVLGIVAVPDDVA
VLWSAEETCPVGEPPCAGTWFGIDVPVAQTIVHVSLFVAVLSGLYFTVST
SVDPIYRERFFEPLISDVAVSLAGRDAYLEMDKGKSE
375142152YP_005002801.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIDVQQRRAADAWFLDHGLPAVLRPGRLVRRLWPRSAPALAAFAVFMANS
AVVVLVTGKYTINIEGEPTRTEWFVLGLLVLVLPLASLVGWLVSRISTVQ
GRTIAAAVALVAAITGGIIGGPSHLVVADLIFEGIVIAAILALTASGLGS
IMSWTARTTLSHLVAIGSLMVRALPVLLLTFLVFFNSPVWLMAGVVTRPR
MWLAILLLSLIAAAFVVAVTVDRFKPVLAAPDATAGRNEQLADTPFADMP
DPSAPQDLSRAERLNVMFVLAVSQLAHILVVAIVIALIFFVLGLILLSPE
VLAAWTRNGSSDGEVLGMTIPVPQALIHVTMFLGALTFMYVSAKAAGDGE
YRTQFLDPLSDDLRLTLVARGRYRAAIPAR
375142151YP_005002800.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPSDSDDSYPVTMVRAVMAQTSKAYGMDHQFLALPNYLQVGRQSN
375142150YP_005002799.1 proteasome accessory factor PafA2 [Mycobacterium rhodesiae NBB3]MQRIIGTEVEYGISSPSDPTANPILTSTQAVLAYAAAAGIQRAKRTRWDY
EVESPLRDARGFDLSRSAGPPPVVDADEVGAANMILTNGARLYVDHAHPE
YSAPECTDPLDAVIWDKAGERVMEAAARHVASVPGAAKLQLYKNNIDNKG
ASYGSHENYLMSRQTPFSAVIAGLTPFLVSRQVVTGSGRVGIGPSGDEAG
FQLSQRSDYIEVEVGLETTLKRGIINTRDEPHADADKYRRLHVIIGDANL
SETSTYLKLGTTALVLDLIEEGMDLTDLALARPVHAVHVVSRDPSLRATV
ALADGRELTALALQRIYLDRVAKLVDSRDPDPRAADVVQTWANILDLLER
DPMQCAEILDWPAKLRLLEGFRQRENLGWSAPRLHLVDLQYSDVRLDKGL
YNRLVARGSMKRLVTEQQVIDAVDNPPTDTRAYFRGECLRRFGADIAAAS
WDSVIFDLGGDSLVRIPTLEPLRGSKAHVGALLDSVDSAVELVEQLTT
375142149YP_005002798.1 ubiquitin-like protein Pup [Mycobacterium rhodesiae NBB3]MAQEQTKRGGGGGDDDDPTGSAGAGQERREKLAEETDDLLDEIDDVLEEN
AEDFVRAYVQKGGQ
375142148YP_005002797.1 proteasome- beta subunit [Mycobacterium rhodesiae NBB3]MTWPHRDRPTFGSPLPGAPSLPVELSSFSELLRRQAPELLPVNRHAVPTD
APSDSLPHGTTIVALKYPGGVVMAGDRRSTQGNMIAGRDVQKVYITDDYT
VTGIAGTAAIAVEFARLYAVELEHYEKLEGVALTFGGKVNRLATMVRGNL
GAALQGFVALPLLAGFDLHDPNPEAAGRIVSFDAAGGWNYEDEGYQSVGS
GSIFAKSSMKKLYSQVSDADSALRVAVEALYDAADDDSATGGPDLVRGIY
PTAVVIGAEGAEEVPEERIADFARQVIESRSRADTFGSDVAHRFTDARGD
S
375142147YP_005002796.1 proteasome- alpha subunit [Mycobacterium rhodesiae NBB3]MSFPYFISPEQAMRERSELARKGIARGRSVVALAYADGVLFVAENPSRSL
QKVSELYDRVGFAAVGRFNEFDRLRRGGIQFADTRGYAYARRDVTGRQLA
NVYAEALGTIFTEQAKPYEVELCVAEVAHHGETKAPELYRITYDGSINDE
PHFVVMGGATEPIAEKLNENYTENAGLSAAAKVAIEALKAGTNGESRQID
ASTLEVAILDANRPRRAFRRITGSALEALLPEDESTPEPESQ
375142146YP_005002795.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MHASVPPGEQNRALPAADGQNESVWSRSAPVDGFRLAYDRFGATGAPPVV
LLHGWPGNRHDYRHVAPLLTGAADVVVPDLRGFGGSDKHAVAVRHFYSAT
AQAGSVIGLIRELGLSQVVLAGYDVGSRVAQSIARMEPELVSALVLSPPL
PGAGDRVLTARAQSEFWYQAFHQLPLAAQLIDGNPDVVREYLRHFWVHWS
APNFTVLEDDLDRLVADYALPGAFTASIAWHRAGAGMIAQSLSELPPDRA
IKINVPTDVLWPQHDPLFPRDWSDRLNSYFTDVALHFALDAGHFTPLECP
DQFAELILIRARPGDAV
375142145YP_005002794.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MSDAQAWQPDSLHEAAASWQAAATDFHAYVEMAVQGVGAAHDVWTGSAAE
AARADVLAVGRTSDALARAMVLAAVAARDAAGQIASARTAVLDLVSASEA
AGFAVSDDGTVSVHDAPTALLVALSGGDEGLAHELLTLRAQELTTQLVGA
LDRLAAADADAADDIEEAFAEPVSRAAATVPAANSSADFGDMVAGWPVTS
QDRIAEQIAALSPEQRDRLVTDFPRQVGNTDGVPWELRVVANRTNIAQAI
LDEPDPVRTAFYRTLLGEVDDPAGGGRRIDRQIVAFDPARASLVELNGDL
AAARSVAVLVPGMNTTIEGSAADTATARRFVAATGGDVAALTYLGGPFPR
GNLVSGVIDAASPRYALDMAPRLVAFSEDVDRTVDAAAGASVPVTYIGHS
YGGSILGTAEAMGLTADQTLYVAAAGAGVGVEDPGDWHNRNPAVVRFSMT
APGDLIQAVQGIPGGPHGADPDEMEGVIHLATGYYDDGRVMAGWQAHSDV
LNAPSDSWRNILAVITGDRARIRPAG
375142144YP_005002793.1 proteasome accessory factor PafA [Mycobacterium rhodesiae NBB3]MGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLY
LDVGSHPEYATAECDSLVQLVTHDRAGERVLEDLLIDAEQRLADEGIGGD
IYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAG
KVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRR
LHVIVGDSNMCESSTMLKVGTASLVLEMIEAGVAFRDFSLDNPIRAIREV
SHDLTGRRPVRLAGGRQASALDIQREYFARAVEYLQDREPNTQIQQVVDL
WGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKISQLDL
AYHDIKRGRGVFDLLQRKGLAARVTTDEDIEAAVNTPPQTTRAKLRGEFI
YAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVKRLIASM
375142143YP_005002792.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMGSRWQDTGAPRGDDYDTRWQKLAAAGESIHGEADLIESLLRETGGRRVL
DAGCGTGRVAIELAARGFSVVGIDLDEDMLATARAKAPELHWVHADLAEA
SDHLNGEFDVVALPGNVMIFVAVGSEGRVLEQLSSLLAPDGLLVAGFSLQ
PDGLTLEQYDRLAETAGLRKVNRWATWDRQPYDGGNYAVSVHRRLT
375142142YP_005002791.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MAISKVERLMNLVIALLSTRNFITAERIRETVSGYSDNASDEAFSRMFER
DKNELRDLGIPLETGRVSQFDPTEGYRINREAYALPAVELTADEAAAVAV
ATQLWESPELITATQGALLKLRAAGVDVDAPHTDVAIASTAALPSMRGSE
EVLGILLSAIDSGQAVQFSHRPTRSDPYTTRTVEPWGVVTNKGRWYLVGH
DRDRDAIRTFRLSRIGAEVRAIGPRGAVQRPDGTDLRDIVDRAVGEFPSI
GQAKVWVADGRATALRRRATVVGPCTLGGRAGEEIQLDIGMVDRLAREIA
SYGPDAVALEPESLRADVLERLRAQAERTNEVRA
375142141YP_005002790.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MTAISTRLVRLLNMVPYFQANPKITYAKAAADLGVSVKQLRDDLNQLWMC
GLPGYGPGDLIDFEFSGDTIEVTFSAGIDHPLRLTSPEATGVLVALRALA
DVPGVVDPEAARSAIAKIESAAGVVGHGDGMPGAAVDEPAPIESEAAAAV
RAAARDGRALAIEYYSASHDMLSSRIVDPIRVVLVADHSYLEAWCRSAEG
VRLFRFDRIVDAHVLDEVSAPPPPAVQAGPDTSLFDADPSLPSATLRIER
SASWMFDYYPLREIRELADGACEAAMTYASEDWMTRFVLGFGSAVRVLTP
ESLASRVRESAVAALSAYDIAR
375142140YP_005002789.1 twin arginine-targeting protein translocase- TatA/E family [MycobacMGGLQPWHWLIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQSDS
KQDTLSPDAAGRAAPAATPIASERADTAATPAPETAAPPPDQRPA
375142139YP_005002788.1 twin arginine targeting protein translocase subunit TatC [MycobacteMQTPGLFRKLDPRRRRSRVNPDGTMSLIEHLHELRTRMLLSVAAVVVTTI
LGFLWYTHGVFGLPSLGDWLRGPYCSLPPSSRATIAPDGACRLLATAPFD
QFMLRLKVALTAGIVLACPVWLYHLWAFITPGLYKKERRFAVAFVFIGAL
LFITGAILAYVVLSTALGFLLTVGSDVQVTALSGDQYFGFLINLLLVFGF
SFEFPLLIVMLNFVGILPYAKLKTWRRGMIFGLFVFAAFFTPGSDPFSML
ALAMALTVLLEFAIQIARIHDKRKARREALEEVPDEEAAPIGDVEQIDTP
TAVPTSSRFVVDDDAT
375142138YP_005002787.1 superfamily II RNA helicase [Mycobacterium rhodesiae NBB3]MTTPPSGPLLAGFVEQLPFSLDAFQRTACEALENGQGVLVCAPTGAGKTV
VGEFAVHLALAAGRKCFYTTPIKALSNQKHNDLVRRYGAEKIGLLTGDQS
INGDADIVVMTTEVLRNMLYANSPALQGLSHVVMDEVHFLADRMRGAVWE
EVILHLPDDVLLVSLSATVSNAEEFGGWIQTVRGDTTVVVDEHRPVPLWQ
HVMVGKRVFDLFDYRAKGAKRDDRRELLVDPELLRHIAHRQEADRLADWQ
PRGRGRNRSRPSICRGPTRPDVIGTLEREGLLPAITFIFSRVGCDAAVKQ
CLRSSLRLTTNSERARIAEVIDRRCADLPEADLVILDYHEWREGLLRGLA
AHHAGMLPVFRHTVEELFVAGLVKAVFATETLALGINMPARTVVLERLVK
FNGEQHMPLTPGEYTQLTGRAGRRGIDVEGHAVVLWTPDVDPAEVAGLAS
TRTFPLRSSFAPSYNMTINLVHQMGPAQAHKLLESSFAQYQADRSVVGLV
RGIERGERMLGEIAAELGGGPPIRQGAADAPILDYVRLRQQISERERAQS
RASRLQRRKAANDALTALRRGDIITITQGRRGGLAVVLESDRDSDDPRPL
VLTEHRWAGRISSSDYSGASAPLGSMSLPKRVEHRNPRARRDLASALRAA
AAGLDVPSGKRRRSGEPVERDVDPELASLREQMRRHPAHQLPDREEKARL
AERYLRIERDNEQIQHKVAAATNSLARTFDRIVVLLTERGFIDGSDDDPK
VTDDGRLLARIYSESDLLVAESLRSGIWEGLDAAELAAVLSAVLYETRGD
TPTVPGGVDIPTATVRRALNQTRRLWTELRADEQRHRISHSREPDEGFVP
TIYRWASTGDLTTALAAADAGGTGSPLSAGDFVRWCRQVLDLLDQVRNAA
PTPALRSTAKRAINDVRRGVVAVDAG
375142137YP_005002786.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSGPQGSDPTQQWTGAQQPDQPAEQASSEPTNQWQPQQPSSSEPTTAAPQ
WQPPAYDPQQQQPPAYDPQQQQYPQYPQQQQPAYQAPQEYQQPTEYNPQA
YPQQGQYGQQPGYDQSGQYAYGQQPGQYGQPGQYGQPTQYGQQPGQYGQP
GQFGQQPGAEEGSKRSLAVIGGVVGLLAALIIVVVLILGFWKPGFFVTTK
LDIDAAQTGVQRILTDEANGYGAKNVQNVKCNDGQNPTVKKGGTFDCEVS
IDGTKRQVTVTFQDDDGTYEVGRPK
375142136YP_005002785.1 5'-3' exonuclease [Mycobacterium rhodesiae NBB3]MSAPLILLDGASMWFRSYFGVPSSITAPDGRPVNALRGFLDAVATVITRE
RPGRLVVCRDDDWRPQWRVDAIPTYKSHRVVEENPGDEPDVEEVPDDLTP
QVDMIFEILDAFGIATAGAAEFEADDVLGTLAAREKRDPVVVVSGDRDLL
QVVRDEPVPVRVLYLGSGLAKAIKWGPEEVAEKYGVPVDRAGQAYAELAL
LRGDPSDGLPGVPGVGEKTAATLLAQHGSLENILAAAHDPRSKMSKSPRT
KLLAATDYIEKAGPVVRVATDADLNWSTSSDILPLAAEHPRKVVTLAEKY
GVTSSIGRLQRALDDLPNR
375142135YP_005002784.1 lactoylglutathione lyase-like lyase [Mycobacterium rhodesiae NBB3]MPFAVDRIDHVVLNCRDVEQTVHWYARVLGMRREIFGDGRMALVFGNQKL
NVRPTGAPNWATGAVDAPGSLDLCFIADVSADEVGAHLRACDVPILEGPV
AKTGALGPMTSHYCRDPDGNLVEVASYRMPD
375142134YP_005002783.1 Xaa-Pro aminopeptidase [Mycobacterium rhodesiae NBB3]MSAGRFDTDVYAQRLHTAAAAAGAAGLAGLVITPGYDLRYLVGSRAQTFE
RLTALVLPASGEPTVVVPRLELASLKESALTELPVAVRDWVDGDDPYQLV
AEALGGAPVATAVTDAMPALHLLPLADVLGVVPVLATDVLRRLRMIKDAA
EIDALRKAGAAIDRVHARVPEFLVPGRTEAEVAADIAKAIVDEGHSEVAF
IIVGSGPHGADPHHECSDRELRAGDIVVVDIGGPYEPGYNSDSTRTYSIG
DPEPEVARRYAVLQRAQQAAVEAVRPGITAEQVDATARDLLAAEGLADAF
VHRTGHGIGLSVHEEPYIVAGNDLTLEEGMAFSVEPGVYFPGQWGARIED
IVIVTADGALPVNNRPHELVVVPAGPAAAG
375142133YP_005002782.1 PPOX class F420-dependent protein [Mycobacterium rhodesiae NBB3]MSQSSGKATTRLTSDAIAFLTERHLAMLTTLRSDNSPHVVAVGFTFDPKT
HIARVITSRGTQKAVNAEHRGVAVLSQVDGARWLSLEGKAQVNEDPAAVR
DAELRYAQRYRTPRPNPKRVVIEVRIERVLGSSGLLDRAAD
375142132YP_005002781.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MKDTGAPPVVVVFGGRSEIGLEVATRLAPGAVVVLAARRCGDLDAQVAAV
RAAGAAAVAVREFDADALDSHRSVVDSLIADFGPIDTAVLAFGILGDQAR
AEKDPAHAAAVLHTDFVAQVSLLTVLTTRMQDAGSGRVVVFSSIAGTRAR
RANYVYGSAKMGLDGFTAGLTDALHGTGVKVLLVRPGFVVGRMTAGMDPA
PMSSTPQQVADAVVRALRKGRSTVWVPAPMAALAFAFRMTPRFIWRRLPR
375142131YP_005002780.1 precorrin-6y C5-15-methyltransferase subunit CbiE/precorrin-6Y C5-1MIVVVGIGADGMSGLAQASRAELVRATVIYGSRRQLDLLDDSVTAARREW
PTPMLPALRSLLDGTAGDVHVVASGDPLLHGVGNSLIRLYGAAQVVVLPH
VSSVTLACSRVGWAVQDTEIISLVTNEPHTAVRRGGQAIVMSRDASSPVA
LARMLTDTGRGDSEITVLEQLGGPAERRRSATAREWSARPPGDVDALNVI
AVRYLPDERRFSVMPDEAFANDGQITKQPVRAFTLAALAPRAGELLWDVG
AGSGSIAIEWCRSGPGCRAIAFERDEARRKRITENSVAFGAHVEVRAGAP
DAFDDAPPPAAIFIGGGVTQPGLLDACFDRLASGGRLVANAVTVESEAVI
AQWYARHGGELRRFDHQRGEPLGGFTGWRPAMPVTQWSVTRP
375142130YP_005002779.1 precorrin-4 C(11)-methyltransferase [Mycobacterium rhodesiae NBB3]MTVYFIGAGPGAADLITVRGHRLLSRCAVCLYAGSIMPEDLLAVCPPDAK
VVDTGPLTLDAIISEIAQAHAAGLDVARLHSGDPSIYSAVAEQCRRLEAL
GIDFEMVPGVPAFAAAAAVLGRELTVPGVAQTVTLTRVATLSTAMPPGED
LATLSSVGGTLVLHLAAAQIDAIVPQLLAGGYQPETPCAVVAFATWPQQQ
VLRCTLAELAEQMNAAGITRTAVIFVGDVLAAEGFTDSYLYSAGRARRER
H
375142129YP_005002778.1 precorrin-6x reductase [Mycobacterium rhodesiae NBB3]MRILLLGGTSEARALAAQLHPDIDVISSLAGRVPDPALPVGQVRIGGFGG
ADGLRDWLRGAGVDAVVDATHPFAATITSTAATVCRDLGVPHLVLVRPAW
PPGDAIVVQSDQQAADAVAEHEFSRVFLTTGRTGTAIFKDSGAWFLIRAV
TAPDPQDLPRRHQILLSRGPYRYDAELGLLREHHIDALVTKNSGGAMTRP
KLDAAAALGVAVVMVDRPPLPPDVDTVATVEDAASWLSGRSR
375142128YP_005002777.1 putative aminoglycoside phosphotransferase [Mycobacterium rhodesiaeMGIPRGPEDVTATWLGSVLDADVSAVDVTAIGTGQTGATYRVSATYSTPQ
PELPNSFAVKLSAQDDAVRERVALGYRSEVEFYTLIADRMRIPVPKNFYC
EISDDGADVVLLLGDMAPAVQGDQIAGCSEEEAGLAVEALAGLHGPSWCD
PEWMGLAAIVMPKPGDDDAAKGLGDVSTMAADIVIDRLGARIAPEDQETL
VAAMSSVTAWLRAEPKRFALMHGDYRLDNMLFDPDRTRITVVDWQTVGIG
LPGRDLAYFTGTSLEPELRADVERSLVERYHRALLGYGVTDYDAETCWRD
YRLGAVQVPLLVALGTAFASTTDRGDDMMLAMLRRGCVAIRELDTLELID
SYR
375142127YP_005002776.1 precorrin-2 C(20)-methyltransferase [Mycobacterium rhodesiae NBB3]MTDGSGTLWGVGLGPGDPELVTVKAARVINDADVVAYHSARHGKSIARGI
AAPYLRAGQIEEHLVYPVTTETTNHPGGYAGAMEDFYRESADRIAEHLDA
GRDVALLAEGDPLFYSSYMHMHTRLTERFHAVIVPGVTSVSAASAATGTP
LVQGDEVLTILPGTLPVDELTRRLADTDAAVILKLGRSYPAVREALSAAG
RLDETFYVERASTQAERVLPAGGVDETSVPYFSLAMLPGTPRPEATTGSV
AVVGLGPGDVDWMTPQSRRELASATDLIGYGPYLDRVGTRDGQRRHPSDN
TDEPARARLACTLAEQGRSVAVVSSGDPGVFAMATAVLEEAKQWPGVEVR
VIPAMTAAQAVASRVGAPLGHDYAVISLSDRLKPWEVIAARLTAAATADL
VLAIYNPASKSRTWQVGAMRDLLLEHRDPGTPVVIGRDVSGPAEEVKVVR
LADLDQADVDMRTLLIVGSSQTQWYLSDTGDTVFTPRRYPT
375142126YP_005002775.1 precorrin isomerase [Mycobacterium rhodesiae NBB3]MLDYIRDAAEIYRQSFVTIRAEADLSRFPEDVARVVVRLIHTCGQIDVAD
HVAFSDDVVAKTHAALAAGAPVLCDSSMVAAGITTSRLPAGNEVVSLVAD
GRAPELADRLGTTRSAAGVELWADRLGGAVVAIGNAPTALFRLLELIDEG
APVPAAVLGGPVGFVGSAQSKQELIERPRGMSYLVVQGRRGGSAMAAAAV
NSIAQERE
375142125YP_005002774.1 precorrin-3B synthase [Mycobacterium rhodesiae NBB3]MARIRDQDACPGALQVHQAADGALARVRLPGGMITAPQLESVAMAATRWA
SPAMELTSRGNIQIRAVTDTSAVAQALAASGLLPSDTHERVRNIVASPLS
GRVGRFADIRAMVAELDDAIQAQPALAGLPGRFLFSIDDGRGDVSGLAAD
AGIQVVGEAAALLLAGRDTGLRFPPSEAVSALITVAVRFAEIRGTCWRIR
ELDDAGPLLAGFAATTEPGATWESSTRGPIGWIEQNDGRVTLGAAIPLGV
LNARVGEYLAAINAPMVITPWRSVLVFDLDEEVADVALRVLAPMGLVFDE
NSPWLSISACTGSPGCERSAADVRADATALIDEPAAGHRHFVGCERACGS
PVVGDVLVATGDGYRLRDAHP
375142124YP_005002773.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIDLTATDRPTFQTTVAPAALPDRVPSPDGTTLITEQQVLFSTAAALQPA
KVGHWATAMKTVTDTMSVLFTESRPPAQRYVARRYAYLENAVMGREMYRL
375142123YP_005002772.1 putative taurine catabolism dioxygenase [Mycobacterium rhodesiae NBMALRVVKLSANIGARIDGIDLTQDYDPASVSKINAALLEHKVIFFRGQDR
LDDGGQLALAAKLGTPTTAHPTVTSRGAKLLPIDSRYDKANAWHTDVTFV
DRIPKASLLRAISLPEYGGTTTWANTETAYELLPEPLRALADNLWAVHTN
AFDYSREVDRRLESLADTEREYRDEFVSDYYETEHPVVRVHPETGKRVLL
LGQFVKHFVGLGSTESTTLFGLLQARITKLENTIRWSWQPGDLAIWDNRA
TQHYAVSDYDNQYRRLNRVTLAGDIPVDVHGERSRPVAGDASAYSDVVDP
VRLAS
375142122YP_005002771.1 proline/glycine betaine ABC transporter permease [Mycobacterium rhoMQALWEYMAAHHSQLLFDSYQHVSAVVQSVLIATIIGVAVGVLTYRNSLA
SNLATATSSVILTVPAFALLGLLIPLFGLGVVPSVAALVLYSLLPIIRNT
IVGLGAIDPALTDAARGLGMGRLATLGRVELRLVWPSILSAMRISTQMSM
GVLAIAAYVKGPGLGNLIFAGLARVGSPTALPMALTGTLLIVILALLLDG
ILVLVGRLTTSKGIR
375142121YP_005002770.1 proline/glycine betaine ABC transporter ATPase [Mycobacterium rhodeMTSLSESATSQPSSGAQIVLDHVSKVYPGSKEPAVDDTSLDIPAGEIVIF
VGPSGCGKTTMMRMINRLSEPTSGRILIGDKDALSIKPTELRRSIGYAIQ
QAGLFPHMTIRQNVGLVPGLLRWDRKKIADRVDELLDLVGLEPGQYAERY
PRQLSGGQQQRVGVARALAADPPVLLMDEPFGAVDPITRSTLQDELLRLQ
SELRKTIVFVTHDFGEAVKLGDRIAVLGQRSKVLQYDTPQAILASPADDT
VAGFVGSGASLRQLSLVRVKDVELRAHPSVHRNDSLESVRNVLANSDYDW
VVVVDERDRPVNWVRERNLRHAQTLADAFEPLDVLSTQSTLEDALEAILA
EQHASAVVSGPGSKYAGVVTLDTLIDTITRLRTEAESPDGDES
375142120YP_005002769.1 proline/glycine betaine ABC transporter permease [Mycobacterium rhoMTAAVDSAAPKVTGAERLRLLIQPALVLVVGAVVVYWAFDRDLTATQQEN
INAGNVATLIWQHLLITFAVTAIVLAVGIPLGILVTRPGAKVLRPFIVGV
ANIGQAAPAIGLLVLLFLWTAKTGFWIGVLPIALYSLLPVLASTILGLDQ
VDRSLMDAGRGQGMARSALLLRVELPLAIPYILAGLRTSLVIAVGTATLS
FLVNAGGLGILIDTGYKLQDNVTLILGSVLAVCLALLVDWFGGLAEHFLN
PRGLR
375142119YP_005002768.1 glycine betaine/choline ABC transporter substrate-binding protein [MRRALAVLVATMCALTMTACGLGSGGTVPFMVGPGSIRPDAALEGVKITV
GSKEYTEQVIMGYILEYTLAAAGADVRDLTGIVGSRSTREAQLRGQVDVA
YEFTGNAWINYLGHEKPIPDSREQYEAVRDEDLQRNGVVWLPPGPMDDTY
ALAASKKVVERTGVRTLSQYADLVRTNPAAAKTCVDTEFRARQDGYPGMA
AAYGFDPARAQTPILQVGIIYQATADGNQCDFGEVFTTDGRIAALDLVVL
EDDKQFFAHYNPSVTMKRQFFDAHPEIAEVTAPVTAALTNDAIIEMNKQV
DVEGRDPAVVARDWMVAEGFVTAE
375142118YP_005002767.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMSRQRALRVAIIGAGMSGICMAIKLLDGGIDDFVIYESADDVGGTWRDNT
YPGLSCDVPSRFYSYSFRPNPDWSRFMSPGPEIHRYFRQVADERGVTPHI
RFGSEVTAARFEDKRWWVSTPDGEEAFDVLITATGVLRVPRYPQIEGLDT
FAGPQFHSSRWDHSITLPDKRIGLIGTGSTGVQITAELGGKVRGLTIFQR
SPQWVYPTPNLRYRAITRAALARWPALNKLGYRFWQTYIENTLGRAAVEA
GLNRRLMALSCRLNLRMSVRDPELRRKLTPDYHAMCKRLILAGHYYRSIQ
QPGVHLVTEAIDHVEPRGVVTADGVLHELDVLVLATGFDARAYVRPMSIV
NDSGVTLDEVWEAGPHAYRSVAVPSFPNLFMLMGPHSPIGNQSLVLIAEN
QADYAMWWINKIRNGEIIAASPTDAATKDYNEQMKSAMPQTIWVTGCKSW
YLGKDGLPELFPWRPVRHRELLATPDVSHFEVRTA
375142117YP_005002766.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFEIIVFAGVVALVAGALGLGYPESTYHRWNRH
375142116YP_005002765.1 cobaltochelatase subunit CobN [Mycobacterium rhodesiae NBB3]MTPPTRSPTVLLLSTSDTDLITARATGAEYRWANPSRLVEDELPEIVRDA
DVVVVRILGGYRAWQDGIDLLEGCGVPTVVVSGEQSPDAELMGHSTTPTG
VALQAHVYLAQGGVENLRQLHAFLCDTLLMTGFGFAPPATTPNWGVLERP
TADNGGPTVAVLYYRAQHLAGNTGYVEALCDALEAAGGRPLPVFCASLRT
ADSALLELLGTADALVTTVLAAGGSTPAAVSAGGNDDTWNVAHLAALDIP
ILQGLCLTSSRSQWQDNDDGLSPLDVATQVAVPEFDGRIITVPFSFKEID
DEGLISYVADPERCARVAGLAVRHARLRSIAASEKRVALVFSAYPTKHAR
IGNAVGLDTPASAVALLRAMRDHGYRIGEIPGVDAGDGDALMHALIERGG
QDADWLTDGDLAGNPIRVSAKEYREWFATLPAELTDPMVQHWGPPPGELF
VDRSSDPDGEIVVAAMQAGNVVLIVQPPRGFGENPVAIYHDPDLPPSHHY
LAAYRWLDAAFGADAVVHLGKHGNLEWLPGKTLGMSAACGTDAALGDLPL
IYPFLVNDPGEGTQAKRRAHATLVDHLIPPMARAESYGDISRLEQLLDEH
ANIAALDPGKLPAIRQQIWTLMRAAKMDHDLGLTDRPDEDSFDDMLLHVD
GWLCEIKDVQIRDGLHILGEKPTGESEIDLVLAILRARQLFGGEQSVPGL
RQALGLAEDGHDERAAVDAAEAQARELVVALADSGWDSTAVDSLTDNADV
AAILRFAATEVVPRLAGTADEIPQILRALDGRFIPAGPSGSPLRGLVNVL
PTGRNFYSVDPKAVPSRLAWETGVAMADSLLERYREDHGDWPRSVGLSVW
GTSAMRTSGDDIAEVLALLGVRPVWDDASRRVVNLEPIGLEELGRPRIDV
TVRISGFFRDAFPHVVTMLDDAVQLVAGLDESAEDNYVRAHSQADLAEHG
NQRRSTTRIFGSKPGTYGAGLLQLIDSRNWRDDADLAEVYTAWGGFAYGR
GLDGRPAADDMNQNYRRITVAAKNTDTREHDIADSDDYFQYHGGMVATVR
ALTGKAPAAYIGDNTRPDAVRTRTLSEETTRVFRARVVNPRWINAMRRHG
YKGAFEMAATVDYLFGYDATAHVMADWMYERLSAEYVLDDENRKFMAESN
PWALHGMAERLLEAAGRGMWAQPDQATLDGLKQVLLETEGELEG
375142115YP_005002764.1 PPOX class F420-dependent protein- Rv2061 family [Mycobacterium rhoMAATFADIAKSEYVLLTTFTKDGRPKPTAVWAPPDGDRLLVITQEKSWKV
KRIRNTPRVTLAECDRSGNPKGEAVEAVATILDKSANAATYDLIGQRYGL
LGKTFNLFSKLRGGMTNNVTIELKPA
375142114YP_005002763.1 PPOX class F420-dependent protein- Rv2061 family [Mycobacterium rhoMADTFEDVARSKYMILTTFTKDGRPKPTTVWGVYDDGKLLISTDDGSWKT
KRINNTPRVTIQRAYAIGNKPKGEPVEAVARNLPKSDNRRVFDMVTKKYW
WHAWWWIPQAIVRGGIDKVHSAIEVKPA
375142113YP_005002762.1 dienelactone hydrolase-like enzyme [Mycobacterium rhodesiae NBB3]MTTVDIDTPEGRIDALLSVPDGQGPWPGVVVVHDAFGYGPDNEATSARIA
AAGFVAITPNMYSRGGRARCITRVLRELLSQRGRALDDILAARDHVLSMP
QCNGSVGLIGFCMGGQFALVLAPKGFGASAPFYGTPLPRHLADTLDGACP
IVASFGRRDPLGVGAPARLRKVVEEKGITADIKVYPDVGHSFANKLPGQP
LMRITGFGYDDAATDDAYARVFAFFNEHLAAR
375142112YP_005002761.1 protein affecting phage T7 exclusion by the F plasmid [MycobacteriuMAMRLFVLYVVIELAVVVALTSTIGFGWTVLLLLGTFLLGMALAGSQVKR
HIRRLRSGLNAGTVQGAAADSVLVALGTVLVAIPGLASSVVGALLLIPPT
RAAARPLVTAMAARRVPLITVASAARYPAPRGDYIDGEVVDVTDFEPLAV
ERKPD
375142111YP_005002760.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTTLLINGRVHSPAMPDASAMAVRDGVVAWLGRDDVGRAQFPDAQIVDLD
GAFVAPAFVDSHVHLTATGLTLTGLDLRPATSLAHCLQLLDEYARTHPGP
VWGHGWDESGWPEQTPPSTADLDGIAEDRSVYLARVDVHSAAASSTLRRL
TPGLAEAYGYSAEQPLTADAHHRARAAAREGLTPKQRRDARLAALDAAAA
FGIVSVHECAGPDIGGLTDWDEVRSVEHGVEVVGYWGEAVSSADQARELM
ARTGARGLAGDLFVDGALGSRTAWLHQPYNDAAGCRGNTYLDIDAITAHV
RACTEARITAGFHVIGDAAVHAVVGALERVVDEFGAPAVARCGHRLEHLE
MVTDTQAHQLGTWGVVASMQPNFDALWGGEHGMYAQRLGLDRSRSLNPFA
LLASQGVPLAFGSDSPVTSLNPWATVRAATQHRTPGSALSARAAFAAATR
GAWRAAGVRDGETGTLVPGAPASYAVWEADEFEVSAPADAVQRWSTDQRS
RVPALPRLDGALPRCRQTVHRGAVIHG
375142110YP_005002759.1 apolipoprotein N-acyltransferase [Mycobacterium rhodesiae NBB3]MADEVPPSVVHDADHKTEEPQGSSPVGPSRAKRFGHAVVDRLPQLSVAIL
AGVALCLSFPPFGWWYLAFVAFALLAWPLTRESTTVAGGFGYGLLFGLAF
YLPLLPWISGLVGEVPWIALSALEALFPALFGALAVVVRRLPGWPLWFAG
LWAAQEWLKSTVPFGGFPWGVVAFGQTDGPLLSMVQVGGAPLLSFAVVLV
GFSLAALTLEIVKWWRVGDTRTAAPPPVVVPGACIALVLLLTALTWPQVR
HSAVGADDEQPITVAAVQGNVPRLGLEFNAQRRAVLDNHVRETLRLAEDV
RAGRAPRPMFVIWPENSSDIDPLANPDAKAEISAAAAAIDAPILVGSVVA
APGATADNPSSTNSVIVWNPETGPADRHDKQIVQPFGEYLPWRSFFRHLS
SYADRAGYFVPGSGNGVVHAAGVPVGVATCWEVIFDRAPREAVRSGAQLL
TVPSNNATFDEAMSEQQLAFARLRAVEHDRYVVVAGTTGISAVISPDGRE
IARTSFFEPAYLDTQVRLKTQLTAATRWAPLVEGLLVAIGVGAVIAAILH
NGSFVRRLRTTTKDRGAT
375142109YP_005002758.1 glycosyl transferase family protein [Mycobacterium rhodesiae NBB3]MTTGPGPGERPSQRTLVIIPTYNERENLPLIVGRVQYACPDVHILVVDDG
SPDGTGELANELALADPDRIHVMHRSAKGGLGAAYLAGFEWGLGRGYSVL
VEMDADGSHPPEQLHRLLDCIDGGADLVIGSRYVTGGETKNWPRRRQALS
RTANGYARVVLGVDIHDITAGYRAYRREVLEKIDLSAVDSKGYCFQIDLT
WRTINNGFVVVEVPITFTEREFGQSKMSGSNIREALFKVAEWGFRGRMDR
ARGVGVSR
375142108YP_005002757.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEI
PHAWLCRNGMEGTLIEGDAPEPKKTKPPRTHWDMLLERRSVDELEELLKE
RLDIIKARRRG
375142107YP_005002756.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVRRLRSQPCRWCGREVADAGLGRRRQYCRQSCRQRAYEQRSIVKGTSLS
PDAVVLTADEAAELADRVYQVRCAAEDVATAVEEGAEGTELRQLCDALMR
AAKAADGWR
375142106YP_005002755.1 DNA-binding protein [Mycobacterium rhodesiae NBB3]MGPAVTLSTPESSASTGVWRFEDFVLDTHRYELRSGGDVIRVEPQVFDVL
TQLVSNSHRFVSKEELFDSVWGGRFVSEAALTSRIKAVRRALGDDGESQR
FIRTVRGRGYQFVGTLIAEPPSAPPPLPAAVPEEPPPPRQHIAFCRAADG
VRLAYAVAGDGPPLVRAANWMTHLGYDIESPVWKHWVRDLSDKHRFIRYD
ERGCGLSDWEATDFTFEDWVADLESVVEALGLERFPLLGVSQGGAVAVAY
AARHPERVSRLVLCSAYARGRAVRASGDDEKRAAALDLELARVGWGRDDP
AFRQVFAAQFLPDGTRADWAAFDQLQRRTTSPENAVRFLEEFGRIDVREL
ARDVACPTLIMHSRDDHRVPLRFGEELASLIPDSRLVALSSNNHLLTAGE
PAWQVFRAEIDAFLAV
375142105YP_005002754.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNKLTRTLLVGISAFVALGTLAACSGGSSNQATSSSASPTTTTAAPTAFP
QSARYIADMTAADGKTMTIGISVDGDQVAAYACNGTDDEAWFFGNQTDGS
IDIKSRFRDTLQADFDGTNVDGDLNMNGVAYEFTAKPVTGAAGMYTAELD
GARASWVVREDGSAVGVQINGAVLDAVDVQQLNDAQFRAQVRNKRQLQQA
AQITRLSNGAMSSTINGTDVTPTLVNGSFRLG
375142104YP_005002753.1 nitrate/sulfonate/bicarbonate ABC transporter permease [MycobacteriMTSPVELAAPIAPVRAANTGWRQRKWALIRLASPIVLVALWQLGSALGLI
SQDVLPAPSLIVEAGLEVLENGQLVDALRVSGIRVVEGLLLGGMVGVALG
TAVGLSRWVEATVDPPMQMVRALPHLGLIPLFILWFGIGETPKVLLVALG
VSFPLYLNTFSAIRQVDPKLFETAQVLGFSFWQRFRAIIVPSAAPQVLVG
LRQSLAIAWLTLIVAEQINADKGIGFLINNARDFLRIDIIIFGLIVYALL
GIGTDAIVRALERRALRYRT
375142103YP_005002752.1 nitrate/sulfonate/bicarbonate ABC transporter ATPase [MycobacteriumMTLAPPRATHIAGELRDVNKWYGDHHVLTDVSVRVDRGEIVALIGRSGSG
KSTVLRVLAGLSTDHTGHRCVEGAPALAFQEPRLFPWRNVRTNVVYGLTR
NRLPKAQAQQRADRALADVGLADRADAWPLTLSGGQAQRVSLARALVAEP
TLLLLDEPFGALDALTRLSMRTLLLDLWREHGFGVLLVTHDVDEAVALAD
RVVVLEDGEVIHTLDIPDPRQATNADHYRAELLDQLGVRN
375142102YP_005002751.1 ABC transporter- substrate-binding protein- aliphatic sulfonates faMRKLAAVVALSTLLLAGCVSRQDSSGPSEAPATVSLSELSDLTLNVGDQK
GGTEALLRAAGALDDLPYKIAFSTFTSGPPQIEAATAGKIDFAITGNTPP
IFGAASNAKVKIVSAYDGGGFGDQILVHTDSPIQAVGELRGKKVAVAKGS
SAHGNVLAQLQRAGLSPSDVELVFLQPADALGAFTQRRVDVWAVWDPYTA
QAETDLPVRSIARATGVTNGAGFGVASDTALADPKRNTAVSDLLVRYAKA
VRWAHDNREKWAKAYGEEVGLAPEVATLAQGRSLRLPTDLSDQLVASEQE
LADLFAESKQISAAPEFTNWVDTRYSETLAPFYIKRDQE
375142101YP_005002750.1 F420-dependent methylene-tetrahydromethanopterin reductase [MycobacMSAPAQPESPSPTAKFFWFLPTNGDSRSIVGASHASSHHTVPANYRAPSR
RYLAEVARAADRLGYEGVLTPTGTWCEDAWLTASALLAETERLKFLVAFR
PGLVPPTLAAQQTATLQRFSEGRVLLNIVSGGDDVEQRRFGDWLGHDERY
ERTGEFLHIVNTLWRQDSLDFEGKHYTVKDARVSAAPDPLPQIYFGGSSP
AALPIAAEYVDVYLTWGEPPQAAAAKIEQVRKLAEERGRKVRFGIRLHTI
SRDTSAAAWAVADELLAELSPEQIAKQTELHSKSESEGQRRMTALHGGRV
DSLEIYPNLWAGVGLVRGGAGTALVGSHEEVANLIYEYHSVGFDEFILSG
YPHLEEAYWFAEGVLPLLRNKGVA
375142100YP_005002749.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MSPDALVERFCAEAPCRPLRYYLRMNADKRVCGRRLANDQADLVVEVFRM
LADATRVQLLWALADREMSVNDLAAQVGKPPPSVSQHLAKLRMAHLVRTR
REGTQVFYRLENDHVRQLVTDAVHNAEHATGGVPAHHLEERELRVLHEKG
VG
375142099YP_005002748.1 cation diffusion facilitator family transporter [Mycobacterium rhodMGVGHSHNHSDRVDDALRDSAAGIRAVKISLVVLGVTALAQVAIVVLSGS
VALFADTVHNFSDALTAVPLWIAFAMSRRAATRRYTYGFGRVEDMAGLFV
VTAIAISALVAAVEAVRRLIDPVPPSHLSLVIAAGIVGFIGNEVVAVYRI
RVGRQIGSAALRADGMHARADGLTSLAVVAGAVGVGLGFPIADPIVGLLI
AGAIGIVLIVAARDVFGRLLDRIDPELVDVAHTVLSGRPGVRGVRRLRMR
WVGHRLEADAELDVDASMTLSDAHAVAHDAEHELTHAIPKIGSVVVHAYP
AHEPLLSS
375142098YP_005002747.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRVAWLISILLLVAGCSSSTDGEAERITPIPPNSSRPSSSTTTPSTKAPT
KPPDPGAPVAEVTAWIEAGKTVDAAQYHVAMREGVTTDLGEDVAFVTPSG
KTNCMTDSKYSGGALACLVELTDPPPRPAAAYGEWKGGWVDFDGTTVDVG
SVHGDPGRFTAGTGPQLPYGQAIGFGDYQCRVDPVGLYCANRAHNTAVRF
SDAGIEPFGCLQRVTAPPDIGEKFSC
375142097YP_005002746.1 carboxylesterase type B [Mycobacterium rhodesiae NBB3]MHEHTVRATIASGTIEGFTRDGVNRWRAIPYAKPPVGQLRLRAPQPVQAW
PGVRYCHGVGYCAPQQRMYTLLAPGRYQPMSEDCLTLNVVAPSSPPDTSL
PVMVFIHGGGYFMGSSATPIYDGAALARNGCVYVSVNYRLGALGCLDLSS
LSNQEHTFDDNLYLRDLVMALRWVRENIAVFGGDPDNVTIFGESAGAHAV
ATLLAVPAAKGLFAQAISESPAAGMVRTSEIAAEYATIFAELLGAGPGEG
ATALMTARPTELVTAFERLIVEGQREMLGAFAAGPTSGSEYLPRDPVEAM
RDGHAHQVPLIVGTNAEEARLFGRFLKLLPMTEPMIERLLSATEPAERER
ITAAYPGYPDPAACIQFGGDFAFGSAAWQIAEAHSRHAPVYLYRYDYAPR
TLRWSGLGATHATELLAVFDVYRTTFGKLLTAAADRKVALRVSDDVQSRW
RAFARTGVPGEGWPAYENPERAVKVFDRKPRVEFDPHASRREVWEGFTLA
GR
375142096YP_005002745.1 putative aminoglycoside phosphotransferase [Mycobacterium rhodesiaeMHTTDVIERPSDLTAAWLSAALGTTVTDFTFERIGTGQMSECYRVELTRP
SGDPGPSSVVLKVAATDQASRQTGLALGLYEREVRFYTDVAPTIGGGPVA
ACYSAGFAPDTGAFHLLLSDAAPAVVGDELRGATIEEAKLALAELARLHA
PAFGDASMAQADWLNREAPMNQGLIATLYAGFLDRYAGQIAPEHRAVCEQ
LVGCFDAYLEAEGSSDRIMGLVHGDYRLDNMLFGQPGADRPLTVVDWQTV
TWGPAMTDVAYFIGCALPSELRRDNYDALLRAYHEALGTGAAISLDEVRD
GVRRQSFFGVMMAIVSSMLVAQTERGDEMFMTMLARHADHVLDTGALDTL
PEPVAPQPLTPHPADEEAHTAGDEPLWSESWYFDFADPQQEIGGWVRLGL
MPNENTTWVNALLCGPDMPTVALLDFENTGAIELTLEAAEPLQTYRVTVR
GSGQAYDDPSELLHGQPGRPVEATMRLVWKTVGVPYQYRITPRYEIPCTV
SGSVTVDGHEYTFDGVPGQRDHSWGVRDWWSMDWVWSALHLDDGTHVHGV
DIRIPGAPPIGIGYTQRAGEALVELQGVTAEASFADNGLPVSTTITYNPG
DLVATVNIRGHAPVLLTSPDGRISHFPRAWARVATADGRTGVGWVEWNRN
QTT
375142095YP_005002744.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MMVLKSVALFVLAALLEIGGAWLVWQGVREQRGLAWIGAGVIALGAYGFV
AAFQPDPHFGRVLAAYGGVFIAGSLLWGMVADGFRPDRWDFIGAVVALVG
VGIIMYSPR
375142094YP_005002743.1 transposase- IS30 family [Mycobacterium rhodesiae NBB3]MGFRGQGQQAPASARLAFFEAVNAGSSWAAAATVAGVARDTGDRWARAAG
YQAQTRHFGTRYSAQAREAFWAAMRAGASVTQAALGAGVSEIAGRRWVKQ
AGYVPRTTVPIAAAEVLTVVDGSARCRPALTFTERCRLEMLLENGYTAAQ
LVDLLGRHQDTISREIARGQTASGYRARVGQDVADANRKRPKVRKLVRNP
ALLAEVLQGLQQRCSPEQIAGRLRLDFPDDSEMWVSHETIYQGLYVQLRG
ELTKDLKSALRTGRIKRKPHGRNQIAERRRFKEGMVSITERPAEADDRAI
PGHWEGDLIMGSANASAIGTLVERTTGFVLLLHLPVDHTAETVAAAMTAK
IVEIPEILRRSLTWDQGTEMAQHSAITKATGLPIYFCDPHSPWQRATNEN
TNGLLRQYFPKGTDLSFWGPGFLDQVATELNGRPRKRHGFRTPAEELHRL
LSNPSAYAAATA
375142093YP_005002742.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDRHPKLARRFFDRLEPVHAVTYFAPEARAALDGLGFRGFWMGYFAARSA
PFGVVPTQVVTATFYNFAPHRVAKALPAAWDIASPADALRVREQSAVEAL
RRYGVGADDDVAIAADLAAKAARSAALDGRPLFAANLALRWPDEPVAKLW
HAVTLLREQRGDGHVAVLTSLGISGRESNVLHAAAGKVPKEFIMRSRDYD
DDQWAIYRDRLIGRGLLDKHDALTAAGHDLKQRIENTTDALALGALDALD
DDEVETLFRSLTPITRKVVSAGDVPAATPMGLSRDDLDDDSAGLAG
375142092YP_005002741.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MASQPNVGALHGSLLAALGAAIVSGQYPEGQVITLDGVSAHHKVSRSVVR
EAVRVLESMGMVETRRRVGITVQPAHKWNVFDPRLIRWRLESGDRTAQLL
SLSELRRGFEPAAAALAARRADPHQCRIMAAAVSDMVVHGRSGDLDAYLL
ADKIFHQTMLEASGNEMFRALNGVVAEVLAGRTHHGMMPDTPNPAAIELH
DEVARAIRMRDEAAAEQAMRAIIDEAASAVTEEFAPSDQL
375142091YP_005002740.1 thermoresistant glucokinase family carbohydrate kinase [MycobacteriMASPIVAMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIAKMTAGEP
LDDDDRYPWLESIGEWLAQRCDSGGVMSCSALKRKYRDQLRRHCPDVEFL
HLSGTPEVIAKRQASRPGHFMPASLLASQFDTLEPLADDEHGTTIDVDQS
IDSIVENYVSQTDTRVTEQENR
375142090YP_005002739.1 gluconate transporter [Mycobacterium rhodesiae NBB3]MNNAITILAADTELAEPVAAGWQLIVAALAGIAIIVVLITVAKLHPFLAL
IFGAITVGIVAQGWNNLADVFDSFADGFGTTAAGVGILIALGAMFAKLLA
DSGGADEIVDTIVGHASPRALPWAMALVGAIIGLPMFFEIGLVLLMPVIY
LVAKRSQLSLITVGIPALAGLSAMHGLVPPHPGPLTAIDLLGADLGITLA
LGVAVAIPTIIVAGPLFGRLAGKWVVLDVPDRFDADDFSHDRAGATSQAS
VEGDTATTVKTATRQRPSFGMTMFSVLLPVALMMGKALVDIFIDDEANPV
RQTFDILGRPLVALLIAVIVGIFTLGRGAAMARDQIVKCIESSLPPVAGI
ILIVAAGGGFKQVLVDTGIGTMLADWAKTTGVSTILLAWVLAVLIRLATG
SATVATITASSLMLGLVEGMSTGEVSLIVLAVGAGSLFFSHVNDAGFWLV
KEYFGMSVGQTIKSWSMMETVLSVVGLVLVLLLGIFI
375142089YP_005002738.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTNPQYGEQAAYPPVGGQQPGGLLVRWLARIIDGILVAIVSYALIFATDT
LSNYWVTGLFTGVLTFVYFLAFEQLMGSTPGKKLLGLSVRGPAGAPKPTV
AQSAVRNSWTLLPIIPFIGGLLGVVAIIVIAVTINGSPTKQGKHDELAGG
TQVVKG
375142088YP_005002737.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLIRRVARPMLSAAFIARGVDALRAPKPAADAARPTLEGLSKLPDPVGTN
IPSNAETVARINAGVQIGGGLLLATGKLPRLASAALALSVVPGSLGAHAF
WSESDPQQKAEERRAFLTDISLIGGLIIAAVDTEGKPSLGWRGRRAAHKV
SEAVSAALPVGAATGGALADSELAEKVGHGLHAGAERGREFANVARERAP
ELAELARKRGAEIADVARERGPELAGLARRTGAEIADVARERGPGLAELA
RKRGVEIVDVTRDRGWEWADAARERAPELAETARNRAADLADTARTKGRE
QVKQTRKQLKQERKRLSS
375142087YP_005002736.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGQWSVASEQCEPAGSWDEDRNETEAQRLDRNWSSLLQELRVAQTGVQLL
TGFLLILPFQPRFAGLDFVMRMVYLVTVGCSLGATVLLVAPVSMHRVLFR
RHRLETLVAVSHRYAVVGIMLLGTALSGVAVVIFDSVIGRAGAWIAGGCT
LVALIAFWYALPLRDRHWRDTTY
375142086YP_005002735.1 D-xylulose kinase [Mycobacterium rhodesiae NBB3]MVLVAGIDSSTQSCKVLICDADTGEVVRSAASPHPAGTEIEPDQWWSALQ
TTLKNAGGLDEVAAVSVGAQQHGMVCLDSAGEVVREALLWNDTRSSAAAD
ALVAELGAREWAKRVGVVPVAAITAAKLRWLADHEPAHADATAAVCLPHD
WLTWRLSGSTDIADLRTDRSDASGTGYFSAETGTYQLDVLDLAMRGRRPE
VPTVLDPSQEAGRTSTGAVLGPGAGDNAGAALGLGAQPGDCIVSLGTSGV
VSAVSDVAPHDPDGIVAGFADATGRQLPLVCTLNGAPVLAAVAKLLDVDF
DELDRLAISAQAGAEGLTMVPYFEGERSPNLPDAAGALHGVTIRNLNAAN
IARAAVEGLISSMAYCIERITAHGVSVNRIILVGGGARSAAVRTIAPALW
GAPVHVPAPAEYVALGAARQAAWALSRDNSPPEWSIGATSTYEADPTPQV
LEQYRAAQSLTLGQ
375142085YP_005002734.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MNFTWEPLADGISRCRLPFLDVTIGLVWSSAGALLVDTGTTRTEASAVRA
DAEDLAGREISHVVLTHHHFDHVLGASTFDGAAVYCAPAVAATVTEKAGR
LRADAVRYGANPREVDDAIAALRPPQHPTTSEVIDLGERVIILGHPGRGH
TDHDLIAVVEGAERTVVFCGDLVEESNDPSIDAESDTTAWPATLDQLLSA
GGADAVYVPGHGASVDARFVRRQQQWLAVH
375142084YP_005002733.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MIMNDCVVDTRRLQLLLSLSRLGSMRAVADAHRLTTSTVSQQIAALAREV
GAQLIEPDGRRVRLTPAGLRLADHAVTILAAIDSARLDLDPGAEPSGTVR
VGGFATGIRVSLLPIVAELAKQYPDVRLRISEYEPIEAFALLTADDLDLA
LTYDYNLAPASPGQVLQTEALWSITWGLGVPASFPDGPAEIAAYAQQNWI
VNSRNTADETAVRTLASLAGFVPRIAHEIDSLDLVEDLIVAGFGVGLLPI
GRPTGRGVKVLPLSKPDAVLTAYAVTRRGRADWPPLRAVLDRMRPARGAG
LPRPQWPRPEADS
375142083YP_005002732.1 putative permease- DMT superfamily [Mycobacterium rhodesiae NBB3]MVTNQARTGAFMALGSMLCVQTGLAIAVTLIDRIGVEGAAWLRLAWAGIL
LLLIVRPKRSAFTRTSFTMCVVLGVVTAAITLLFMAALDRIPLGTASALE
FLGPLGVAVAHGRGRQRFVWPGLAAVGVVLLTQPWAGVIDPVGVMFALAA
AVCWATYILLTQRVGDQVAGINGLAVSMPVAGLVATITVGPAVFGRMTPE
ILLIGIGLAILLPVVPFALELLALRRLTAAAFGTLMALEPAFAMIIGLVV
LHQVPWIGGVVGICFVVAAGIGAARSGARAEPPVPAEVNA
375142082YP_005002731.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRNMASGVFGTPIFGIVNKMFVALIDAPVIGPVVRRGIINVRYVGRRSGR
TIETPVGYRRTADGVLINVMSPDNKTWWRNFLGDGGDITLLKYDGTDRTG
HAVAHRDAHGRVSVKVAL
375142081YP_005002730.1 ABC-type spermidine/putrescine transport system- permease componentMTLAAMESATSPKPAKTVRGTPRWGDLLLRAVAGLVLLYLFLPIFVIILF
SFNKPAGKFNYSWQGFTLDNWADPFKYPALTEALLLSLEVAAVSTAIALI
LGTLVAIALVRQRWRGQKAVDTFLILPLTAPEVVMGAALLTLFLDFGWAA
GYTTILIAHVAFEVSFIAMTVRARVRGFDWTLEDASMDLGASPLRTFFKV
TLPLIIPGIVAAAMLSFALSLDDFIITYFVSGSTVTYPLYVNAAVKAAVP
PQINVLATAILVISLILLAAGTLLRRKRFEG
375142080YP_005002729.1 ABC-type spermidine/putrescine transport system- permease componentMAGVATSGRQRSKIAPYLMVLPALVYLGIFFVVPFFTLAKTSLSTSGGSV
YLPTLTFAWDFANYAEAFSEYREQIIRSFTYSLAATVLCVLLAFPLAYVI
AFKAGRFKNLILGLVILPFFVTFLIRTIAWKTILADEGWLVGALGSIGLL
PDEGRLLSTSWAVIGGLTYNWIIFMILPLYVSLEKIDPRLIEASKDLYSS
NTRSFTKVILPLSMPGVLAGSMLVFIPAVGDFINADYLGSTQTTMIGNVI
QKQFLVVKDYPAAAALSLVLMVIILVGVLLYTRALGTEDLV
375142079YP_005002728.1 spermidine/putrescine-binding periplasmic protein [Mycobacterium rhMPSKNIDLELAARMAASRTSRRRFIGGGAAAAAALALGPSFLAACSKDGG
GSGETSAQPGGPASGTLRVSNWPLYMADGFVAAFQTATGVTVDYKEDFND
NEQWFAKNKEPLSRKQDIGADLVVPTEFMGARVHSLGWLNEISEAGVPNR
KNLRKDLLDSKVDPGRKYLAPYMSGLVGLAFNKAATGRDITKIEDLWDPA
FKGRVSLLSDTQDGLGMIMLSQGNSPQDPSEESVKKAVDLVREQNDKGQI
RRFTGNDYADDLASGNVAIAQAYSGDVVQLQADNPDLQFIVPESGGTTFI
DTMVIPYTTKNQSAAEAWINYIYDRANYAKLVAFTQFVPVLSDMTEELRK
VDPAAADNPLINPPQSTLDNVKSWPALTDEQTQDFNTMYAAVTGG
375142078YP_005002727.1 spermidine/putrescine ABC transporter ATP-binding subunit [MycobactMTGSHTTAVDHQAGQHGSDRAKGGPVIEIDHVTKRFADYVAVSEADFSIA
AGEFFSLLGPSGCGKTTTLRMIAGFESPTEGAIRLEGVDVSRVPPHKRNV
NTVFQHYALFPHMSVWDNVAFGPRSRKIEKALGKGAVRKRVDELLEIVRL
TDFAERRPAQLSGGQQQRVALARALVNYPSALLLDEPLGALDLKLRHAMQ
FELKRIQREVGITFIYVTHDQEEALTMSDRIAVMNAGNVDQIGSPTEIYD
RPATVFVANFIGQANLWAGRQTGRTNRDFVEVEVLGTTLKARPGDTAIEP
GGHATLMVRPERVRVSIDAPTGGVATVAATVKDLTFQGPVVRLQLAAPDD
STIVAHVGPEQDLPMLRPGDAVHVSWAPDASLVLPAADIPTAEDLEEMLD
DS
375142077YP_005002726.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMATVDVSVSSDLPPERAWELASDLRRFDEWLTIFGGWRSGVPTEVEVGTS
VSSAIKVKGFRNVIHWRVTRYDEPKTIELVGHGKPAVCIALRLCVKEIPS
PSGDDTAGSEFQVIADLTGGLLNTRIGNLVAKVLESDVRKSVTNLAALG
375142076YP_005002725.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMVETDANRSTASGAGPRSSLLVAGLSVVVLTVAVLQTAVVPVLGIIADQL
HASDVGVSWAVTANLLAALAATPLIGRLADLHSKKPVLLSVLVVVLIGSL
LAATTTSLPLLIVGRVLQAASYALYPVGIAILRDELPPERLMSAMAVLSG
TLGFGGGSGLVVVGLLMSGDAGYHRVFWLTTAFTAVVIVIAVVVVPRRPR
STTGTIDWIGALGIATGLSAVLLSLTQGQSWGWTSPATLACAVGGVAVLV
GWWIWERRAKHPLVSTDMLKRRPILLTNLATVFVGMGLYFAFLGLIQFVQ
IPREVAGYGFGATVLEASVVFLLPGVAVGFLIALFSGRFIDRFGARPVLL
IAAVAGIVGFLLVAFVHSQAWHVIVAGILANAYISLGYGALPALVVSEVD
AGETGVATSMNAIARTIGSSTSAALVAVLLSRLVTGTDVPMESSFFVIFI
GGAATAVLAMVLIAFSRAGAPPQESVEARYESRAMNHEWG
375142075YP_005002724.1 purine-cytosine permease-like transporter [Mycobacterium rhodesiae MPDKGAKSALTEPTFTGHRPVRAGDLSVETHGIAPIGEDQRYGTPGRLFT
VWFAPQVNVAGVFSGTLAIVLGLGFWLGMLAMVIGTVLGAAIVGYLSTWG
PRTGTGQLPNSRMAFGGAVVVPGVLQWLSSIAWTALVGLFGGQALAALLG
IPFWAAVLIALGLQGAVGFFGYELIHRVQAVLSVVLFVTFVVFAVKLVGG
HQIVTPALVSGADLAGAFVLEVTIAFSLAVSWASYAADFSRYLPVHSSRG
RVFGFTVAGLVLSYTFVQSIGIAAADVIGEHTAEGVRAVMGGGVLGALAL
VIITVASIGSGVMNDYSGSLALQTIGVKVRRPVSAVIVTAVAFGLILWLN
AADTATRFLDVLLLVSYWVPAFAAIVVIDWALRIRGRASINPAQEPTDGR
DAAVAVIVFVVAYAAAIPFMNTSMLQGPIAVAWHGADIAYFVNLLVAAVL
YGGYRFVRRRGASG
375142074YP_005002723.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MKHLELHGDRVAYQDEGSGPQTLVLIHGMAGSSQTWRAVIPQLSRRYRVI
APDLLGHGQSAKPRGDYSLGAFAVWLRDLLDELEVSRATIIGQSLGGGVA
MQFVYQHPDFCDRLILISSGGLGPDVGWTLRLLSAPGAELLLPVIAPRPV
LSAGNKVRSWFTTAGIQSPRGAEMWSAYSSLSDAETRQAFLRTLRSVVDH
RGQAVSAMNRLHLTSDMPTMVIWGDQDRIIPVEHGYAVHEARPGSRLEVL
AGVGHFPHVERPSEVVDLIDDFINTSGQPDAPRLRTNR
375142073YP_005002722.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAYGPSHWGALTVFVAGALAVMWLGRRQSARQARRFGRVVGVITAAIYAA
AFVNALFPPDVRWSVPLHLTDLATMVTAYAMWSQRQWAYVLTYYWGLALS
VQALISPVLTGPDFPNYQFLGFWAIHLLVVWAAIYLTWGRRMRPGWRSYR
FVVVVTVTWVVVTMTFNTIAGSNYGFLNAKPTTPSLLDVMGPWPWYVLVG
AVLVAGVWAAMTWPWERLRRIEGEGP
375142072YP_005002721.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTAPEGLPVNHHADHPGFSGVTGAIVGLVLLWMGRANARLAADVTGVSAG
DRVIDIGCGPGGAAREAARRGASVVGVDPAPVMLRLARTFTRDASTSWVE
GTAENVPLADGSATVLWSLATVHHWQNIGRGLSEARRLLSPGGRLLAVER
RTEPGASGLASHGWTEQQAESFAAQCRTAGFENVAVGQHGQGRRPVWTVL
ASRR
375142071YP_005002720.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MARATKDDADEEERQRFADRALGFLEDVIYWAIAVVLIIGSIALLIAQFN
TMLGLRNAGAKIVMLEVLDGLLLIFIFVELLYAVRSCLRSREIVAEPFLI
VGILACIKEIVVLSVEAATLLKDGPQFSRAVVEVGVLGVVVLVLALAAFV
LRERRRDVGDPAEQDVRQAEEDQEKATSR
375142070YP_005002719.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATEPAHFARTEDGGFMPTRFALSHWGDDHLNGPAVVGLAAQVLESQCGS
AEFMPARLTVDLFRAARLASTVVDVRVVRDGRRVRGAECDVIQDGRAVAR
ATLIQYRRSSAPPGRQWIAPMPHPSPPPPDDQVVPFVGSDAGWTRTPGDH
QNDSRKRFYNRGINVVAGEKVSPFVRAAMIAEATSLVTNLGTDGIGYING
DLTVALSRLPVDEWICIQGDSHLACDGIAVGTATLFDHHGAFGSGVTTAV
ANPAAQIDFSTQSFDRRGLNYE
375142069YP_005002718.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAERVALWGRDIDESSADLDDGYVAPGQHEPITEPVAMVDGGDEPIGDVE
AGPDSLHVRPAIDRRLGSASSTLTFKPAPTPWYRTGRGLVVLMGAIGVVV
VLSVVPMLLRDSAPGLDEPTDAPPTTAVLAPSSVQPRSDSNAPTLTSRPA
PPPPPAPPPPPPAQETPVYVPRYQAPSSEAARPEIDVTRAPISVAPKPVT
PIDPPRTGGGGNDNRRGFGW
375142068YP_005002717.1 DNA-binding domain-containing protein [Mycobacterium rhodesiae NBB3MTSRPVDEQRLRDLRLLRKVRDRIDRNYAQPLNVEALARGVNMSVGHLSR
QFKNAYGESPYSYLMTRRIERAMALLRRGDMSVTDVCFAVGFQSLGTFST
RFSELVGLPPSAYRDQTAGATAGLPHCVEKQVTRPIRNREAAAVTLHLT
375142067YP_005002716.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDITINSSMLPHDDPEASLAFYRDTLGFEVRLDVGQGTMRWITVGPPNQP
DTNVVLYPPSATPGLTDDERRLIAEMMAKGTYAQINLATKDLDATFERVQ
AGDVEIVQEPTEQPYGVRDCALRDPAGNMVRIQELS
375142066YP_005002715.1 Excinuclease ATPase subunit [Mycobacterium rhodesiae NBB3]MGHPADTHDLIRVHGARENNLKDVDVELPKRRLTVFTGVSGSGKSSLVFD
TIAAESQRLINETYSAFVQGFMPTLARPEVDVLEGLTTAIIVDQQRMGAD
PRSTVGTATDAGAMLRILFSRLGKPHIGSPQAFSFNVASISGAGAVTLEK
GGRTVKERRDFNIVGGMCARCEGRGSINDIDLTALYDDGKSLNEGALTIP
GFSMEGWYGRIFNGCGFFDPNKPINKFTKKELDALLYKEATKLKIDGVNL
TYLGLIPQIKKSFLSKDVEAMQPHIRAFVERAVTFTTCPDCDGTRLSDTA
RSSKIKGRSIADVCAMQISDLAEWIGGVTDKAVAPLVASLKHTLDSFVEI
GLGYLSLDRPAGTLSGGEAQRVKMIRHLGSALTDVTYVFDEPTVGLHPHD
IARMNDLLLQLRDKGNTVLVVEHKPEVIAIADHIVDLGPGAGGNGGQVVF
EGTIAGLRKSRTVTGRHLDDRAALKSSVRSPSDALEVRKASTHNLQNVDV
DIPLGVLCVITGVAGSGKSSLIGGSVAGRDGVVLIDQAPIRGSRRSNPAT
YTGLLDPIRKAFAKANGVKPALFSANSEGACPACNGAGVIFTELGVMATV
ESPCEECEGKRFQASVLEYTFGGRNIAEVLAMSVADALEFFGAGDAATPA
AHKILERLADVGLGYLSLGQPLTTLSGGERQRLKLASQLGDSDIYVLDEP
TSGLHLADVEQLLGLLDRLVDSGKSVLVIEHHQGVMAHADWIIDLGPGAG
HDGGRVVFEGTPAELVAKRCTVTGEHLAEYVNA
375142065YP_005002714.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMLFRGKMPGVEFDVEALRQKYARERERRLRSDGIEQYVEISGAFAGFAND
PWSDPDFTRAPLFDEVDVAIIGAGFGGLLTGARLRELGVQSVRLIDKAAD
VGGTWYWNRYPGIACDVESYVYMPLLEELGYVPTEKYAKGPEILAHCKSI
AEHYDLYRDICLQTEVHEIRWDAEALRWIIATNHGDAIRARFVAMANGYL
QKPKLPGIEGIMTFKGHTFHTSRWDYDYTGPDLERLADKRVGIIGTGATA
IQCVPHLATAAKELLVFQRTPSTVDVRGNRPTDPAWSESLRNGWQSHRVE
NFQLLTAGGEAEEDLVDDAWTSIVKKLFVMRQTRVEGMSDEERLRAVELA
DFAKMEEIRARVDSIVSDPATAEALKPWYGYFCKRPCFHDDYLQSFNRDN
VTLVDTKGKGVERITSGGVVADGTEYRIDCLIFATGFEVGTDHSRRTGFE
IVGRDELTLTDKWRDGVQTLHGLAVHGFPNCFILSIAQSGFTVNFPYLLD
VQARHTAEVIAWALSHDATEVEATVEAETNWVDTVIARSAASADRAKSCT
PGYYNREGQANAKTRQGSFFFGAPTEYAEILEASRAQGTPEGFRIRTGIP
R
375142064YP_005002713.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMRRRYLAGRLRALTRRGASPRVAIIGAGFGGLGAAVALRRRGIDDLVIIE
RSDGVGGTWRQNTYPGAACDIQSHLYSFSFAPNRNWTRTYAYQPEILSYL
ESVADQFDLRRHLMLGTSVQRLVWNEADTRWDIELADGRTLVADVVVSAV
GLFGAPRYPDIEGIDEFTGHLMHTSQWDAGIDLAGKRVAVVGTGASGVQV
VPELAGTAAQLTVFQRTPPWMVPKEDRPYSIDELSRFRRIPWAALRERWR
LWKLQHDNTALTPDHPRMAVVQELSENFLRQHVEDEAMRDALTPRYPFRC
KRVLLGEKYYLALQRPHVELVTYPIERVTESAVLTTSGRVVDVDVLVMAT
GFETSNYLSGLEVVGLSGESLHDRWGLDPQAYLGVAVSGFPNFFMLYGPN
TNQGANSIIYVLEAGARMVASAVSRLAGRGGYLDVRPDVESGFNTQIAAD
LERTIWTQCDSYYRSPTGRIVTQWPHSELDYARATWRIRSREWVHRTT
375142063YP_005002712.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAAQAAAETAQAAAREAAETAQTAAGAALRIPPASIQLAAQLPDLIENL
AIATERLNTAIDRAERYLALADPMIRTMDAVLPQLEALVKTGNEVYGAVS
SLPGVSTLSRLASRGQAPADEKPPRGRSAPKKTGRG
375142062YP_005002711.1 Kef-type K+ transport system NAD-binding protein [Mycobacterium rhoMPGYLYDFADNKGPRVTVVAIYLVITFGLGGVAMALRLPPLVGFLAAGFV
INALDVEDVPQLDVLADLGVTLLLFAIGLKLNVRILLRREVWLTTSVHMI
GSVVLGTVTMWVAAVAGVSMLSGQSVQTIALLAFALSFSSTVFAVKVLEE
RGESHALYGRIAIGILVMQDIVAVVFLTATSGHLPSPWALTLVGLWPLTR
LIRRIWTQLGHGEMQSLFGIVMALVPGYALFSAVGLKGDLGALIIGVLLA
SHPASSELSRSLFHIKELLLVGFFVSIGLTGLPDLPTIGVALLMMLFLPF
KAGWYVLLLSRMRLRYRTAFLAGLSLMNYSEFGLIVVSVGVSAGLLNQAW
LVEMSIAVALSFVLSALVNGRGHLMVEKIAARLPTQDEETLTSEERPGDA
GDAEVVVIGMGRVGFAAYQRLTNHYGLRVVGVDFDGPRIERLAADGLRVI
KGDATDLDFWHRLRHSESVEIAVLAMPRHGANVTALACLRESGFSGKVAA
VARYDDEVQWAKEHGVDIAFNVYAGAGLELADQVGDDEAPGSPVHSADDG
GS
375142061YP_005002710.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRIVPSLLYVAIALATITACGEDDGMDRSATSVSNGPGVWQPPVSTTWQW
QLASLPIDTSLNAAAYDVDLFTTTDTELATLRADGRKVICYFSAGSWEAL
RPDAAEFPAAANGNPLDPPFQDELWLDIRNPEVRTVMRRRLDLAATRGCD
AVEPDNVDGYRNDTGFDLTAADQLDYNRFIAAEAHSRGLSVGLKNDVDQL
TELEPYFDWALNEECFTYNECAQYRDNFLAANKAVFHAEYVNGNRLGEVC
AVTERLGLSTLIKNIELDAFALSCP
375142060YP_005002709.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLLDVQEFEPLTAAERKLVEAVARSAACDFFGVNGLPVRDNLASPGDGHI
RATVLRALLSGRDNPWGVDAHAPVDIRGAVITGRLGGLHGAELPQLRLQS
CRFDDDVDFSGAIFSSEARIVSSSFEKFATFTESIFAGGARFDGTAFTKD
ARFDGAIFSGKAQFDGVSFSGDAWFDGATFTTDATFERATFSGEACFKHA
VARDISFMRAVFAQPDPGPWIAATVSLEKAQLMVRGRISITATAVNASRL
HAREGAYLALHCDRVDLSASELLRGSIFTSSPPMEVMPSGTTPSTVEYPV
GSTARAATAAATEFRNDLAGELSALQSRCRLTSLARADIRGLVISDVALD
DCEFALAHGLDELRIGAGCSFQHTNGLWHRRPMIRRIVIAEELVWRRHHQ
GRRDKTSSAGFVPAPEIASIYRDLRKGMEDAKNEPGAADFYYGEMEMRRL
VARKPTGLADAVQLPSSRVERAVLYMYWMASGYSSRTSRALIALALVILS
AALLYTAPGFATVTTPPAQIASIDPTSGAVTYTSPPPPVGPTFSTALDYA
ARESVSLLEGPPTLPITTKWPGDLLNAVLRLAGPVLLAFAIFALRSRTKR
375142059YP_005002708.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MKRPERLYALVDLLRGSRRPLSAARLSEEFEVSKRTIERDIQSLQLAGVP
IYADHGVSGGYSILREHSLPPLNLTVPESLAVLAGLGLLETSPYGAAARR
ARAKVLAISSEDQLAPVDEALASMFIIDAQPPTEAAISLIPEAIAARRVV
RIDYTSEDGQTHTTRDVEAMGLLRGGDSWMFVGWCRLREGIRGFHLDRIR
HLEITSEVFPERDPAVLDADLSRWRTRRLG
375142058YP_005002707.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNKNMHMVNTDPVAADAALAVWLEMWNTDNEIARRICSDDFRIHFLISDA
DGSNPGDDVLGAESFARFLDRYREQHPDVVFTEFTRAVDGAHGRILWNMQ
DGDVSAGGIDVFDFTVDGLIREVWSVNGTRAHVT
375142057YP_005002706.1 putative F420-dependent oxidoreductase- MSMEG_2906 family [MycobactMTRPVRVAVQIQPGGTPDYRTWRDAVLAADDLGVDVIFGYDHFHRPAMET
IIDGKPVMFDEQPDVSNFEGWTALASWGEITSHAEIGLLVTGVGYRNPDL
LADMARTVDHISGGRLILGLGAGWYEKDYTTYGYDFGTFGSRFDLFDESL
IRIEKRLTALIPPPVRKIPILIGGTGPKRSLPAVARHADIWHAFQDLDAF
RRLSDRVDELAATFGRNGADIERSTLWENAESGDAFREAGVTLFQTELTS
DNGYDLTTLKQVVTWRDNG
375142056YP_005002705.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGQRLTVIVGFTVLNAALGIVGQSPSHVTSFGYLERRL
375142055YP_005002704.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMSNDAKVTVERTVPASAEALFEVLSNPERHQALDGSGFIRSVDHADRIQK
VGDVFTMNMQGDHMGGEYKTDNHVTGYAKDKLLAWKTAPAGTEPPGWEWL
WELEPHGPDETLVRHTYDWSKVTDKKLLEKVKFPLVTEDQLSDTLGRLAA
EVSS
375142054YP_005002703.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTYPNQSSAPPPVYVAAPPTNGMAIAALILVFFFFPLGIVFGHVARGQIK
RTGEGGRGLATAALIIGYLQVALTVAVVGVAAVLVALGAR
375142053YP_005002702.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKIIEFCPFFNERKVAELKVKEASYWIDELHFCEADKTFSYEGKPSNFDM
ALLGPKVKYHELKASGCFDSPYADVSYYDIDTCGAKNFDEWYWQLISKNF
AYHNEAVQRNHCTLLRDAVNDDDIVILSDVDEFLDSRMADRIVDLVKRHQ
IITVRLHFSAFYLNLFCDDNHGAVDFSYRLYVMTGRYFRKMPFTSDYLRK
KGIAEGLGRTVHCPMEFMGFHHSWLQYETNAFEKQRAFDANVADKAIVRR
REFAEECIRDMRLPYLDANLYVANDKPFLRSVLESDTQGLWFGHAQ
375142052YP_005002701.1 amino acid adenylation enzyme/thioester reductase family protein [MMTETDEFPLTPPQQRLWFIHRLNPQSTAYNAPVVRTLRGRVDPARLEHAL
LQLVQRHEQLRAAFAMRSTEPVQMIREVPSVELVFVENMVPKDVSTKITE
FIQPFALEHAPLLRAALFHVLDELESSYVLVLDIHHIICDFSSEEILARD
LFRLYHDLPLPELDCSYLAHAQKQTESASAAVQRATDEEFWLSKLSGELP
ILQLPVDHRRPAVFDFYGTIRHFSMGRDRTKALRAYSALHGVPLQDIALT
AVFVLLAKYSLQEDLIVGTPHEVRSCDDVGDVVGMFMNTLSIRANVHPDN
TSRTLLAEISDDVREARQHASYDVRYLVEKLKPQRDPSRNALYDVLFFHQ
LQESQIYDGLQVTPRQFIHEKAEVDLTFGLVEIDDRLSFSIEFATSLFRP
SSIERMAKHYGAVLDALVGSPDDQVVDIDILSDDEHARVASFSGRASPYP
WKTIHGLFEEQVDRSPDHPALRYRSETLSYAELDARANRVANMLRARGAK
AGDVIALFAHPSPDMVAGSLGILKAGCAYLPITPNLPTTRTAYMLDSSKA
RFLLVQQPSTGFADIEIIELGLADLFPADRPHCECVPSALACVLFTSGST
GKPKGTLARHFNVVRTVINTNYLAIQASDHVLQMSSPTFDVSMLEIFGAV
LNGATSVVVDSGSRGDLSRIATLLDTEHISVAFMTPALFNAIVDERLSAL
KGLRKILIGGDRASADHMRKALAQLGPGKLMNVYGPTEATIFTTYYPVDD
VPEDATNIPIGYPLSNTKILILNGRSPVPVNVAGELCIAGDGVVAGYLDK
DLTSQRFVNIGGDRFYRTGDIAKWREDGAIEYVGRLDRQVKIRGQRIEPE
EIEAVLQAHPGVKEAAVIVRANERGDKSLQAFCTCAADNSTTPDELTAHI
GRHLPRYMIPASLATIEAMPLDANGKIDRHRLQSTVLPATEDDAEHPPVT
AVEKIIAATLRELLGVSVVNVYRSIFDYEAHSLTAAILSSRLEDALNVPF
PLRDIFEHPTIASLAAHLSGVSGSTSDRYRHRSPILRNPRRAHYPLSFSE
RMVYAHQHATAGNHCYHNIFPMLIEGPLEIEKLEQAFRTVVRRHEAFRSK
FVVRDGIPVKSVVDRVDFHLQLMQGTESDVPAVVSRLRQPYDLTKPPLVR
ACLLTVGEERHVLIVANHHIVSDGVTESMFMREIGLCYRGESLEPCSLQY
SDYTLWQQRELEVGHYREEEQHWLAQLRGPLPVLELPLDHPRPSETDFNG
RTLTIGLDTQQTSGLRRLAAAHHTTLFTLLFAAYAVLLHKYSGQDDLIVG
IPVANRTHADLASVAGMFVNMVPLRTQPVPGQSFSEYIEAVKEVAVSAFE
HQSYPFERMVQAVKGERDPSRNPLFDTIFAFQSTGPVVLDIEGLHSELYP
LPDAAAKVDLTLEAFQFSNQIQLSFTYATALFRESTIARMAESFTRLISD
MVRDPRKRLRELRWLSADSVDPGIAVVQSYPRDKSLYGLFEECVRRFPQR
VAVRFRGESLTYAQLHARAESMAVRLRELGVRPGEPVALMTARSVEMVVG
ILAILRAGATYVPIDPEYPPERVQSILQNSGSSICLTVDMIRARQGAVVD
TSVLSPVGVPVGPAYIMYTSGSTGVPKGIAVAHHSVTRTVMNTNYVTVEP
EDNVLQLVNYAFDGSVFDIFGALLNGATLVVPEQDDITDPDRLAAIINNA
GASIVLMTTALFNAYIDHDPMIFAPLRKVLFGGERASVWHVKKALTHLGP
GKLVHAYGPTEATSITSAHGVNVVVDDVVPIGKPLSNTRLYVLDGDRQPV
AVGVVGELYIGGDGVGMGYWGDARLTCQRFVPDPWVAGAVMYRSGDMVKW
LDTGDLVYVGRVDEQIKLRGFRIEPGEIEARLLEHPAVGQCAVIVKGDRL
VAFYTSDEPVDDTLLKTHLRTTLPYYMVPDRFEHTDRLPLTNNGKIDRQT
LATYSARSTTRQPHTPPETSMEQLLVTLWCKVFERDVVGIDDNFYALGGH
SMKALEIISLLQASGHTLSASDLFRHPTIREVAHAVRPLSPRADTSIQSS
PDEGFALSAVQHRFFQRDLVDRGIFNSPFLIMLNEYVDPAIVEDAVLRTV
QSHRILTARFEEFSGGWRQYYQSPVARRCFTRVDLAGVTPVDHVAAISAR
CAALQHDFDLSEGHLYRVLLFENYQHRNRQVLFFLFHHLVFDRTSWEVFL
EEFRRHCVNEPIPPNRSISYSEWCLRLQRYADEGSFTDAARFWQTMVRRG
EPFLPDTLQSPFALQSEMLHYTTRPLHGPEFISGLDGAMETYQANAFHLV
LAAFGEACRDLQPRTSLPLYVMSAQRESFLADADITRSVGFFAGAYPLRI
DLSADGIIRETVENVKHALFASPREGLDYFMVRYMPSLRERYDGLDHPYP
LLFHFINDRDRTGNGFSTPLEVPVGLTHSPHNPSAYLLNVTAVLDSAGLK
LTFYYSRAHFHADTIERLSRSFEQHLQDIVLTDDHSRVRQ
375142051YP_005002700.1 amino acid adenylation enzyme/thioester reductase family protein [MMCYNGSTINDVDISSDMIGGNTPKVLAPLYDDRMGQIHRLELDLSLYPRD
KSLYGLFEECVRRFPQRVAVRFRDESLTYAQLHARAESMGVRLRELGVRP
GEPVALMTARSVEMVVGILAILRAGATYVPIDQGHPPARTQSILRDSGAR
VCLTVAMIRARQGAVVDTSVLSPVGVPVGPAYIMYTSGSTGVPKGIAVAH
HSVTRTVMNTNYVTVEPEDNVLQLVNYAFDGSVFDIFGALLNGATLVVPE
QDDITDPDRLAAIINNAGASIVLMTTALFNAYIDHDPMIFAPLRKVLFGG
ERASVWHVKKALTHLGPGKLVHVYGPTEATIFSSACSLDEVVDDVVPIGK
PWSNTRLYVLDGDRQPVAVGVVGELYIGGDGVGMGYWGDARLTCQRFVPD
PWVAGAVMYRSGDMVKWLDTGDLVYVGRVDEQIKLRGFRIEPGEIEARLL
EHPAVGQCAVIVKGDRLVAFYTSDEPVDDTLLKTHLRTTLPYYMVPDHFE
HTDQLPLTHNGKIDRHNLTARAAPTSPTQPDIRYQRSSGQDDVVYRLFAE
MLGVPVVGPHDGFSDLGGNSITAMMLASRLKRAGYKVTPRDIMHCQTIDK
LLEETSEHTINLADSSDIDVDVQPETGVLDGDVLRLLDDSIAMNNRIVMG
APVAKEYPLSAMQQMQISFETPGSLAIEPLQRVMNLPALRRAYGNLIARH
GLLRSVPVKSGGIRVWREYGYGGEETPQIPVIKVAEHLGDELSVQALIEK
LTTRSFKGEGILHQLVVAVVDKDTYFLVWVVSHVIFDRVSKEILSRHLIR
HYDAVLQGQVLPAEARSFEDYVRQLARGPQGVETHDIVRAFRLHEFYEAK
QQAKHLVKATGSRSSTNFNIVVPLESSWQIEHPWETALVVHVKGLRQYLQ
IDELPILFVTEGREFENQRYYDTVGELTDMIPLFVDARLSPTEITRSVLD
RLEFVKQHNIAFLHLAAEGATHAQWAEITSLVDIGSDFEHLDILMFNILG
YADDLTAESIVEASWVQPQPLPIQTLLNAITGVHSDKLVCSFRTSCAVDV
TRIRDCFKHAATELA
375142050YP_005002699.1 putative acyltransferase [Mycobacterium rhodesiae NBB3]MRGSLGEVFDPRQNALNAWRLVLAAGVILRHSWPATGHYLDTPFDPLFTQ
VFVDSFFVLSGFLIVRSWRNNPRLREYAAGRLLRIFPGLWVCVTIIAFVL
APIGAALSGGSLRLSSQIAYVLNNAVLNIFYTGIDGTPKGVPTPGVWNGS
LWTLIFEMVCYIGVAVLGVAGLLRRRWTIPTVFVLAVGASAVVGYADMTV
DLAQIVLRSVVVFSAGALVYQFRDRIPARWWLVAVCAGLVVVLGLLPNYR
VFAALPLAYAVVVSGALLKRPWLRNDLSYGMYIYACPVQQLLAAAGMTWL
DPRLFFAVATVCTVPLAAASWFVVERPAMKLKGRVHRPQSHSVNGSIGGE
QYVVSLDDPIAHGVGSDGEVAVRAKPNARRQTPPP
375142049YP_005002698.1 non-ribosomal peptide synthase/amino acid adenylation enzyme [MycobMTDSGGTYGWALPLTPGQQEIWLSQRTGHSTTEWQLGLFVRIEGTIQQDL
LRRAICQAVAEAEPSRAAFIEVDGQVLQRAVDHPDVELAFHDLRHALDSL
REAEGIASEMRTTPMTFAGPLFKFALFQTRPDEFYLFACCHHIVIDGIGM
ALVSRRIATIYSALVAEKPIPAAYFGSLQDLLSYELDYRSSVDWSEDEAY
WRNNLPSETRTQYPSPRVSSEPDPYAPSAAIQVDPSVVRRINDLSKAFGI
RRISMITAACALVVRGLSGTGAEVVLDFPVSRRISPESKVLAGMLAGVVP
LVLTASPKASVGNFTRHVDRRMRELTRHQRFRVLDLERREGMHELRQTSS
RAVINFIPSRLTLKLGDAPATATYTNLAPVGDLVLLFLGAGDQLFLLTAG
PKATFPDVDASNVVDRLERVLVAMAADSRRRLSSVDVLDEVEHAQLDVVS
NRAVLSGPVGGAVSIPEAFVAEVAAAPEALAITFGSQSMSYGELDGAAER
LAHLLVDCGVGPGERVAVLLPRSPEAVVAILAVLKTGAAYVPIDPGLPDA
RVRFILADAAPVVVLTAVGLIDRLDGDSRAVAIDCLSADAKSSGALPIVD
PDDVAYLIYTSGTTGTPKGVAVTHRNVTGLLASLWQEVGRAGVWSQFHSL
AFDFSVWEVFGALLSGGRLVVVPDEVARAPEDFHALLVSERVTVLSQTPS
AFYALQAVDSASADRGARLSLQMVVLGGEALEPQRLGAWLENHLGAPRLI
NMYGITETTVHASFREIVASDADNARSPIGIPLPGYALFVLDPWLCPVPP
GVVGELYVAGVGVSLGYAGRAGLTASRFVACPFGGAGQRMYRTGDLVRWG
VDGQLDYLGRVDEQVKIRGYRIELGEIQAVLNELDGVEQAVVIAREDRPG
DKRLVGYVTGTADPVTVREALAERLPAYMVPAAIVELDAIPLTVNGKLDK
RALPAPEYQGAQYRAPSTAVEEVLAGIYAQVLGVERVGVDDSFFELGGDS
ILSMQVVARARAAGVLCRPRDVFVEQTVARLASVAKVISGEDTVVDEGIG
AVTATPIIRWLNDFDTPAVSQFNQAVVLQAPVGGTEADVVTLVQALLDRH
AMLRLRVETDDSGNWILSVPTVGAVDARRCVLVANELSDETVAAARTRLD
PAAGIMLSGLWVPSSGQLALIIHHLAVDGVSWRILLEDINIAWIQHHSGQ
PVMLPAPGTSFARWSALLAEYALAPEVTERAEQWQRILAAPAILPSVQPK
VDTRESAGHFSATLNAETTRMLLGKVPAAFHAGVQDILLVAFGLALAEFS
GVDARPIGIAVEGHGRHEELAADVDLSRTVGWFTAIYPVALDVSGLDWSC
VVAGQAELGTVIKNAKEQLRALPDPLTYGLLRSLNADIELAGLDSRIGFN
YLGRLGAAATEASDGVWRISEEGLSLIAATAAIPMPLAHTVELNAGTFDT
DNGPRLHADWTWAPSALNQEQVARLGRLWFEALTGICAHVRSGGGGLTPS
DIAPARLSQRELDELQQRSQIADVLPLTPLQQGLLFHASSVPPSDDTAYA
VQLDITVTGPLDPQRLRAAVQTVVTRHPNLAARFSDQFDEPVQIIPADPV
VPWRYVELYGEDVDVDQQVRLITAAERRAVCDLSDRPVFRTALIQSGHNR
YRFLLTNHHIVLDGWSTPVLLNEIFASYYGQPLTPAVPYRRFVSWLTDRD
LDRARDAWSAVLAGFHTPTLVGPPGRVRLGSREVTSTRIPAQTTRAVTEL
ARSCQTTVNLVLQGAFANVLSWLTRQHDVVFGTVVSVRPAELSGAESLVG
LLINTVPVRATIVETTSPVVLLDQLQRAHAHTLEHQHLALTEIHSMVGHE
QLFDTLFVYENYPVDTSALAGDHDLAITEFTASESNHYPLSVQVQPGDEL
CLRIEYDSEVFDPASVDALIERFEQVLVAMSADPPPPR
375142048YP_005002697.1 EmrB/QacA subfamily drug resistance transporter [Mycobacterium rhodMLLAMGDRAVDPKHQKSMTLTVANHKYPDRLDARLMQIGGVCLLISVMAS
LDATIVAVAQRTFVVEFHSTQAVVGWTVAGYILGLATVTPMTGWAADRFG
TKRLFMGSVLAFSLGSLLCAVAPNILLLIIFRVIQGVGGGILMPLTVIIL
RREAGPTRLGRIIAIAAIPMVLAPLCGPILGGWLIRTYGWEWLFLINLPV
GLAAFLLAAILFPRDRSTSSETFDFVGMVLLSPGVAAFLYGLSEIPARGT
VADPRVWIPMIIGFLLITTFVLHALHCAVHPLIDFRLLTNRAVGVANVGV
FIYVVGGSVALLIPSFFQQLMHHTPLEAGLHMIPAAVGTMLTMPLAGVLM
DKYGPGKIALVGLSVIVTGMGIFTFGIAKQWHYSPNLLLAMVITGMGAGC
ALLPLSASAVQTLAEHQIARGSTLIALTEMFASAVGSALMSVLLTNQLGR
SENISAATTMATLQHQAAETGMRVDPAAIPPPALAPDFMATVQHDLSHAY
TTVFGVAIVLIALTLIPAAFLPRKPASSTRIKAAPPN
375142047YP_005002696.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLSTTNRPTTVSAQSRRMTRTTLTAGVLALAAIPFGAIAVANATYKESD
FASCLERDMPTDYCCEHAGGVMRNGACINPDDLLQSSGGAVLETQPNPPK
KFPPIVNTDLSSGTFVDVQPAPPTRVPSRGAVDGPVLTTSR
375142046YP_005002695.1 beta-lactamase superfamily metal-dependent hydrolase [MycobacteriumMSVDSIALGSAGLDELVPSRYAVQVGDIEVLVISDGVLPITARTMATNAD
PAEYGEWLNDMFLPQDVLDWPLNVVVVRSGAQTILVDAGLGVEFPDFPRA
GQTVHRLEAAGIDPSAVTDVVLTHLHMDHVGGLLTEGLKERLRPDLKVHV
ATREAEFWEAPDFSHTDMPAPVPDALRSIASRFLNEYRGKMRTFETDYEV
APGVLVARNGGHTPGHSIVRLASGGDRLTFAGDSVFAPGFDNPEWHNGFE
HDPDESARVRIQLLRELSATGEALVATHLPFPSVCHVATQGDVFRCVPAA
WDY
375142045YP_005002694.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MGTKPSRSGYLPINGLKLYYEVYGELGTVRPPLLLIPGAFMATDSMQQWV
NAFAETRTVIVFDQQGHGRTQDSPREMSYDQFGDDAAELLRALGVQRADV
MGYSQGGGVALQLAIRHPSLVDKLVSMSATFRVDGWYPSVVEAIGGLSAK
DFAGTPVEAAFKAHTPDADAYATYLEKMKVLNVDDQQISDEQMRSISAKT
MVIVGDADGVTLDHAVAMFKLRGGGDEQAAATGVLQNAPAARLVVLPATS
HIGVAGESAVLVPMVTAFLDDGPPTTPALFESEE
375142044YP_005002693.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRKPFHRRVAAVLSAVGVAALIAQAPAAGADPYTPVQTQDNAEFAIADGY
IVKQMNCTPDSPPVFESITWDPPGFTPQGGTGMIHDANPALGGQFAAKWA
GDYWDVEYQFC
375142043YP_005002692.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Mycobacterium rhodesMSGGCSVTTVNFSRVSSSVVLVAGGALLATTLAACGSDTETSSASSSSTS
TSAADPFSVTQTQRPAAPPTSAAASTCPTTAPADNGTPEWTLPGATGSVA
VTGSTDTTAPNIKVDSPFSVTETQVHTLQAGDGPVVSPTATVSVCYMGVN
GRDGSVFDNSYERGAPEQFPLTGVVTGFQKAIAGQKVGSTVAVAMTSADG
YADGQPAAGIQPGDTLIFAIKILDAAG
375142042YP_005002691.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPDKTDQRPPRTGVGEKATLMEFLDYLRRAMLSNLEGAPEPQVRTPGVPS
GTSVLGLVKHLSHVERFYFLGEDVSDWSATFRPTADDTIDSVAASYAAAV
SHANEIIDVCEDLSQPAPHSARPQPAPAMRWILVHMIEETGRHAGHADIL
REQIDGATGR
375142041YP_005002690.1 serine/threonine protein kinase [Mycobacterium rhodesiae NBB3]MPVEGTPFGRYQLIELLGRGGMGEVWRAYDTQIDRVVALKMLLQNLSDDP
EFEQRFRREVRAAARLDDRHVVPIYDFGEIDGRLYVTMRLIGGTDLHSLL
DNGPLEPPRAVAIIEQIAAALHAAHQTGLVHRDVKPSNILIDENDFAYLI
DFGIARTAEDGVTQTGATIGTWAYMAPERFSSDQTNPSSDIYALACVLYE
CVTGQQPFPGDTFERVASGHIFMPPPRPSEVSRTIPTALDAVIATGLAKQ
PAERYRTAVDMASAAKEVISGSSQANLYRPPPSPPAYSYPHAGITMPAPT
GPPPPKRPRRNQGLLVGALVFFTTLVVVAAVVGVVAFTQRDGSFTSSPSA
SPSGTEFTGTYTADYGPGTDLDDKPVPNAPATTSNWAVRSECGASGCVAT
AANISSSGMALLSNLTFDQIGGTWIAVGLASAQCGGDQPEELWVIFTLQP
HPDGTLSGESVRASTNGACAAKRTVKFTRTGDADSNKVADPAVLPPRVVS
PAEALHGAYRQTTTFTDGKVLPGNVLSTNTYCLRTGDRCMSLMHAPDGVV
TLIFAQDKWTRNEAGTTPCPGGGSAQITITAEYPMPRQLDDPIALLTGRG
KQTVAAGGACAGGGDFTDTFERTGD
375142040YP_005002689.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKWSFAQFGLLIICVFHVVQAVVGFIAEPSFATGPDAPTVQILGMDYNGW
HAVAGLALFAPGLVFAMRKSWSVLYLLVAGVGGALPGVWAFFSKQVAYIF
AFPNNITDAIVHIATGAVMIAVAAIQIRLDGGFRNSMADLRKA
375142039YP_005002688.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKYLVGIMLSLAAGAVASATPAAASEDEFVREMQTRYAFLTDGQLRAEGA
KICSVLGGGTPASDAVGMVREDLGVSISAAGEIVSAAVVQLGC
375142038YP_005002687.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDSKRVKFMLGTAGAGAIIAAGVLSFAIGDVNAAVPQPVPSKSGAGQTVT
ETTAPSEPETSIAMPPITTAPYTNGPGETH
375142037YP_005002686.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKGRPRTSAAWVIGFAVASVAAGTGVAHAQPAPTDPVIPQIPGVVTNLVT
APGPLPVNPPPPPGAPTVPAIPADQLQAPGELGSIGNVLSNPGEVIGTLF
ADPVAPYTPVRQMPMGPPPPPDPAFAPRQ
375142036YP_005002685.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAKVVSVNLAQVRANPAAPSRKTGIDKSPTAEAVMVRAPGSMRSGLGSGL
VGDTIGNKKFHGGDDQAVYAYAREDLDEWESRLGRPLTDGMFGENLTTSG
VEVTHARIGERWHVGTDGLVLEVSAPRTPCRTFSAFLGLDGWMKTFTNAA
KPGAYLRVVSPGTVRADDEISVEHRPDHDVTVNLVFRAKMSEPELLPQLL
AADALSAELKDYARRRLGR
375142035YP_005002684.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPADRAALVVGGIRLASGVSFLVDPLRANKLWGDPGEPAPTALLLLHSMG
YRDALIGGLMIAAAVRGKNTRGWFLASGGADASDLLGGMRVHDDMTRSQQ
LIGLGGAVVGIGVGLWGATRRRPKPAESD
375142034YP_005002683.1 transcriptional regulator containing an amidase domain and an AraC-MRIEIVVFDGFDALDVVAPWEMFARAATIDSGLEVGVVRVDGPALVTAAD
GLQLQVDDELGTPDALFVPGGSWVGGSNNGVRREIRQGTLPRIIAELSTE
VRWVASVCTGALLLGEAGILRDRNATTNPAALEELSRYDAIVRQNRVVDD
GNVVSAGAVTSGLDLALWLIRRELGEPVAGDIARAVAYPMPTDVWQTPGQ
RPN
375142033YP_005002682.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTSTVDAADRVVGLARGMSELVQTQAEESERARTLTQTVVDEMWASGLMT
SFNPVEAGGVEPSFTEMIETWIEMAWQDGSFGWIGIANLPSSFAAAAYLP
DEGFAEVFTAHQNRVTMGGQFFPNGQGHTVDGGFTLSGSWSFGSGTGHSE
YVAAGFFPMDDGEMRWLSEGVPDMRVAVVPREQVTFTDGWHVQGLKGTGS
YDYSVQDLFVPEYRTFALFSREPLRGTSPATRMGLMPVTAAGHASWALGV
AKSMLDDVQTLAATKFRMSDMASLASRQTFQKGLAHHVAAWRAARLLVLE
AFTTAEAAVASGQELTPTLRADMRVAAVYATDVSREAAEWAHLVAGTSSI
REGSRLERAFRDIYTGSQHAFISEKVAMDAAQIWLGIIEDQFGL
375142032YP_005002681.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MSQPRLTIPALLEYSAREFGDQTYLATPTDRLTYREAEQRSADLARWLLA
QGVGKGTRVGLFFPNGAEWVTWWLAVSRVGAVAVPLSTLYAPAEIAKVLR
LADIGLLIAPSEVLTIDVAERLEAALPELAGQQTDRLVLTAAPYLRRIVV
TQSSGRRWATPHDAAAPVVPADILAAVQQEVSPADLAVMVHTSGSTADPK
GVLHTHGTLVRQTSTWPDAIRAVTGSGAHARILCAMPFFWIGGLLATTGA
LHEPVTLLVIPRLDAETALDLVEREQATGIVGWPAFTQRLREHPTFPDRD
LSSAPMLREGPLDIAMTDVPDGFPVHRTMSETAGGFAYTQMRIVDDDQNP
VPAGTVGELLVRGIGVMVGYNKRERSETFDDDGWYHTGDRVYRSDGDPRL
FYVGRTSDLIKAAGANVSPLEVESVIEQFPDVSQCIVVGIDDAVRGEEVC
AVVVPAGSQIDMQSLATRTRDQLSAYKVPTRWVLATSEQIPILASGKLNR
KALRTLVMDGTLSQESLRDDAAQVGRHVRGPHR
375142031YP_005002680.1 cell wall-associated hydrolase- invasion-associated protein [MycobaMRSIYALAISLALLVTTTGLATAQPQPYQQMASQQQAIQTVIARGLAQRG
VPFSYGGGDVTGPTRGSGPATNAAGINPEGRIVGLNPAADVVGFDASGLM
VYAFAGVGVKLPRSSGAQYKVGQKVTAAQALPGDLIFYGPEGKDSVALFI
GNGQMLEVADTGVTVSPVRTANMTPYLSRIIA
375142030YP_005002679.1 putative dehydrogenase [Mycobacterium rhodesiae NBB3]MTARTLQAIADAYDGKNVRREEPMTDRVAVVGGGIVGVAMAREILTRTPD
AQLSLFEKEDHLAAHQTGHNSGVIHAGLYYQPGSNKAVLCRRGVGLLEEF
CAQRGIRRIECGKVLVALNEAERARLGDIEERARANGVPGVRVIGPEELR
ELEPHVRGVAALHSPTTSIVDFTEVTKALAADAVAAGAKMLLGQEIIGFR
STGTEVVVTARTAGGTYQAAFDRVIACGGLQSDRLAELAGDGPDPVIMPF
RGEYYLLKPQRRGLVNGLVYPVPDPRYPFLGVHITPRVDGEVLVGPNAVL
ALAREGYTWRTASKHDLTEVVRTPAFWRFARQHWRTGIRETYGSLSKRRF
IAGARAYIPEISDDDAVPGPAGVRAQALDADGALVDDFRISVRGRIVLLR
NAPSPAATSALAIAEHVVSLI
375142029YP_005002678.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGDPFIGSEALRTGRLSPYALRSRFVAIYPDVYIAKDTEVSAITRAKAAF
LWTGRRGVVAGRSAAALHRAKWVSAGQPAQVLWGNRRAPSGIQAWSHSAA
DDEIALTDGVRVTTPARTALDIACRYPIGEAVAAIDALSRATHLKMSDVE
LLAARYKGRRGIRKAVEVLDLVDPGAGSPRETWLRLLVIRHGFPRPRTQI
QIFDEFGSRVAVPDMGWEDRKLALDYDGEHHRDPVQFNRDIRRHDTLTEL
GWTDIRVTSLDTEAVIIARLTREWTRRT
375142028YP_005002677.1 isocitrate lyase [Mycobacterium rhodesiae NBB3]MAIIEADAAPQTPFEREVADTQQYMDSPRFDGIIRLYTARQVVEQRGTIP
TDYPIAREAAAAFYPRLRELFAQKKSITTFGPYSPGQAVVMKRMGIEGIY
LGGWATSAKGSISEDPGPDLASYPLSQVPDEAAGLVRALLTADRNQQYLR
LKMTEEQRSTAPQYDYRPFIIADADTGHGGDPHVRNLIRRFVESGVPGYH
IEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMRVPGIIVARTD
AEAANLLEGRSDERDQPFLLGVTNLKIPSYKSCFLAMVRQFFNAGVTELN
GHLLYALPDGEYAAADAWLQRHGIAGAVSEAAKEWQDGADDSIDAIFDKV
ESKFVDAWQVDAGLQTYGEAVGDLLDFREREGEPSEMSAADWRTFAATAP
MYSAREKAKELGADVAWDCERAKTPEGYYQIRGGIPYAIAKSLAAAPFAD
ILWMETKTADLADAKQFADAIHAVYPEQMLAYNLSPSFNWDTTGMSDDEM
RAFPEELGKMGFVFNFITYGGHQVDGVACEEFATSLRQEGMLALARLQRK
MRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGEGSTQHQHLVQT
EVPKKLLEEWLALWSDHYQIGEKLRVQLRPRRAGSDVLDLQILGDGEEPL
ANVVVDPIKDRHGRNILTVRDQNTFSEKMRKKRLMDVIHLWLIHRFKPEI
VYYVTPTEDNIYQTEKMKSHGIFSNVYQEVGEIIVADVNQARIDELLASD
REALKRLIAKED
375142027YP_005002676.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MDVLRTPDERFDNLPDYPFPPKYVGVESRKVPTLRMHYVDAGPADGPVVV
LLHGQPTWSFMYRKVVGVLSDAGMRVIAPDNIGYGRSDKLTDATAYTFRR
HVDWMQGLVTGLDLREATLVVQDWGGPIGLSVLAREPDRFARVVATNTIL
HTCDPALAGKLAWAHHGVDDDRVMLQETLLDYVALYQRSPDINPSMFLDA
VAGPLDPDVLAAYDAPFPDRSYKAGLRQMTALIPLTRNDPGAAIGRDTMA
ALRRWERPFLTAYTDGDPPTRGWDNVFREHIPGASGQAHTTITGAGHFVA
EQQGEKLAAIIAEFVGKTT
375142026YP_005002675.1 signal transduction histidine kinase [Mycobacterium rhodesiae NBB3]MMGPIRRLYDFLARVLSLRVIVIVAALSVVALVITLGAWVWFGVTNDQYS
QLDRRLDSVSSLGDISMLLRAAQQAGTDQAQAPDGNLVRTARIDGITVSI
PPEVVLPEFGVGYANTTIDGVEYRVRTFTAGDALIAVGAPLAETQRRIDE
LHRRVLLICGGVIIGTVLVGSVMWSIMINPFRLLAQQARAINAQSNPDEV
QVRGVQEAVEIAEAVEGMLARIGDEQQRTKAALESARDFAAVASHELRTP
LTAMRTNLEVLSTLELRDDQRQEVIADVMRTQTRIEATLTALERLAQGEL
TTVDDFVPVDITELLDRAAHDAVRNYPDLRVSLASSTTVLMVGLPAGLRL
VIDNAITNAVKHGGANEIQLSATSSGEGVEIVVDDNGTGVPEAERSAIFQ
RFSRGSTAARSGSGLGLALVAQQADLHGGTAAMEASPMGGARLVLRLPAP
S
375142025YP_005002674.1 lysophospholipase L1-like esterase [Mycobacterium rhodesiae NBB3]MSRLISAMVAFALLVSVGISIGPVRPIQVSHNDFVAQNTFMNRIAVIGDS
YTTGGDLGGLGANGWTARAWHELSEYRIPVSADVGAEGGAGYGTRGNRGS
IFEDLTARTVKPDDKLVVFFGSRNDQGVDPAQLSILAFGTFQLARRIAPS
ATFLVIGPPWPTADPPAAVVRIRDALQYQAGVAGATFVDPIAEGWFVGRP
ELIGADGVHPTDAGHAYMADKIAPLIAAELPASV
375142024YP_005002673.1 putative acyltransferase [Mycobacterium rhodesiae NBB3]MITQRIDSVSERAALVVPLVPCEAAGCVVAGRHTARQAYAYATPLNETVR
VPHEKSVVRTGEIKALSGLRIVAAVWVVLFHFRPLLEQAAPGFRSALAPV
LDCGAQGVDLFFILSGFVITWNYLDRMGESWSWRSTLHFLWLRLSRVWPV
YLVTMHLAALWIIFTLNVGHVPSEAAGSLTAMNYVRQLLLVQLWFAPYFD
GTSWDGPAWSISAEWLAYLLFGALVLVIYRIARATRARGLIYLAVAALLP
NLVLLMATGLFYTPWSWLPRIIMQFTAGALVCAAVRRLNPSDRARNVAGI
ASLLIVAVIVTILYLLDAYPIPTIYDSAGLVDVLFVPLVLTLAIGVGTLP
ALLSIRPVVYLGYISFSLYMVHELVHTTWNWMVLQFEIQLGSDLAGKAVL
LGLIAVAFAGAVLLYHFVEEPARRWMRDMMSPPRGARADTGHGKLQTIDR
QRAERTPVVSARAG
375142023YP_005002672.1 Fe2+/Zn2+ uptake regulation protein [Mycobacterium rhodesiae NBB3]MSSTPDYADQLRLADLRVTRPRLAVLEAVYAHPHADTESIFSAVRVGLPD
VSRQAVYDVLAALSASGLIRRIQPSGSVSRYESRVGDNHHHVVCRSCGVI
ADVDCAVGDTPCLTPSDPDGSLDGFDIDEAEVIYWGMCPDCSASQTSRSR
P
375142022YP_005002671.1 catalase/peroxidase HPI [Mycobacterium rhodesiae NBB3]MSDSPDAKPPSPEKPTASSGSESENPVIDTPKPKAHAPRTNQDWWPGQVD
VSKLHARGSFSNPYGDDFNYAEEFAKLDPEALKADVLSVITTSQDWWPAD
YGSYAGLFIRMSWHAAGTYRIYDGRGGGGEGMQRFAPLNSWPDNANLDKA
RRLLWPVKQKYGNKISWADLLVFAGNVALESAGFETFGFGFGRPDVWEPV
EILFGEEDEWLGTDKRYSGERDLAEPYGATTMGLIYVNPEGPEGKPDPIA
AAIDIKETFGRMAMNVEETAALIVGGHTLGKTHGAGPDEGMGPEPEGAPI
EQQGLGWKCPFGSGKAGDTVTSGLEVVWTDKPTQWSNRYLEILYGHEWEL
TKSPAGAWQFEAKDAEAIIPDPFGGPNRKPTMLVTDVSMREDPEFGAITR
RWLDHPEELNEAFAKAWYKLLHRDMGPISRYIGPWVAEPQLWQDPVPAVE
GELIDDADIKALKAKVLDSGLTVQQLVKTAWCSAASFRSTDKRGGANGAR
IRLEPQKNWEANEPSELAKVLPVLERIQQEFNGGGKNVSLADLIVLGGSA
AVEKAAKDAGFEIDVHFAPGRTDATQEDTDVESFAVLEPRWDGFRNFVRP
GEKNPLEQLLMEKAILLGVTAPELTALVGGLRALNVNHGGSKHGVFTDKP
GVLTNDFFVNLLDMGTEWKSGTAENVYEGTDRATGQPKWTATANDLVFGS
NSQLRALAEHYAQDDNKQKFVEDFVAAWVKIMNSDRFDLD
375142021YP_005002670.1 GMP synthase [Mycobacterium rhodesiae NBB3]MLGKFFTVDAPFLLLSIRGEDEAADDEYRAVVRFAGLDTTDVHRISLTQQ
PLGAVDLSEWSGIILGGGPYNVSDAPESKSATQLRVESELLDLIGRIVDA
DYPFLGCCYGVGTLGTVIGAVIDRTYPEPVGGMAITVTEAGRGDPLFADL
PDVFDAYGGHKEAAATLPTDAVCLATSPQCPVQAFRVKRNVYATQFHPEL
DLDGIDVRLDAYKNHGYFAPESAEQLKIEARQWNVQHPHAILRRFIERYA
RRR
375142020YP_005002669.1 phospholipase/carboxylesterase [Mycobacterium rhodesiae NBB3]METVQYAPGRRADVYGDPAQRAVLMWHGAQPDARVTMAPLAERVADQGAG
VIVSDWNSRADDRGHSDLLGSLRFVRARWSAPIVLVGWSLGGAAAAGATL
HAAEFDLELTHTVCLAGAFMVADSISGQTLPTDLASFGGGAPFTLLHGVE
DDVIPVDVSRTFAETLRHNGWPVELVELPTDHAAIAGAAYDSAADRYRPA
TDPQALVIVDAVADRIANIVAAVGH
375142019YP_005002668.1 UDP-glucuronosyltransferase [Mycobacterium rhodesiae NBB3]MKDVTLGRIVVAASSLSGHVLPMLRIGAHLQEEGHDVTVVSAPEFRDDVE
RARLRLVPLGPAAHVPPPSQPPRVPIPRLLRRLLLGLAELESTFVSPLAA
QYDALERVLAEDSVDVVLADLTFTGVLPLLLKDGPRPSVFVVGVGPITLS
STDTPPFGMAWAPRPDMDYEGVHRVVQGIFLRGVHKSLNRALGTRGARPS
PVSLVDWPRLADRLLQLTVPAFEYPRRDLPETVDFVGPVLSDNVATFDPP
DWWPEMLSARTVVHVTQGTFDNHDQDRLIGSTLTALEGADAVVVATTGRP
VEGTDLPPNAFAAEWLPYSALLSHVDVMITNGGYGGVQHALRYGIPLIVA
GETSDKAEVAARIAYTGVGVNLGTAAPSPARIRTAVDEVLATSDYRAAAQ
RVGADIAESRALDRIGQWVSSATRTPGVHK
375142018YP_005002667.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MADSLVQVRDDLFQTRTDSPFPGLTTHAYLWRRPAGNVLFYSPAGDSDFD
AIDSLGGVSAQYLSHLDEAGPNLVRIAERFGRRLHAPAAELGAIAQHGRV
DMPLDAVRHVDGNDVEVLPTPGHSPGSTCYLVAGVGGERYLFTGDTIFPT
GEGTWSTFVVPGRGDAAAMRDSIKLLSTVEPDLVISSAFGGETAIESVDA
DRWSEIVDQATASVSG
375142017YP_005002666.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKTPKIVSAGEWDTALHDMLVKEKEVQRARDALAAQRRRMPWTPVEKEFV
FDGPDGKLSLLDLFNGRRQLIVYRAFIEPGTGDWPEHGCTGCSLMADHVP
NLAHLNARETTFVYVSRATQSDLARMKKKMGWRHPWYSITDTFDEDFGVK
DWHGTNAFIRNDEDRIFRTYMISGRGDEVFVNTWNLLDMTALGRQEEWED
SPPGYPQSPPYEWWSWSDTYSEHTPWRWFGDPDPDDPNDQRPPRKDPESH
DACC
375142016YP_005002665.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MAEMDEVFRALADPSRRLLLDSLNARNGQSLRDLCAGLSMARQSVSKHLA
VLEEANLISTVWRGREKLHYLNAEPINAIADRWIHQYDRARVQTLADLKI
ALETEPMNNSADFVYTTYIRTTPERLWQAITDPAFSHRYMGHAMASDWKK
GSAYVWEDRELRIEHPEQVILESDPYRRLAFTFHTFVPELTTLGLDADVI
EKAASERRSKVSFDIEPVDDDQVKLTVVHGDFPPESTVRELISGGWPWKL
ANLKSGLEGSEK
375142015YP_005002664.1 putative ATPase [Mycobacterium rhodesiae NBB3]MLGLHGGSVVSADTLAELLWGARPPRTAVKALQTHISSLRRGLGDGFVLT
EGSGWTLNTTEIDATRYKMAARLGRDAVAAGDAAQAVTRFDEALSLWRGV
PELPDGPRAASEKTRWIEGHAALVEDRADALLATGRAAEIVGELEAAIAE
APLRERRWGQLMLALYRAGRQGEALAAYQRARSLLVDELGVDPGPNLRRL
EAAIVAQDPALEIPVSQHLSTVTKAVTFLLTDIEGSTAAWEAQADAMAVA
LARHDEIVEQVVTSRGGRLVKTRGEGDATFSVFDRPSSAATAAIELQEAI
RHEPWALASPMRIRISLHTGEVELRDGDYFGRAVNRAARLRSLAAGGQIL
CSGATAELVIDTLADDVVLADLGMRQLKNLARPEHVFELRLEAVEDTDTA
EPESPMRRPSLPAVLTGPGPFVGRGEELAGLLTAWQSTLTVGTRAVLVAG
EPGVGKTRLAGEWSRQVYEEGAIVLYGRCDEDLGAAYQPFAEALRSLVPC
LGADRLRGLRGVEALLPLVPGLADVVPDLPTSPRSDPDTERYALFDAVVA
LLGAASTRAPVVLILDDLHWAAKPTLLLLRHLLRFGEQARVQIVGTYRST
DLDRSHPLAAMLTDLHRDGSASRLALTGLDEKDVSAYVSEAGYDDEELAR
ALASVTGGNPFFLIEALRHVDESGGRWDPNTLPQGVREAVSRRLSRLPEE
TNKALAAAAVVGSRFAVELVERVVDGDLVDAFDEARKAGIVIEEPGGRYR
FNHALVRQSLLAELPSVRRMRLHQRIAVTLEAESGAEDELLAELAYHYFE
CAWAGNAAKAVEYCRRAADQAMSRLAYEGAADLYDRALHALEELDDELPD
RDALQAELLVARCEALLAAGDVGSAAGAVAQLQQAAGDSVRLAAWGTCFD
GELSMLTNPEQLDEIEVAVGAAAAKLAGLEDAAGEAKAHTVRAGCLTRLG
RIGDAETALDQALTAARRAHDHRRVNAVLAGAPLAALWGPNPVPRAGGRC
LDVVRLLRITTGSPVVEATSTRCQGVLDALRGRAAAGRALIDSARRSLTE
LGMRHALLEVEQFAGIVELIANEPAAAEPLLRRACDGFRRMGLDADTAET
AAFLAKACLALDRDADADELCTESERLAGHALKPSITWRTVRAQLLARAG
AHDEARRVAEEAVSIAERTDALVDHGDACLTLAVVLNIAGDVVGARSAAD
QAVALFERKGAAALAELALSITGSADNRHGAASQEPPLPVPENACLAAVR
RWASAFNREAGDDYEAMYAPDFRIESRRRIVGFTQDDLPSGDWSRDARRL
YKPSDTHRMVPIAVRGDRLALARLEISTADTSPGAPRDEVLQIFAIDETG
RVARHLLFDVEDMDAAVAELDALHAQLELENACVRVIRRIDDAYDRNAWD
ELEQHVAPVVFVDSRRKVVGLTLGDVPRSEWMFEARTYREVMAPVRYRHN
VVAVRGDRFALTSLQVGPEDKSPGAPRDEFLQLYGLDQEGLFALQIWFDS
EDMDAAIAELDARYLAEQGASTSRLENNASRMYGRIKQHFANRAWDAVGE
MLADDVSSDDRRKVVNAGVQQGRDACLSEFRGTAEVGVRVWQSDVIAIRG
EHLVFNRVRVASDQRSNAFNAELLDIIETDADGRVKARIVFDTNDFDAAI
AELDARYLAGEAAPYARVWRSAMETLYEANSHEPGRILSRLSYTNHQRVS
FGSADFGRAVQELWELVPDARYRATSVHALDAHGVVASLLIEGTDSTGNE
LQWHRIVVLLADESRMDVYDDDDLTAALAKFNARKSTTHLENAASRADVH
FNALFGDGRLDEIGQLFVDDLRVEDRRRGLYRVGVGRAAELAEVRAIAEL
GTKTMKSHVLAVRGERLALVRTRYSGRDQRPDAFHTEVLRIAEVNDDQRI
VAYVAFDLDDLDAAFAELDARYLSGEAAPHAHVWSVVVNTYAAFNREDYA
NVVSVDHRKSVRYAPGELTTSRMKAHMPDLRSYIEVVHRLNDVGVVVTGM
SSGTSDEGFEAEWRMALILTVDGDRLAWNELFDEEDLDDALARFDELNRS
RSGLDSTASRVLASYLSHFAARDWDAMWQALADQFSADDRRRVLNGPKRG
RDEEIANFKVVAELGCSSITSTPVATRGERLVLAHHSLTAAGPAPLEAEM
IDVVEVNRDNKIVNVVFFDTDQLDAAIAVLDAWYAAAEAAEYANTWSVVA
GVFDSLNRHETPAATPDWVNVDHRRGTPLAHSDLREIVKSLNEITPDLRN
HIEAVHVLSQHGAVLTQVSRGTSPEGFGAEWRMVNLLTVDGDLVSRCELF
DESDLDVALARFQELCRPAPGLENAASRAIQRFNASFAQRDWAAMASMLA
DDSNSDDRRRMVGGADLRGRDAMIDSFKTVAEFGTPLATSTAHATRGERL
VLTRVRYSVSDDLPDAFHAELLQIIEVDRDSRIETFVTFDLDAIDAAFAE
LDSRYLADEGAEYAHTWALVARAFTDYNRREQPGVSPDWVNIDHRRATAF
PAGDMIAYMGVTWADTPDVKIHIEEVHRLNARGAVVTWAGHGNSTEGFEA
EWRATVLVTVDGDLINRCEMFDTSDLDTALTKFDELSSPTTYVENSATRI
YQRFMTTFVARDWKAMAETLAPEIRHVDRRRVVNGGIQHGPDDVIANMRA
VAEVGVRNIEPSFFATRGDRLALGRQRVSGDKRPEAFGIEVLIVAEVDAD
NRLVGGVAFDPDDLEAAIAELDARYIAGEAAAYADTWSVISRGYAAVMRH
ELPAFTPDAANIDHRHATAFAPGELSTYLHAMWDQTPNEQFYIETVHRLA
SAGAVVTHIAKGTSQQGFEGEWREVTLSIVEGGTIKRSELFDEADLDLAL
ARFEELNRRAPQLENAASQMITRFQKVFGARDWDGMAKIFAEDICLDDRR
RVVGARFVGREATIANMQASADTGVKNVTSTVLATRGDRLSLQRVVISGR
DNRPDAFRTEALHITEVDVHDQATAFVMFDPHELDAAFAELDARYLAGEA
RGHSGTWSAIAEGYAAFNRREMPKTTPDWLNIDHRRGGSAFAPGDQTSYI
HATWEVAPQVRSDAAAVHRLNRLGAVVTQTTSGTSHEGFDVEWQDIILFT
VEGDLLARCEVFNEDDLDAALAKFDELSRQAPRLQNLASQVGARFRAAYA
SRHWDAMADMLAEDSYNDDRRSVVNGGIRRGRDSMMDDLRSGADIGIPEF
RVTEIATRGERLVLVRAESHYDERPQAFYVENLTIGEIDADQRIAAQVMF
DIDDVDAAYQELESRYLAGEAAAHAQTWSVIVDTYAALNRHELASTPPDW
VYVDHHRLALWQGDFTANMLAAWEVIPDWRIQIVAVHHLTNLGAVITAVA
SGSSRDGFNAEEPGIALVTVRDGVINRFEYFDVADLDAALTKFDELNVQS
ARPENAATRSHLRLNAAFAARDWNAMAELLPDDTSSDDRRPIVGGGLRCG
RDAVIDDWRAIADVGVKSITSTVIATRGERLALGRYGFVGHDQRPEAYHT
EVLGIVEFDSDQRMTACVMLDLEEIDAAFDELEARYAAGEAAAHAHTWTL
VTNAFAAMNRREMPATRPDWVTIDHRRLSMIDPTSRDQYLSAAIDVTQLG
VYVEEVHRLSDAGAVVSWQGQWTTPEGFDAEWHGISVLIFDGDLVARCEL
FDEADLEVALERFDELTSDVPRLENAASNAYKRYNAHFVAREWDAMAEIV
ADDVLTDDRRRVVSGGIQSGRAAQAADMRAVAGVGVKSIESSVIATRGDR
LALIRVRVAGDERPDAFGIELLIVVGINEDDRLVAGILFDLDDIDAAFAE
LEARYLAGEASAHAEMWSMVANGYAALNRQELPETSNWVVVDHRVRQTFK
GDDLAAYVRSLWNVAPGAKNYSEAVHRLSDVGALVTHAAYGTSPEGFRAE
WRMIALLTVGDSTSSVELFDESDLETATAKFEEQGRQVREPHNIATRMWT
LMADAFHRRDVEAFVDLTHPDGFLDDRRKGLRVSLDGSMRKRAVEVLFEF
PQSWRMELEHVAVRGSRLSLSRHFYRDTDQFDFPITVEVVTVTECSGDDR
VHTLVLFDPEDIDAAFTELDRRYLAGMPAKCANAWTIIAEAYSGMTRGEF
PPTTTDLVNIDHRRAIQMAPDSGIAYLRASWEVAPEFHLYIEAVHRLTEL
GAVFTRRSSGTSRTGFDAEWRAVDLITLEGGLINRGEIFEEEDLDTALAR
FDELARPTRQFSSTAGRVTERVRALFAARDWDRISECLAENFSLDDRRRT
VNGGLSYGRETTMHDMRTTADTGFTDLTEDFVAFRGERLVLTRARYFGSD
PRFEPYFVEVLHILEIDANEKIVATIVFDPDDLDAAVAELDSRYLKGEAS
AHPGIWSVFARTHVGLNRHEIPTTIADTVHVDHRQLITIEPSDMAKTLHT
AWDLMPDLRIYVEAVHRLTSVGGVITSRSYGTSRDGFDAEWRMLHIGVVA
GDRISRYELFDESDLQAALARFAQLHDELLGLENAATRASASLADAFNRR
DLNDLVARYGAKAQYEDRRKGLQNVGLLSRDFGAGLFELEAASTWRMETT
PIGVRGDCLALVRHTYRDTAKADRPVTVEALLLMDADNDGLICHCVLFDP
DDIDAAFEELDTRYGTGEAAGHARTWALVARSYATFSRHEMPATTTDWVN
IDHRRATAFAPGDLDQYVRAAWSVTPDTKAHIQAVHRLNSRGAVLTVSTY
GTSPQGFGAEWQDIHLATFDGDLCDRFELFDEADLDAALARFDELSLTVP
QLANAATNNFARIADAFNRRDLTAFLGAVTANARYEDQRMGFRNEGPVDA
NLVHAMLSKAADGWRVTIEPIAVRGRDLALSRYSYRDVNEVDRPITFEAL
VLTEVAEEHLSTVFDPADIDAAFEELDVRYLAGEAAEYAQTWSTIIRGFA
GFGDHDLPDTAFEWIDHRTLVGSGISDPGETSRAVWDMTSDIRTRIVAVH
RLDNRGAVITHVIQGTSREGFDFELRLVDLIAMAGGIVSRCECFDEADLD
AAIARFDELSHAAPLLDNAATRARSRVIEAYNSRVTDAFPAATSGRYEDR
RKGLRDEGTADEKYVHAVFSGTPTSWRIDTEFVGIRGDRLALSRERFRDS
SEAHQPITVELLTLTSVDEGDRIAYTVFFDPEDVDSAFGEIDARWIASGG
CAHPEVIKAVQSFAEMANRHDWDALAARHAGATYANHRQLRSGADTVADD
MSSLRMLALLVPDLRFEATEVLRLSAGGTVIHTVARGTSTEDVPIEIPLV
ILMLIDGDRITRAETFDLNQRNDALDRFEELDSNAPPPENAIARVLERVV
DAFDRRDPQRYLALFADDCTYEDRRKGLRDQGSIRPDYAQTVTFGADAGW
QAEFETIAVRGEHLMLGRATFRDQSEAGSPVTVEALNIGSIDDDELISWF
AVLDPDDIDAAFAELTARWIASGEVAHPEVIEAAHRSNEMYNRHDWDAIK
ANESGATYVNHRQLVSAEPETIEDHWRSIRALATLIPDLRTEPTEILAHS
AKGVVADLVVKGRTPTGTVIEFPAITLILFDGTRVAHMEAFDVDQRGLAL
DRFDELNRPE
375142014YP_005002663.1 putative AP superfamily protein [Mycobacterium rhodesiae NBB3]MDLPQPDPDTPHLADVIPSVFSAMGVAGFDGRIPLREDVAGACVLLIDGL
GAELLDAHADEAPVMAGLRGRTLQVGFPATTVAGLAALGTGCRSGEHGLV
GYSFRLPDVGVLNALRWRMHPWGEDLRDAAPPEQVQPIPTTFERATEAGA
AVSVISGAEFAGSGMTRAALRGGRYIGVHAMGDLSAQVRAAVAAGGFCYA
YHSELDMMGHLYGPGSPAWRIHLQLVDRLVESIVEGLPPGGLLAVVADHG
MVAVGTDDVDIDSAKPLTDGVTDIGGEPRARHIYVTPGADDDVLATWRET
LADRAWVVSRDEAVAAGWFGGRVSDSTRRRIGDVVAAARGSTALLRRAAE
PLESSLIGHHGSLSSAEQDVPLLLAYG
375142013YP_005002662.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNVVTDFGGPHKALLTSVGMFAVATLLTLVNSVSGTPYVTGGDSPAGTDC
SGLVSWVTNAATGRPVYGDRFHTGNIEQALLARGFQYGTQPGALNVGWNG
GHTAATLPDGTPVSSGEGGGVKVGGGGAYQSQFTNHMFLPMPADQVPPPP
GAPVVLMGQQAPLPPAPPMAPPPPPPPGAPMAPPPPLDPMLAPPPAPAPP
MAPPPPPAPPMAPPPPPAPGMPPAPGMPPA
375142012YP_005002661.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIVLLPPSETKHPGGDGPPMRLDDLSYPELSPLRAALVDELVELSADPPE
CRRALGLSASQQIEIERNAALRSAPTMPAINRYTGVLYDALDIESLTGAA
AGRARARLAVGSALFGILRADDSIPAYRLSATSKLPGRAALSTRWRPLLE
PVLTRLAADELVVDLRSGSYAALGKVSDAVHVDVVSERLDGTRAVVSHFN
KAHKGRLARALATSRSEPTDASAVATIARRAGMRVERKSNRLTIVVPA
375142011YP_005002660.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAALAVAAPAVGASADDTGGGTVMAFSQISRICDFSEVNYIGPTGMGRP
SATLRSDGSTVSADVQIATVLPNFPYDVRLIQVPRPSSKPCWGGDPGVTL
SKLQTDAGGNGSVSLSGPIQPGATGAWIWITRPDPFRQYPGEFYTTDFVA
PI
375142010YP_005002659.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MQDFPLTVTGILRHGTTWFSGRKVITKTPDGYREICFGELGTRVAELAHG
LTQLGVTSGQRVATFMWNNQEHLEAYFAIPCMGAVLHTLNIRLAAEQIAF
IANQAEDSVVLVDVSLVPMFAAVLPDLATVHTVVVVGSGDVEPLSTSGKK
VVRYDDVLDGQPITFDWPDLDEKSAAAMCYTSGTTGNPKGVVYSHRSTYL
HSMSINTANAIGLVDGDRVLPVVPMFHANAWGQPYAAVMAGADLLLPDRY
LQAEPLVDMIELQRPTVAAAVPTIWNDVLQYLHAHPDRDISSLKTVCCGG
SAVPLSMMKEYEQHYGVEILQGWGMTETSPLAAIATPPPEATGEEAWTLR
AAAGRVASGVEIRIVDDEGGVLPDDGKAVGEIEVRGPWITGSYYQNADSS
KFHDGWLRTGDVGRIDPQGFITLTDRAKDVIKSGGEWISSVELELRIMEH
PAVLEAAVVAVPDERWQERPLAAVVIKSDAACTAEELRKHLCDKVAHFWL
PERWTFIDEVPKTSVGKFDKKHIRSLYAEGVYNVVDCRT
375142009YP_005002658.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSQYGYPPVPPPKPPASGGDIAASTVVLVLTALLLAVAGFFGLFSLAFLD
SCPPESCSVEGAVTAVMFGVGAALAVGLVGLVVTVVRLVRRKRGWPVAVA
TLALCAIAVFLGGVGYVIAVGG
375142008YP_005002657.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDEDPASKSEAPGLVPVGALRSGDPITDVNGGGQHYIVLESKKLSEGCIV
LELESKANDRIRVIEASFPADYVMSLTPRHPIL
375142007YP_005002656.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MVVAIARPKLEGNIAVGDDRQISFAEFGDPQGRAIFWLHGTPGARRQIPM
EARVYAEQQNIRLIGVDRPGIGSSTQHSYDTVVAFAEDLRTIADTLGIDK
FVVVGLSGGGPYTLGCAAALPDRVVAAGVIGGVAPTMGSDAITGGLMGNL
GTRVAPLLQVAGTPIGLLASAIIRLVRPVASPVADLYGRVSPEADRRLLA
RPEIKAMFLDDILNGSRKQMAAPFSDVVVFARDWGFRLSDIKVPVRWWHG
DADHIVPYAHGQHVVSRLTDAELYPMPGESHLAGLGRAEEILHTMLKVWD
EYGDR
375142006YP_005002655.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTATERDQLSESAVAAGWHRRGEDRADYYSRTPVRVHVIWQGNDAISGG
ALYHDDFLMAYSRDLATVAGWLRR
375142005YP_005002654.1 competence/damage-inducible protein CinA-like protein [MycobacteriuMSYGVSARAGIVVTGTEVLTGRVTDLNGPWLADRLLELGVELAHITICGD
RPDDIEAQLRFLAAEGVDLIVTSGGLGPTADDMTVATVARFCGRELLLDN
DLEVKIADIVQRLMARFPNVDLEAVRAANRKQALIPAGAHVIDPVGTAPG
VVVPGKPTVVVLPGPPRELQPMWPTALQTPAVQEATAGRTTYRQEMVRMF
GLPESGLADTLRDAEASVDGFERLEITTCLRRGEIEMVTRYEPDAAAVYA
DLMTLLRERHGGEIFSEDGSTVDDQVAALMAGRWIATAESCTAGLVAARL
TDLPGSSAYVAGGVVSYSNEAKSELLGVDPALIETHGAVSEPVADAMAQG
ALRRFSADTAVAITGIAGPGGGTDDKPVGTVCFCVKLADGATDLRTMRLP
GNRSDVRERSTAVAMHLLRRALTQSAAAVR
375142004YP_005002653.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSFSMTAPKSLRELFDQLGLAEVPSSDDSVIMEMAVDERTVNTAGGLQGG
LIATMADVTAGQLAARATPFGHAIATTDLFIRYLRPIKVGPARAVARILR
TGKRSVVIQVDIYRGNDDQIGATATVNFAAVD
375142003YP_005002652.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MGRVDGKVALISGGARGMGAAHARALVAEGGKVVIGDILDDEGKALADEL
GESARYVHLDVTDAEQWDAAVKVAVDAFGKLTALVNNAAIVALGQIGKFD
MAKWQKVIDVNLTGTFLGMQAVVEQMKEAGGGSIINVSSIEGLRGAPMVH
PYVASKWAVRGLAKSAAIELGPKNIRVNSIHPGFIRTPMTKHFPDDMVTA
PLRRPGQSEEVAPFVVFLVSDESSFATGAEFIMDGGLVTDVPHKALPLG
375142002YP_005002651.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAIRVALLGTGNCGSLALRQLITDARFDLTGVWVSTDAKVGKDAGELAGL
DVTTGVTATNDLDAIIATKPDCVVYTAMGDTRPREALADVRTFLSAGINV
VGSSVGALQYPWGLLPDKAIQKVEDAAREGNSTVFFTGVDPGFCTDLLPF
ALAGTCQSIEQIRTMEIADYATYDGATVMFDVMGFGRPISTAIGDLPILY
QPGVLSIAWGTAIRQLAAGLGIEVDEIRDSVEQEPAPEDLNVAVGTIKKG
TVAAVRFLIEGMVGGKPVIVVEHVTRLHPDLRPDWAQPAHPGGSYRVEIT
GEPSYFCDIVPMSRNGGAPYAAILAAAGRIVNAIPDVVAAPPGIRTTLDM
PLVTGKGVVAAT
375142001YP_005002650.1 HAD-superfamily hydrolase [Mycobacterium rhodesiae NBB3]MTAQPVAEDPTAEIAASTPGSSIGAFFDLDGTLVDGFTAAAHASDRIRRR
QAGIGEVLGVVEASMRYKLRRMRFEHLLTRAAGYLQGEALTDLDDVCERI
FVDSVSTRVFPAMREIVAAHQERGHTVVLSTSAVTIHANPVARFLEIDHV
LCNHFTVDSAGRLTGQIAKPVVWGRNKATAVVNFCERNQVDLQRSYFYAD
GDEDAALMVKVGNPRPVNPRPKLAALAAEHSWPVIRVVGSRGRRRPSLKR
FVGYD
375142000YP_005002649.1 2-nitropropane dioxygenase [Mycobacterium rhodesiae NBB3]MRTPICNDLNIEYPIFAFTHCRDVVVAVSKAGGFGVLGAVGFSPEQLEIE
LKWIDENIGDHTYGVDIVIPNKYEGMDSTDLDPEVLKKTLNDLVPQEHID
FAKKILSDHGVPVEHSDDDALQLLGWTEATATPQVEVALQHPKCTLIANA
LGTPPAEMIKHIHAEGRKVAALCGSPSQARKHADAGVDIIIAQGGEAGGH
CGEIGSIVLWPQVVKEVAPVPVLAAGGIGSGQQIAAALALGAQGAWTGSQ
WVVVEESEHTPQQHAAYVKAGSRDTVRSRSFTGKPARMLKNDWTEAWENP
DNPKPLGMPLQYMVSGMAVAATHKYPNESVDVAFNPIGQVVGQFTKVEKS
SAVIQRWVQEYLEATATLNDLNEAASV
375141999YP_005002648.1 TetR family transcriptional regulator [Mycobacterium rhodesiae NBB3MPSPRERMVISAALLIRERGAHPTAIADVLEHSGAPRGSAYHYFPGGRTQ
LLCEAIDYAGEYVAAKIANAQSSVEALDGLFGDYRKQLLKSDFRAGCPVV
AVSVEAGDPDKADAAAPVIERAAAAFAKWTDLIADHLVADGASKKRAAEL
AMLTTTSFEGAIVVARASRDLKALDLVHGQLRALVLAETSER
375141998YP_005002647.1 anaerobic dehydrogenase- typically selenocysteine-containing [MycobMTNEDVAAAAAPEDWQPTACILCECNCGIVVQLDGRKLAKIRGDKEHPAS
QGYTCNKALRLDHYQNNRSRLTSPMRRRPDGSYEEIDWDTAIAEIASGFK
HIAQAYGGDKIFYYGGGGQGNHLGGAYSGAFLKALGSHYRSNALAQEKTG
EAWVDAHLYGGHTRGEFEHAEVSVFIGKNPWMSQSFPRARTVLNDIAKDP
KRSMIVIDPVITDTAKMADMHLRVRPGTDAWVLAALAAVVAQENLCDDAF
LANHVTGAENVLDVLRTVDVGDYALRCGVDEELIRAAARRIGAAESVSVF
EDLGIQQAPNSTLCSYLNKLLWVLTGNFAKRGAQHLHSSFGPLFRHTLDV
GRTPVTGAPIVGGLIPSNVVPQEMIGDHPDRFRAMIVESSNPAHSLADSN
ACRDAFSSLELMVVIDVAMTETARLAHYVLPAASQYEKAESTFFNLEFPH
NTFHLRHRLMEPLEGTLPEPEIWARLVRALGVVDDAELEPLRRAAAESRE
AFTAAFLQAVSSSPMLGKVLPYVLYETLGPTLPEGLSGAAALWGLAQKAA
MTYPEAVRRAGHADGNALFDAIVSSPSGITFTVHEYEDDFALITHADRKI
ALDMPEMLAEIRALSDAQTHFTTPDFPIVLSAGERRAYTANDIFRDPTWR
KRDADGALRVSLEDAEKLGLVHGGRARITTAAGSAEASVEISEAMLPGHA
SLPNGFGLDFVDSDGRAHVPGVAPNALTSSDWRDPYAGTPWHKHVPARIE
PAPVPVTV
375141997YP_005002646.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MVAQTRTPRSTWIDAGLAALASGGPDAVRVDLLAKALDVTRGGFYHHFDN
RGAFLEALLQEWEHRSTDEVLDRVEAEGGDPRDKVRKAGMLTFSEDLLPI
DLAVRDWARRDKSVARRLRRVDNRRMDYLRALIGTFSDDPDDVEARGMLA
FSLAIGSHFIAVDHPGSSRKQVLERATRRLLS
375141996YP_005002645.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFGSTLLDKTEHTSRPWRIHAIANDFQILDVWALPTPGDADDFGRLVELW
STFDAQRSSPIVRALFAIRWTLGRVLGLDRPETGLGKRVEMLRDRLPVDL
RDAPTGFVDDRSPFTPLYLTDDEFALEIANQTVHGVMHVGWVRDEACESG
DFRGQLAVLVRPNGALGVAYLTAIAPFRHLIVYPLMMRDIGRVWREKLST
STQPDRRHQ
375141995YP_005002644.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIDTEAAEARVRQITPDAHATSASTLTRIDYADAFVVDVDAPHSRRAEEW
MRVILEDAPASVRLRLLSAWSAIGLKVSLPGSDRSVLGWKIRATDRDFVL
LGAESRIGMPGELLLQRHETGLLFATFVQQDNSIARGLWASIEAAHVRTV
RSILEMASRRTAAE
375141994YP_005002643.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRIDIEVKAAAVASAGLGTLAALLAGATTAQADPGVPAPPQPPPALVAPA
VPGPPLAPPPAAPVAATAPAAPGVPAPVLAAPVADGAPVPAAEPVPPAEV
PHLVSPENLPPGTSMTPAGPGQHSSGSYLRELWHAVQTQEVSGKDALLLL
TQRPLRANSTPPPGLAANPPEQMPATPPLGDPLPPAAAPILPAAAPAPPV
PAAPAPIPPPSAG
375141993YP_005002642.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MPTPNLPPGFDFTDPDIYAERLPIEELAHMRKVAPIWWQKQERGNLAFGD
DGFWVVTKHKDVKEVSRRSDVFSSNKKTALPRYRDEADPASLEAGKVVLL
NQDAPHHTHLRKIISRAFTPRAIESLREELRLRARDIVKRAAAEGSGDFV
EQVSCELPLQAIAGLMGVPQEDRMKLFEWSNQMVGDQDPEYGRNDPTAAS
VELIMYGMQMAAERGKNPGDDLVTKLVQADVEGHKLTDDEFGFFVILLAV
AGNETTRNSITQGMMAFTEFPDQWELFKRERPATAADEIVRWATPVTSFQ
RTALEDTELSGVKIKKDDRVVIFYRSANFDEDVFDDPYTFNILRDPNPHV
GFGGTGAHYCIGANLARMTIDLIFNAIADEMPDLTPISAPERLRSGWLNG
IKHWQVDYTGAGAT
375141992YP_005002641.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRTTSSDERPIPRWLHFVLISDRAGSSWYIGIGFFFAPVLVLLSPWPTVT
AVAWVAIGLAGLWLGLLGIAMATGLTMAMRSNVEIPEEYWRSLVDYPVR
375141991YP_005002640.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MATPRRVGETEPVTTAHVQSPPFGTMMREWRQRRRLSQLDLAIEADVSAR
HVSFIETGRSAPSRAMVLRLAEVLDVPLREQNQLLMAAGLAPVYSERSLH
DPDMTAVRDGVERVLRAYDPFPCVVVDRGWQIVHANAGAGLLLEGVAPSL
LERPNALRISLHPDGLAPRIRNLAQWRHHVIERLRREAAVSGSADLSGLL
SEIESFPGGFDDTRDLGGVAVPLELFTPAGQLLTFLSTVTTFGTALDLTA
AELSIEAFLPADDATAAALGVK
375141990YP_005002639.1 conserved lipoprotein/antigen [Mycobacterium rhodesiae NBB3]MDNRLVAAVAIAVAAVAAGCSPPPAALGGTTAKVTIDGKSTGDAHAVVCS
QTGWMWDIKTPGEPSGLTAFLNTEGEVTVQSVEFRDFAGFTGTFWQGRIG
KAEVTGNGGTFTITGSADGSYKDNPSKAVTATFRIEANC
375141989YP_005002638.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVHPFRAAIEARDLDAAVALLREDVVFRSPVVFTPYEGRDALRLILGAVI
EVFEDFRYVREIGAEGAPDHALVFEARVGDKQLQGCDFIHVDADGAIDEF
TVMVRPMQAMLVLAEAMKARLAAG
375141988YP_005002637.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MALQPVNRRSVPEDVFEQIVAEVLSGEMKPGESLPSERRLAEVLGVSRPA
VREALKRLTAAGLVEVRQGDATTVRDFRRHAGLDLLPRLLIRAGELDVSV
VRSILETRLHNGPKVAELAAARRGPELAALLDDALCALADENDPVEQQRC
ALAFWDRIVDGADSIAFRLMYNTLRATYEPALPALAAVMADEVGRPQAYR
ELADAIAAGDPTRARAAAHDLLEPATTALLVALDDLEDQS
375141987YP_005002636.1 fatty acid hydroxylase-like protein [Mycobacterium rhodesiae NBB3]MTTATARTARKKLTLGDAAREFAKHPSPWMIGAVLAVAVAARIVVGDWQI
TDAVVPLVMLALFPFFEWMIHVFILHWRPRRLGALTIDPLLSREHRAHHV
DPRSIPLIFIPWKSLASWVLPLAIGVALLAFPRLGMGLTYLVCIAVAGLG
YEWTHYLIHTDYKPKTRVYRAIWRNHRNHHYKNEHYWFTVTSSGTADRVL
RTYPDPATVENSPTAKNLHAELPA
375141986YP_005002635.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLKLRLLAVVGLMVAALSGPIATSSAGVSLPTDVVSISPSGTTVGVAAPI
TVTFAGDIADRAAAEQSFDISSPTVPAGEFTWLNDRVLQWTPSEYWPAYS
PISVSAGGAKTNFQTGGQTVGVASISNHTFTVSQDGEVLREMPASMGKYG
FPTPVGNFTALEKQSTVIMDSRTIGIPLDDPEGYKLTVYDAVRVTWGGVY
VHGAPWSEGSQGYENVSHGCINLSSDNADWYYNMVRIGDPIIVEA
375141985YP_005002634.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSSAPGLAILRLVLRMAIVMSVLIALVVVEISSRSGVSWRLITFTYQAN
IIAAAYYLWTLVSPRADPRVGLRGAVVLYVVIAGVVWNLLLTGRSMGYTP
ANVLLHVVVPVLALSDWLLVGRGQGRVRWWHPLAWLVYPSLYVVLAVVVL
NEAGRRAPYFFLDPESVGVATVVLNVCVLGGCVVAVGYALLAVNRLATSA
RFDAV
375141984YP_005002633.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDTVLGLSVTPSAVGLVLVEGQDADGTTVDREAFEIVSGRHSTPLAASEQ
AAAAVLRTEAIAASRGQRLHSIGVTWSDGADTEASMLLKSLNDSGFDNVV
PVRLPEATEALAWGIAEVIGYQVTAVCVIESDTVIMLVVHDGVGAVQTAI
NHAIETEEALLQWLSTVFTRADWRPEALVVVGSGSDLHSVIPRLEDILSV
PVFVPAESELALARGAALASAHNTEFIQIGQTAERAPRDRSGARRPLAQT
GPLAMLVAGAVAFVVSVSVAVSIEMTPDRHAAAPEPQPAAKASPEIANIR
AAAPDAPSPAVLPAPAEELPSPPPEAPLAEITPPPEVAPDAAIVPDAQPV
DGLPAVAPVDAVPPDAPVLAAPDAPVGAVPPGAIPPAPGLVPVQPTPVPQ
ERPGLLTRIKDRLSNIGRNDDAQQAAVPPAPGAPLAPAPEAPPLLPPQ
375141983YP_005002632.1 amino acid/peptide transporter (peptide:H symporter) [MycobacteriumMATTARTEGGPAGRTVFGHPIGLANLFGVELWERFSFYGMLTILGYYLYY
SLTDGGLELPKATATGIVGAYGGLVYLSTVLGGWIADRVLGMERTVLYGG
VVVMCGHIALAVIPDLAGVAVGLVLVALGSGALKANASSLLGTLYEKGDP
RADGGFTLFYLGINLGAFIGPLLTGLLQTRLGFHWGFGAAAVGMALGLTQ
YIVFRRNLGDHGRTVPNPLPRSAIGWVAGIGVLIVAVIVAVFVTGLVKLS
NLSHVTTGVLVVASVVYFVVMLTSSKVAPIERTRLRAFIPLFIANAVFWS
LFQQIFTVLAVYSDERMNWSIFGWTAPSNWIGSIEPIWIIALSPVFAIMW
TRLGGRAPTTPRKFAYGVIGMGAAFLLFLPMSGTTGRTVPALLVVGIMAV
FAISELLLSPIGLSVTTKLAPEAFRAQMMALYFFSVGLGTAMSGVLSGYY
DPAREFAYFGILGLVAIVVGAVVFALSGWISRLMEGVH
375141982YP_005002631.1 threonine dehydratase [Mycobacterium rhodesiae NBB3]MVTIDDIRAAATRIRAFVVRTPLLPALWADAERPLWIKPESLQSIGAFKV
RGAFNAIGNLDESVRTRGVVAYSSGNHAQAVAYAAAVYGIPAHIVMPKET
PAVKVDATRDHGAEVVLCEAGQRERVAAEVVEETGGVLVPPFDHPDIIAG
QGTIGLEIAEDMPSVENVLVPVSGGGLASGVGSAVKALCPQARVFGVEPE
LAADTAEGLEKGRRVDWSIEDRNRTIADGLRSQPSELTFAHLQQVLDGVI
TVSDSEIRDAVRELALKAHLVSEPSGAVALAAYRQGRTPPGRTVMVLSGG
NIEPRALIDILG
375141981YP_005002630.1 putative thioesterase [Mycobacterium rhodesiae NBB3]MAVSTFSLPITPRYAEIDQQGVVFNGHYLTWFDEACTGFLDHLDVTYPGL
IASGYDIQVVHSEIDFKGPVRWRDAVRVEVHCERIGSTSFTLGFSVMRSR
DGDTEQTAVRGHNVYVVVSTEDWAKRPIPSVLREALTSVERQPHNASE
375141980YP_005002629.1 agmatinase [Mycobacterium rhodesiae NBB3]MIEQLELAYAGVASFGHRPFLTEVEQLESWRPDVAIVGAPFDVGTTNRPG
ARFGPRAIRATAYEPGTYHLDLGLEIFDWLEVVDFGDAYCPHGQTEVSHN
NIRERVHAIASRGIVPVILGGDHSITWPAATAVADVHGYGNVGIVHFDAH
ADTADEIEGNLASHGTPMRRLIESGAVPGSHFVQVGLRGYWPPQDTFEWM
QEQRMTWHTMQEIWDRGFKEVMRDAVSEALAKAEKLYVSVDIDVLDPAHA
PGTGTPEPGGITTADLLRLVRQLCREHDVVGVDVVEVAPAYDHAELTVNA
AHRVVFEALGGMAARRRDATPDAAPPGPPAR
375141979YP_005002628.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSGTLFFDGKCGMCTRSRDFLLKLNRTGELHTEPLQTPGTSERLGIPDSA
LMDAVRWLDSNGDVYAGAEAANAAVSAALGTRIPLTVYRIPGIRSLEDAV
YRWVADHRYRLPGTTPYCESHPVSC
375141978YP_005002627.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNRTGWLTSTQSRSLLWSALVLSLVLGVALVVVDRHEADPVGQFGAPLTD
EQAIEQVVGSARRIVAAAHLQDAAGGYSFVSCATQNGPPYQVALYMNFTL
PQSDWIRYLDEVASAMVVDGWADAPAKAEHFGRKLTKGGVTAVLQRNLDD
PTSATMRLYGECRNTGDHRHDNPAWTEVTL
375141977YP_005002626.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MKVNDRGAAPAATRRTQAERTAATRALLIETGRKLFADKGFNEVSTQAIV
EAAGVTRGALYHQFDDKVGLFAAVYEQAERQLVEDIARQIVELQPLDPLE
AMRVGARLFLDGCAAPDVQQIVLIDAPAVLGWDRWREVGVKYGLGVIEGM
LAHAIAEGVVPEQPLRPTAHVLLGALDEAALFVSRAPDRERARTEMDAVC
ERLISGIAGRG
375141976YP_005002625.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MPQVALEQATIDYRVLGPQDSPHPPVVFVHGILVDSRLWDRVADGLASKG
FRCYLPNWPLGSHTIPVNDGAELSPRAVATMIDDFIEKLGLADVTLVGND
TGGGLCQLVIDAYPENVGRVVLTNCDAFDKFPPFPFTLVFALLRGPVSIK
VLFEQMRIKALRHSPLGFGLLVNPDPQLTASWLEPARTDVRIRRDLARLL
RAVAKTDLTDVSTRLHRFTKPVTIVWGQRDRAFTPSLGRRLAALFPTSTL
IEVPESRTFVSLDAPSAVIDAIATVGAGAR
375141975YP_005002624.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMGADVSTETVTTQVPSRLDRLPWSRFHWRVVIGLGGVWILDGLEVTMVGN
VADRLTEPGSGIEMSAAQIGVAAAIYIAGACLGALFFGQLTDRFGRKKLF
ILTLVLYLTATVATAFAFAPWYFYIARFFTGAGIGGEYAAINSAIDELIP
ARVRGRVDLIINGSYWLGAAGGAAGALLLLNTSIFPQDLGWRLAFGIGAV
FGLAVLVVRRNVPESPRWLFIHGRQEEAERIVREIEDEVARETDKTLAEP
EGSLTIRPRKTISFVEIAKVAFTRYPKRAILGLALFIGQAFLYNAFTFNL
GTLLGTFYGVASGTVPLFFVVWALSNFAGPLLLGRMFDTVGRKAMISLAY
LGSAAVAVGLTALFYAEAGGVVVFIAVLSACFFLASSGASAAYLTVSEIF
PMETRALAIAFFYAVGTAIGGITGPLLFGALIDTGDRGPVAISFLIGAAV
MALGGVAELIFGVKAEGQNLEDIAAPLTTADEKPA
375141974YP_005002623.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTFACRVFGHQPAFHADGSIMRWACRRCGQSSGAKEYATATEAARYAAAF
NKRDADDLGKRAPLIGLLPLRLWRRLRSR
375141973YP_005002622.1 methyltransferase- cyclopropane fatty acid synthase [Mycobacterium MPETTNDADGLKPHFEDVQSHYDLSDEFFRLFLDPTQTYSCAYFERDDMT
LEEAQIAKIDLSLGKLGLQPGMTLLDVGCGWGATLNRALDKYDVNVIGLT
LSENQKAHVEKVFAESPSTRTKRVLLEGWEQFDEPVDRIVSIGAFEHFGA
DRYDDFFKMAYTALPSDGVMLLHTIVKPSDEEFAERGLPLTMTKLKFFKF
IMDEIFPGGMLPFVSTVEEHSAKVGFEVTRVQPLRMHYARTLDIWADKLS
ASKDEAIAIQNEEVYDRYMKYLTGCADLFREGYTDICQFTLVKN
375141972YP_005002621.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPEVVDKVREFNRFYTRVVGLLRPDLAGSQFGLTEARVLFEVAHSNGATA
SDLRRELGLDAGYLSRILGSFTTAGLVDRERCGEDGRRQIIRLTDAGRRA
FADLDRLQVEAIHALLAPLDEPHRQELVTSMGRVRRALGGPRAHPDVVIR
PPRPGDLGWVVERHGARYAAEYGWDVTFEALVARVVADFAERGDAQREAG
WIAERDGERIGCVFCTTTDRSDTAQLRLLLVEPSARGFGVGTRLVDECLR
FAKRAGYTRITLWTNDVLLAARRIYEHAGFECDRREAHHSFGQDLVGEYW
SRTLR
375141971YP_005002620.1 cytochrome c biogenesis protein [Mycobacterium rhodesiae NBB3]MNQELLGLAFAAGLVAALNPCGFAMLPGYLALVVRSDVDSERSGVLTALG
RAVAATAAMALGFIAVFGTFALLTVTAASTVQRYLPYVTVVIGVLLVALG
IWLLAGRDFAALSPVAHAKWAPTARLGSMFGYGLSYALASLSCTVGPFLA
ATGVALKGGAHLGVLVYVAYIAGFTLVVGVLAVAAALASSGVAERMRRIL
PYVNRFSGALLVVVGLYVSYYGLYEVRLFAGDGDPADPVIAAAGRLQGAL
AGWTHRHGAWPWVAALLVLACLALVVAWRSRPKVASRSLDRGRATAGDES
375141970YP_005002619.1 Redoxin [Mycobacterium rhodesiae NBB3]MRHRFIRFGRSVTLAALAAVLAVGLVNPPAAVADDRLQFTGTTLSGAPFA
GSSLVGKPAVLWFWTPWCPFCNAEAPNVSKVAAANPDVTFVGVAARSSVS
DMEGFVSKYNLNFTNLNDADGSIWARYDVPWQPAYVFYRADGSSTFVNNP
TAAMPEQELADRVAALK
375141969YP_005002618.1 putative F420-dependent oxidoreductase- MSMEG_3544 family [MycobactMKIRFGIGLGAETGPDELPDIVDHLEDNGVDSLWFSELVYSKAVDPFIGM
AHALARTADLKVGTSVAVLPGRHPVLVAKQLASLAALAPKRVLPVFGLRS
AIPAEREIFVVPEGERAAVFDEALRLLRSVLEGEDVSFAGNYFSVSSVGV
LPRPSKPLDIWLGGSAPAGFRRIGQLGDGWLGSFLTPAEARDGRAQIERA
AAQAGREIEADHYGINLAVCDGDVSGELVAAVRRRRPDVEPAELIADSWS
RLHRQLDAYLEAGLSKFVIRSAGLCSASAFIDRFVAELLPRQN
375141968YP_005002617.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMEGSVTVSMAAPADKIWNLIADVRNTGRFSPEVMEAEWVGAATGPALGAR
FRGHVKRNEIGPVYWTTCEVTACEPGREFGFAVLLNGKAVNNWHYRLTPV
DGGTDVTESFRLDDSLTMKLFSIFGGQLRRRRNIRDMRKTLERIKAVVEG
PEAG
375141967YP_005002616.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGKWSRAELEEAWRRYQESVVEVGKTWDWSSYADHFTEDARYVEHALGNM
EGRENIREWIVSTMNTFPGSEMPTYPVEWYSIDEDKGWVIFKNINTMRDP
GDGSVHGAGVITVLEYAGDDRWSYEEDAYNPMNFMVMIQQYIQRSHELGT
ISEDARAFAKNMNWELT
375141966YP_005002615.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSKWSRQEIEDTFSHHQDLVVEIGKSWEWARYGELFTEDATYVEHLYGKM
AGREAISTWIASTMDTFPGSEMPFYPVTWYSIDTEKGWVFSEIMNRMKDP
GDGTIFEAPCITILRYGGDGMWHNEEDAYNPTNFLPMVQGYIQRSHELGT
ISDDARTFAKNMNWQLT
375141965YP_005002614.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMVARVVRNPHAGQPFTTTDDEIAEALLDVSIPTLMLSLVHMSADPELIRG
ALKPAGLFLNEVQGYMSEEDKAAVRKIALEVIADYRDRGCPEPEPVSPEL
LHEMMQWLVCEPVPAEYVPMVLEEMELDGRDARATGEVHEAAREDFGVVV
IGCGESGLLAGIRLKEAGIPFTIVEKNAGVGGTWYQNSYPGARVDVGNHF
YCYSFEPTDHWTHFFAEQPELQAYFQGVMDKYDIAPHVLWETEVTEASWR
DADATWRVRVLGRDGTTTELTARAVISAVGQLDRPHVPLIDGQHDFAGPA
FHSSQWDHSVDLRDKKVAMIGAGASGFQIAPTIAPDVNRLTVFQRTAQWM
FPNPNYHERVGPGVQWALRHLPFYGRWYRFLIFWPGCDKGLDAARVDPDY
PDQQKAVSEINEITRIMFTEWITSQINDKPELAAKVVPDYPATGKRTLQD
NGSWLKTLTRDNVELVRTGIDHIEADAVVTEDGHRYPADIIVYATGFEHT
KMLWPMTIRGRDGEILSERWGERPSAYLGITIPGYPNFFCMNGPGTWLAS
GGSLIFHSECQMRYISECLELLIEGRHATMEPTVEKTKDWHERSQAEMAK
MVWSQPSVKHSFFKNSFGEIHTLSPWRLVDYWTWTREPDPSDFVFR
375141964YP_005002613.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MGISTRVNGAVPPHMPLSDIELSDWKFWVLDDDMRDGAFATLRREAPVSF
HSPLETPGVEPGPGHWALTRFDDVHFASRHPHIFSSSPGITINDANPEVS
EFFGSMIAMDDPKHLRLRNIVSRAFTPRVVARTETSVRERARRLVEKMIA
DNPDGTGEVVADLAGPLPLQVICDMMGLPEEDHQQIFHWTNVILGFGDKD
IATDYEEFVKVAMDIGAYATAHAEDRRANPQEDLTTALVQAEVDGERLTS
AEIASFFILLVVAGNETTRNAISHGVLALTRYPDERARWWADYEAMAPTA
VEEIVRWASPVIYMRRTLTEDCELSGTKMSRGEKVSMWYCSANRDEDKFA
DPWLFDVGRNPNPHAGFGGGGAHFCLGANLARREISVVFEELHRQIPDIA
ATEEPRRLLSPFIHGIKRLPVAWTPPERRMP
375141963YP_005002612.1 haloacid dehalogenase superfamily protein [Mycobacterium rhodesiae MRKHKRDVSAAVLFDIDGTLVDSNYLHVAAWIRAFADIGTPVDGWRIHRS
IGMDGSTLVSTLAEGADDDAHARAKDLHSQYYKETASLLRPLPGARELLE
AVEKLGVQVVLATSAPDDELAILRDVLDCDNLVSATTSSEDVDTAKPRPD
IINVALERAGVEAAHAVFVGDAVWDVEACKRADVLTIALLSGGVSKCELE
EAGAHQVFEDARDLCQHLDDTPIAALANLVGAR
375141962YP_005002611.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDSNAVVWIVVAVVAIVVIAFVAWTIRNSRRRAEAERLRGEIGHRTEHLE
KRAAVAAETEARARAAKAEAEAKAAEAARLENTARSHREEVDTTREELDA
HRERVDKLDPKGSTAEHAPGKADEVRTDTATTMPQQPTASHERHRS
375141961YP_005002610.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MAVDPLRVLVLGLNYAPEPTGISLYTSGLADGLAARGHQVHVFTGLPHYP
QWQVAPGHDSGSDTGPETNPRVCHLPHHVPSPPSMAGRIKMELTFGRGLA
QADWGDPDAIVAVTPALLSTAAAIAKCRSSRRRPPIGVWVQDLYGLGVAE
TGAAGGPASSVISRVEKTVLRSADQVAVIHDRFKSHVVESLGVRSERVSV
IRNWTHLRPLDRSARVRARRSFGWADDEVVALHAGNMGAKQALENVIAAA
ATAESHTKPVRFVLMGDGNQRAKLEQAGAGISTLEMIAPLPDARYREALL
AADVLLVNEKATVGDMAVPSKITSYFTSGNPVVAATRADSITAAEIQTSG
GGLVVAPESPVDLLDAVEKLGRDKDLAAQLGQAGMDFCTRTLSQTTALDH
FEEWIQRLAKTASGRRTDTRGVLHA
375141960YP_005002609.1 GDP-mannose 4-6-dehydratase [Mycobacterium rhodesiae NBB3]MTKRALITGITGQDGSYLAELLLAKGYEVHGLIRRSSTFNTVRVDHLYVD
PHEPDAKLFLHYGDLSDGARLVTLLAKISPDEVYNLAAQSHVRVSFDEPE
HTADTTGVGTVRLLEAVRMAGLNCRFYQASSSEMFGATPPPQDEDTPFYP
RSPYGAAKVYSYWITKNYREAYGMFVVNGILFNHESPRRGETFVTRKITR
AVARIAAGLEQYVYMGNLDAVRDWGYAPEYVEGMWRMLQTDEPDDYVLAT
GEAYTVRDFLEIAFDHAGLNWQDHVRFDDRYLRPTEVDSLIGNALKAERK
LGWKPLVHTPELARIMVDADREALKHAGGQWIDTPDLPSWPIS
375141959YP_005002608.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium rhodesiae NBBMTDDTRAFALDRGETIYVAGHRGLVGSAIWRALQTRGFGNLVGRSSDELD
LTDRAAVFGFISDVRPSVVILAAAKVGGIKANNDFPADFLSENVRIQTNV
LDAAAAIRTPRLLFLGSSCIYPKFAPQPITESALLTGHLESTNDAYAIAK
IAGIIGVQAVRRQYGLPWISAMPTNLYGPGDNFSPTGSHVLPALIRRYDQ
AIADGASSVTNWGTGTPRREFLHVDDMADACIHLLERYDGPDQVNVGTGK
DITIAELAGVVADAVGFDGDTSWDTSQPDGTPQKLLDVSLLRSTGWEPKV
TLREGIRSTVDWYRANRAAIRT
375141958YP_005002607.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAAKWSLAGFSGAGYDKGRGPLTQILWFAVSGLILAHWWCPNAVRCTVL
RWFGAEIGPGTLIRHRVRIHWPWKLVIGANTWVGEGAWILNLEPVTIGDD
VCISQEALLCTGSHDRRSPTFEFDNAPIRVGDGAWIAVRATVLRGTSIGC
NAVVGATALVASDVAPGTTVLAPRAAATNR
375141957YP_005002606.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MRILQIVTLVSPDSAYGGPVRVAENQCTALLSRGHDVHLAAGVRGYDAAP
DMVGAVPATLFPVRTTIPGIGFAGLRAAGLVRWVRRHAGEFDVAHVHLAR
DFVTLPAALALVRAGVPVVAQPHGMIDASDRMLARPLDHYLTRPVLRAAS
SVLHLTPREFDDLAGIAGDSIALRELHNGVPETTVSADVERTVNGEVLFM
ARLHPRKRPTLFVRMAAALVEAGVDAHFTLVGPDEGEGAAVANLIDEASL
HGRVTYEGPLPPAQSIPRMSDAKVYVLPSVDEPYPMSVLEAMSVGLPVVV
TDTCGLAPLIAASGCGLVVASDDIESLVAAVRTILETPGLAGEMGENSRR
TVAERLDMSAVVDILEQNYRRAIFTREPVR
375141956YP_005002605.1 Secretory lipase [Mycobacterium rhodesiae NBB3]MIAKSKPMRASVAILIVGVVCALLPGCSANDAAQQGQSTSPTGEQPLEIS
PEAKSRRGSIVESQPVATPSPPLADLKSKQFTVVYRSVSGIDGTGRDVSG
TVVVPEGTPPPGGWPVIAYGHGVTGIDDACGPSGYPDLLGYDLVVASLVS
LGFVVTLSDYEGLGHPGTHPLLEPRTAAFNMIDSVRAAREIAPSASTKWF
AVGISQGGQASWAANEFAGEYGDGLELLGSASMAPVVDMSKFATLAESGW
LSMEQQALLPMLVHGLRATHPDLDPTDYLHGALSRNTDVWLACTGPLVQQ
RLALSGELRETDSTPVSKEAGEKLERIFAEYSMPQRPATAPMLVITGAND
DTVRAQWVRTAVENACGRGDVVEFTVRPDEGHSNLNGGPRLSQWLTERLD
GAAPVDNCSEV
375141955YP_005002604.1 Glycosyl hydrolase family 71 [Mycobacterium rhodesiae NBB3]MVFAHYFPPYPISLDNVDPAVDYYSTNYLDPDGQNGQYSEFGGMLRDRPL
PRAPRSAANWRELDLMQEVAQASAAGIDGFSVDILTPAASDIWVADVPAM
LLRAAGLANPNFKIMLMPDMHGELKNLTPAQLAGEMAALAASPSAFRLED
GRLVVSPFYAENWSPDLWRMFLHEMKSTHGLDVALVPVFLEAREDLIDAY
HDISFGMSAWGGRNPAFNPVTGFPLAAIERVRSFNQLWMQPVSMQDYRPV
QKIYDEAENTTNLRNTWQIAINGDADWVQLITWNDFGEGTAFAPSVQHGT
ALLELNALYVAIYKTGIAPPAAYDRVFVTHRTQSVGVSTFPRQRALAALR
DGSVPARDTVEALTILTGPAQVTVQVGDQTTVCDAEIGVSVCEAAIGALD
NPEVEVNVRVSRGDQSVLELTSPHRILSAPSVQDLTYTMSESRVG
375141954YP_005002603.1 capsular polysaccharide biosynthesis protein [Mycobacterium rhodesiMNWRKITRRSLPIVAGVVVGLVASIAISSLLPQTYEANSRLFLGSPASAD
SAGAYNGDLFSQQRAATYAQLVGNRDLAVKVIDDLGLTVSPEELATQVTG
AQVPKTVLMEISATDSSAQGAANLADAYANNLVAYIKRLETPVDSNQPTS
VVTVVQQAETPSAPVSPSYVLNALLGMLLGAVVALLATWLANKLDKTVKS
EEQLSDVTGVPVLGVLPRDSARTRTPMDASADATSPYAEAVRQLRTNFLY
SQGDSPSATVAFASPTSAISTTATMTNLAIALDGIGRRPVIVDASLRDSR
LVKYLADNSDRGLAQVLSGEVTIDDAIQQLPQTDVRVVFGGNCKGASSDL
LASDEMAKTLNALRQWFDHILLDTPGVLGATDAAVVGLGCDAVVLVAVSG
KTRVDELTRTKETLHNVGVNVVGAVLTEAR
375141953YP_005002602.1 capsular polysaccharide biosynthesis protein [Mycobacterium rhodesiMDFRRYLDFLRGQWEWIAIATTAGGVIAMILALTATPKFAATAELFLATP
GYSGVASIDTADNSPFQADAFSQQRARSYVELATRQDLARRVVDNLQLPM
SPADLSSAVSARVRPDTVLIAVTVKASSPVDAQNLANAVTIQLADDIRRL
ETPAGMRIPNVDPVITQPAEAPNRPTDPNIAVYALLGISIGFLVGVTGAV
VGQRRRFITDARTVEAVGGLPVLGVVEDSGERGLDWSLAALSIEHALPVE
RPVILAVTEANEDAGESAAATIELTAALACFPDIIVVDASRALERIDDVS
YGLRDEVDQVLVVVVTGRMRQSELRAAVERLRAHDLSILGAVLAPPARLT
NSYVNQKFSVSSKRRVAE
375141952YP_005002601.1 lysophospholipase L1-like esterase [Mycobacterium rhodesiae NBB3]MNRSSTLRTLCACWLTATLCLGSILLWRIADGDAPNVTATLPWSGQKPAS
LEFTYRPSLLVMGDDYASGYGGIARNAYPYILCNAVDVNCNVDAQTGTGL
LNDGRAYSPDVDRLIERLARDREWYSVDLAIIDAGRNDAQAPLTSLSRAL
DKYLKRVGELWPDARLVVLGPANLSKEQAPDYPLRVAAMRDVVTRHGGIL
IDPAAEGWYDDVDLSTIRAEDGLHPTPLGHQLIARKIAEALQRNGIIETD
EG
375141951YP_005002600.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGSVGVVSERDTLGVDGGGAIAATSRHDWRTLPAWLLATWVAIAMIVVL
PLGLVSATPSDGRPVWVVALSVTTISGLRYAWIIADGRRRLHEMSFWVFV
YVFLGLAPLVQLRTQQNPGTTPRIDPALNQPAMVVVLVGIAAFCVGLGLA
MPRRSWSPGWTVSDTPHMWRTVMLAAFALALDAYFISRVGVGTLFSSRGD
FLLALQGNWAETSVAAMISAFTGMTLLVAFIAMVNLVRRQQTREWPLIAL
TVVVGAALAITINPLSSARYVFGTVALAVAATFGLFATAKRFRGIAILWV
VVLIVAFPLADAFRYSSTAEFKSGSVVESLTSPDFDAFAQINNTLLYVDN
HGITNGNQAAGVLLFWVPRRFWPEKPSDTGILLSESRRYDFGNLSAPIWS
ELFINGGWLALVVGMLGLGWLVRSRDNGIEGSLQNARAPGIIDCVLPFYL
MILLRGSLLQAMSYLLVIVGSTIFVSRWKRVAPR
375141950YP_005002599.1 lysophospholipase L1-like esterase [Mycobacterium rhodesiae NBB3]MTKARLRIFSALLVLSLGGTTAAAIVDHNGAAEGAQPAPPASAMPSPHAQ
RQDNRPPLLVIGDSFVAGAGVAYEGETYPALLADATDMRLMVDGQGGTGF
INDARGTGNGHTSKLIDRLAADGEKFPDASLVVIDAGRNDLRFPIDQVGD
AASEYLNHARAQWPTADIVVVVPTFITPDAFERYEDVRNRLENSAAKIGA
IVIDPIAEGWYDNVDVSTLLAADRVHPNSEGALRIADRMEKSLRSLGLVR
SAA
375141949YP_005002598.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDHVLEAEAEVATPSQPKSLLGKIAGLISSQPLLIAQMFMSASGAGAMV
MAAAAMQAAEFVTFSLLTLVTVTLIGAVRSVLFQPALIEMRQNSDSHIHV
RTALIGALVASGIFAAAAFALGVRQPLWLAVLALTNVLPIAAEWLRIRGM
ALDERVSVMRSDGLRFAATMFGVVVLFFSTDALVFTLFVNLTYLITVGYL
ALRLPAVSAHASPLAFWRPASAQLADFSFGQAVSTIPLLVLGGFGPSVYI
GGLRLAQTLLGPLNMVLSAAAVNLLADGATKESHADPRELIRRGRKLALG
LGILSPTLVLALLAFLMMTGFSFRGVDNRSLIVGVALVGALFTTSGLGLV
DTFIVRLLGHHAGPTVGRILLVIVTGTAYLWGYHVGGTDSSLIYGFLVGA
IANPVFFSLPAAVLYRRYKAGTLTAAP
375141948YP_005002597.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKVGWADVAFAGTRTSLLAGPLDHKGEDYAKAALRAVAERGPSARVGLIP
SSTTNKWEFRPDEFARIATIDPLPVPEMLRKYEQITAEASVGNHPLVLVF
CGDYVMFSADHGFGDATACLEVVALASGSDVDGYLESNDDLPLKKAVNAV
VSKSPSTALKALRGQPVSPPEDVPHLRTYPKADVRDIVMSFVRTEPGTFN
TLRKLRKESFPEVSMSAAVSYLIRRAFADHGVELTDDLGVLVDLRRFLPE
GTVTLANLPGIAEVTAPVSSTLEEYGKAYNAAVSTPAPLLRLAASLLKKR
ILPSGQSGTESADYPDRARTIFSDPSLHPTMKKIRWSDRGDGCMYILIND
PGVPHQIPITTMWDAQGRLNITASYYSASFDRAVIDSILDDVAAQPLRYL
ESAAVS
375141947YP_005002596.1 3-oxoacyl-ACP synthase [Mycobacterium rhodesiae NBB3]MGDRISTGMSFAGLGAVTGYGWGKDALWNGLLSGKPAARLCRIDDDGGEE
SGWLARIPEGGAPEDGDGLFIRSYLSSCREAIEDAHNRGWVPGNRVGVIR
GTTFGDSYAFRDFYRSYSGSRREFVGSVLTSTAISMLMKENDFHGPATEV
SATCSTGLVALLTAKMWLEAGMADDVIVSTTDLSFTPEILSGFVNLGAAV
IDEEPLAVCRPFQSGSRGFSPGEAAITFVMSNRVETPYFRLLGAAMTADG
YHPTGMDTSFARVKESVATALSSAGVDRSEIRYLNAHGTGTEQCTKAEVT
VADDIFDGDLDIYALKPLVGHCLTSAATIEIAGAALAEQHGKIPAPPAFS
ERHPRLIDGPTEMEDGLTLKLSMGMGGYNTAAILGSR
375141946YP_005002595.1 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferasMSSSLDSFEGTAALRRKVDLVRPLEQSVPPTKAAVDMPSGVFERSTWQRR
YAATLAVSDFVVVSAAVLLSQYVRFGPTWTPPDYPQYYVPAYSALFIAGW
LCVLAAFRSRSPRIIGTGVEEYRRVVSASLSTFGVIAIISLLLKLDIARG
YLALALPVGAVGLVLTRWAWHRSIIRQRSKGRCRTAVLAFGELDAVEHLV
SELTQNESDGYQVVGVAVPGYGPSRGEHVTIDGHVIPVVGDEAEMLRAIR
THGADTVAIAGTEHFGVRGIRRLIWDLEPMGVDLVVSTGVMDVALSRLVM
RPTAGLPLLQIEGPQYRGSKKLQKRAFDLCFAFAVLVLTSPVLLAIAVAI
KLDSRGSVFYTSERIGIDGRPFSMVKFRTMVADADRQLLSLLASNESDGV
LFKMKEDPRITRVGSFLRRYSLDELPQFINVLLDDMSVVGPRPPLRREVE
SYDCDVLRRLLVKPGVTGLWQVSGRSDLSWNQAVRLDLSYVDNWSMIGDL
LLIAKTVGAVAQKKGAY
375141945YP_005002594.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQTTQQYLLNQDLRVSADPRGGAVADEHIAGYGRDAGKPGIRRTT
375141944YP_005002593.1 plastocyanin [Mycobacterium rhodesiae NBB3]MKKILVLCATACLAAAIAACGSESSYTTSEGDTGTATATASPETTGAAEP
AGPTITMVGMSFGDPITVAPGAKITVKNDDSAEHSVTSRTEGIFDVHVDA
GEQGTLTAPSKPGEYAFYCVYHPSMKGTLIVK
375141943YP_005002592.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTRSLILLVAAMLPLAGTSAVAAADPVPPTCTYNLSPPQVVDVSGTSMVT
ATLSPGACDRSNVYLSVACVQLQGSPESAKCAQNNGVLTAQVFYAPYRPG
ATYVSTGRGCANTGNPPQPVCTPVGPVTASF
375141942YP_005002591.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGVPTGHEDIERTRTLWFALLLTLANGFLDAHTYIVRGGVFANVQTANV
IFGAIATSEGKWFAALNHLWPLMAFIVGMALASHIKSGRVERFLPHALRW
TIGAQAVALAIFGFVPADVPHSYVTVPISFLAAMQIGLFRNIGDLAYMPV
ATTGNLMRLMESWYDAFVEKNAESRRAFGVYGALISVFGLGALLGSFASV
AWGVHAIWLPAGFLAFTLCLFIIDERHLR
375141941YP_005002590.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MRVVQVANFYGPRSGGLRTAVDRLGAEYCARGHEVFLVVPGRVSECHELT
SGVVRISLPARLIPFTGGYRAVLPGRVTELLAQLAPDALEVSDRLTLRSL
GEWGRRRDVVTTMISHERLDRLVGQVLPSRAARSIADAANRRTAASYDAV
VCTTAFAREEFDRIEATNVVTVPLGVDLDQFHPSRRSESVRQRWASPDQT
LLVHCGRLSVEKHAHRSVDTVASLRDSGVDARLVVVGEGPMRARLERQAA
RLPVEFTGYVGCRDTVATILATADVALAPGPHETFGLAALEALACGTPAV
VSRTSALAEILTADSGAAADNDPDAIAQAVTSIISRPERLRRNDARRRAE
HFTWPRAATGMLNALGAG
375141940YP_005002589.1 dienelactone hydrolase-like enzyme [Mycobacterium rhodesiae NBB3]MTPLQRYIAEEIATDHIDGLLSRREALRRLALLGVGTAAATALIAACGEN
KQSTSDGPVTSNAPATESAPPPGSQNAVATEPIAWAGPRGELQAAWAQAA
QPRGGVLVIHENKGLNDYIRSVAGRFAGIGYSALAIDLLSAQGGTAKFAD
PAEATAALGKLPPEDAIADLKSGIDELQRRVPGKKVAAVGFCMGGGFVWR
LLASGEPRLAAAVPFYGPTPDNPDFSGSKGVAVLGIYGARDQRVNASEPV
ARAALEKAGLVFELVTEPDANHAFFNDTGDRYNAAAADDAWRRVQDWFTE
HLA
375141939YP_005002588.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTWTPDTDALRGRVAVVAGATRGAGRGIAAALGEAGATVICTGRSSVSGN
EGSDYDRPETIEETAELVERLGGTGIAMQVDHLDTAAVSRLADRIRDDQG
SIDILVNDIWGAEVLKGGPAMWNRPIWEHDIDDGLRILRLGIDTHLITSH
RLLPLLISKPGGLLVEVTDGTKDFNDSNYRLSVFYDLAKTAVNRLAYSQG
HELERFGATAVAVTPGWLRSEMMLDNWGVTEENWHSALDPRRTDGPVAPP
GFAESETPRYVGRGVAAIAADPHRARFNQRSVTSAELARDYGFTDLDGRQ
PDGWE
375141938YP_005002587.1 N-acyl-D-aspartate/D-glutamate deacylase [Mycobacterium rhodesiae NMASPTWTAVSQTAGNSKNRSSDAKVDKFSNLFTDFVDTRGSGLFYGWVTY
DTIIRNGRWFDGTGAPSAICNIGIRDGHVVAITADELDQAGCPRVIDATG
KWVLPGMLDIHTHYDVEVLVAPAMAESLRHGVTTVMLGSCSLSTVHVDAE
DADDIFGRVEAIPREHVIGAVDDHKTWSNCEEYIAALQARPLGPNVAAFI
GHSDMRAATMGLDRATQKRQRPTRSEQAQMEKWLEEALQAGFVGMSSQQL
LFDKLDGDVCRSRTLPSTYAKPRELRRLKSRLRRAGRVLQSGPDIQNPLN
LGSQLFQSLGVFRNPLKTSLLSAADVKSNPYAIKVLGPLARLVNRLGGNF
RWQHLPVPFEVYADGIDLVVFEEFGAGAAALHLRDEVERNELLRDESYRR
EFRKQYESKFGMRVWQRDFFDAEIVGCPDEAVVGKSFGQVGLDRGGLHPV
DAFLDLVLEHGKALRWRTTISNHRPEVLKKLARDPGIQMGFSDAGAHLRN
MAFYNMGLRLLRHVRDAQNTGRPFMSIEQAVHRLTGELADWYRLDAGHLR
IGDRADIVVIDPERLDESLDAYAEAPVEQYGGLSRMVNRNDDTVTAVFVG
GRAVFLDGEPTDVVGAARTGRFLRAAHKAPAQAIDESELASVS
375141937YP_005002586.1 limonene-1-2-epoxide hydrolase [Mycobacterium rhodesiae NBB3]MSVEDTVLGMWKALSERDWETVKTFLSDDCIYLDVPVGPAAAARGPEDIV
KRLKIGIEPLASYENFNGLMVDNGTDVMYEHHEEWHWATGESAVLNFVSV
HKVRDGKITLWKDYWDMGALANHAPPTWMEDFANADMSWVFDATGLV
375141936YP_005002585.1 glutamine synthetase [Mycobacterium rhodesiae NBB3]MVAMTSRAAKPLAAAAIAQLEADGVTTLIGTVVNPAGLTHAKTVPLRRMS
TFADPGLGASPVFHVFAIDQTGIVFGDAIGVVGDQRIRIDLGGLRILGDG
FCWAPGGFFNQDGSPDPYCSRGTLRKVSERLSEAGIDAVVGHEMEFVLVG
PEGGELPSHMWAQYGLAGVLEFEGFVSDVTEAATNSGVAIEQFHPEYGRN
QFEISLSPQSPVDAADSLVLIRIIVGRIARRYGLRVSLSPVPFAGSVGSG
SHQHFSMKRKGVPLFSDGSGPAGMTPDGESAIAGLLAGLPEAQGILCGSV
LSGLRMQPGHWSGAYVCWGTENREAAVRFLAGGHGNPHGANVEVKVIDPS
ANPYLATAAILGLALEGIQRKLPLPPEVTVDPASLSEAQRQESGIAPLAQ
EQVAAIGTLDQSAVLRGILGDEVVDAVVAVRSYEQQNYGDLAPEELAEKF
RLAWSV
375141935YP_005002584.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFQFCALGAYDAVMSRIGPFADDDAAAWVVKSPDIGVAMAGFTNAVYNKN
RLPMRVRELARMVIALDNECVVCQNTRDSEGIAAGVDEDLYDHAAEWRTW
PGYSAQERVAAEFAERFASDHTGLRDDEDFWARAGEQFDDELLTDLALSC
AMWLGMGRMLRTLDIGQSCKITL
375141934YP_005002583.1 anti-anti-sigma factor [Mycobacterium rhodesiae NBB3]MSDFVTRTTESGVVVVQPTGRLNMSASPALRKQLGDIVEGGNNRIVVDLS
STDFIDSSGLGTLIASQKIAREAGGDLRIAAPTQQICTVLELSNLDQLLR
PYESADSAFDG
375141933YP_005002582.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MEGLTGPETLDEIQRTLDLAWTEHDVPEYTRMCIELAVSEIGTNIIAYSG
DGKPVLMRMVVHVQPDSVTVRFTDDGHPAPLDLTHISMPEEAAERGRGLA
LAHRVLDELRYWRDPQGNHWKLILRRSP
375141932YP_005002581.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAMIDAISQCVEGDEVSPHAIVDDLSANVRELPDGDHQ
375141931YP_005002580.1 HAMP domain-containing protein [Mycobacterium rhodesiae NBB3]MATISSNANAEQPGPRIPRRRYLGARLTVQGWLTVVLCVMGVIVIGSSVV
VAVLLHRTDIATRQLADTISPARSTAFQLQAWMRDQETGVRGYVITGNPR
FLEPYYAGRTAEDTAAAALRQRLSGHDDLLADLTAIETAVDQWRTSYAEP
VIARVSPGRPYPLSQGEADSGKAQFDQLRSLFDTQNENLNAARTVARTQL
QQDQTSLNRVLTGVLVAILATGLALSLLVRNAVARPVAAVAAACRRIATG
DFEARIPVDGPSDIRGIAVDADGMRRRIVDELETSQAARAELHDSEELFR
KSFNSSVAGKLMVIRANDQWSVERANPSAQDQLPGLHEAITDLGALMGQD
AVAELSTAADSLADDGSARLTLQLADGRSLDVSIAVIGDKPEGIQFVLHF
RDVTESERLRQLELEEMNRAAEVQRALVPGVLPATPGWGIGTFTSPARQV
GGDFYDVRVDQPSIVLSLGDVMGKGMDAGMLAAATRTALRSNDPATTPSD
VLNGAAGILDGDLRRISAFVTLSYVLVDMDSGGFRFADAGHGLLFVIRTT
SGTVERLSSEDMPVGVGNHWRQLSDRLALGDMILLVSDGVLDLWGGSIEG
LEDAIAQCANGNGMSPQGVVDYLCANAGELVDSDDVTAVALSRNG
375141930YP_005002579.1 EmrB/QacA subfamily drug resistance transporter [Mycobacterium rhodMTSTQADAAVADSNSPSALISPQRRNIIFVAVLLGMLLAALDQTIVATAL
PTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKLGDLFGRKAVFQASVLF
FLAGSILCGLAGSMTMLVASRALQGIGGGAMMVTAMAVIGEVIPLRERGR
YQGALGAVFGVTTVIGPLLGGFFTDHLTWRWAFWINVPIGIIVIVVGTMA
IPSLAKAAKPVIDYAGMLFIGLAASGLTLATSWGGSTYAWSSPMIIGLFA
ASLVALAIFVRVESRTPEPILPIRLFASPVFTVCCILGFIVGFAMLGALT
FLPTFMQFVNGVSATESGMRTLPMVAGMLITSIGSGQIVGRTGRYKVFPV
AGTAAMALGFLLLSQMGAATPLWQQSMNLFVLGAGIGLCMQVLILVVQNT
SSFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLTSRIPGALAASGAP
VRAADSPQALHALSPEMAAPIVDAYADSLGTVFLCGVPVAIVGFVVSLFL
KEVRLREIETVSASDLGEGFGMPSTESPEQILEVAIGRIFRDSPEIRLRS
LAQLPGCHLDVTQMWALLQIYRQNQVFGMATLTDIAERLRVPYEVIEPTF
DRLIRDGFVLGTAGKLWLTQSGMKQVNAISGLIVGRIVDKLATSSSFEGR
PDRLQVEAALERIVHRMLLQQSWTEDRGDLVAAR
375141929YP_005002578.1 bacterioferritin [Mycobacterium rhodesiae NBB3]MQGDPDVLKLLNEQLTSELTAINQYFLHSKMQANWGFTELAEYTRKESFE
EMQHAEAITDRILLLDGLPNYQRLFSLRIGQTLREQFEADLAIEYEVLAR
LRPGIIMCREKEDATSANLLEKILANEEDHIDYLETQLELMVKLGEELYS
AQCVSRPPGHA
375141928YP_005002577.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDFDLHSLILACDFRVDDVDQMWEWLKKHSDGLASIGAHHVVLYTSIWE
RNRVLVTIGIRHVRSMRDVLRSPAIFEWFNISGADDIPPIFGGEVVEKID
LYPPSPDEHVGRVVVGVMSSVDDVSALMVKLHDGVERFKRGGVRKIWVYR
ALDDGQEVMILQEIEDEDAARQWIEHPDAAAEWMSNAGFGPYPTQFVGRF
AHLMSIDEQS
375141927YP_005002576.1 bacterioferritin-associated ferredoxin [Mycobacterium rhodesiae NBBMFVCLCVGVTSHDVDKVVANGACTSKQIAEACGAGGDCGRCRRTLRAIIA
THHDSAGCPSKNNCPRKPANGRESKSVSR
375141926YP_005002575.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMILQIADDQRVRTLTLNRPEVLNAFNEELYLATATALTEAAADPEVAVVL
LTGAGRAFSAGNDLNEMQRRITDPTFNEQGSHFTTMISALADFTKPLICA
VNGVGVGIGATILGYADLVFMSSTARLKTPFTSLGVAPEAASSYLLPRLM
GRQNAAWLLLSSEWVGAEEAREMGLVWKVCEPDDLLPEARRHAEILASRP
ISSLMAVKQTIAAPTREGIDAATARENEHFAVLMGAAANAAALADFTGKG
K
375141925YP_005002574.1 PPOX class F420-dependent protein [Mycobacterium rhodesiae NBB3]MTTLDEAFALAAGESGLAVVSTVRADNTVQASLVNVGVLPHPATGHPALG
FVTYGKVKLANLRGRPQLAVTFRNGWQWATVEGRAELAGPDDPQAWVTDG
DQLRLLLREVFTAAGGTHSDWDEYDRVMAEQRRTVVLIAPTRVYSNG
375141924YP_005002573.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MEKVIIALQRADSDEAWCTRMRTDVAADLLELGLPGVAINVRDDVVRHSL
MTLTVLDPPVVGFVTVWAHQYYAEPVTAAVARLESEADRVAAYLVTESVP
LPPPVTAAGARTDGFANIALLRRPTDLDEATWRQRWHINHTPVAIETQST
FGYTQNAVVRALTPGAPAIDAIVEELFPEAAVTDLHAFFGAPDDDELSRR
MERMVASTTAFGANRDVDTVPTSRYVYRTPFVADNRIG
375141923YP_005002572.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSAESPDVAARIAPLEEIVERGQVWSRMAAKWGVENPVPPWKTSLDGMC
DALDRASCDENIPDFKQRRDEEDALSATVYSNLPYPENQLMSLAHSLVAR
GVIDEAELEERLASIRARLEA
375141922YP_005002571.1 thiocyanate hydrolase- gamma subunit [Mycobacterium rhodesiae NBB3]MTDHDHDHDHDRTVAPMVDEITDFEVLEIALRELCIEKGIFTAEDHRLMT
EFAEQIGPTPAARLVAKAWLDPKFKELALAEPMTASKEVGVDWLHPTGWG
TPSDFTAFQILADTRTVHNVIVCALCSCYPRPILGNSPEWYRTPNYRRRL
VRWPRQVLAEFGLYLPDEVTVHVQDSNQKHRFMVMPLQPEGTEDWTEDQL
VEIITRDCLIGVALPKAGVTTNMIVDTRPAIHPGNAG
375141921YP_005002570.1 Nitrile hydratase beta subunit [Mycobacterium rhodesiae NBB3]MSTAAERAAQLELTSRLRSAYPELPDAPTPDMLDPGRIKAYWKPVHDVGG
EPDAPMKYENKQYEEWEHMTYVMCEVLGWRGIWLSEERRRIGNVDVGRAQ
YLGLPYYGRWLIAVARVLVEKHHIGLSELSERMAEVKERYAGGLDGRKPE
AEPKSEGDGAGVKRNSHAEEADGKGDPGCYAGQAGEAKFKVGDPVVVREL
PVIFYTRTPEYVRGANGEIEALAYETPAAEDETWDREVKPEWMYVVKFNM
AELFYGYTGTANDVISTEIPERWLESAK
375141920YP_005002569.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTGSRVVEALKPPTPDIGAVARGLIAVLAMSLLALAVGSGAAAVWAAGA
GIVCASIALQDSPGGRVQLVAIVALQMGAAVFLGSLTSAYTVAFVIVVAV
WCLGAGMQWALGNNAGLVAAAGTALLVIAPTDVPSATSVALPTLLTIAAG
FVQAALVAVWPPQRWRTQSDALAWAYRSLAADARRIAADRDSPLEAAQLT
WLRDAFADTQATRRPAAYHGGHRLPERLMGALLALRGSSGDERDRISHML
NDAAVALDAIAENKHNARREAEHALVRVDTAVMALKGPEGPAAQRFSKQL
QEAAEFRFPDLLQPDVMNPLRAAMTEVRKHLTRTSPILRHAVRLSVAVAL
AVAADRFAPIAHGHWIALTVLFVLRPETAHTYTRCVGRVGGAAGGIVLAS
LVTTIWQPTGVIAAMLTVACLAITFWVVRFGYLATSAGVAAAVVFLLEID
TAAAGATVEDRLFSVVIGGGLAVVAHVVLPDHALTRLRQRAGELLKTEID
YAATVVRAFVHELDHPADAMSAAWQRAFRARAAFEAASGAARMDSRELRR
WLRSYRAALNAVTSACTTLERSLPTQSPTTLTPDFITAVDDYVEALRGAP
PNPALPWTVDVAALTAAEKNVRDRAGSLPGDIGAGRVLVSEIATITRSLV
GIVPNREPTSAG
375141919YP_005002568.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVQWTDLGDVSSAEVDRMRAVYEPLAGAVRELVDATIRTEVDAETVAAVK
AEIDAATARLRAVQCDGPFGVRFTAGGDRMAWGNPVIGIRNPVAPPLTIH
QDSDGGVFTDFHLGAAYEGPPGHVHGGVSALVLDHVLGEVAANPESPRFT
GTITLRYLRPTRLGRLHAEARITRTDGFKAYATGHLADDEGITVEAEGVF
IQPKWARG
375141918YP_005002567.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDIARLSATSLAVAALVIGVTASGCSKGDDSKSESSTSSAASSTTSAEAT
SSGESAPPETSAAPAEPADYGKLLLPPADMGDDTQTPGGVQLNPGGNPGA
AQVYASSDGKQKIIDTILVFPDVAAAASNFDSNSKTMNEVTTGAPEPVEV
GDQGVMAIGTSPDGTKSVTVVLFSQGKALVSLNFEGEPNDPVPPDVAKDI
ATKQAALIADGLPEE
375141917YP_005002566.1 TetR family transcriptional regulator [Mycobacterium rhodesiae NBB3MAARADSADPRAERVRSRLRAAAFALAHEGPVDALTVGDIVTRAGVSRQV
FYQHFRDRDDAVASAVSAAFAAATADHSGDARTRILRLFDYAAEHRSAYR
NVVPSAVTQRVAAAFRVELLPACEEIAAQGIPALTAVAGLTEEAVTRFLV
GGFMEVLRSWMEDPDSTDLVDRAGAALDTVNALLGLTPSTNGLHHG
375141916YP_005002565.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGRHHESESHPAGDRAAIRTMILAMIGLTIFVVAMIASYSGAFAKPTLHH
LTVAVAGPQQLTDGVRSQDGLAVNAVADDAAARQQVYERSADAAFVVGPT
GDMKIYVAGGGGRSVAGAAETVGRAIAGKAGLAATVDDVAPTAPGNPSGT
VEFYAVIFISIGASVGAAVFGRLMGSVRNPKTLVLRTMTLAGYSALLAGS
VTVYVDGVLHAVVGHPWQVFGALWLYALAVGGAVSGVAAAFGTVASMALT
LFLVIIGNAAAAGPVGRPLLSGFYADFNAIVPQGSGVSLLRSIEYFGGNG
AYTPVVTLAIWGAGGCLLAVIATASRVQAGVLSGCGHRRQRS
375141915YP_005002564.1 cytosine/adenosine deaminase [Mycobacterium rhodesiae NBB3]MYSPAVAIDDNDLEYLSRCVELAREALDEGDEPFGSILVDHTGRVLFEDR
NRVKNGDHTRHPEFAIAQWSVANLTPNGRADATVYTSGEHCPMCSAAHAW
VGLGRIVYAASSEQLTRWLSEWGCRPPPVAPLPITTVAPHTDADGPAPEY
ADAMKALYEKKFRP
375141914YP_005002563.1 glycosidase [Mycobacterium rhodesiae NBB3]MTEPAWVQHAIWWQVYPLGFVGAYPADTPPTADEHRLRRIVEWFDHAIGL
GASGVALGPIFASQTHGYDTTDHYRIDSRLGDGGDFDHLVEEARKRGVRL
LLDGVFNHVGTDFGNSSWFRKRRNGSGFDTFEGHDGLIALDHDNPEVVDY
TVGVMTHWLARGADGWRLDAAYAVPDRFWAQVLPRVREAFPDAWFVGEVI
HGDYSARVRDGGFDSVTQYELWKAIWSGLNDQNFHELDWALVRHNEFLDD
FVPMTFVGNHDVTRIASRLENTKHLAHALVLLLTTGGTPSVYAGDEYAYR
GVKEERFGGDDAVRPEFGSPPEGIEQLGHDELRLHQFLIGLRRRHLWLHT
ARTSPLQLTNRQYVYQTRNGADSLVVALNIDDEPLSVSLPEVGVAQGEIL
GGSGAPPQHIVTAAEVEPHGWLIIAPTARP
375141913YP_005002562.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGEFLTSDGADPFDLRRFVDAQERVYSSVLSELRDGRKRSHWIWFIFPQL
KALGRSPTAIRYGIASLAEASAYLDHDVLGPRLRECAQLVAGIEGSSADE
IFGWPDNLKVRSSMTLFARATADNADFRAVLDRFYDGAEDALTVEQLAR
375141912YP_005002561.1 family 3 adenylate cyclase [Mycobacterium rhodesiae NBB3]MSRMSIQSKLLMMLLVTSVLSAAVVGAIGYQSGRSSLRESVFDRLTEIRQ
SQSRQLREGIGDLKNSLVIYSRGATSIEAIGAFTAGFDQLNAATINPAQQ
QSLVDYYTQQFAPQKAAIGEEVDVDAVLPRTNASRYLQAYYTAPFADWDK
SIQFDNAGDGSTWSAANARYNDFFREIVQRFEFEDALLFDTRGNVVYTAY
KGVDLGTNVFTGPFKGGLLASAYKEALESNTVDYVGITDFGEYEPADEPT
AWFLSPVGPQGSVEGVLALQFPISKINRLMTMDRRWQESGMGETGETFIV
GPDDLMRSDSRMFIEDPEAYKRDVVDAGTAPDIAAEAIQRGGTTLIQPVP
TEATKLAQRGQAGTLIAQDYLGQETLQAYAPADIEGLRWNVIAKINTAEA
FAPVSAFTRTLVLSTVAIIFVVCLAAMLLARLFVRPIRRLETGAQKISSG
DYNINLPVHSRDEFGDLTVAFNEMSRNLAIKEDLLAEQRRENDRLMLSLM
PEPVVQRYREGEETISQDHQDVTVIFADIVGLDDLSPQLSSDELLTIVNK
LTRQFDAAADNLGVEQVRTLHNGYLASCGLSVPRLDNVRRTVDFAIEMQR
IIERFNGETGHDLSLRAGIDTGTVTSGLVARSTLAYDMWGSAVNLAYQVQ
SGSPQPGVYVTSTVYDQMRDSRSFTAAGVITVDGEEQPVWRLAQQ
375141911YP_005002560.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMSSVFDSPWFYWAVAVAIGFPVCLVALTEVHNALLRRSNPLARPVHLVRN
YILPLGALLILLVQAIQISGEATPVRVVATVFGFVVLVLVLSGLNATMFA
GAPEGSWRKRIPSIFLDVARFAVIAVGVGIMLAYIWGANVGGLFTALGVS
SIVLGLALQNSVGQIISGLLLLFEQPFQLGDWIDTPTARGRVVEVNWRAT
HIDTGGGMMIMPNSALAAASFKNFSRPPGAHSLSVSTVFSVDDPPDDVIA
MLNRVAVMLPQLRPGATPSSVRSGAMDYSTGIPLRSPADDFAAKSQFLRW
VWYASRRAGLHLDEAEDEFATTERVQTSLRIIAPTLRLTHEDQEDLLTRV
RLTRYGADEYIQYSGQIPKRMTFIVNGKVRLAATDDAGGIIPVRTLEAGD
FLGQTTLTLEPVSAAAYALEEVTVLRIDREVVEDLVSRKPVLLQDFGRAI
DERRESLRRALAAAKD
375141910YP_005002559.1 alpha-hydroxyacid dehydrogenase- FMN-dependent L-lactate dehydrogenMKRRPPRPQELAALLQFQKPRLSPTRRRLDSALTIEDLRRVARRRTPKAA
FDYTDGAAEEELSLARARQAFRDIEFHPTILRDVAKVDTAATVLGDRVAQ
PFGIAPTGFTRLMQTEGEVAGAHAAARAGIPFSLSTLGTASIEAVKEANP
HGRNWFQLYMWKDRDRSMALVERAAAAGFDTLLVTVDVPVAGARLRDTRN
GMSIPPALTLKTVLDAVAHPRWWFDLLTTEPLSFASLDRWPGTVAEYLDT
MFDPTVTFDDLAWIKSQWPNKLVVKGIQTLDDARSVVDLGVDGIVLSNHG
GRQLDRAPVPFHLLPRVARELGRDTEVLLDTGIMSGADIVAAVALGARFT
LVGRAYLYGLMAGGEAGVDRAIEILSGQVSRTMRLLGVTSLDELQPGHVT
QLRRLVPGES
375141909YP_005002558.1 putative esterase [Mycobacterium rhodesiae NBB3]MAKALRQVMKGGLVAVMKFNVRLRGKWLRRLAAGAVAAATLPGLIGFVGG
SATAGAFSRPGLPVEYLDVFSPSMNRNIRVQFQGGGPHAVYLLDGLRAQD
DFNGWDINTPAFEWYYGSGLSTVMPVGGMSSFYTDWYQPSRGNGQNYTYK
WETFLTQELPGWLEANKGVSKTGNAVVGISMAGAAALTYSIYHPQQFIYA
ASLSGFLNPSEGWWPMLIGLAMNDAGGYNAESMWGPSSDPAWKRNDPMVN
INQLVANNTRIWIYCGSGTPSDLDTSGGGGNLMAAQFLEGLTLRTNVSFK
DNYVAAGGTNGVFNFPANGTHSWGYWGQQLEQMRPDIQRVLGAQATT
375141908YP_005002557.1 ATP-dependent protease La [Mycobacterium rhodesiae NBB3]MAEAKSVPVLFLSESIVLPGMVVPIELDDAARAAVDAAKASESGELLIAP
RLEDRYASYGVLASIVQVGRIAGGSGTAAVVRGTKRAHIGAGANGPGTAL
WVEVTEVEEPPATDEVRTLAADYKKLLLAMLQRREAWQIIDFVNQLTDPS
ALADTAGYASYLTQVQKRQLLETPDVGARLNALIEWTGDHLAEVEVTDKI
ADDVREGMEKTQKEFLLRQQLAAIRKELGEGEPDGSDDYRARVEAADLPE
KVREAALREVGKLERSSEQSPEGGWIRTWLDTVLDLPWNVTTEDSTDLKS
AREILDADHHGLEDVKDRIVEYLAVRARRAQRGMAVVGGRGSGAVMVLAG
PPGVGKTSLGESVARALGRKFVRVALGGVRDEAEIRGHRRTYVGALPGRI
VRAIGEAGSMNPVVLLDEIDKVGSDYRGDPSAALLEVLDPAQNHTFRDHY
LELDLDLSDVVFLATANLIENIPSALLDRMELIQIDGYTEDDKVAIARDF
LLPRQAERAALTEAEVTVTEDALRKIAADYTREPGVRQFERLLAKALRKA
TTKLASDDDQSLTIDEPDLVDYLGRPRFLPESAERTAVPGVATGLAVTGL
GGDVLYIEAGATDGEAGLQLTGQLGDVMKESAQIALSYVRAHAEQLGVDP
KSLDRRIHVHVPAGAVPKDGPSAGVTMVTALVSMATGRQVRSDVGMTGEV
TLNGRVLPIGGVKQKLLAAQRAGLSTVFIPQRNEADLDDVPADVLESLEV
KPMVDVADIIAQALAPAEAEASVAA
375141907YP_005002556.1 TfoX N-terminal domain-containing protein- partial [Mycobacterium rMSYDEDLAHRVRELLAGERGLDEKRMFGGLAFLIDGNMSVCVSGQGGLMV
RVPREDTEKLLDRDHVEPMIMAGRETRGWLRVSVEGVKTKRQLQGWVKRG
VDYAKSFPAK
375141906YP_005002555.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPAASTTKLLKVLLEQAGTTYAEQADITLGDKPMPLFQLLALCMLASKPI
DATIATQAAREVFAAGLRTPNAVAEADRATMIAAFGRAHYARYDESSATR
LTDIAQTVRDEYAGDLRGLADRSRHDVTEARRLLKQFKGIGDTGADIFLR
EIQDHWTWVGPFFDDRALDAARELGLPHRADELGGLAPRSNATLAAALVR
CSLDADLRNRLLQAT
375141905YP_005002554.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRIGTSGWSYDHWAGVLYPPKLPVAKRLGVYVEEFDTVELNASFYRWPK
DATFEGWRQRLPAGFTMSVKAQRGLTHYRRLRSPEPWVERFERCWTALGD
RREALLVQLHPALERDDELLAHFLTVMPDWIPVAMELRHPSWDDKAVYSL
LERHNAAYVVMSGAGLTCVPLATSRLVYLRLHGPSQDSIYAGSYTDDELR
EWADRIAGWHDEGRRVLVYFNNDLGGHAIRNARTLKDLLA
375141904YP_005002553.1 NAD(P)H-nitrite reductase [Mycobacterium rhodesiae NBB3]MTTSSTFAIIGGGLAGAKAAEALRDKDFDGHVVLYAAEEHLPYERPPLSK
EFLLGTKQFGDFTAAPSAWYRDHHVELQLGTEVSAVDRAAHTLSLPDGTT
ASYDKLLLATGSTPKRPPIPGADADGVHYLRTIDDAAALNSLLREGASLA
IVGAGWIGLEVAAGARERGASVTVVETAEVPLMAALGREVGEVFAAMHRD
HGVDLRLKTTVEEITTSGGRATGLKLGDGSTVTADAVLVAVGAAANIGLA
EQAGLATGNGGVLVDASLRTSDPDIFAVGDIAAAEHPVFGTRIRTEHWAN
ALKQPAIAAAGMLGKPQEYTELPYFFTDQYDLGMEYVGHAPAYERVVFRG
DLRGREFTAFWLDAENRVLAGMNLNIWEGLDDIKSLVRSRERVDPDQLVG
A
375141903YP_005002552.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRIPPAVVAAVAMLAVGCSGGAVTDTGESHTPVPAGAAPPPSAPAPSNAH
LANAFDYVAYPPTGTTYYFTSPSGAWACAIVPRVKAGCQSATSFPATMGI
TGEPDSVPGADGGAAPPNALVVPREGAAQFVALQAPELALDPGPGKELPF
NRILAVAGFRCNVQEATGVSCLSEFSGNGFTFSTDGLVPRYTDVPVEAP
375141902YP_005002551.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MKIEAGQVAVVTGGTSGIGLALATVLARRGVNVMIADVREDAIPRAVDAL
SQHSGRVVGVHVDVSVDADVDALADATIERFGRVDLVYNNAGVVCEQAPM
WEQRVQSWRWLIDVKLMGVVHGIRTFAPLLIAQGSGHVLNTASVGGLIPL
PSLGPYNATMHAVVGLTETLDAELKAVSEHLGATVLCPGLVDTPLGQNSA
ALVPHGAAATPVSGQTEAMRGAISPLVVAEAAITAVEAGRVHAVVGPGAG
LVARGRVEALLADLD
375141901YP_005002550.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MDPRTPVLIGYGQVNQHDENPGVEPVDLMEAAARAAADPRVLEAVDSVRV
VNLLSWRYRDPGRLLAQRIRADGAATRYTGIGGNVPQTLVNKACLDIQSG
RADVVLITGAETWRTRSRVRKAGGKLDWTKQDDSVPIAEGSDEGIELAGP
SDLRINLDRPAYVYPLFEQALRIAAHESSDDHRRRIGELWSQFSAVAAAN
PHAWSREALSGDEIAEPSPSNRMVSWPYTKLMNSNNMVDQGAALVLTSVE
KATYLQIARDGWVFPYAGTDAHDTYHISDRAEFHTSPAIRIAGNRALELA
GSGIDDMALVDLYSCFPSAVQVAANELGLPTGDPSRPLTVTGGLTFAGGP
WNNYVTHSIATMAEELVANPGQRGLITANGGYLTKHSFGVYGTEPPTHEF
RWEDVQSEVDREPTRKAVVEWSGVGIVESWTTPFDRSGAPEKAFLAVRTP
EDARALAVIPSDVEATVREDIAGAKVQVNLDGTATLL
375141900YP_005002549.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MSTGLLASVRVLDLGGASSDGVGRLFADLGADVLKVETPSGSEARRALPG
VDGASIAFAVHNANKRSAVLDPGSADDRQRLIELAGTADIVVDSGTPGTA
SAFGTSCAALADRFEHLVALSVTDFGSAGPYRSRHATDAVLYAMSTALSR
TGPTTGRPVLPPEGVASGTAAVQAAWATLAAYFRRLRDGRGDYIDFSRFE
GVLQSLDPPFGSEGQAAVGQKPAGELWRGRPRNQHIYPIFACKDGHVRIC
LLSPRQWRGMRDWLGEPEQFADPKFDTIAARYAASRELNAAIADLFAPQT
MDTLVAGGQSRGVPVAAVLTAAETLTSEHFRAVDALTDVTITADVTVTGP
AGPIVVDGVHAGLVHPAPTVGADECAWASGPSSVEPADDDVTRPFDGLRI
LDLGVIVAGGELGRLFADLGAEVIKVESAAYPDGLRQTAPGMTMSRSWAL
THRNEKSLGLDLRHSEGAVIFRRLVADADAVFANFKPGTLDSLGFSYERL
REINPRIVLAESSAYGATGPWSDRMGYGPLVRAATGVTWLWTSPDAEPDK
FYDATTVYPDHVAARLTAVAALAAMIRRKHTGTGAHVHIPQAEAAVSQLA
TTYVAEAARSAGLAVTDDDAVHGVYPCTGEDEWCVISVRSDADRARLAKV
MGCHGLPRERAPFIAAVSEWTGTLDKADVTEILQRAGVPAGPMNRAVDIP
SDPQVSSRQLYTDMRHPLFDAPMLSETGPAPYTGIPAAELHPAPMSGEQT
RQICAEVLGLSTDDTDRLIADGVLFTQQAQQGSP
375141899YP_005002548.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMPQYGVAANAELARFASTAEQLGADSLWVGDRLLAAVAPSVGYAGKDTIP
EQFRTGIDPFIALAVAATATTRVRLGASVFVAPWYPPVQLARQLTSLDVI
SGGRLLPGFGIGWSPEEYQAAGAPFRRRGAQLDELLDALDRLWTTNPVAH
QGERWSIPESWVNLKPVQQPRPPIYLGAFTPAGLKRVGERADGWTGVVQV
PGGVSIDMLDWQRQAIDAAATAAGRDPSAIHTYVRINVAEGAPVEQVAEA
VQALAANGYPDAFVDLLYVATTTDAHLDWVERLLTR
375141898YP_005002547.1 phosphoketolase [Mycobacterium rhodesiae NBB3]MTTVAHNWHSAETHSLSDETLAQIDGWWRAANYLSVGQIYLLANPLLHTP
LSRDDVKPRLLGHWGTTPGLNFLYAHLNRVIKEREQSTIYITGPGHGGPG
LVANAYLDGTYSEVYSDVTQDTEGIRRLFRQFSFPGGIPSHVAPETPGSI
HEGGELGYALSHAYGAAFDNPDLLVAAVVGDGEAETGALATSWHSNKFIN
PAKDGVVLPILHLNGFKIANPSVLDRIPTDELRSLMIGYGHNPYFFEASE
DEDVADVHRRFASLLDEVLNEISGIKANAAERDERRPTWPMIVFRTPKGW
TGPDYIDGKKTTGSWRAHQVPLASARDTPEHLKVLADWLGSYRPDELFDA
DGRLDPAISELAPQGALRMSDNPHANGGMLLKDLRLPDFRKFGVDVPAPG
ATIAEATKVLGQWLTEVIRLNPDNFRIFGPDETASNRLQPVFDATAKQWN
ADFVGPEVDEHLARAGRVVEMLSEHQCQGWLEGYLLTGRHGLFNCYEAFI
HIVDSMVNQHAKWLKVTNHIPWRRPIASLNYLLSSHVWRQDHNGFSHQDP
GFIDHVVNKKAEIVRVYLPPDANTLLSTYDHCLRSRQYVNVVVAGKQPHP
NFLTMDEAVAHCTRGLGIWEWAGTEELGTDPDVVIATAGDVPTLEGLAAA
DLLRQHLPELKVRFVNVVDLMRLQDDTEHPHGLSNRAFDGIFTRDKPVIF
AYHGYPWLIHRLIYRRDGANNVHVRGYKEEGTTTTPFDMVMLNDLDRFHL
VIDVIDRVPSLQSRCATLRQQMVDMRIAARQYTREHGDDLPEVRDWVWPD
ARELAGREKINAAAATGGDNE
375141897YP_005002546.1 CAAX amino terminal protease [Mycobacterium rhodesiae NBB3]MSDQAVVAEPHPLTDQLSALHHFRIYADIAVVVVVLALTNVVAHFTTPWA
SIATVPAAAVGLLVLVRARGLGWTELGLGREHWKSGAGYAVAAVGLVLSV
IALGALLPWTRPMFMNNNYATISGALVASMIIIPLQTVIPEELAFRGVLH
GALDRAWGFRGVAAAGSLLFGLWHIATSFGLTSSNVGFTRLFGGGLLGTV
AGVVLAVAATAFAGFVFTWLRRRSGSLIAPIALHWSLNGLGALAAALVWH
LST
375141896YP_005002545.1 conserved protein containing a Zn-ribbon-like motif- possibly RNA-bMDEYDERVVAEPTRWLADEESKPAPEPLLRIQALVNTVELPTGPDRLADP
DDARPWLIDNGLMAAEAYLSDADLQLLRDVREALRAVLVRNSGGPAPTEA
QCKPLRTVAAGGVARAEVDADGNVGLVAAGDSVPERLVDLLLIMRDAQRH
GSWARLKVCGNDECRWAFYDRSRNHGGTWCEMSSCGNKLKNREFRARRKK
ANR
375141895YP_005002544.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADNDVEAAALPTTTDTSRREPMPRPSLVSQLMARLRADRLDRLIAVGVP
AAAGSAQAAHEARLVSTAERETIARSLRTAAADARGRGLLLSSRVPLHVP
NITAAGDMIDAVTLRLHSPGPVSARGMARLRQILSDGTGPMYRYGRGDLR
GRLGAALAAL
375141894YP_005002543.1 zinc-binding alcohol dehydrogenase family protein [Mycobacterium rhMRAWRVRRPGPMSTRPLEHVTADVPRPGPGELLVAVRACGVCRTDLHVAE
GDLPVHRQGVIPGHEVVGEVVEVGPQETPGAGFAVGDRVGIAWLRHTCGR
CKFCESGKENLCAQSRYTGWDADGGYAEFATVPAAYAHSLPDLYSDTELA
PLLCAGIIGYRALLRAELPAGGRLGIYGFGGSAHLTAQVALAQGAEVHVM
TRGEKARDLASALGAASVQGAYDRPPVALDSAILFAPVGDLVLPALEALD
RGGTLAVAGIHLSDIPPMNYQRHLFQERQVRSVASNTRADAREFLSFAGR
HHLEVTSPQYPLARADDALADLGAGRISGAAVLVV
375141893YP_005002542.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDIIATTQFLSERSTTLTSVGWIGYIIIGALAGWIAGKIVSGRGSGILMN
IVIGVIGALIGGFLLSFWFDTAEGGWWFTFFTAILGSVILLWLVGLVQKK
T
375141892YP_005002541.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLNMIRRVTARVATVLAFLTLVSLVSPAFGHAVECGAGTIYDPPTDTCIA
APLPPPPPPPPPPPPPPPPPPWNGDPTPYFSVGICAPIPFVSLCAGI
375141891YP_005002540.1 Fibronectin-attachment protein (FAP) [Mycobacterium rhodesiae NBB3]MDQQDAVRVHRKGLSKSLAIAALTGATAVALALPSIAQAQPAPTPAPPPP
PPSGNTFLQGPPPPPGAPAPPPPPADPNAPPPPPPADPNAPPPPPADPNA
PPAPPPVEAGRVDNAAGGLSFVVPAGWKVSDSTQLSYGQALLTKIAPEGA
EPPNDTSVLLGRLDLKLFAGAETDNTKAAQRLASDMGEFFMPFPGTRINQ
KTVPLDAAGMPGVASYYEVKFTDANKPTGQIWAGVVGEPVEPGTPRGQRT
PQRWFVVWLGTATNPIPQEEAVTLANSIRPYTAPAAPPPADPNAPPPPPG
APPAPGAPPAPGAPPPPPADPNAPPPPPAPPGVGVPVPVAPEAAPGMLPP
S
375141890YP_005002539.1 ABC-type sulfate/molybdate transport systems- ATPase component [MycMTDVSVRAVVENRGVDIEFAVAAGEVLAVLGPNGAGKSTVLHVIAGLVRP
DEGVVRVGDRVLTDTASGTHVATHDRHVGLLMQDPLLFPHLSVAANVAFS
PRSSPKDAARWLDEVDAAQLADRMPRQLSGGQAQRIALARALAAEPDVLL
LDEPLAGLDVGVAAAMRKLLSRVVVRDGRSAVLITHDVVDVLTLADTVLV
LEAGKVVEKGSTATVLAAPRSKFGARFAGVNLVLGTVGADGVLTTQWGQV
WHGVPGADTVAGSSAVALFKPAAVAVYRDEPHGSPRNTIEVTVAELDSHG
SAIRVRAEEQPDGAPGLAADITAGSASDMRLTPGDRVFFSVKAQEVTLLP
SS
375141889YP_005002538.1 molybdate ABC transporter permease [Mycobacterium rhodesiae NBB3]MICEAHRGTVRRDFRSSKALTPTAVLPRWIYVPAALGALFVAVPLVAVAT
KVDWPRFWSLITSPASVSALELSLRTAAASTALCVFLGVPMALVFARSDA
RVVRMTRPLILLPLVLPPVVGGIALLYAYGRLGLIGQYLNAAGVQIAFTT
TAVVLAQTFVSLPFLVISLEGAARTAGVDYEVVAATLGARPTTVWWRVSL
PLLAPGLVSGAVLAFARSLGEFGATLTFAGSREGVTRTLPLEIYLQRESD
ADAAVALSLLLVVVAAVVVIGLGSRRLRPGGANAW
375141888YP_005002537.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MEVLVTGGDTDLGRTIAERFRDAGHQVVIAGARRGDLEVAAKELDVDAIV
FDNTDAASLEQARDQFPHHLDTIVNVPAPKQEAGDPRTYSLADRATAWRN
ALDSTVLSAVLTVQILGDHLRSGGSIISVLPDNPTEGGAESAIKAALSDW
TAGQAAHFGIRGITVNAVASGRSAEPGYDGLSRTPAPVAEEITRLALFLS
TPAARHITGQTLHVSHGALANFG
375141887YP_005002536.1 putative F420-dependent oxidoreductase- Rv1855c family [MycobacteriMTIKLGLQIPNFSYGTGVAELFPTVIAQAQEAEAAGFDSVFVMDHFYQLP
GLGTPDQPMLEAYTALGALATATERVQLGTLVTGNTYRNPTLLAKAITTL
DVISQGRAILGIGTGWFELEHDSLGYEFGTFTDRFNKLGEALEIILPMLE
GERPTVNGKYYKTVEAMAEPRFRDHIPLMIGGSGEKKTIPLAAKHFDHLN
IIAGFDELPRKLAVVKERCEEIGRDPATLETSMLVIAIIDENVTEDLIPA
DFKQQAVFGSAASVAEQIKTKVLDAGVSGVILSPVTSLNGYQPGGVTAVG
EALKPYLAW
375141886YP_005002535.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium rhodesiaeMSHPGATATDRHRVVVVGSGFGGLTATKALKRADVDVKMIAKTTHHLFQP
LLYQVATGIIASGEIAPPTRMILRKQKNAQVLLGNVTHIDLANQTVRSEL
LGHTYVTPYDTLIVAAGAGQSYFGNDHFAEWAPGMKSIDDALELRARILG
AFEQAERSSDPARREKLLTFTVVGAGPTGVEMAGQIAELADHTLKGAFRH
IDSTTARVILLDAAPAVLPPMGEKLGNKAKARLEKMGVEIQLGAMVTDVD
RNGITVKDPDGTFRRIDCATKVWSAGVSASPLGRDIAEQSEAEVDRAGRL
KVLPDLTVPGHPNVFVVGDMAAVEGVPGMAQGAIQGARYAANAIKAELKG
ANPAEREPFQYFDKGSMATVSRFSAVAKIGPIEFGGFIAWLAWLALHLVY
LVGFRRKITTLLLWTVTFLSKKRGNLTITEQQAYARTRIEELEEIAALVQ
DPEKEAV
375141885YP_005002534.1 urease accessory protein UreH [Mycobacterium rhodesiae NBB3]MRSEVLIVARPDRRPRIESRGGLAARETEPDTVHLVSAAATPLGGDSVCV
RVVVESGAVLRVRTVAATVTLPGATTRESQAIWALEVAGELDVDPQPTVV
AASSRHITSTRLAIEGSGRIKLRERIQIGRTGERQGFWSGLLHADVDGSA
LLRHRVELGRGSVSDDELGAPMACISELHYPEAEVDTAGVALALARGGCL
STWQGERL
375141884YP_005002533.1 urease accessory protein UreG [Mycobacterium rhodesiae NBB3]MPPHFLDGQPHDHLDRPRRQRIAGEPLRIGVGGPVGSGKTALVAALCRQL
RDEVSLAVLTNDIYTTEDADFLRRHAVLPDERIAAVQTGGCPHTAIRDDI
TANLDAIDDLIAGNDRLDLVLVESGGDNLTATFSSGLVDVQIFVIDVAGG
DKVPRKGGPGVTYSDLLVINKTDLAPMVGADLDVMRRDAATVRGDRPFVL
ISLTGDPAATAVLSWVREQLRVPV
375141883YP_005002532.1 urease accessory protein UreF [Mycobacterium rhodesiae NBB3]MTHLATLLTLADSRLPTGGHVHSGGVEEAVTEGLVRDLVTLRAFLRRRIS
TTGLVGASIAAAVHRGALSVAAADIETDARTPSPAARQASRAQGRGLLRL
ARRVWPDGRWDALGATPHLAVATGCAGAASGLQPEQTALTVVYTTMTGSA
TAAQRLLALDPGDVAALTFELSPLCEQSAAAACKELADLSDPLLDVLAQR
HAERERPLFVS
375141882YP_005002531.1 urease subunit alpha [Mycobacterium rhodesiae NBB3]MTGISRARYKALYGPTTGDRIRLADTDLLVEITEDRSGGPGLAGDEAVFG
GGKVLRESMGQGRVTRADGAPDTVITGAVIIDHWGIIKADIGIRDGRITA
IGKAGNPDVMSGVHPDLVVGPSTEIISGNGRIVTAGGIDCHVHLICPQIK
EEALGGGITTIVAGGTGPAEGSKATTVTPGSWHLGRMLEALDSWPMNIAL
LGKGNTVSAESMWEQLRGGAAAFKLHEDWGTTPAAIDACLAVADESGVQV
NIHTDTLNEMGFVEDTLAAIKGRSIHAYHTEGAGGGHAPDIITVASHPNV
LPSSTNPTRPHTVNTLDEHLDMLMVCHHLNPAVPEDLSFAESRIRPSTMA
AEDLLHDIGAISMIGSDSQAMGRIGEVVIRTWQTAHVMKRRRGALPGDGA
ADNNRARRYVAKYTICPAVAHGLDHEVGSVEVGKLADLVLWEPAFFGVRP
HVVLKGGMIAWAAMGDANASIPTPQPVLPRPMFGAAPAAAAATSVHFVSQ
QAVDDGLAGRLAVSRRLVAVRNVRGVGKAQMPLNDTLPEIEVDPDTFTVR
IDGDVWQEDPAVDLPMAQRYFLF
375141881YP_005002530.1 urease subunit beta [Mycobacterium rhodesiae NBB3]MSPEPGEVVFGDGDIEINEGAQRIEMEVVNTGDRPVQVGSHVHLPQSNTA
LQFDRAAAHGRRLDIPAGTAVRFEPGVAQRVSLVPLRGSREVHGLSMRPP
GRLDPS
375141880YP_005002529.1 urease subunit gamma [Mycobacterium rhodesiae NBB3]MRLTPHEQDRLLLSYAAELARRRQARGLLLNHPEAVALITDHLLEGARDG
RTVAELMASGREVLSRDDVMAGVPEMLYDVQVEATFPDGTKLVTVHHPIP
375141879YP_005002528.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTDITSSLGAGFDSEIGLQFLELTPDGGVARLEINDKLLQPWGIVHGGV
YCAVIESLASVSGQVWLSENGGGHVVGVNNNTDFLRAISAGTVTAVSVPI
HRGRRQQLWLITITDDNERVVARGQVRLQNLPPE
375141878YP_005002527.1 Ferric iron reductase FhuF-like transporter [Mycobacterium rhodesiaMTVLVDDPLIASMAIEQALPLHESSRRLRDLYPECPRVYGVAVIGDLSRR
RWWPLQQALTGDKLYSMFTLAAEETESRAAVAQQLAATLAHVVVGRVVPL
LVLEGRAWDTGLENLWVHVDSEGAIDWVGVADATLRALPDDPFFANRAAI
RTNVSARDGIVALPNEAALTTWIAHRSHRTLEPLFGKLAEISDSAISIAS
MWHIVGAAVVGAATQVPLLAGSSELTSMRRGQAVLDALVGFGLPVRGPTR
AMAGAAGKGLLN
375141877YP_005002526.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MAKLTRLGELERAVMDHLWSAREPQTVRQVHEALAARRDLAYTTIMTVLQ
RLAKKNLVVQHRDDRAHRYAPTHGRDELVAGLMVDALDQAADSGDREAAL
VHFVERVNADEAAALRRALAELESKHRISPPAGDPGTG
375141876YP_005002525.1 Zn-dependent protease with chaperone function [Mycobacterium rhodesMSALAFTVMALVLSGPVPAMLARATWPSRAPRAAIVLWQSIALAAVLSAF
SAGIAIASRLFAPGPDGRPTATIASEIDVLGWPLWVTYMGVFALTLVIGG
RLAVAVVQVAIATRRRRAHHRMVVDLVGKSHKSGLRVLDVDEPLAYCLPG
VRSRVVVSEGTLTSLADNEIAAILSHERAHLRARHDLVLEMFTAVNAAFP
RFVRSASALDAVRLLIEMLADDAAVRAAGPTPLARALVTCATSRTPVGAL
AAGGPTTVVRVRRLGGAGNSLVLAAGAYATAAAVLVVPTVAVVLPWLTEL
NRLFTA
375141875YP_005002524.1 6-phosphogluconate dehydrogenase [Mycobacterium rhodesiae NBB3]MSSSESPTNGTAQIGVTGLAVMGSNLARNFAHHGYTVALHNRSVAKTDAL
LAEHGSEGKFVRSETIPEFLAALEKPRRVIIMVKAGDPTDAVINELADAM
EEGDIIIDGGNALYTDTIRREKAIRERGLHFVGAGISGGEEGALKGPSIM
PGGPAESYKSLGPLLEEISAHVDGVPCCTHIGPDGAGHFVKMVHNGIEYS
DMQLIGEAYQLLRDGLGKTAPEIADIFADWNSGDLDSFLIEITAEVLRQT
DAKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSG
SVAQRKATTGLASGDLGEKPSDAARFVDDVSKALYASKIIAYAQGFNQIQ
AGSEEYDWNIAPGDMARIWRGGCIIRAKFLNRITEAFDENPDLPTLIAAP
YFREAIEAAIDSWRRVVVTATELGIPIPGFSSALSYYDGLRTERLPAALT
QGLRDFFGAHTYGRIDADRDARFHTLWSGDRSEVEA
375141874YP_005002523.1 IMP dehydrogenase family protein [Mycobacterium rhodesiae NBB3]MKFLHGNKPAYDLTYTDVFIVPGRSDVLSRMDVDLSTSDGSGTTIPVVVA
NMTAVAGRRMAETVARRGGIVVLPQDLPISAVQQTVEFVKSRDLVVDTPV
VLSPDDSVSDATALIHKRAHGAAVVIFEGRPIGLVTEAGCAGVDRFTRVR
DIAITDFVSAPTGTDPRKVFDLLEHAPVDVAVLTEPDGTLAGVLTRTAAI
RAGIYTPAVDGKGRLRIAAAVGINGDVGAKARSLAEAGVDLLVIDTAHGH
QLRMLDAIKSVASLDLGLPLAAGNVVSAEGTRDLISAGASIVKVGVGPGA
MCTTRMMTGVGRPQFSAVLECADAAKQLGAHVWADGGVRHPRDVALALAA
GASNVMIGSWFAGTYESPGDLMRDRDDRPYKESYGMASKRAVAARTAGDD
PFDQARKALFEEGISTSRMGLDPSRGGVEDLLDHITSGVRSTATYVGATS
LAELHEKVVLGVQSAAGFAEGHPLPTGW
375141873YP_005002522.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNVATSLLSIGAIVLLTVGTAVFVAAEFSLTALERSTVESNARNGDRRDQ
MVRRAHRTLSFQLSGAQVGISITTLATGYLAEPVVGRLIRPGLEAIGVPE
RFVTGVALFFAVLIATSISMVFGELVPKNLAVARPVQTARWSAGPQLLFS
ALFTPLIRMTNGTANWILRRLGIEPAEELRSARSPQELVSLVRSSARSGA
LDPVTALLVDRSLRFGERTAEELMTPRSKIEALDSDDTAADLVAAAIKTG
HSRFPIIEGDLDETIGIAHVKQVFEVPPERRASTALSGLALPVATVPSTL
NGDAVMTQIRANGLQTALVVDEYGGTAGMVTMEDLIEEIVGDVRDEHDVE
PPDVVPAGRGWRVSGLLRIDEVAAATGFRAPEGDYETIGGLVLEKLGHIP
DESESVELTAFDPDGAAIDDPIRWLATVVRMDGRRIDLLELTELGRAGEG
DVS
375141872YP_005002521.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGGDIFGVLLTVLLLGANAFFVASEFALISARRDRLEALAEQGKKSAVTV
IRAGENLSLMLAGAQLGITICSILLGRVGEPAVAHLLEMPFGLFGIPDSV
LHTVSFFVALGIVVTLHVLLGEMVPKNIAIAGPESSAMLLIPTYLVWIRI
ARPFIAFYNWCANITLRSFRVEPKDELDVAVSTVELSEMIAESRSEGLLD
QEEHTRLTRALQIRDRVAKDVAVPLSEIRAVPVAREGSGPTLRAIEEALA
ETGYSRFPVSGPSGDFVGYLHIKDVLPLVHDPSNDQAVLDASMVRPLPRV
PASMSLPDALSRLRRENAHLAVITATDGSVSAMVALEDLVEDLVGTVRDG
THRV
375141871YP_005002520.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MCEAEHSGVTEVVLDEREWTLREQCHRDRVDNFLRSFRAPAGQSHPVWDF
LFTYYSLRPRQLRTWHPGFGVALAGDAGAAYLGRSGYGPAPAGVGVTRDF
LSGRADTVRFIAGLMRATASRPARLNCFGLHEWAMVYRSPTVRHDQVPLR
LGTAGTDAVVESMPLRCSHFDAFRFFTEPATELNSEQLTRDGQVGAEQPG
CVHAAMDCYKFAYKLGPLVGSALVMDSLELAARARELDMRASPYDLRGYG
FDPIAIETPAGRAEYVRVQQHIAELAAPLRERLADHCERLLATLDRASAD
AVDRASADAVDRASAEAVHAE
375141870YP_005002519.1 malate synthase G [Mycobacterium rhodesiae NBB3]MTERVEAGNLRVAQVLYDFVNNEALPGTGLDPDTFWSGVDKVVADLTPKN
QELLAKRDDLQARIDRWHRQRVIEPIDAEAYRQFLTEIGYLLPEPDDFTI
TTAGVDDEITTTAGPQLVVPILNARFALNAANARWGSLYDALYGTDVISE
DDGAEKGTSYNRVRGDKVIAYARRFLDGAAPLATGAWNDATGIKIDDGQL
VVTLGDGQSTGLKTPEQFVGYTGELGSPSWSVLLRNHGLHIEILIDPDSP
VGATDPAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGD
LSEEVAKGGKSFTRVLNDDRAYTTPDGEGELTLPGRSLLFVRNVGHLMTN
DAIVDSEGNEIPEGIQDALFTSLIAIHGLKADDDNGPKVNSRTGSIYIVK
PKMHGPEEVAFTVELFSRVEDVLGLPPNTIKVGIMDEERRTTLNLKACIK
AAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKKQPWILAYEDQNV
DVGLATGFSGRAQIGKGMWAMTDLMADMVEQKIGQPKAGATTAWVPSPTA
ATLHAMHYHEVDVYAVQKELEGKTRTTVEELLTIPLAKELAWAPEEIREE
VDNNCQSILGYVVRWIDAGVGCSKVPDIHNVALMEDRATLRISSQLLANW
LRHGVITEDDVKASLRRMAAVVDQQNEKDPEFRPMAPDPDASVAFTAAQE
LILAGAAQPSGYTEPILHRKRREFKAANNGG
375141869YP_005002518.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGRHSIPDPDESAGDEQHEDPETTRFGQADEPESDYGTEEFDEPGYRTSD
HESRDFAGFDLQRVGSSSTPPPPSRPRSGPQHGGDWDGGEWTGSHRAVTP
GRRGVSIGVIAALVTVIIVVGAVIVWRFFGDALSTRSDAAAARCVNGELA
VPVVADPSIAEQLKPLAERYNQEADPVGDRCVKVGVTPADSDQVVNGFIG
KWPAELGERPALWIPASSVSAARLEASAGEKTISDSRSLVTSPVLLAIRP
QLKPALAQQNWAALPSLQTNPTALDGLGLQGWGSLRLALPMSGDSDASYL
AAEAVAAESAPAGEPPSAGIGAVNSLVSGQPKLADKKASTAMDALLNADD
PADAPVHAVVITEQQLFQRGTTLPDAKDVVTSWLPPGPAAVADYPTALLA
GDWLSQEQVAAASEFARFMRKPEQLAELTKAGFRTQGGTPPQSDVTDFAP
LAAPLSIGDNGVRVSLADSLTAPAESPAVTIMLDQSMPAVEGGKSRLANV
AAALDARLQALPPNSAVGLWTFDGVQGRSEVPMGPLSDQLNGTPRSATLT
SELSGQTASSGGAVSFTTLRLVYEQAKASYRQGQNNSILLITTGPHTDQS
LNGPGLEDYIRGAFDPARPVAVNVIDFGQDADRPTWEAVTAASRGKYQNV
ASSEGPELTSAIAGFLG
375141868YP_005002517.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MLPPSVAEWRDGGTFFPTSAGRVFVRSSSGAGPTILLLHGYPSSSYDYRQ
VVPHLGERAWVTLDFLGFGLSDKPRPHRYSLLEQADIVAAVVADTTAGPV
ELIAHDMGTSVATELLARDTQGQLPFELQRAVIGNGSVILSRASLRPAQK
LLRSPLGPLLSRMSNGSSFVREFGKLFSVGHPLSDEEGQAQWALWSNNDG
HRIAHLLIYYLNERVSYASRWHGAVRDWPKPLSFLWALDDPVATTNVLDG
LRELRPAATVVELPGVGHYPQVEVPEEFTRSALNLLSAD
375141867YP_005002516.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MPSEFTPDPQLYPFTSRWFDSSRGRVHYIDEGTGPVIVFFHGNPTWSFLY
RNIIAALRDRFRCIAPDYLGFGLSERPSGFGYRIEEHASVIGEFVDHLEL
DQYLSMGQDWGGPISMAVGTDRAERVRGVVLGNTWFWPTADLPTKMFSAV
MGSPPMQWAITQRNFFVERLIPAGTATRLDEAVMVHYRGVQPSPRDRAGV
ARMPKEILAARPLLERLADDVPAKLGSKPALLVWGMKDFAFRPGPNLPRM
RAAFGDHVVVELPNASHFIQEDAPGQIAEAIINRFG
375141866YP_005002515.1 glycine dehydrogenase- decarboxylating [Mycobacterium rhodesiae NBBMSDSENFTFAARHIGPDDDAIATMLATIGVGSLEELAKKALPAGILDPLT
EDQVAPGLDQLPPAATEDEALTELRALADANTVAVSMIGQGYFDTLTPPV
LRRNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVCDLTGLEVANASM
LDEGTAAAEAMTLMHRAVRGSSNRLVVDVDVYRQTAAVLATRAQPLGIEI
VTADLRQGLPEGEFFGVIAQSPGASGVITDWSEVVTQAHERGALVAIGAD
LLAMTLITPPGETGADVAFGSTQRFGVPMGFGGPHAGYLAVHAKHARQLP
GRLVGVSLDADGAPAYRLALQTREQHIRRDKATSNICTAQVLLAVMAAMY
ASYHGADGLAAIARRVHGHARALAAGLVDGGVEVVHREFFDTVLVRVPGG
AAQIRDAAKANGVNIWQVDDDHVSVSCDEATTAQHVEAVLSVFGAAPAAT
SGRGAAPAATSGRGVAAGSEFDGPAIATRTSEFLTHPAFTRYRTETEMMR
YLRSLADKDIALDRSMIPLGSCTMKLNAAAEMEPITWPEFARQHPFAPAS
DTPGLRKLIADLETWLTAITGYDAVSLQPNAGSQGEYAGLLAIQAYHAER
GQPDRDVCLIPSSAHGTNAASAALVGMRVVVVACRANGDVDLDDLRAKVN
EHADRLSALMITYPSTHGVFEHDIADICAAVHDVGGQVYVDGANLNALVG
LARPGRFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVREHLAKFLPGHPLA
DELPDEYAVSAAPYGSASILPISWAYIRMMGADGLRAASLTAIASANYIA
RRLGEHYPVLYTGENGMVAHECILDLRVITKETGVTVDDVAKRLADYGFH
APTMSFPVAGTLMVEPTESESLAEVDAFCEAMIAIRGEIDAVAAGTWPTD
DNPLRGAPHTAECLLVSDWDHPYTREQAAYPLGKAFRPKVWPPVRRIDGA
YGDRNLMCSCPPVEAFA
375141865YP_005002514.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGDTPRQEEFDLSSSESDPVESAITVTSAPVQGGLFPDDSVPDELVGYRG
PSACQIAGITYRQLDYWARTSLVVPSIRSAAGSGSQRLYSFKDILVLKIV
KRLLDTGISLHNIRVAVDHLRQRGVRDLANITLFSDGTTVYECTSAEEVV
DLLQGGQGVFGIAVSGAMRELTGAIADFPGERADGGESIAAPEDELASRR
KHRDRKIG
375141864YP_005002513.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGEVRVVGIRVEQPQNQPVLLLRESNGDRYLPIWIGQSEAAAIALEQQGV
EPARPLTHDLIRDVIGALGHSLKEVRIVDLQEGTFYADLIFDRDIKVSAR
PSDSVAIALRVGVPIYVEEAVLAEAGLLIPDENDDEATGAVREDEVEKFK
EFLDSVSPDDFKAT
375141863YP_005002512.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MSQPDTPALSGMSIGAVLDLLRPDFPDVTISKIRFLEAEGLVTPERTASG
YRRFTAYDCARLRFILTAQRDQYLPLKVIKAQLDAQSDGELPQSGSAYGV
PRLVTVSSEFSEAAGEVSAVAPTQVRLSREDLRRRSGVDDELLTALVKAG
VITTGPAGFFDEHSVLIAQCARALAEYGVEPRHLRAFRSAADRQSDLIAQ
IAGPVVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRDVLDR
375141862YP_005002511.1 FHA domain-containing protein [Mycobacterium rhodesiae NBB3]MTDKDQNSGADQTSDDLTVETTSVFRADFLNELDAPASAGAEGAVTGVEG
LPVGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAE
FRLEGSEFQVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGP
KSDDNGGG
375141861YP_005002510.1 glycine cleavage system H protein [Mycobacterium rhodesiae NBB3]MSEIRADLYYTEEHEWVQRTGDDTVRVGITDYAQSALGDVVFVQLPDVGA
EVAAGESFGEVESTKSVSDLYAPVSAKVVAVNGDLEGNPQLVNSDPYGGG
WLLDLQVEAGALADGLGKLLDADGYRATVSE
375141860YP_005002509.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDESPPPPAEPDEHGRHELPPDAPRPEIGDLHRSGIAGVLQRGRSQIVF
GALAMVLCVLLGLAIITQVRQTESGDSLETARPADLLILLDSLQQREAAL
NTEVADLQRTLAQLQASGSSDQAAIENAQARLAALSILIGTVPATGPGVT
LTITDTTPGVPAETMLDVINELRNAGAEAMEIRGGGSAVRVGLDTWVAGA
PGALVSDSVTLNPPYSVLAIGDPPTLAAAMNIPGGAMDSVERVGGTMTVQ
QADRVDVTALRQPKPRQYAQPVK
375141859YP_005002508.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIGIAALVIGIVLGLVFHPEVPEFVQPYLPIAVVAALDAVFGGLRAYLER
IFDSKVFVVSFVFNVLVAALIVYLGDQLGVGTQLSTAIIVVLGIRIFGNA
AALRRRLFGA
375141858YP_005002507.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSLGGYDPEAGRRAHEANRPTLIPVPGLLRSLLSDHLDPGYQAAADAKE
QGKQRKSWQSWAWQIAGAVLIATVFVAAVAQARTTAPGVREQQHVLSGSV
RSAEADVSDVSARRNDLAEQVDSERRQRLEGDVRGQLLLGKLDEANFAAA
ATPVIGPGLQITVTDPGMSADLSDVSKERLPGSQQVILDRDLQQVVNSLW
VSGAEAVSVGGVRIGPNVTIRQAGGGILVDNQPISSPYVILAIGPPHSVQ
DVFERSPGVQRLRLLEGSYGVGVNVSTSEALTLPASPVRDVNFAREIGQ
375141857YP_005002506.1 phosphatidylglycerophosphate synthase [Mycobacterium rhodesiae NBB3MQEPRSRRHQTGVPPASESRVLTVPNVLSALRLVLVPVFLWLLLVVHANA
WAVAVLMFSGFSDWADGKIARLVDNQSSRLGELLDPAVDRIYMVVVPVAL
AIHGSVPWWIVLTLLGRDVVLAATLPLLRSRGLTALPVTYIGKAATFALM
SGFPLVLLGQWDALWSRVVLACGWAFLIWGLAMYLWSGVLYLIQVSMVMR
RMPRAAR
375141856YP_005002505.1 preprotein translocase subunit SecA [Mycobacterium rhodesiae NBB3]MRGGAAYRKPVAKTKTRTSGRVSNRFWRMLGASTDRDQASSMSQVRDSAD
FDDKAADLDDEELRKAAELLNLDDLADSDDIPQFLAIAREASKRTTTLRP
FDVQLQAALRMLAGDVVEMATGEGKTLSGAIAAAGYAIGGRRVHVITIND
YLARRDAEWMGPLLEALGLTVGFVTSDSTPDERRNAYKCDVTYGSVNEIG
FDVLRDQLVTDVADLVSPNPDVALIDEADSVLVDEALVPLVLAGTTHRET
PRVELIKMVGELTEGKDFETDSDSRNVHLTETGARKLEAKLGGIDLYSED
HVGTTLTEINVALHAHVLLQRDVHYIVRDGAVHLINSSRGRIAQLQRWPD
GLQAAVEAKEGIETTETGEVLDTITVQGLINRYPTVCGMTGTALAAGEQL
RQFYKLGVSPIPPNKPNIREDEVDRVYVTAAAKNDAIVEHIIEVHKTKQP
VLVGTRDVAESEDLHERLVKAGVPAVVLNAKNDAEEAAVIAEAGTLGSVT
VSTQMAGRGTDIRLGGSDEADHSVHKKKVADLGGLHVIGTGRHKTQRLDN
QLRGRAGRQGDPGSSVFFSSWEDDLVAAHLDASKLSMQTDEDGRVVNPRA
ASQLDHAQRIAEGHLLEVHSQTWRYNQLIAQQRAILVERRNTLLRRPTAR
DELRELSPDRYEALAEEIGEEKLENICRLIMLYHLDRGWADHLAFLADIR
ESIHLRALGRQNPLDEFHRMAVDAFASLAADAIEAAQQTFDTAASIEDEP
GIDLSKLARPTSTWTYMVHDNPLSDDSALNLPGVFR
375141855YP_005002504.1 thiamine pyrophosphate-dependent protein [Mycobacterium rhodesiae NMSIDAPVPTAVNAGHLIARRLRASGIDTIFTLSGGHLFPIYDGCQAENVR
LIDTRHEQTAAFAAEGWSKVTRVPGVAALTAGPGVTNGMSAMAAAAQNQS
PLVVLGGRAPAARWGQGSLQEIDHVPFVAPLTRFATTAQSPDAVGPLIDD
ALRAATGADGQPTGVSFVDFPMDYLFGEARDGGGPGALARASTVAAPDGN
AVDAALALLAGAERPVIMAGTNVWWGRAEIALLRLAEELRIPVLMNGMAR
GVVPADHDLAFSRARSKALGEADVALVIGVPMDFRLGFGKVFGPDTLLIA
ADRVEPGRPHPREVAAGLYGDLTTILSALAEAGPTDHEAWIADLRTTETA
ARAGEAAELADDRTPLHPMRVYAAVSEMLDRDAIVVIDAGDFGSYAGRVI
DSYVPGAWLDSGPFGCLGSGPGYALAAKLARPDRQVVLLQGDGAFGFSGM
EWDTLVRHGVHVVSVIGNNGIWALEKHPMEMLYGYSVVAELRPGTRYDEV
VTALGGHGELVATPADLRPALDRAFAAGLPAVVNALTDPTVAYPRRSNLG
375141854YP_005002503.1 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [MycobMPNTEQTQVLIAGAGPIGLTAAIELTRRGVDCRIVDPLYEPPQYAKAVGV
QPRTLEVFESMGVLPRVLNAAVQMRGQIVYLNGERVAEVDFAVPSDVPFG
FVAIPQYATERILRDELALRGIAVERGWRLTGFEQDADGVLATLAGDAGA
QTVRASYLLGADGAHSVVRKALGLTFEGGAFEEQYMLGDVEVDWSVPRGY
AVRAIHQRNGATDDLLVCIPLPQSDALRAGAHRRRGRYRMSMLVPPDLAA
APSQGLAHGFEGERKPDLSHIQAVLDRLSPEPTTARNLRWSSVFRISHRI
VDAYGRGRVFVAGDAAHIHPPTGAQGMNTGIQDAHNLAWKLALAVSGRAA
PTLLASYDAERRPVGEEVVGRTVRSAREGIGADSTDVDYVIRREAQLLVN
YSGSPIVGTDAGGRAPDATGLTRDAVTAPLRLFTLLGTGHTLLLYADGTA
GPADVDDFEQAADDAAAVAGGELTVYLIAAPEADVAATVLPLIRDSASGF
AAAYAAGGTAVVIRPDGYLGFVGDHTDAAGLAAHLRTTFG
375141853YP_005002502.1 ABC transporter permease/ATPase [Mycobacterium rhodesiae NBB3]MFTPTLDWGHELLASLKWIGQAWLIAAVATLLICALIAKYTVWGRQFWRI
TGDYFKGPESVKVWLWLAVILLSVVFGVRLSVLFTYQGSDMMTSFQVVAS
GVAAGEDAVKNSGRDGFYMSIIVFSALAFLHVARIMFDLFITQRFMLAWR
AWLTDRLTGDWLDGKAYYRGRFIDDTIDNPDQRIQYDIDIFTAGVGGLPN
TPANTSTSTLLFGSVDAITSMISFTAILWSLSGPLTLPFVNYELPKAMFW
ILLTYVIFASIIAFWVGRPIIWLSFRNEKFNAAFRYALVRLRDASEAVAF
YRGEIAERTGLRKLFAPIVANYKRWINRMMGFYGWNLSMSQIIVVPPYLF
QFPRFFEGEITLGAMSQSASAFGNIESGLSFFRNAYDAFAGYRASIIRLD
GLLTANEEGRALPEITTTPCQDGTVKLDQIEVRTPDGKQLVNPLDLHLEV
GDTLAVKGESGSGKTTLLRSLAELWPYTSGTLTRPCGPNETMFLSQMPYV
PLGNLRAVVSYPNEEGQIDDATLKRTLEKVALPHLIGRLDEVEDWAKILS
PGEQQRIAFARILLTKPRAVFLDESTSALDEGLEYLLYTLIRTELPDTIL
VSVSHRKALEQHHSHELELLGGGEWRFGRVGGEEPATV
375141852YP_005002501.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMSGLDIPDTVDAADVQTWSDEVDVLVIGFGIAGGCAAVSAAAEGANVMVL
EKAAAAGGTSAMAGGHFYLGGGTAVQQATGHDDSADAMYSYLVAVSADPD
LDKIRLYCDESVEHFDWLEALGFQFERSFWKGKVVVPPGTEGLSYTGNEK
VWPYCEQAKPAPRGHSVPVPGELGGAAMVIDLLVKRATDQGVQIRYETGV
TNLVVDEGRVVGVRWKHFGETGTIKAKAVVIAAGGFAMNAAMVAEHTPAL
GQKRKTKHHGEVEPYILGNPHDDGLGIGLGVSAGGVAENLDGLFITAAAY
PPEILLTGVIVNNQGQRFVTEDSYHSRTSAFVLEQPDQQAYLIVDEAHMQ
MPEMPLIKFIDGFETVPEMEAALGIPAGNLAATLDRYNENAARGEDPDFH
KQPEYLAAQDKGPWAAFDLSLGVAMYSGFTMGGLDVSIDGQVLRSDGSPI
PGLYAAGACASNIAQDGKGYASGTQLGEGSFFGRRAGTHAAHA
375141851YP_005002500.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MHAQTPVQIAWVTRDLDATEKALTTLLGAKRWVRIPDVHFAPDTCTFRGE
PADFVAHISFSYAGDTQLELIAPVSGGASVYTEFLDTVGPGLHHVCLEAP
DSAAFDAALRDFEGNGTPVVQQGIMPGGMQFAYLSAADAGVPYIEVAVIP
DEIKSFFDYVKQEQQ
375141850YP_005002499.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEVDVEHQIKAVERKLGTRIIDAKEAHVVTISQSYDTDQDDLWDAVTNI
ERIPRWLMPITGDLTVGGSYQLEGQAGGTVLTCDPPKNFTATWEFGGGVS
WIDVSVSADGPDRARLVIEHIAHADDHWEQFGPGAVGMGWDSMVLGLAIH
LSTGQGIDPSFGEQWIVTDDGRRFLALSGEQWRTANVEFGTDPSAAREMA
KRCLAAYLGEEN
375141849YP_005002498.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MVHAFDVLGDPVRRRILELLAGGELSAGAIGVQIQEEFAISQPAVSQHLK
VLRDNGFTSVRADGQRRLYAVNGTALREVDEWLDAFRRFWAPRLDALATE
IARGKRQRRSQGRQHD
375141848YP_005002497.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MGKRQDTRDRIERRIIELGRRHLITDGAAGLSLRAIARDLDMVSSAVYRY
VASRDELLTLLLIDAYSELADAVDDARVNTETSWRDRLRAMAHAARRWAV
EHPASWALLYGSPVPGYRAPAERTVGPGTRVVGALFDVVAEGIAADDVSN
TEVAVPQLLSSDFDGVRAEFAFSGDDSAVARCFLLWAGLIGAISLEVFGQ
YGADTLTDPGAAFDIQVTLLIEMLTR
375141847YP_005002496.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTVRYDRPTPAARTFNEVFRVLAEVGISIAGTVAIRVRGRKTGQRRGVVV
NLLTVSGRDYLVSPRGNTQWVRNARAAGVIEMGPRWRSTDVPISEVADHD
KPELLKRYLDRWFWEVKGHVGGLTPESSDAELFAAAPSIPVFELQR
375141846YP_005002495.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRRRWLRLFATATAPLVALVVPVMPVEADPGVVVFPGMEVIQGTNACTVG
FVDPAARVAYTAGHCRGDGTVQDQGRRSIGHQASFRDNTPDGATIDTNHQ
ITDWEVITLAADVAVNNILPRGLALVSDPTVVPAPGLPVCHFGVVTGESC
GNIQAVYNGWFTMANGVVSQKGDSGGPVYVVTSDGRAAMVGMFNSTWGQF
PAAVSWQAVSAQAQQDVISAMSGVSTP
375141845YP_005002494.1 glycine/D-amino acid oxidase- deaminating [Mycobacterium rhodesiae METVFDAPVDPALVERSLAPSTFGSMWLDIPRPDYPALIASLTCDLLVVG
GGYTGLWTALHAAERYPDRRVVLIEANRIGWAASGRNGGFVDASITHGAE
NGKSRWAAEFDTLEQLGLENLDGMQSDIERLGLDTEWQRTGMLSVATEPH
QVEWLRDGAASGEGQFLDTQRVRAEVDSPTYLAGLFSADTCAIVHPAKLA
TELARACTEAGVQIYESTNATALNGGGGRLRVDTATAAITAGQVVLATNV
YPSLLRRNRLRVVPVYDYVLATEPLTDLQLARIGWRGRQGIGDCANQFHY
YRLTMDNRIVWGGYDAIYHFGRKVDPAYEDRPATYRRLAEHFFITFPALD
DVRFSHRWAGPIDTNTRFCAHWGLACEDRVAYVNGFTGLGVGAARFAADV
CLDLLGGKPTPRTELQMVRERPLPFPPEPFASIGIQATRWSLDRADHSAG
RRNLLLRTLDALGLGFDS
375141844YP_005002493.1 sterol desaturase [Mycobacterium rhodesiae NBB3]MDWSRVLTDVLPPLMHDPVTFAIPFFLIMLIIEWVSAGKLVHDEAERAPA
GSYLKSDAWASIKMGLVSIATSGVLNAVALVGYAALYVYVAPWQLPATAW
YTWVIAIVGVDVLYYFYHRIAHRVRLIWATHQAHHSSQYFNFATALRQKW
NISGDVFLRALLPLFGVPPWMVFASFSINLIYQFWIHTERIGKLWRPIEF
IFNTPSHHRVHHGMDQEYLDKNYGGIFILWDRLFGSFKAETFRPHYGLTK
QVDTYNIWTLQTHEYVAIFRDIRHAPRWRDKLGYAFGPPGWQPAPRRISE
NTAKVRV
375141843YP_005002492.1 carboxylesterase type B [Mycobacterium rhodesiae NBB3]MTAEANTQRVVDEHPVVDTSYGPVRGVDNGTIKAWKGVRYAAPPVAGLRW
RAPVAPQRWSEPADATRVGPVCPQPTDPRIPLDLGAPQGDDCLTLNVWAS
SDTEAGDGKPVMVWLHGGAYILGSSAQSLYHGGALASSGDAVIVTVNYRL
GALGFLDLSSFGDGFDTNLGLRDALFALHWVRDNIAGFGGDPNRVTLFGE
SAGAGMVTTLLASPAAAGLFCGAVAQSSPATSIYDSERGRRFAELFLDAL
DVGRDEAHRLAAIPTDAVMAASKKVFDVVPVRWPGTLAFAPIIDGDVIPA
HPVKQAQEGRTHKVPLIIGTNKHEAALFRWMKSPLMPISPQALRTMFADI
AAEQPSLQLPSEVQIREAYRGRPKTIGMGVARDIGFRMPSIWFAEGHCDV
APVYLYRFDFATPMLRLLRLGAAHATELPYVWGNLVAGPKDPTFKLGGLK
AGKTVSARLRTRWLNFAVDGVPAAPAGDPQWRPYRAHDRATLVVDAQDRV
VDDLDRDLRSAWGREVLSFR
375141842YP_005002491.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSVTSVSQRIGGGVRRRIVEDFEKGAGRHDDLEIYGGPAGDPGLIGPDSI
SWEINADLASVSQAGLPAIVLEILHPSVVAGVQDLSNYREDPFQRARATL
GYVLTTTFGNTEAATRVIERVKRVHSFVNGTRPDGVPYRALDPELIAWVH
TCIPWMILRTFEHTNRPLSRDEQDRYLAEQAVIGRMGGADWVPTSAAELD
DYVEAMRPKLSVNAQTREFIDFLMASPFFPDLPGPVDRQLHRFTIYAGMS
RAPSWARELIGYDRPSALTRRLIGPALRQDARQLRWAFGTPRYAQLARER
AAGVRPKVAAR
375141841YP_005002490.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MIDAQLIEVVGGAVSSGRADPSVDESADRTSQRILDAALQEAAAVGLQRI
TVEDVVRRAGVSRMTAYRRYPRRDDLVEALVRRETQRFLAAVADAIDATE
DPHEGVAEAFIAAVTFARENPMLRRAGHVEAAAIDSAELLRMGAAFIANY
IHSEAPGRPSQQVRWVADVFARLFFTYTALPPTDPDFGDDAELRRFAHQV
LTPMVERALEPMT
375141840YP_005002489.1 cation/cationic drug transporter [Mycobacterium rhodesiae NBB3]MRKWALLAGAIFTEVAATLSLRASVDHSAWLAVVITGYVVSFVMLTLVLR
AGMPVGVAYGIWGALGTAVTAVLAAALFGDPFTWPIVAGIGLIIAGVLLV
EFGSHRAEAAES
375141839YP_005002488.1 cation/cationic drug transporter [Mycobacterium rhodesiae NBB3]MWLALAGAILVEVCATLALRASDGFREKAWIAPIIVGYLLSFYLLYLSLG
LGMPVGIAYGVWSACGVAMVAVLARFLFAEPLTPMMAFGIALIVGGVLTI
EMSGVAH
375141838YP_005002487.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMAPKPLDVAVARNRKARIAVAALFLSNGALFANLLPRYPEIKADLHLSNT
VYGIAIAAFSAGALVAGLTAATLIRRYRSSRVAVVGTLGIGGFVVVAGLA
GDPVMLAAALFAAGACDAVTDVAQNAHGLRLQRNYGRSIINSLHAVWAAG
AVLGGSMGAAAIALDISRATHLAIAAVVFGALVLIAYPHLLKGPDHDDHR
SQLARDGSTAGTAVYLTLVALVVIAVAGATVEDAGSSWATLYLRDSLGAP
GAVAVFGYVALVGSMFVGRLIGDRLVDRLGERTVVRAGGVLTATGMGAAL
AFPSVPGTIAGFAAAGFGVATLIPAAMHRADQLPGLRPGSGLTVLTWLMR
IGFFGAPLIVGVIADATSLRVGLLAVPVAGVVAFALAGALSARPQTSRS
375141837YP_005002486.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTADGDDQGLDYRFTLANERTFLAWIRTALALVAGGVAVVQLVPALSIPG
VRHGLGTVLTAAGGVLAVLAVRRWRGVQDAMQAGLDLPRSRMPVLLGGAI
VALTLALIFVITVQP
375141836YP_005002485.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAPQPEKPALQAERTQLSWERSAFSFLVAGALPLFGRGPFDDGRIVLPIV
GALLAILCVALGRRRAGRLSAGPKTEVVLLGWATAGFAALIVMFSVV
375141835YP_005002484.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MNTRTVVITGANAGLGLECARALLAHDPSWHLVLAVRDVTRGAEAVAYLG
HPGRCTVLELDLASMQSVRAFADTLRGAALPPLHAVVCNAGLQVVSGTEY
TADGVETTFGVNHVGHFALVQALLDDLVQPARIVIVSSGTHDPAKFTGMP
SPNYTTAAALAHPDESQPPDGRRRYTTSKLCNVLFAYELDRRLDHGERGI
TVNAFDPGLMPGSGLARDYSTIGRWVWRYVFPLLRVLPNVNSTRSSGARL
AALAVDPRFDNVTGAYFEGTRQIRSSEDSYDRDKALDLWETSEQLLLTAI
375141834YP_005002483.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MPTKKQQQGEQSRELILDATERLMATRGYAATSISDIRKACGLPPSSIYW
HFGSKDGVLAAVMERGAERYFAAIPVEADIEGQLAAVIAQQEQHPAFLRL
FLLLSLERSDDPAVADVIRRVRDRAIGRFREAMMQLLPDDLPEVLAERVS
AELAAVATALSDGIFLAAHLEPDATDVARMYRRLYQTTTALIPILLEEK
375141833YP_005002482.1 diaminopimelate decarboxylase [Mycobacterium rhodesiae NBB3]MSPEATAEELIGLFPPGTRTDGDGMLTIGGCRLDDVADRFGTPAIVVSED
ALRQRARDYLTAFRSRWPRCDVAFASKSFPCTAVQRVMVEEGLNLDVAGG
GEILTALKAGADPARLVLHGNAKSDEELTLAVDRGVGLVVVDNFDDIDRL
ERIVPTGRQQPCLVRVIPGVEAATHASQATGHAGSKFGLMPDDARTAIAR
IDRSAKLRLDGVHTHVGSQLLDVGQLAQAVEPIAKLGTFDTYDLGGGLGV
RYTYDEHPPTLDAYADAMVAQAKALLPEHSRIIVEPGRSMVAGSACTLYR
VTTVKRGVVTHVAVDGGMGDNLEVSLTGQRFEATIADRVGGGETVSVVGR
HCESGDQLVDGVALRDPSVGDLLAVPVTGAYCYTMSNQYNGARRVPVVFV
SDGAARLVVRRDTWDDLLMRDVD
375141832YP_005002481.1 4-alpha-glucanotransferase [Mycobacterium rhodesiae NBB3]MTELPESLVELARRYGVATEYDDWTGSRVTVAESTLVGVLDALGVAAATE
DRRRAALTDHDRDHWSRSLPPVVVSRSGTTSTFWVHVTHGDPVRLWIRLE
DGSVRTGLRQLENNRAPYDLDGRLVGEASFELPADLPLGYHELHLQLGIS
DISAPVIVSPASLEPPPGRTWGLATQLYSVRSQTSWGVGDLTDLTDLAVW
SASRHGAGFILVNPLHAAAPSPPMEPSPYLPTSRRFVNPLYLRVEAIPEF
AYVTHRGRVRKARENAQARAKRARLIDRDAVWKFKRAALHTVFREDRSAG
RTLAYEAYRRREGSSLDDFATWCALAEKYGADWHDWPTDLRHPASPAVTE
FAAEHPEDVDFHRWLQWQLDEQLTAAQATSVAAGMALGIMHDLAVGVDPN
GADAWALQDVLALGVTAGAPPDEFNQLGQDWSQPPWRPDELANQAYAPFR
ALVNTLLRHAGGVRIDHIIGLFRLWWIPKGAPPTDGTYVRYDHEAMLGIV
ALEAHRAGAVVVGEDLGTVEPWVRDYLSERGLFGTSILWFEFDRDGDGGP
LPAERWREYCLSSVTTHDLPPTPGYLAGEHVRLRDELGLLTRSAEEELAA
DRRQQAAWLDELRRVGLLSGDLEETGVDQVVSALYRYLGRTRSRLLSLSL
ADAVGDLRTQNQPGTTDEYPNWRVPLAGPDGKKMLLEDVFADPRAAALAE
VMRTAVRAPM
375141831YP_005002480.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKKLVVLSGGLVAVGSVALVGAGIAMSQPSAGGAANVIDEPYGRAIQILE
SQGIKPLFGGKTGSVLQQSQCLVSSQKLIKSSSQGNPAAKVQLFLDCTQT
AADKLAEMGSAGGPRVGGNGVTTVTPTPVVPIQGAPGAGAPVAPPG
375141830YP_005002479.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMRVQRQCVIDADREAVWKVVSSPECYPEFMASLERWEMNDDGPARLGARY
TVHWKVGSVPIGGVIELVEFEAPREVSWVGLTGVSQRGRFRLRETSDGRT
KVTFRLAYESAGNLLGLIADRVAAGQVGRNMGETLKNLRQMVEG
375141829YP_005002478.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium rhodeMAGFGDVLNWTRNQVTSRVPKADLDQRDADYIREQLPGLWLLASLYFRAD
VRGLDRIPKDGPVLLVGNHSGGNLPPDTFVFTLAFCSYFGVERPFYQLAH
NLVVSMPGLGSLRKFGTVAANHDNATLALESGAALLVYPGGDYEVFRPSW
EGNKVDFGGRKGYVKLARDAGVPIVPIASVGGQEAALFLDRGQWLARLLG
VDKIARLKSVPILLAPPWGLTVSDMVPRLPLPTKIAIEVQDAIDAEDIAV
SDDDVVHEKVEASLQAGVDRLAAERRFPVLG
375141828YP_005002477.1 putative metal-dependent hydrolase [Mycobacterium rhodesiae NBB3]MAQSPVLPAILHAREVDPGPVQIQARKVHFDVSDVPLEWIPSHPVASTMI
NLFNVVLPTAEHWFVDTFNEALPYVKDPKLAEDIRGFIGQEATHAAAHDD
VIRHFLIGNGVDPAPILEMVEYLFGKILAPTTSTNPKRRLNNLCERLWLI
AAIEHYTAVLGDFALNSTWDDYGADPTMVDIFRWHGSEEVEHRSVAHDVA
VYFHHSYLDRIRAMSVAATAIFVFFQRGTRYLFTADPATDIGFWKMQRLR
MHDSKLGLLPKFRTLFGSQTLTYFRPAYTPEQMGSTAQAVAYLATSPAAR
AAHL
375141827YP_005002476.1 flavodoxin reductase family protein [Mycobacterium rhodesiae NBB3]MGLRERYRQLPSNPFRPQRRDWMIGIAGAMIAGMDAMAGATRRVTLPEAS
DRTRLLRVVARETVAHDENVVALTFAAADGKPLPPWHPGAHLDLHLPSGR
LRQYSLCGDPQWPDTYRIAVRRIPDGGGGSIEVHDGLDVGATVTTHGPRN
AFPLTVPGYGSPTRRFRFIAGGIGITPILPMLALAQRLGVEWSMVYAGRT
RDSLPFLDEVAALGSANRVRIHTDDVDGRPTPHDLLGDCPDGTAVYACGP
AAMLTSIRSELAGRAKVELHFERFAAPPVVDGREFAVTIASTGQQIRVAA
DETLLAALKRSGVDAPYSCQQGFCGTCRTRVLSVLGGAVDHRDTLLTAPE
HENQMMLICMSRAAEGSSLTLDL
375141826YP_005002475.1 protein kinase family protein [Mycobacterium rhodesiae NBB3]MPLADGATFAGYTIVRQLGAGGMGEVYLAQHPRLPRQDALKVLPTSVSAD
GEYRERFDREADIAATLWHPHIVGVHDRGEFDGQLWISMDYVEGTDAARL
LRERYPDGMARGEVAEIISAVADALDYAHQRNLLHRDVKPANILLANPES
NDQRILLADFGIARWANDISGLTATNMTVGTVSYAAPEQLMGERLDGRAD
QYALAATAFHLLTGSPPFQHSNPAVVISQHLSKAPPAIGDQRPELAGLDP
VLAKALAKAPADRFERCADFARALAHQLGGTPGDDGTSLATPLPPQRAAG
RSLMRAGVIVPAILAVLLVAAIAVAVFETRRADDDRPAAAPTSTSPTVTK
PTTPLPPPPEPPPSPSTTAAPPPTTDTDTPTATTTSAATAAAVIGANCSP
VGSTATTSDGSTAYCSTLQTTGTSVWSLTQGDIPSPTVTTEPTEEPLPVA
EESPVLVCMQQTGQTRRECRRDIRESNGLPVLP
375141825YP_005002474.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLRTSDRLAIADLVHLYASAVDDRRFDDVLELFTPIAELRLPDPPRTLE
PVRIHHGRDGVRAAMAALAPVTRTEHAIVGEVYAAGERADHALGRITCIA
HHWTSADGPITDLVWHVRYDDEYLRTPAGWRIHGRALTINAIETRPIRRL
RAPTADSRAADAALSAASTEPQPRETNPRGRFRGTP
375141824YP_005002473.1 putative NTP pyrophosphohydrolase [Mycobacterium rhodesiae NBB3]MPKLSAGLLLYRVIDGELEVLIGHPGGPFWARKDDGAWSIPKGEYVEGED
PWTVAQREFEEELGKKVPVGARIDFDPVRQPSGKVITAFAVRGDLDLDGS
FSNTFEMEWPKGSGKLREFPEIDRVGWFPVAAARSKLLKGQRPLLESLLS
ALEADESDVSR
375141823YP_005002472.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATYRVLNPHGDVVDTKDIESADDAHAWFVDQKAEPELGWRMEVKTDDGD
WAFFDDSEGDRKY
375141822YP_005002471.1 NADH dehydrogenase- FAD-containing subunit [Mycobacterium rhodesiaeMTSVVVVGSGFTGFECARQLARKMARHAKKTGASVDITIISPVDYMLYTP
LLPDVAGGLVDARFVAIPLANALTGVQAIRGRVDEVDFDGRTVTFTDPEE
RVRSLAWDRLVLTPGSVTRLFDITGLAEHARGLKSPAEALYLRDHVLQQL
ELADVDDDAGRAEARRTVVVVGASYSGTELAVQLRALADSAARQMDFDPA
EVKFVLLDLAEQVMPEVGEKLGAAAQRVLKSRGIDVRLGVTLAEVHPEHV
VLSDDSLIRTHTVAWVTGVTGAPLIEKLGLPTERGRLKVTTELQVPGHPD
VFGAGDAAAVPDVTQPGEITPPTAQHATRQGKALARNVAASLGYGKAKPY
KHRNMGLVVDLGPRYAVANPLNVQLSGFPAKVVTRVYHIYAIPRFVNRWA
VSLAYLTDVFFDRSVVSFGLSTQEDARFATSEGIPMPKPD
375141821YP_005002470.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAGPLRRFDPFRPIDMLTSLWTTAAVGPVSSGAAMAYRTLFTTVRRLVVG
RRLAIRLDDGTLTLTVTEFDSTLDVRGLSVGQLNDVRIAARDIRWEDNTF
HHATAVLHNVHMRPSTPPVLVAAPVELTLQVPAAALDDLFLWAAPRLSGE
VGSDGVARLRMARRPMLGHIEVDAQLDGSTLWLRPRVLVARRSRWTLPAR
APAYPVRLPELPHGLRLTRVAFAPDVVCLTASVSEWQMDLPRKRLEDILG
QLSVAGVPLNLTRLTRLL
375141820YP_005002469.1 transposase- IS30 family [Mycobacterium rhodesiae NBB3]MADAAAAAGVSEASGFRWVRKAGGMANLAKYRDACPILLNGVADVTVLRS
PESDAEPPPGAALSFTERCRIEALLTEGQIPAQIARLLGRHRSTITREIA
RGMTSGDSYRAIRGQCEYETRMARPKVRRLQANPALLAEVLSGLKKRYSP
RQIAGRLRLDFPDDPEMWVSHETIYQAIYVQPRGELARLMKAALRTGRIK
RKPQGRQAQQGRGKLKDMISISDRPKEADDRAIPGHWEGDLILGANNASA
IGTLVERTTGFVLLLHLPGDHTAETVAAAMIAKMPELPEILWRSLTWDQG
REMALHTKITEATGLPIYFCDPHSPWQRGSNENTNGLVRQYFPKGTDLSF
HGPGILDNVAAELNGRPRERFGWKTPAEMLDKLLSDPNQSVAATA
375141819YP_005002468.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAATPDLCEVLRVRGVEAPFWSAAGWEVAAVGSGSVLAGGAVGGDSFGGG
QVGGDQRRDWVEVVS
375141818YP_005002467.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEIARYPEGPVEVTVSRDGDDLIFRSSHEDYGRTITEESRITAPDFVAK
GPGPWPWFDLGIRRAGALQVLDALGVDRPAWTEPLAPSVLDLFERAHRGD
TTVIELLAMGADPDPVDACGATPLWYAVCSLAAGTTVALIDEDADAGRRI
ELSARGEKFTTILHEIVRRGRTVALNHALAHGVDPDLVDSDGATAMHVLD
GSADNVNPEMVRALVRAGAAIDAALPGGTQPIELAARMVLPATVAAMVEL
GADPDRGLDSLLAWWAVGSTFNGYRAAAVADVVDLLRTGGATVTQRHREQ
AANAGASEVEAALRR
375141817YP_005002466.1 lysophospholipase L1-like esterase [Mycobacterium rhodesiae NBB3]MPAYSRYVAIGDSQTEGLWDGDDSVGLVGFADRLATMLDTHHPGVTYANL
AVRGRRIKDLLDEQLPAALALQPDLISVCIGMNDVTRPGPYFGHALSELD
DLYRHLAASGATVLTTTFPDIAKILPIGRVIASRVEQINDDIRKATVRHG
FRLVDLYNAPSMTQPDTWSADRVHGSAKGHQRFAAAAAEALGLPGSNHDW
ALVDGPSRRPSLRSQAVSQVLWTQNMLMPWLWYHVRGKSTGDGRGPKRPQ
LEGVAA
375141816YP_005002465.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTMAVDNEMTYEQFGRQFFEIAVTEDRVGGAIAAIAGDEFAMGPMAQGP
GNLAKVTAKVRVLHPRLTREVGELITFDIRIPLEIDLVVDLRIDKPKFMV
FGEIKLRATARAAGPLLLILDVEKPRPSDISIHVTSKSLRAELVRILGNI
DAEIKRFVAAHVAGEIDSPASKEAKIIDVAESIDGVWSG
375141815YP_005002464.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDSRDDSKSESDVDDDDHVAASRAGKDGDDDGSYVGQTASDDAIDVGESG
AEARSEEAR
375141814YP_005002463.1 NTF2 domain-containing protein [Mycobacterium rhodesiae NBB3]MVGTFMTFTRSDVLATAERSPAAAGAHDRGGWVGLFAADGRVEDPVGSAP
HQGHGAIGLFYDTFIGPRDITYRPDADVVTGSTVVRDGELDIVMGAVDLR
VPVYIRYDVRDADGELKIAALSAFWELPAMVGQFLKGGFAGVPAGLALSK
SLLVNQGAVGVLGYLGGLRGTGARGKRRIGQFLDDARAGDEVAVRRWLSK
GARLTIGDDLPLSTTELLSRVAGTRSRKFIASGYSVAVGLDRDGKRDVLI
ADVAAKSIAIDRIRYFTDDA
375141813YP_005002462.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSNGPFGFDPEEFDRVVREAGEGLRDALDGVGRFLSTSGERAGWVNLVD
EFTRHSRPKREPETTGETGDGVWAIYTVDTDGGAHIEQVYPSELDALRAN
KNNTDPTRKVRFLPYGIAVSVLDASEPPAEEA
375141812YP_005002461.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRAEQVLSEDVPASPDEVRAFYVDLDNIKTVHPLVVSVRETARTELADGY
CQSYRVQDRIPLGPLTLPTSYTAHLRVASVGPVITEARQFPRVRLYGVVS
FDAVGAGTRIVERLTIHAPRPLHKMTTREAVKAHIEMLAGIRRHFGG
375141811YP_005002460.1 ring-hydroxylating dioxygenase- large terminal subunit [MycobacteriMDRDQLIDLTRRALKLARDKTTDLMPTEYTVAADTYTSATHHFEDTAMLL
ASPQLVGYVSELPRPGTYATKTVMGRSVLLTRAADGVLRAFDNVCLHRQS
RITEGCGAARRLACPYHSWSYDLTGALAGVPGKEGFPETSSGTPRLTELP
AAECAGFLWISLDPNATLDIPTFLGPLAAELDSWGIGRWSPLGEKVLDCP
INWKLAIDTFAENYHFATVHKTTFATIARSNCTVFDSFGPHHRLVFPLNG
ILDLEDVPEEEWEPLQAMVVIYALFPNIVLSCTVANGELFRVYPADEPGR
SITVHQNSTPLDVSEESTAAGAAAVFEYAHSTVRDEDYALVAGLQANLES
GVRPHLVFGRNEPGLHHRHSTWVEAVKPTARQ
375141810YP_005002459.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNHPQSTDWRRYPFALVPGDRQLDFPAAEANHPDCESDTWFLAGELTGES
GRGYAFLSIFNKNRPGLGDIVADFYTFALFDLDAGTYGTYTDYDMPPANM
QPGAVMKMSVSDECLDIAFDSGADRAVWRTCRDDNGDLVPYTYDVTFVGT
DAAGEAMRVDLHVTPTRAPVPLGAADFGGKIECFGQADTYSYLQTGLTMT
GTLRWGSSAESVTGNAGHVDRQWFPLIANSGGADGDVRWRAHEWRTINLD
NGVDLSIWRQFDRTDRNALQPFSGATTSSPIPGVDPEYADDIEVAIDSYV
RWPEAVRTLYRPPAKARYLPDRHRLTSRKLDLDLTGEPLVPAPGHGLPLE
YMEGPFHYRGTLRGEPVNGFAFYERSLALYRDWELVDVLASVVGDARVAT
LRELVEGGRREEAVAHLRDEILPSGAGIDQIVDDLIVALSV
375141809YP_005002458.1 NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae NBB3]MRSLDYDKLYIGGRWQEPSTNRRLSVISPHTEEPIGETPEAAPDDVDKAV
TAARKAFDEGPWPRLSVGERMEKIEQLAALYMAETDAIADLITAEMGSPK
SFSRLGQGAGALAQMHLNMATAKEFPWVERRPGLFGDVHLRRAPVGVVGA
IVPWNVPQFLIMPKMIPALIAGCTVVVKPAPETPLDAMWLAEMLDEIDLP
EGVVSIVPGGRETGEALVRHAGVDKISFTGSSATGRHIAALCGEQLKRVS
LELGGKSAAIILDDADIANTVKHLKMASLMNNGQACVAQTRILVSENKHD
EVVDALAEMMSRLQVGDPADDTTDVGPLVAQRQQSRVQGYIQAGLDEGAR
IVLGGKEKPYDRGWYVQPTLFTDATNDMKIAREEIFGPVLTVLKYSDEAD
AVRIANDTDYGLAGSVWTADVERGLEIAAEVRTGTYGINMYTLDTTAPFG
GFKQSGIGREFGAEGLSEYVELQSTVSADKLPDLA
375141808YP_005002457.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MTHHLSWDDIAASTELAEVIDTIDYQRVVMNPGATWDYFPGHFDPDYARR
HGQPTIFVNTMHIAGFVDRIATGWAGPYSRVVRRKVSLLGSIYAGDSMVG
RGRVVGKRMETAGDVARRLVDLEIAVYNQRDELCCPAEVTLEIT
375141807YP_005002456.1 acyl dehydratase [Mycobacterium rhodesiae NBB3]MNDGIRYEFAFGTYSDALRMVGVRTEPRYAGTAVSGARIQHFASMVRDPN
PAYWDVDFAREVWGGLLAPPALLMGWLIPPPWLPTDEPPVPSIAIRVPLP
GTTFINASNDVEFPTTILEGDRLHVVEEVVSVSPEKTTRVGTGHFVETCD
HFYRADGALVAVNRNTLFRFTPAGQS
375141806YP_005002455.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSLTYQQQYVLDGLAGRAAILNLDARHNRLYSDGDLVGWITTFRHSGATY
VRSGESFNDLRTAFDGGGGLRLVTVDHEIVVDGVDATQKCVALLLRDNQL
QASGTFTDRLVYERGGWYFTSRALEWDHATRESALSV
375141805YP_005002454.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MPPGRGAVLDPAAFGVEHFSVPGVLDSRAEQHGSRVMMAIAGTPITFAQM
RDRSCAAAHILRDLGVERGETVALFTGTCPEWVYFWLGAARIGAVSAAVN
AASKGEFLSHALDLSRAALVLTDTDRQPRLADIADDVATLRTTLVQDGSL
IEALAAAPVTPPDVQPAGPHDIGALFFTSGTTGPSKAVATTWHYLFTAAA
TVASSWELGAGDTLWTAMPLFHLSAAPTVLAPMLVGGTSVLASTFHPGRV
WDEMRDCGAVGFAGAGAMVSMLWNLPPDPRDAELGIRFISAAPIAADMYR
EIEQRYRCRIVTMYGLTEAFPIAYKSVSEAGTPGTAGQVNPAFDVQIVDG
HGQPLPIGMVGEIACRARTSHAMSEGYVVSVPAGVTAVPGLDVRPHPEWF
RTGDLGTLDEDGNLSFVDRAKDSLRRRGENVSSVEVEQTVMGHPAIAEAA
AVGIPSDLGEDDILVVVTLNDGATVDFAELLDFCSTRMPYFCVPRYLEAI
EEIPKNVIGRVRKDVLRNRGLGADAWDREAHGYVLSR
375141804YP_005002453.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium rhodesiae MTDTVHDPKVDPSEREFGPSGISLSTYRFPTGWFIVGFASELAPGQVKRA
HYFGEDLVIFRTKSGKVNVLDAYCLHLGANMAVGGTVEGEHIVCPWHGWE
WRGDGTNALIPYSKIGCKQNVKIKSYPTQEWYGFIVVWHERHGRAPYWQP
PVLPELETDDYYPLHPHSRMLNRVKVHAQMIIENAADPYHVQFVHKADSA
ANTTSFDVDGYHLHATVTANFGGGRPSTWLTPEGPVDANIIYDNYSLGLG
IVRFPKELVATIEVTGQTPVDEDYTDYFYTQASVREPGDTGDKPAGRAAK
FLALQQEVIKQDFFTWENMKYLEKPNLAPEEARDYAALRRWAHRFYPGEE
PSPIDFGYTADGEPDPGLARV
375141803YP_005002452.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MPTTTPVDLSDSALWQNGFPDDLFAHWRRELPIFHHELTEGVAQTVKRDF
WMTTKHRHAQRIHRDTDAFTAADGPLIQGIGPIGAFPNVITMDPPVLTKR
RRVMSHAFTPKAIGKLEEGIRRRAAAMIDRLLESGGGDWIEDVADVLPMS
VIGDIVGIPDEDRPHIFDTLDRILKTNEADDQTKPEEHYELFGQIFTYAT
ELTASKRRNPTDDIWSTLTTAVVTDETGQELSIPASELEIFFFVLTLAGS
DTTKNALAGGLQAFVANPAEMERYRDDESIRARAVEEVLRWSSPVAFWTR
TTKVDVEMDGVIIPAGDRVVSMLRSANRDEEVFDDPFVFDIGRTDNPHVT
FGGGGPHHCLGAMLARAEIRAALDELLLRADDIRLGPPKVTHPNLANNMS
IFDGMSISLTRS
375141802YP_005002451.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MGDTAPTPLHDLRVVEISDRIAGAYCGKLLTDAGADVVKVERETGDPLRS
FTATGAVPLTGEDAPLFAYLNAGKRSVTSISDEFLAGADIVVLAATRSGA
TDRGIDVPRLLQLAPALIVVTISDFGWTGPWAERPATEFTLQADSGLTGF
RGDPAGPPISVGGDLGEYQGGVWAAYGALAAHRGVRHGGLGTHLDMSMLE
AITLMQSGEWLHSQLLKAPHVRRSVEVPSIEPAKDGFVGISMVTGQQWLD
FAAMVDCPEFTEIPQLQFQIGRWDYRDWIRERIDPWMRERTVAEIVELGQ
LFRLPLAALGNGATVREMDHLQERGVYVDNPAGFRQPRPPWLMSVATPSP
IRTAPQIGASDGEELWEPRRSRSEARTGRPLAGLRVVDFTAFWAGPSATH
SLAAFGAEVIKIESIQRPDGIRYSGGMRKDVDDWWEYGWVFHAMNTNKRS
VTLDLQTDQGIGLVKTLIAQADVVIENFSPRVMDQFGLGADALLELNPRL
VMVRMPAFGLTGPWRDRVGFAPTMEQLAGLAWVTGMPDGLPVAPRGACDP
LAGTHAAFALMAALEFADRTGRGQLVEVPMVESVLNVTAVQPMEYERFGS
ILERCGNKGHHPGETQDVYRCAGEDSWIAVTVRTDGERDALHAVMGGPGR
DLAEWFATQDAASVVEQLVQAGVPAAVVISPSVVIENPQLVHRGFFESLV
HPSTGPGLYPCPPFAKPEGVDTWLRRPPPTLGQHNGEVLTGLCGLTDGDL
DRLAADGVIGTRPKGL
375141801YP_005002450.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTTLGIGPEARRRLGSRRTAEIVADELRRQIIDGELADGDLLPRQEVLVE
QFRVSLVSLREALRILETEGLVSVRRGNRGGAVVHAPAKASAAYMLGLLL
QSDTVPLADLGAALQELEPMCAALAARRPDRGDELVPKLKEINASMAEQI
EDGAKFTEIGGQFHDEVVRGCGNHTMIAVVGSLETLWTGHLNWWAQETTA
RGEYPSMSQRRIAMSIHNKISDAIEAGDGERARKLSARHIADTQTYFSAV
DPEQRIVALSPQALARRKN
375141800YP_005002449.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MRSALVTGGSGGIGHACGRRLVDLGYDVVLTARREEPLRAAAAEIGARYA
VADAAQPETFAPAVEALDDIDLVVHAAGVLGGTYARKQTFDQWRATMSAN
LDSCFVVTSAALPKMKPGSRFVFVSSSAAHEPMMARTAYSASKAGMNAFA
GALAREVDRDGITVHIVTPGPVETEMLQDVPFEMYAIRANDVADAVAWLD
TLDPSVDLPEIRLHAVTRGPHARSPVVPLEAERRTAQQ
375141799YP_005002448.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSPSDGSTVESALTDLVRDYDKRWSSLDCVALGDLWERDDPAPIYVGDE
YAAPLIGADELERHWARVAGRLSSATVTSTLHEFDVVDDTVVRAIVLSRW
RLAGIEGDAERTGASWITWLLVWRAERLRIFHQMESQVHLSE
375141798YP_005002447.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMTTVEDVAERIAARDIEVTIVDTDVHPLPVSADVLKSYAPAEWKDKLWPT
ANAVSPVPHFYDTPDSYKTNSLRVDAGPPGGGVAGSDPDFAAKQLLVDAG
VSIAVLEPMCDAQLPQAEHVLKATHNDWLADVWLGEANWHGRWRGAISVT
AQDPDAAAREIERWAGHPYMAEVLMTPQTRGIPFGSPHFDPMYAAAARNG
LPVATHLMGQTPFELIPIYPVGNPAHWHDFFASWPLLYVSHLMSLVFDGA
FDRHPDLRVVFVEGGFTWALPAMWRMDRIWEHRKADLPHVRRKPSDYVRE
HVRFTTQPLEEVNLGEYREYLEMMDLGDNIMFSTDYPHWSYDSPDWAIRR
FPADQRERIMRGNATALYGLPSTVKALPAERPGAGDVAV
375141797YP_005002446.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMIIDANVQPHFRYNAEIRRYLSAPHKLRAIPDVEQQWYQAPGGDYRADLY
GDGYPGSDPETMARHLFDEGGADYAILNPLTRGNIADYLLNSRICAAVND
WLLDRWLDPDTSGRFRGTIRVNPEDVRGAVAEIERLAGHPKMVQVGVPLQ
SREPYGKPMFEPIWEAAAAHGLPVAVHINGGNGVDHAPTFAGHAYTYPGY
AAFMPLNSFVHLATLIVEGMFGRHPDLRFVFADGGYDILTPLMWRLDTFW
MSMRDQTPWVDRFPSEYLRDHVRFCSSALDGPTDGSQAERWMDFTDKADL
LMYGSSYPHWSTVGPDAVVAGLNSAQRDKVLWRNASDLFGVAADRAGSPT
EAEVEGSLT
375141796YP_005002445.1 ferredoxin subunit of nitrite reductase and ring-hydroxylating dioxMQRRAVCAVEDLPPGTMKLVQAGKFGVGVYNIAGSLYAIANYCSHEGAPL
CLGYTRGTTEYAPEMPDRIRHVREGQIARCPWHQWEFDITTGESLADPKK
RVRTYEVDVADGQVYLTA
375141795YP_005002444.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTTSTEAQDQSNAPDLLNDPYPYFNHMRRTSPVWRGTLMESDLMPEELKN
PENWTLFDFDSVFTAFREDTVFASEMYNQTIGLVFGPTILGMAGKQHHDH
RSLVSKAFKQSTLAAWEPEVIDPICDQLVDEFKDAGEVDLVKAVTFEFPT
RVTAALLGLPQEDLEMFRRLSLDLISITEDIEAGLNASVELGTYFQQQVD
QRRSAPTTDVIGDLVAAEVDGEKLTDEAIISFLRLLLPAGLETTYRSSGN
LLYLLLTHPEQLAAVQRDRDLIPAAIEEGIRFETPLVLVARNTTREVEMH
GQTIPEGASITLCMGAANRDEKRWEDPDTFDIHRPRRAHISFAGGIHSCL
GMHLARVETKAMLTSLFDRLTDFRLIEDDDTKIVGMPFRSPKHLPVTFKP
TSAEPTKRT
375141794YP_005002443.1 oxidoreductase- Rxyl_3153 family [Mycobacterium rhodesiae NBB3]MKSRAAILHDMGQQWSVEEFELDPPKAGEVLVEMAAAGLCHSDEHIRNGD
MSASNEVMQAYGLPSMFPLIGGHEGAGVVLEVGAGVTDFAPGDHVVTSFV
AVCSRCRWCNSGMEYICDMGAQVMIPGMPTDGTFRHHTTDGRNLGHLSKV
GAFSKHTVVSPDSIVKIDPHLPLLPMALLSCGIPTGYGSAENRAKVRTGD
TVVVIGVGGIGTGAIQGARINGAAQIIAVDPVEFKQKSALGFGATHSVAS
TEEAADLVRDLTSGVMADSVIVSPSLITEADVQPALSLTRKGGTCVLTGM
TRQMTSSIGINLQEFILWNKSLVGTVFGSCNPRVDVPRFTKLYESGQLQL
DEMITRRYRLEEINDGYRDQLNGEIVRGIIDFSLD
375141793YP_005002442.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MNISDHAAGAPDSPALIVDDGTTISYAGLFAGSQRIAALLYDAGLRPGDG
VALVVPNRPEFFEITWGCQLSGLYYSAVNTHFTADEVAYVIADSEAKAVF
IDESMVDLAAYVRKANPRVEVHISVGAALPGWTAYAEALASAGDAPPVSD
GTEMLYSSGTTGRPKAVRRPLPTDGQGSWAQKVLEYSLGQRYDLDSSSVY
LSPAPLYHAAGINYTMAVHRVGAASVLMRKFDAEAVLRLIEKHRVTHAQF
VPTMFVRMLKLPETVRTAYDLSSLRCVIHAAAPCPVDVKYKMMEWIGPII
HEYYGGTEGFAGTGIGPEEWLAHPGSVGKPITPVHVLDDDGVEVPTGTAG
ELFFEGGPAFEYFKDPEKTASVSNDRGWRSLGDMGFVDDDGYLFLTDRST
FMIVSGGVNIYPQEVENLLVMHPKLVDAAVFGVPNDEFGEEVKAVVQPIA
GLDAGPALEAELIEYCRARLATYKCPRTIEFDPELPRDPNGKLYKRRIRD
RYWQGRTSRIV
375141792YP_005002441.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMDINETRERIIFEKSGPIAKITLNWPEKANAQDQKQVEEIDDALRDADRD
YDIKVLILKANGKGFCSGHAIGNNAVDYPEFVEGFKATGMPWKPQTDLFV
KPILNLWEFSKPTISQIHGYCVGGGTHYGLTTDIAIASEDAYFSYPPLQG
FGMPSGECSIEPWVFMNWRRASYYLYTAENVDAKKALEYGLINEVVKRED
LEARVEAIARHIAQAPLTTLLATKANIKRAWEMMGMRVHWQSSNDLVALA
SVSRDVQELIQRVFADKILPSEMAERQAAASKNGDAAT
375141791YP_005002440.1 pyruvate/2-oxoglutarate dehydrogenase complex- dihydrolipoamide acyMADFVIRIPRTSVAVSEAELTELLVEDGQHVEEGSPLFTVATEKVEQEIE
AGASGTVQWTGEIGTTYDIGAEIGRIQDI
375141790YP_005002439.1 pyruvate/2-oxoglutarate dehydrogenase complex- dehydrogenase componMAEKEMTMREALNLALDQALAADERVFLLGEDIADPGASGPTAGLSTKYG
HDRVMDTPISEAAIVGAAIGAAIDGLLPVAEIMIMDFIGIAADQLINSAA
KLRFMTAGRTTAPITVRTQVYGGLGTGATHSQTLEAWFMHIPGMKVIVPS
TPRDGKGLLTSAIFDEDPCLFVETIRLQGQKGSVPTDPGFSIPLGQADIK
RAGSDVTLISYGRSVLECLKAAKQLQQQEINAEVVDLRTLVPLDIDTIVE
SVRRTRRAVVVHDAVQFAGPGAEIVATLQAECFAELTAPIERVGARFVPT
PAAAALEAQLYPSPTRIVNAVQRTLATAGAHG
375141789YP_005002438.1 pyruvate/2-oxoglutarate dehydrogenase complex- dehydrogenase componMSYSAELQRRIYALMVLMKSADDRLSKGIGTGEFMCVYWPSRGQEAIGAA
MGVALRDDDQLVTTYRGLHDLIGKGVPLEEIYGEMMGRTVGASRGKGGTM
HIAKPENGVMFATGIVGAGPPVAVGLAMAAKRKGLDRVTVVSFGDGATNT
GSFHEAANMAALWNLPTVFVCQNNLFAEMTPTRDTMKLERVADRAAGYGM
PGVQVDGNDPLAVLDVLAEAIGKARNGEGPTFIECVTFRFRGHYFGDRMP
YIPKEQLATAMDADPVPRFRKYLIDNGVCTDEELSEIDEGALIKVEQALD
VVKAAEAPTIDELDRDVYASPIRYPV
375141788YP_005002437.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MARGIMYVETMPVSADREAEYHKWYNDTHLEQILSVEGIVSARRFAPTDG
DGPFIAIYELDCDDLDAAVVRLGELGASGTMTGLENLAMDPKPIPKVYRE
IGSLGP
375141787YP_005002436.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MGRVTGKVALVSGAARGQGRSHARTLAAEGADIIAVDICADIETNDYPLA
RPEDLDETARLVEKEGQRAHTEIADVRDRVGLAAAIDRGVEEFGQLDIVV
ANAGICPMTAGLPPQAFVDAVDVDLIGVMNLIHASMKHLHAGASVIATGS
VAAFMATAVNTAGMEGGPGGAGYAFAKQVVAHYVNDLARTLAPEQIRVNA
VHPTNVNTDMLHSPPMYKAFRPDLDNPTREDAEIVFPMIQGMPIPYVEPE
DISEAVLFLASDAARYVTGQQLRVDAGGYLKIKPWSGV
375141786YP_005002435.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDFSYPAEVEPFRKDLRSWLSANLTDAVRAADRERGRDGKAFETLRAWDA
AVADAGWGAVSWPQEYGGRGATVLEQLVYAEETTRARAPMPLNVIGMNNI
APAIMQYGTDDQMRRLLPRMLRADDIWCQGMSEPEAGSDLASLRTRAARD
GDDFVVNGQKIWTSLGHRADWCQLYVRTDPDASKHKGISCLIVDMKSPGI
EVRPLVTINGAADFAEVFFTDVRVPADALLGPLNAGWQVATTTLSHERAG
AARLYAQMEMQLADLVADLANHVVDGRPALENSATLCRLGEVAVRIKYLE
LLCKRSISAMLHGGDALGSASLAKSVWAELGQHLAELAFDVFGPLGSGGR
WVDRRLSSRSLTIAGGTTQINKGITATRVLGLPRQ
375141785YP_005002434.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MNLELTDEQIALRDTVRRYLAEKASLATYVRPLLGDEVAGADAVWRGLAA
MGVTGLLVPEECDGAGMTMVEAGVVAEELGGALYPGPWLSTAVAATRALV
RTGAGEKVPDLLTTIANGSTIATVGPLSGPRPTAIGGARLRGTITGLPDA
GTADVILVFADNPDGIGLYSVDASSAGVAITPCTHVDPTRTYSDVAFDDA
PARLLASPSQDAVDAVVDDVVIAYAADALGAAAAVMNLAIDYAKVRKQFG
QPIGSFQAVQHLCVDMYEATELARSGVIHALWAADAAEPAERHLAALRAK
AFAGRLTTVGDTAIQVFGGIGFTWEHDAHLYLKRLLGWRGFLGSPDRYLE
AVGRGLQ
375141784YP_005002433.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MTGVLRGVRVVELASWTYVPSAGAALADWGADVIKVEDVKAGDPGRALVI
GGFTKENARAHIDFILEIGNRGKRSIAIDIKSETGREFFGRLLATADVFL
TNWLPAPLERARLTVEAIRSFNPSIIIARGTGTGVRGPDRDKGGFDAATY
LSRGGVSYTMTPFGTETPAVQGPGFGDLQGGITLAGGVCAALFHRERTGE
PSIVDSSLLAQAMWTIAPSISVADLFDIDGIPGAPPGLAINPLVNRYKTR
DGRWLQMVFLQPDRYWAGFCERIGLPELATDERFVPSSNLIANAAEACAL
VGDRLASEDLDHWRKVLADEPGVWAALATPKETLNDPQVKPNGYVVPNVD
DQGNEYQIVAAPVQFNETPPAAARAPEHGQHTEEILLELDLDWDDISAAK
DSGAIL
375141783YP_005002432.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMELEAVIYEREPPIARIILNRPDKANTKDAQLVQEVDTCLREADRDKEIK
VVILKANGKGFCGGHVARWGPDENPYPDFGDTFEDLYKGTADLFLWPTLY
LWEFPKPTISQIHGYCMGGGIYLGLLTDFCVASEDAYFQMPLAQSLGEPG
GHTMIEPWLLMNWHRTMDWLLLAPTLSAQEALEWGLLNKVVPRDQLEDTV
EEMARKIGQIPLTTSMAVKNNVKRAYELMGMRVHLQVSHILTNMVGAATD
VQERRRLLIESGKKPRDFIDDA
375141782YP_005002431.1 succinate dehydrogenase/fumarate reductase flavoprotein subunit [MyMVNWDASVDLLIAGSGGGGMVAALAALDAGMEPLVIEKQGLVGGSTGLSG
GMVWLPNNPLMRADGIPDTYEDGLAYFDAVVGDIGEASSAARRETFLTAG
NEMINLLVRKGVRLVRCPGWSDYYPNHKGGNSAGRSVEGVPWDAAALGDW
SDKVQPSMGKNYGFVIKTNELRAVQYFNRSPRAFATAMRVFLRTRIARLR
GREILTNGASFIGQILKAVMDVRRDPPIWINTAMDDLIVEDGRVVGARVT
RDGTPLNVEARKGVLLAAGGFSRNADMRRRYSGDQPNEGKWSIANAGDTG
EVLQTAMALGARTDLLDEAWWLPMVFIQDPGAASLGSGRQRPGAIYVDGS
GKRFCNESNSYVEVGKAMYANKAVPCWQVFDEGYVRRYVSGANPFKKRTI
SEALIEQGAVKRAATIAELAHQIEVPTDALEHTVTRFNEFAAKGLDPDFG
RGQSAYNVCLGDPGYKPNASVGPLDSAPFYATRVFPADVGTCGGVITNEH
AQVLNEQDRPIEGLYATGNITATVMGRNYLGAGGSIANTMIFGYVAARHA
AAANPAR
375141781YP_005002430.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium rhodesiae MTDEGWAPLPVPWAVRSVDRVPKQRYYDQDFYALETELFWPRVWQMACRL
EEIPKPGDFVEYEILDQSIIVVRVADDTVRAYYNACRHRGMKLVEGSGSR
RTFVCPFHGWCWGLDGRNTFVLRSEMFDDANLDADDLGLTPVRLELWGGC
AWINLDDDAPPLRDCVEPFASRHDEFKVEALRIEWWKSCLLPVNWKLATA
AFMEGYHVPQTHPQLLPSAYSPEASSVHPVVQASLYFMRALGSGMGGMTH
ENDIRIAEGLQHMSLPDDPAEAMAAWRGAVNDAVTSWHRARDCDFPDLND
LDRRRVIDPIGFCFPHYFILPQYSSASSYRIRPLGPEETLFEVWSLTRYP
NDRSPGKPTKPEPLEPDDPSWPMIPAQDFSNLPKQQKGLHARGFEYMRLS
NQIEGLISNFERVIDGFLAGLPYDRLVPAIQRTNTTIDVPVAELGLSEKV
RAW
375141780YP_005002429.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMRIIDADGHVAEGASLAVEAMRRWPEHIVPREDGRALVIEGRNYPEADGP
GAGCPREHGLSTAPGIDYSSPEGVLGDADRDHIDTMVLYPSLGLCVPTLE
DPEFGAGFARLYNRWIADYCDATGGRLRGIAVTPIEHGAVAIDVMREAKE
LGLVATHVPPALKTRNLDHRDLDPFYAAAVELDMPLGIHGAPGMHLPKVG
VDRFTNYIQVHCVSFPFDQMTAMTALISGGVFDRHPALRVAFLEAGVGWV
PFFIDRLHEHFEKRGDWIDGGWQRDPEEYLRAGNIWTTCEPEEPILPGVI
DVLGDDFIMFASDYPHWDGEWPHSTEHLRNRRDIGEDSRAKIGGRNAQRF
YSLN
375141779YP_005002428.1 acyl-CoA synthetase [Mycobacterium rhodesiae NBB3]MPSETIQQLLRERATSDTVAVKYDDRTWTWREHLNDASARAAALLALADH
DRPLHVGVLMGNTPEFLNQMAAAGLGGYVLCGINSTRRGDALAADIRRAD
CQIVVADAEHRSLLDGLDLDGVRVLDTSSAEWTRMLEAAGDLTPFREVEP
MDTYMLIFTSGTSGNPKPVRVSHFMVLMSGQALVEKFEVTEDDTCYMSMP
LFHSNALVAGWGVAVARGAAMAPAKFSASNFVSDIRRYGATYMNYVGKPL
AYILATPESPDDAGTPLRIAFGNEASDRDIEAFQQRFGCTVWDGFGSTEN
AVIITREEGTPKGSLGKGFPGVAIYNPETVTECPVARFDADGALTNADEA
IGELVNTDGQGFFTGYYNADDATAERMKHGMYWSGDLAYKDVDGWIYLAG
RSGDWLRVDGENMAAAPIERILIRLPDINLVAVYAVPDENVGDQIMAAVV
LSDGATLTPEAFESFLAEQADLSPKAWPRYVRIAPSLPTTATHKVLKREL
ASQGPTSGDGELWVREPRGTRYERA
375141778YP_005002427.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTAESTTNDTEVYYDPYDVGIVANPYPTYARLRDEAPLYYNEKYDFWALS
RYVDVEKALNNWETFSNQRSDILELMQSDFDMPKGVMMFEDPPIHTMLRG
LMSRVFTPRRMAEIEDQIRNYCINCLDPLVGSDGFDIVAELAAMMPMRVI
GMLLGIPESDQVGFRDRNDANLRTKPGAPMKVAKADAIADGRMYADYVEW
RSNNPSDDLMTALLNVEFTDEEGVTRKLHRKEVLHYTQVVAGAGNETTGR
LIGWLAKVLAEHPDQRREIEQDRSLLIPAIDETLRFEPTGPHVARYMARD
FDAYGQTVPAGSSMLLLFGAANRDPARYDDPDTFNIHRSGSHLTFGKGLH
YCLGANLARLEGRVALDELLNRWPEWDIDYETAQLAPTSTVRGWEKLRII
VS
375141777YP_005002426.1 oxidoreductase- SDR family [Mycobacterium rhodesiae NBB3]MAGRVEGKVAFITGAARGQGRSHAVRLAQEGADIIAIDICRGFEDSTAPA
STPADLAETADMVKNLDRRIVTAEADVRDFDAMKAALDSGVEQLGGLDIV
VANAGIGTTGVKLHKMREDIWDETIDINLGGVWKTVKAGVPHLLARGGGS
VIITSSVGGTKAYPQVGHYIAAKHGVVGLMRTFAVELGARNIRVNTVHPT
HVCTPLLMNEPTYRLFRPDLENPGPDDLAPICQSFHFLPIPWVEPVDISN
AVLFLASDEARYITGVTLPVDAGSLLK
375141776YP_005002425.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSSTASERSRGGRTSATRDALIRATAQVMLEEGYAAATSRRVAAKAGVK
PALVHYYFPTMDDLFLAVLRDGAETNLARQRQALADDEPLHALWRLNSTH
GAKLFMEFMALANHRKEIRSEIAAYAERFGDVEESAVTLAMRAHGVDMEA
FPPVVMSMIVTSLARIVLLERGLGITRGHAEAEAFIKHYVERFELPSS
375141775YP_005002424.1 mycobacterial membrane protein [Mycobacterium rhodesiae NBB3]MIGLAKKIWIPIVIIVVVAVAGFTVHRIRTFFGADGIIVTPKVFADDPEP
FDPKVVKYEIFGSGSYADINYLDLDAKPQRIDGAALPWSLTLQTTAPSAA
PNIVAQGDGSSITCRITVDDEIKDERTSNGLNAQTFCFVKSA
375141774YP_005002423.1 Transport protein [Mycobacterium rhodesiae NBB3]MSTPPSEAPTDSFPPAKPAARPFIPRMIRALAVPIILIWIALIAILNVSV
PQLETVGQMRAISMSPDSAPSMIAMKRVGHVFEEFDSDSSAMIVLEGDKP
LGDDTRAFYDEMIRKLEADKKHVQSVQDFWSDPLTAAGAQSNDGKAAYVQ
VYLAGNQGEALANESVEAVQNIVDGLSPPPGVKAFVTGPAALAADQHIAG
DRSMQMIEAVTFTVIIVMLLLVYRSIVTVLLTLVMVVLQLAAARGVVAFL
GYHEIIGLSTFATNLLVTLAIAAGTDYAIFLIGRYQEARAAGETKEQAFY
TMYGGTAHVVLGSGLTIAGATFCLSFTRLPYFQSLGVPLAIGMTVGVVAA
LTLSAAVIAVAGRFGKTLDPKRALRVRGWRKIGAAVVRWPGPILVATIAL
SLVGLLTLPGYRTNYNDRNYLPADLPANEGYAAADRHFSQARMNPELLMI
ESDHDLRNSADFLVIDKIAKAVFRVPGISRVQAITRPDGKPIEHTSIPFQ
ISMQGTTQQMNQKYLQDRMADMLVQADEMNTTIGTMEKMSALTKEMAATT
HSMVGKMKSMTVDVAELRDNIANFDDFFRPLRNYFYWEPHCFNIPVCWAL
RSIFDTLDGIDTMTHDIQELIPDMERLDQLMPQMVTLMPPMIETMKTMRS
MMLTMYATQKGMQDQMAAMQDNSSAMGEAFDASMNDDSFYLPPEVFDNAE
FKKGMENFISPDGKSVRFIIAHDGDPMTPEGVARIDAIKQAAKEAIKGTP
LEGSTIYLAGTAAVFKDMADGSSYDLLIAAIASLGLIFVIMLLITRSVVA
SAVIVGTVVISLGASFGLSVLIWQHFLGIELHWMVMAMAVIVLLAVGADY
NLLLVSRLKEELHAGINTGIIRAMGGSGSVVTSAGLVFAFTMMSMAVSEL
TVIGQVGTTIGLGLLFDTLVIRSFMTPSIAALMGKWFWWPQRVRARPVPS
PWPQPPQQMAAVGDEGGQQ
375141773YP_005002422.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKRLIVGVAIAAAALLGAAPAQADVDTDFTNELHTYGIYGQKDYNAWIGK
ITCKRLYKGLDKDANMSAQFVHNQLVIDSTTEQAWQFLAAALRMYCPEKL
PILDQAARS
375141772YP_005002421.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLRRASIAAAALGCAAMIFPAVASADATDEYPIPNRLMRTTCTVDQYMAA
ARDQDPMYYERYMIDYRNRPADVQTGARNRIYWFFSLDYAGRRQYSENTA
TNVYYEQMATRWGNWAKLFFNNKGVVAHATDVCMNYPPSDPSVWTWTTTP
375141771YP_005002420.1 hypothetical protein [Mycobacterium rhodesiae NBB3]METVLGLSVTSSSVGWVVLDGSGTGTAYLDHDVVDVTGRPADDLSRHIGA
VRGAQAIAAATGQDLTSIGVTWTDDAAATAKLVLRALPGLGFDKVVPIHL
ADPDDDIELTARAAALAVASSVDTVPVPLLRREPVAAAPIRKHSWVAPAR
AAAVLVAGLSALFVAGPELAGQPESPVPKMQAASDSSAGWQSVYAVSVPV
AAPPTAVTVQLVAGRPSPAPLRPAATVGETAPMTPQVVEAIAPPVAEVAA
PAALLGAEPVAVSHLPAQQIAPVPAPTLPAPSPVVSAPDPAQLVFSPLLG
ALP
375141770YP_005002419.1 Cutinase [Mycobacterium rhodesiae NBB3]MTSILRALGLIGLTVATLPITLATPAATAPCPDVEVVFARGTTEPPGVGG
TGQAFVDSLRSRVGDRSVGVYAVNYPASRAFGTSTPAGRDDMSAHVQSMA
ANCPSTRMVLGGYSQGAAVVDLATTAMPPAVAGNVAAAALFGGPRSSFAD
SLSPGPLPGVGPLYAGKTIDLCVPNDPICAEGGRDWGAHGAYVSSGLVDQ
AASFAAGLV
375141769YP_005002418.1 Transport protein [Mycobacterium rhodesiae NBB3]MSISETTAHPEHHRATGLAKWIRRLAIPIIIGWVVIVGILNSTVPQLEVV
GQMRSVSMSPAEAPSVIAMKRVGEVFEEYKSDSAVMILLEGDEPLGADAH
RYYDGLVDRLEADTKHVEHVQDFWGDPLTATGAQSSDGKAAYVQVYLAGN
MGEALSNESVLQVKKLVDEVPPPPGIKVYVTGGSALAADQQAASDRSVRI
IEVVTFLVIITMLLLVYRSIVSVLLVLVMVVLTLSASRGVVAFLGYHELI
GLSTFATNLLVTLAIAAATDYAIFLIGRYQEARSNGEDRESAFYTMFHGT
AHVVLGSGMTIAGATFCLSFTRLPYFQTLGVPLAVGMATGVVVALTLGPA
IITVASRFGLLEPKRAMRIRGWRKIGAAIVRWPGPVLLATIALSLVGLVA
LPGYQPSYNDRKYLPQDLPANEGFAAAERHFSVATMNPELLLIESDHDLR
NSADFLVIDKIAKAVYRVPGISRVQAITRPDGKPVKFSTIPAQMSLGGVG
QDLNRKYQQDRMADMLTQADEMQVTIDTMTRMSNLMGEMSATTHNMVEKT
RNMTLDIAQLRDYIANFDDFFRPIRSYFYWEPHCFNIPVCSAMRSVFDTI
DGVDTTTQDVQELLPDLERLDSLMPQLLALMPQQIETMKTMKNMMLTMHA
SQGGLQDQQAALSENQSAMGDAFNDSWNDDTFYLPPEIFDNEEFKRGMDS
FISPNGHAVRMIIQHEGDPLSADGIGRIDAIKHAAKEAIKGTPMEGSTIY
VGGTASAFKDMQDGNNFDLLIAAILALALIFTIMLIITRSLVAAAVIVGT
VVLSLGASFGLSILIWQHILGIELQFMVMAMAVIILLAVGADYNLLLVAR
LKEELHAGINTAIIRSMGGTGSVVTSAGLVFAFTMISMVVSDQTVVAQVG
STIGMGLLFDTLVIRAFMTPSIAALMGKWFWWPQVVRSRPKPVPWPRPRD
QFLPS
375141768YP_005002417.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTLTKSVSGADKVAAETPTDRDRAVDVARLGALVVVMFGHCALLLATIDP
TGLRIGNLLGEIPAIASITWIVQVMPLFFLAGGAAGAYGWHRGSSWGSWL
FKRAQRLCRPVFWYLAAWAIGVLVTHQILGADSAASIGRECVALLWFLGV
YLVVLAFVPALTRMSSGRTVVVAVGSLIAASAGFDAIRFAVGEPMAGVAN
FVIVWLIPMVIGVAYARRLIGARAALVASVSAFAAQLVVAAIGPYDVSLV
VTGTERISNVSPPTLLLALHCTWMSCLFVAAAGAIRRWAQRPRVWYVVAT
GNGGAMTLYLWHIPAIAVATFTLHAVGLDAYDVDAPHFWAMLALRAVVFA
IVMFAMFVLLSPLEHRRLPWWDAPPAAPGARSTAAGVLIVVAGVALVLLA
KNGLGDVQGVVTLGFFTAAAAAARICAGSKKASLQTI
375141767YP_005002416.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSQGGWKTIRDHEDRNVAAQTTVNWPAVARNLLANGRGRWLAVVVSLVVS
GGMLYAQSPDKTPHVEKAAPAAPSSAEAPPLDAPAIAVPAEAELLAASAP
AAARDIPFELPKGVAPEGGLQVRTIWAARAISVMFPEITTIGGYRQDPLR
WHPEGLAIDVMIPNHNSEEGIELGNQIAGLALANAKRWGVLHVIWRQGFY
PGIGAPSWTADYGNETANHFDHVHIATAGGGYPTGNETYYYGSMSPDPGN
375141766YP_005002415.1 non-ribosomal peptide synthase/amino acid adenylation enzyme [MycobMELDNPDFPLTRGQQGIWLSRETGHTGAEWQLGLFVRIEGMVDRAVLERA
ICQAVAEAEPGRVGFFETDGRVHQRAVDYPDVELAFHDLSGSPDPVLEAE
AIASSIRRTPMPLSGPLFEFVLFQTHSDEFYLFACCHHIAIDGMGMVLVS
RRVATIYSAMVFGKPIPPAYFGSLRDLVGYESEYEASAEYQEDQEYWSGN
LPTENEAHYPLPRVSSEPDSYLPSAAVQLDPSIVGRIKELSKALGIRRLS
VITAVCALLVRGLTDKGSEVVLDFPVSRRVRPESKTVPGMFAGVVPLVLK
APPESTVADFCRRVDVRIRELTKHQRFPVQTLERPGGLNPTSNRVVVNFI
PSRLTLNLGDAPATATYTNFGPVGDFGLFFLGAGDQLFLLTAGPGLSFPN
LDVSDVAGRLERLLAAMTADPSQRLCFVDSLDEAEYARLDRISNRAVLSA
SGAAPASITALFAAQVESAPEAVALTFEGHSMTYREVDEAANRLAHLLIG
HEARPGAFVGLFLPRSADAIVAILAVLKTGAAYLPIDPAVPDARIGFMLD
DAAAVAVVTTTELAGRLGGHDVAVVDVDDPVVETLPGTALPAPAPDDIAY
LIYTSGTTGTPKGVGVSHQNVTQLLKSLRAQLPTGPGQAWSHWHSLAFDV
SVWEIWGALLHGGRLVVVPESAMTPNAFHELLVSEKVTVLCQTPSAVGLL
SPEGLESTTLMVAGEACPTAVVDRWAPGRVMINAYGPTETTVCVAISGPL
TAGSDVVPIGSPVTGAALVVLDKWLRPVPEGVIGELYVAGRGVANGYVRR
AGLTASRFVACPFGAPGTRMYRTGDLVRWGEDGQLQYLGRADEQVKIRGY
RIELGEIHSVLSDVDGVTQAAVIAREDRPGDKRIVGYVTGTADPMQIRSI
LAERLPTYMVPVAVVTVDAIPLTVSGKLDKRALPAPEYASGDYRAPSTAI
EEALADVYVQVLGVDRVGVDDSFFDLGGDSLSAMRLVATVNTVLGAGLSV
RMVFETPTVAQLAPRIGSDARRLEPLVAVQRPAVVPLSFAQNRLWFIDQL
QGPSPVYNMPVAVRLRGRLKIDALGAALGDVVVRHESLRTLFAAPDGLPE
QVLVEPDRADFGWDLIDATGWSVDELDQTVGEVANRSFDLANEIPLRAKL
FRVGDDEHVLVAVAHHIAADGWSITPLIRDVGTAYTSRSAGRMPDWAPLP
VQYADYTVWQRAQLGDVRDPDSLIAAQLGYWQTALAGMPERLQLPTDRPY
PPTADHRGATVAFDWPSEVQTQLARVARAHNATSFMVVQAALAVVLCKLS
GTSDVAVGFPIAGRGDPALEDLVGLFVNTLVLRVDLTGHPTVSELLERVR
QRSIAAYEHQDVPFELLVDRLQPRRDLSHHPLVQVMLAWQNFADDPSAAL
RLGDVQASALALETRTARMDLTFSLAERFTEDGEPAGIGGTVEFRTAVFD
ASSIETLIGRFERVLGAMTADPARPLSSIDVLDETEHDRLDQIANRAALT
QSPHSSVSISAMFSAQAARTPDAVAVSFAGTSTTYRELDESANRLARLLS
DHGVRFGDRVALLLPRSADAIVALLAVLKSGGAYLPIDPVLPDARVGFML
SDAAAVAVVTTSGLRSRLDGHNLPVIEVDDPRVEQQSSTPLAGPKPDDVA
YVIYTSGTTGVPKGVAVNHLNVTELMKSLHAEVPPGGVWTQFHSLAFDFS
VWEIFGALLSGGRLVVVPDAVARAPEELHALLVAERVTVLSQTPSAFDAL
QAVDEPEAQLSLQTVVFGGEALQPQRLAPWLKVHPESPRLINMYGITETT
VHVTSREIGANDVANTVSPIGSPLEHLGVCVLDQWLRPVPAGVVGDLYVA
GRSVGVGYVKRAGLTSSRFVACPFGAPGARMYRTGDLVRQRADGQLDYLG
RADEQVKIRGYRIELGEIQSVLGELDGVERAVVIAREDRPGDKRLVGYVV
GTADPAGIRPVLADRLPDYMIPTAVVAMDTLPLTINGKLDVRALPAPEYQ
DAAEYVPPGTVVEEVLAGIFSDVLGVGRVGIEDSFFDLGGDSLSAMRLIA
AVNTGLDADLSVRAVFETSTVAQLAQRIGADARRLAPLVAVERPAVVPLS
FAQNRLWFIDQLLGPSPVYHLPVAARLRGKLDVEALGAALADVVGRHESL
RTVFAAVDGVPRQVVIDMDHVDLGWRLVDATEWSTAEVEQAVEVAALQSF
DLSAEVPMRARLFRLGDDEHVLVAVVHHIAADGWSITPLVRDLSIAYTSR
CAGKALGWADLSVQYVDYALWQRAQLGALDDEKSLIAGQLAYWKDMLAGM
PGRLALPTDRPYPPVADHRGATVAIEWPSELQQRVAQLARAHNATSFMVM
QAALSVLLSKLGATSDVAVGFPIAGRRDPTLEDLVGLFVNTLVLRVDLAG
NPAVADLLVQVQQRSLAAYEHQDVPFEVLVEHLNPDRSLTHHPLVQVMLA
WQNFAGDPAADLDLGDLQVTALPLETRAARMDLAFSLAERFTEDGEPAGI
GGTVEFRTDVFDAVSVETLIARFERVIDAMTVDPARPLSSIDVLDETEHA
RLDQIANCAALTQSPHSSVSISALFSAQAARTPDAVAVSFLGTSMTYREL
DESANRLAHLLSDDGVGSGDCVALLLPRSAQAIAAILAALKTGAAYLPID
PALPDARVKYMLTDAAAVAVVTTAGVRARLDGQNPQVIDVDDPRIAQQPT
TALPDPSPRNIAYVIYTSGSTGTPKGVAVSHHGVVRLLESLDTELERAGV
WSQTHSPAFDFSVWEIFGALLAGGRLVIVPDEIVRAPEEFHAQLLAEQVT
VLSQTPSAFYALQAVDGPSAQLSLRTVILGGEALEPQRLREWLDSHPESP
RLINMYGITETTVHASFREIVTSDADSIVSPIGVPLAHLGLLVLDHLLQP
VPPGVAGELYVAGEGLAVGYVRRTALTSSRFVACPFGAPGARMYRSGDLV
RWRGDGQLDYVGRADEQVKIRGYRIELGEIRAALGELEGIDQAVVIARED
RPGDKRLVGYITGTADPALVRNRLGDRLPAYMVPAAVVTLDALPLTVNGK
LDKRALPAPEYTAGEYRAPSTITEDTLVRVYAQVLGVDRVGVDDSFFDLG
GDSLSAMRLVAAVNTVLDAGLSVRTVFDAPTVSELAQRIGAEVRRLEPLV
ALERPVVVPLSFAQTRLWFIDQLQGPSGVYNIPVAVRLTGALDAEAFGTA
LSDVVGRHESLRTIFTTLDGELRQVVLPVEQLDTGWTVVDATCWPPGQLE
QEVADVARLPFDLSTEIPLRAKLFHVAGDEHVLVAVVHHIAADGWSITPL
IRDLGVAYTSRCAGKAPAWADLPVQYVDYTLWQRAQFGLLYDENSLVAGQ
LAYWQEMLAGMPEQLALPTDRPYPPVADYRGATVQVSWPAGLHARIVGVA
REQSATVFMVMQTALSVLLSKLSASSDVALGFPIAGRRDPALDDLVGLFV
NTLVLRVDLTGNPTVADLVAQVRRRSLAAYEHQDVPFEVLVERLNPHRSL
AHHPLVQVMLAWQNFAGDPTAELGLGELQVTSLPLETRGARMDLTFSLAE
RFTDGGAPGGISGEVEFRTDVFDPAAIETLIARFERVIDAMTADPTRSLS
SIDVLDETEHTRLDQIANRARLAQPPHSSVSIPAMFAAQVAKTPTAVAVS
FQGRSTSYRELDEAANRLAHLLVEHGVRSGDRVALLLPRSAEAIVAMLAV
LKTGAAYLPIDPALPDSRIAFMLGDAAPVAAIAAADALSRLEMHDLVLVE
VDDPIVGTQPNITLPGPALDDIAYVIYTSGTTGDPKAVAVTHYNVTELMR
SLSLRLEPESGQVWTQFHSYAFDFSVWEIWGALLHGGRLVVVPEEVSRTP
RDFRSLLDVEQVAVLSQTPSAFHALQTVESGEPQLSLQTVIFGGEALEPH
RLREWLKIHPDSPRLINMYGITETTVHASFREIDARDVDSAVSPIGVPLA
HLGFFVLNDLLQPVPPAVVGELYVAGHGVAVGYLGRSGLTGTRFVACPFG
APGTRMYRTGDLVCWGLDGQLVYVGRADDQVKIRGYRIELGEIQSALREL
DGVEQAVVIAREDRPGEKRLLGYIVGTADPVGVRKELAERLPGYMVPAAV
MLVDTIPLTVNGKLDVRALPAPDYRTGEYRSPSTVTEEILAGIYAQILGV
QQVGVDDSFFDLGGDSLSAMRLIAAVNSGLHADLSVRAIFEAPTVAQLAE
RISRADVVRLKPLVAMERPATVPLSFAQSRLWFLAQLFGPSPVYNMPVAV
RLSGELDVAALREALADVVGRHESLRTIFTATDGVPQQVVIEPAYADIGW
QVVDAGSWPEGQLERAVEDTAQHSFDLSSEIPLRAALFRRAPNDHLLVAV
VHHIAADGWSIAPLVADLGMAYSSRRAGHAPGWADLAVQYVDYTLWQRAQ
FGELTDPDSPVATQLDYWQGALAGLPERIHLPTDRPYPAVADHRGATVAI
EWSAEVQQQVRRVASERNVTSFMVVQSALAVLLAKLSASSDVAVGFPIAG
RRDPALDDLVGCFFNTLVLRVELGGDPSAAEVLAQVQQRALAAYEHQDVP
FEMVVDRVNPARSLAHHPLVQVMLAWQNLPTDPATVIGLPDLEVSALPLE
SRTARMDLTFSLAERYSDDGSPSGISGAVEFRTDVFDAASIEVLIDRFER
VLVAMTADPTQPISSIDVLDEGEWARLDRISNRAVLDAPPVTPLSIPALF
SAQVTKTPTDGALSFEGHTMTYRELDEVANRLAHVLVDHGASQGRCVALV
LPRSAEAIVAILAVLKTGAAYLPIDPALPDTRVRFMLSDAAPIVVLTTTG
LRSRIDGCDSRVIDLNDLGIETAPSAALPVPAADDIAYVIYTSGTTGAPK
GVAITHSNVAQLIGTLPEGFGGSRVWSQSHSLAFDFSAWEIWGALLHGGR
LVVVPDEMLGSPSEMHDLLITEHVDVLSQTPSAVGGLPPAGLDAVALLVG
GEAVTADLVDRWAPGRVMINAYGPTEATIWVAMSTPLTPGPAAPPIGSPV
PGAGLFVLDQWLCPAPVGVVGELYVAGAGVGVGYSGRAALTASRFLACPF
GGVGTRMYRTGDLVRWRADGQLDYLGRTDEQVKIRGYRLELGEIQAALSE
SDGVGQAVVLAREDRPGDKRLVGYVTGTADPAVLRRSLADRLPVYMVPAA
IVVIDAIPLTVNGKVDTRALPAPEYTGGEYRAPSTTIEEVLAGVYAEVLG
VERVGVDDSFFDLGGDSLSAMRLVAAVNSVLGAGLAVRSVFESPTVAELA
PQLGAAEATRFDPLRPAQRPEVMPLSFAQSRLWFLAQLYGPSPVYNIPVA
VRLAGRLDVDALGAALADVVGRHESLRTMFAAPKGIPRQVVVHADDADCG
WRVVDARGWTEDQLAKAIDDVAHHPFDLALEIPIRTNLFHLGDNEHVLVA
AVHHIAADGWSITPLIRDLCAAYASRSGGDVPGWADLPVQYADFTLWQRT
QLGEREDPDSLYARQLAYWRDALAGLPERLQLPTDRPYPAVADHRGATVA
IDWPAELQTRVARLARAHSATSFMVVQSALAVLLGKVGASSDVAVGFPTA
GRRDPALDDLVGCFFNTLVLRVDLADDPDVSELLARVRNSSLGAYEHQDV
PFEVVVDELNPVRNLAHHPLVQVMLAWQNFAGRNADPVAGLGLGDLEVSA
LPFDTRTARMDLTFAVAERFTDDGDPAGISGTAEFRTDVFDPASVTTLVE
RLERVLSAMADDPTRRVSLIDVLDDVEHARLDQISNRAILDAPEAAQVSI
PALFSAQVEITPDEVAISFEGNATTYRDLDQTANRLAHRLVDSGVRTGSR
VALMLPRSAGAIAAIIAVLKTGAAYLPIDPALPDARIGFMLDDAAPTVVI
TTAALRTRLGGHSFLVIDIDDPGLANYADSALPLPAPDNIAYLIYTSGTT
GTPKGTAVTHQNVTQLMGNLDFALPRGGVWTQCHSLSFDISGWDIWGALL
RGGRLLVVPDEVLSSPKQLHDLLITEQVSVLSQTPTAVGGLSPLGLDSMA
LVVGGEAASTDLVDRWAAGRLMINAYGPTEATIWVALSAPLVAGSGVVPI
GSPVPAAALFVLDQWLRPVPAGVVGELYAAGAGVGLGYVGRAGMTAARFV
ACPFGFPGARMYRTGDLVRWGVDGQLLYLGRADEQVKIRGYRIELGEIQA
ALSELDGVDQAVVVAREDHPGDHRLVSYFIGTAEPSDIRETLSLQLPAYM
IPAAVVRMETLPLTVNGKLDRRALPAPEYTGGVYRAPTTAIEEILVGIYS
GVLGVERIGIDDSFFDLGGDSLSAMRLLSAVNITLGVGLSVRTVFEAPTV
AQLAPYVAVSERVLEPLTPVQRPDVIPLSFAQSRLWFLAQLLGPSSVYNI
PVAVRLGGLLDADALGAALVDLLGRHESLRTVFPAVDGIPQQLVVPTGDA
DVGWEIVDATGWSVDELEQAVGAVARQPFDLTSEIPLRARLFRISDEEHV
FAAAVHHIAADGWSVTLLIRDLGTAYASRSAGEVPGWSALSAQYADYTLW
QRAHFGEINDPDSLIATQLDYWQHALSGMPERLQLPADRPYPPVADYRGA
TATIDWPADLQARIAKLAREHSATSFMVVQTALSVLLSKLCTNTDVAVGF
PIAGRRDPALDDLVGLFVNTLVLRVDLTGDPKGSELLNQVRANSLAAYAH
QDAPFEMLVDRLNPARSLAHHPVVQVMLAWQNLPADSVAAMGSGELDVST
LPLENRTARMDLTFSLEERFTDDNGPAGIAGVVEFRTDVFDTVTIETLVD
RFERVLTAITADPSGRLSSIDVLDESEHAQLRQFSHRTALEAPLAATASI
PAQFAVQATTTPAAVAISFQGRSMSYRELDSASNRLAHFLSERGVGPGER
VGLLLPRSADAVVAILAVLKTGAAYLPIDPAVPDARVGFMIADAAPVVVV
TTAGLRPRLDGQSLLVVDVDDPGIAAQPDTQLASPWLGDVAYLIYTSGTT
GTPKSVAVTHHNVAALLWSLNAVVDRAGVWSQCHSLAFDFSVWEIFGALL
SGGRTVVVPDETVRAPEQLHALLTAEQVNVLSQTPSAFYALADVDGTNPY
LGLRTVVLGGEALEPQRLAQWLAAHPISPRLINMYGITETTVHASIRTIL
ATDIDSIASPIGVPLSHLGLFVLDQLLQPVPAGVAGELYIAGAGVAVGYA
GRTALTASRFVACPFGSAGARMYRTGDLVRWRADGQLDYVGRADDQVKIR
GYRIELGEIQAALGSLDGVEQAVVIAREDRPGDKRLVSYVIGTAQPGDIR
GALAERLPSYMVPSAVVVLEVFPLTGNGKIDKQALPAPEYQNPGSYRSST
TFTEEILAGIYTRVLGAQRVGVDDSFFDLGGDSLSAMRLISEVNTSLNAG
LSVRAVFEAPTVACLARRIGSGGHRLDPLIASERPAVLPLSFAQSRLWFI
DQLLDSSPVYNMPVAVRLEGQLDTEALGRALQDVVGRHESMRTVVTSIDG
VPRQVVIDSDRADFGWRVVDAGTWSPSELDDAIGALARRTFTLASEIPLR
VQLFRVSDDVHVLAAVVHHIAADGWSIAPLIRDLGVAYAARCAGQAPDWV
DLPVQYVDYTLWQRAQLGDLDDPDSLIVAQLTYWQNFLAGIPERLQLPTD
RPYPLVANYCGAAIAIDWPAELQQQVHRMAVEHNVTTFMFMQAALAVLLS
KLSASSDVAVGFPIAGRRDPALDDLVGLFVNTLVMRVDLAGNPSVAELLG
QVRQRSLAAFDHQDVPFEMLVERITSSRSLAHHPLVQVLLAWQNFADNPA
AGLDMGELEVSTLPLETRTARMDLTFSLAESFCSSGEPAGISGQVEFRTD
IFDAASVEKLIGRFERVLGAMAADSALRVSSIDLLDEAERVRLDELSNRA
VLSAPAGAPVSVPALFAAQVVRAPDAVALTCGELSMTYRELDETANGLAS
LLIGYGVGPGDCVALLLERSGRAIAAMLAVLKAGAAYLPIDPGLPDPRIE
FMVADAAPAVVITCMGLRSRVGGSDMVVIDIDHPAVDVEPSAALSAPAPA
PAPEDIAYLIYTSGTTGSPKGIALTHRNLAHLAESPPKGLPAEQVWTQCH
SYAFDFSVWEIWAALLGGNRLVVVPDSVVHSPEEFHALLVSEQVNVLTQT
PTAVTALRRQGLESVALLLGGEVCSPGVVDQWAPGRVVINAYGPTEITVY
ASMSAPLQVGGVGVPIGAPVPTAALFVLDERLQQVPEGVVGELFVAGAGV
GVGYINRSGLTASRFVACPFGGFGERMYRTGDLVRWRADGQLDYVGRADE
QVKIRGYRIELGEIQAALCELDGVQQAVVIAREDRPGDKRLVGYVTGTAD
PGGARVALGERLPQYMVPAAVVVLDALPLTVNGKLDTRALPAPEYTATGY
RAPTTPTEELLAAIYAQVLGIQRVGIDDSFFDLGGDSILSMQVVARARAA
GLVFRPRDLFVEQTVSRLVQVASVPLDGGVVDEGVGPVVVTPIMSWLRDV
EGPVGEFNQALVVQSPAGVTQDDVVTVLQALVDRHAALRLYVDDDGAGGW
SMGVPEIGSLDATGCLHIVDELSDEALVRARSRLNPGAGLMLSALWVTSS
GQLAVIVHHLAVDAVSWRILLEDINIAWAQYHNGQPVALPGGGTSFKRWS
ALLAQHAHAPVVVERAGEWRRVMQLPAVLPAVQPTVDMYDTAGHLSVSLD
AETTGMLLGEVPAAFHAGVQDILLIAYALAFTEFSSTYAPIVIDVEGHGR
QEELAADVELSRTVGWFTNKYPVALEVACLDWSHVVAGEASLGELVKNAK
EQLRALPDGLTYGLLRYLNPDVDLEGPDPTIGFNYLGRQAATDNMSSALW
RISPVSLSALTEMPMPLAHTVEVNASALETDAGPQLHANWLWASSALDRE
QVTRLSTLWFDALAGICEHVRNGGGGLTPSDILPTRLSQEQIDQLSQQYG
IFDVLPLTPLQQGLLFHASTTQISDVDTYAVQLSFTVAGQLDPDRLHDAV
QTVVGRHPNLVARFSTEFDEPVQIIQAVPALPWRYVALIAEDGDLAAQVE
DYCAAERAAVCELADHPAFRAALFRTATDRFTFVLTYHHIVMDGWSTPIL
LNEIFASFNGHQLGAAAPYRRYVAWLAERDLECARAAWREALAGFDTPTL
VGPPGRTVLGRRGIATFGMSGETTRGVNELARTNHTTVNLVLQAAWAQLL
MGLTGQHDVVFGTVVSGRPTEVVGSDSMVGLLINTVPVRASIIATTTTVD
FLSQLQAAYSETLEHQHLALPEIHRIAGQDQLFDTLFIYENYPVDSAAMA
SDHELKLNDFSAKESNHYPLSVQVQPGDQLGMRVEYDSDVFEVHSVEALF
ERFVRVLEVMTAEPGRRLSSVDVLSIDERAAIAACGNRAVLFEPATAPTA
ITTLFAAQVRRTPHSVALTFGSVSLTYRQLDDAANRLAHALINHAVGPGE
CVGFLLPRSADAVVAILAVLKTGAAYLAINPGLPEARVEFMLADAAPSVV
LTNSGFRARLDGHDVVVIDVNDPDIATQPSVEPAVMGPMPDDVAYVVYTS
GTTGGPKGVVITHHNVTQLMETLDVQVQRSGVWSQWHSLSFDVSVWEIFG
ALLGGGRLVVVPEEVTRVPEEFHALLVAEQVSVLSQTPSAVGGVSPLGLD
SVALLVGGEAASAELVNRWAPNRLMINVYGPTETTMWAAMSTPLTAGSGA
PPIGSPVPGAALFVLDRWLRPVPAAVVGELYVAGHGVGVGYARQAALTGS
RFVACPFGLPGARMYRTGDLVRWRADGQLDYLGRADAQVKIRGHRIELGE
IQAALCEMSSIKQAAVIVREDRPGDKRLVGYVTGAVNARAIRSALSERLP
EYMVPATIVVIDAIPLTVNGKLDLRALPAPDYATAEYRAPGTAIEEMLAD
IFAQVLGIGRVGVDDSFFDLGGDSLSAMRVVATVNSVLDDGLSVRTLFEA
PTVALLAPHVGAVAQRFQSLRRIERPAVIPLSFAQSRLWFIDQLLGPSAV
YNMPVAVRLTGHLDVAALGAALADVVGRHESLRTVFAAVDGVPEQIVIES
DQADFGWQVVDAAGWSDLKVTQAIEAIAGHLFDLAGEIPLRATLFRLTAD
EHVLVVVVHHIAADGWSITPLIRDVSVAFASRSKGYSPSWSELAVQYVDY
TLWQRSQLGDVKDSHSLVAAQLGYWRDALDGLPERLALPSDRPYPVTADQ
RGAAVAFEWSAELQAQVARVAREHDATRFMVVQAALAVLLSKLSASTDVA
VGFPIAGRGDPALDELVGLFVNTLVLRVELAGDPSIAELMAHVRQRALAA
YEHQDVPFEVVVDHLNPTRSTAHHPVVQVMLAWQNFGGDPAAGLGLGDLE
ITTLPLQTRTARMDLSFSLAERFTDTGERAGISGAVEFRTDVFDAGSIEK
LIGRLQRVLVAMTADPTRRLSSIDVLNGAEHASLDRISNRTVLSAPLAVS
VSIPALFTAQVARTPDAAALTFNGLSMSYRELDEASNRLAHLLTECGAGP
GQLVALLLPRSNEAIVAILAVLKAGAAYLPIDPALPDTRIEFMLADSASA
VVIATAELTSRVHGHGPVIVDVNDSAISSQSTMALPDPASDDIAYLIYTS
GTTGVSKGVAISHCNVTRLFDCIDIGLELGPGQVWTQVSSLAFDFSVWEI
WGPLLHGGRLVVVPEEVVRSPKDFHALLVAEQVSVLSQTPSAVAALAPEG
LDSVALMVAGEACPSKVVDRWAPGRIMINGYGPTEATVYAAISKPLQADW
GAPPIGVPVPGTALFVLDQWLRQVPMGVIGELYVAGAGVGVGYVERSGLT
GTRFVACPFGGVGARMYRTGDLVRWRADGQLDYLGRADEQVKIRGYRIEL
GEIQAALNELEGLEHAVVIAREDRPGDRRLVGYITGAVDPGAARVALGER
LPQYMVPAAVVVLDALPLTVNGKLDTRALPAPDYATAEYRAPGTAIEETL
ADIYAEVLGLDRIGIDDSFFDLGGDSLSAMRVVAAANSRLDAGLSIRSLF
EAPTITSLAPRVDASSATFAPLRPAQRPAVIPVSFSQHRLWFLAQLFGRS
PVYNMPVAVRLSGRLNVAALRAALTDVVGRHESLRTVFAASDGVPEQVVI
EPDQADLGWDVIDGSAWPSRELELAVQEVAQYSFDLAAELPLQARVFRLA
DDEYVFATVVHHIAADGWSIAPLIRDLGVAYAARCAGQAPDWVDLPVQYV
DFTLWQRAQLGHLEDSASPIAAQLAYWQQALAGMPERVALHTDRPYPPAS
DYRGATAVIDWSTELQIQVVKLAREHNVTSFMVVQAALSILLSKLSASSD
VAFGFPIAGRRDPVLDDLVGCFFNTLVLRVDLAADPTIADVLTQVQQRSL
AAYENQDVPFEVVVDHLNPARSLSHHPLVQVMLAWQNFAGRNADPIRGFG
LGDLQVTPVPLDTNTARMDLTISMAERFTESGDAAGISGTVEFRTDIFDA
TTIETFVARFERVVVEMTANPERRVSHIDVLDKAEHARLDKISNRAVLGA
PLSSARVSIPALFAAQVAHMPDAVALTYGSWSLTYFELEQAANRLAHLLL
HHGVGPGQRVALLLPRSGEAIVAVLAVLKTGAAYVPLDPGLPDTRIRFIL
ADAAPTVVITTAVLRTRLSAGNLVLVDIDEPAIESQLNADLSEPSADDFA
YVMYTSGTTGTPKGVVITHRNVTQLMGSPHADLHSAGVWSQCHSLSFDLS
GWEIWGALLQGGRLVVVPDELVGSPRELHDLLVAEQVDVLSQTPSALAAL
QSAGLESMAIVVGGEAASTDLVSRWAPGRVMVNGYGPTETTIWVTMSAPL
SSGCDAGPPIGVPVAAAALFVLDQWLRCVPMGVVGELFVAGAGVGVGYIN
RSGLTASRFVACPFGGFGERMYRTGDLVRWRADGQLDYVGRADEQVKIRG
YRIELGEIQAALCELDGVQQAVVIAREDRPGDKRLVGYVTGTADPGGARV
ALGERLPQYMVPAAVVVLDALPLTVNGKLDTRALPAPEYTAAGYRAPTTP
TEELLAAIYAQVLGVQGVGVDDSFFDLGGDSLSAMRLVAAVNSSLDAGFS
VRAVFEAPTVAQLAPRIGSGAGRLEPLRRMDRSAVVPLSFAQSRLWFIDQ
LQGFSPTYNIAAALALNGPLDAEALGAALADVVDRHESLRTVFPAPGGVP
QQRVIPAGQADFGWSIVDSRGWASADLEEAAAAVVRHSFDLADEIPLRAK
LFRFADEEHVLVAVVHHIAADGWSMTPLIADLGTAYASRSVGEAPAWADL
AVQYVDYTLWQRANLGELDAPGSVVATQLAYWQDELAGMPERLVLPTDRP
YPPVADHRGASATIEWSADLQHHVARVAREHNVTSFMVVQSALTILLSKL
SANSDVATGIAIAGRRDPALDELVGLFVNTLVLRADLAGDPTVAEVLGQV
RAKSIAAYEHQDVPFEVLVERLNPTRSLAHQPLVQVLLAWQNFAGQNIDS
VAGVDLGGLQVTTLPFETRTARMDLSFSLSERFTNDGEPAGISGMVEYRS
DVFDASSIDTMIERFGRVLAAMTVDPTRRLSTVDLLDEAERVRLDELSNR
AVLSAPAGAPVSVPALFAAQVVRAPDAVALTCGELSMTYRELDETANGLA
SLLIGYGVGPGDCVALLLERSGRAIAAMLAVLKAGAAYLPIDPGLPDPRI
EFMVADAAPAVVITCMGLRSRVGGSDMVVIDIDHPAVDVEPSAALSAPAP
APAPAPEDIAYLIYTSGTTGSPKGIALTHRNLAHLAESPPKGLPAEQVWT
QCHSYAFDFSVWEIWAALLGGNRLVVVPDSVVHSPEEFHALLVSEQVNVL
TQTPTAVTALRRQGLESVALLLGGEVCSPGVVDQWAPGRVVINAYGPTEI
TVYASMSAPLQVGGVGVPIGAPVPTAALFVLDERLQQVPEGVVGELFVAG
AGVGVGYINRSGLTASRFVACPFGGFGERMYRTGDLVRWRADGQLDYVGR
ADEQVKIRGYRIELGEIQAALCELDGVQQAVVIAREDRPGDKRLVGYVTG
TADPGGARVALGERLPQYMVPAAVVVLDALPLTVNGKLDTRALPAPEYTA
TGYRAPTTPTEELLAAIYAQVLGIQRVGIDDSFFDLGGDSLSAMRLIAAV
NNGLGAKLAVRTVFYAPTVRSLGEQLDSSDSSVEVVPLEILKEGAGVPLC
CIHDGLGLSWSYRALGAYLDGPIIGINQTIGAGEHEPESIRDMAASYADR
LQAMYPSGRFKLLGWSLGGVVAHELAVELQQRGCVVERLVLIDAASTTER
PTSRNQVPDESEVLEHILSVNRVDTSNRSGPLTYSQAADLIRQRPDVTDF
ALPSRELLDFMAQSVTRNRVHLSEHVPAVFDGDLTIFSAARSDNGHGSPN
PDTWRPYVSGEVAVYSVNCTHFEMLTAASLTMYGAQLKRALEHLDRSPVE
CDQLPGSGLIDP
375141765YP_005002414.1 Stage II sporulation protein E (SpoIIE) [Mycobacterium rhodesiae NBMREQAVAFDVARDAAWTNVPHPVLVVDRAGVVRAVSALAQPLLPEVLRGT
LLRETGPSWLSRAHHDVVQTQPNADEDAGVVAGAVDQRAFTARPTVLPGH
KIAWWLIEDTDRTLQDAQEALARERERATFLDEASAVLMASLNFDRCMEA
TVQMAARHLADAAVVVAPTNGPHVPVVCSVAAGAVEHRSVDADPAEVAGL
AEALRGFPPVPSRWIDPVTLPAWLIPREFTGPVGSVVITPLPGHGVPAGA
LVLLRRSSHTAFSEGEELFARLFAARAGTALSAARLYGEQSAITRTLMRE
LMPPQLHRQHGFELAGGYRASEDHQQVGGDFYDVHPASTPEDETLVVLGD
VCGKGLDAAVLTGKIRNTLQALAPLADKHEDVLKLLNSALLSPDNSRFAT
VVLASVARRDGQLLLRLTCAGHPAPMIVRHDGTLERADTRGTLVGALPQF
RARSYETALAPGEVCLLFTDGVTESRGGPLQRDVFGEDRLSAALAECAGM
PAEAVVERIMMLASQWVGHRTHDDMAVVAIASPHRNHLAAVNGHTAGRYT
A
375141764YP_005002413.1 putative cobalamin binding protein [Mycobacterium rhodesiae NBB3]MTSQVTRSATKSEALERLWGAVIDGDEYAAVGTVFAALDDGFAPESVLLE
LIARVQHRIGTEWAANRLTVAQEHAATAINERVIAALAHHPSCRRTPDAG
RVTVACVDGEWHALPARLLAEVLRLQGWQVDFLGAQVPTPHLIAHLHQHG
PDAVALSCSIPTRLPTAHAAITACQAAGVYVLAGGAAFGPDGRYARLLGA
DAWAPDAQSAAQCLSGDFPRVRFTSNHQPIDDLPHLADQEFTMVSRSAAR
LVETTVGDLERRFPAMAGYTDAQRQHTVEDIAHIVDFLATALYTDDDELF
TEFVIWTAGILSARGVPTESLDPALDLLAAQLRDFPRTQRIISAALTALT
DTKDEQRV
375141763YP_005002412.1 anti-anti-sigma regulatory factor [Mycobacterium rhodesiae NBB3]MNFTLKSDTTSQSAILHIAGDVDYTTTPELVETAEKLLVEHPVLRDLHLD
CAQMTLCDSAGISGLLTIHQRTAAAGVHLHLDRRPNFLERILDITGILDH
LTAAPSARGRREADPVEMADESGVV
375141762YP_005002411.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKYSALIAAALLTGGGLAVGTASPASATDPITLNAVGTYSAEYPWATNTW
VVTPCANNANQCVHVVEYGPGDTERKYPGWSADAYWQVGWWIMLRVPITD
SITCEDGSKHSLPMNYAWDAATGEGVRSYYEPGLCGDAYSGANELQLTKI
GPAADT
375141761YP_005002410.1 putative acyl-CoA transferase/carnitine dehydratase [Mycobacterium MEHTGPLSGVRVLELSIALTGPYIGALFADQGASVVKVERPDIGDIMRWI
GPSVNGLSAVFRVCNRGKQSIAIDIRTDVGREIVLELAERADVVMQNFRP
GVADRLGVGYDDIRKINSEVIYLSQTGFGEVGPYRDRSAYDTVIQAYAGV
ASSQASKDGEPKFLQQVIADKVSALYASQAVTAALFARAMGRGGQHIHVS
MVDAVVSFLWADAAGNEVLLDSDGSQPSSFTIGLRPFPFIDGWGVVTPIS
DSDFTGMCRALEAAGADDPRLGTAELRNQHRPLMAEVMEHCYEGAAKLTV
EQATARFDAEDVPYAMIVSPPELPDDPHAVAMGLFVEVDDPVVGRTRIPR
HPALFDATPAQLAGPAPALGEHTADVLASLGRADQEAELRQAGVIAG
375141760YP_005002409.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMDEPHLKFERDGHVVVLTMNNPRKRNALTPSMIELMAQAWDEIDGNDDIR
VAILTGEGSSYCVGGDLADGWMVRKSSDDDDKPQRERNGSIITDGLLLSR
SLAKPLISAVNGACLGGGCEMLQQTDIRIAEEQAVFGLPEAKWGMIAGAG
STVRLKRQIPYTKAMEMILTGEPLTATEAYHFGLVGHVVPQGKSLDKSRE
IAAVVAANGPLAVRNAKASILASGWLDEEDARKIEQRFVVEVMRSEDAKE
GLAAFSGKRAPRFTGS
375141759YP_005002408.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMENYVIISADTHAELPTEQYREYVDPEYQDDFEAYLAEKKAAAQAGGFID
EEFAEQWFEEHGEGISGGWDVAQRDKELDGDGVVGEVIFPDADAVTGVAG
APFGAGLGQSGDLDPGRAMAGARAHNRWLAQLCSHSPERRAGVAVIPILA
DVDAAVTEITRAAKSGLRGGILIPVLWGDYPPYHDRRYDKVWAVCQELEM
PVHTHVGPAPSAEYGEHLGIYTTEVRWWGARPLWFALWSGIFERFPTLRW
GATECGAFWANDLLWLMDTRFLREHSAKKMSRLLEGQLTMPPSAYFDRNC
FIGATTTERRELARRYEIGVSNMLWGNDYPHPEGTWPNTRKWLRHAFWDI
PIEETRQMLGLAAAEIYKFDLKALAPLVQRIGPTPADLGQDDSVSIPKWE
AARQAGRTWLTEAASMPDLVQS
375141758YP_005002407.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMDRYTVISADCHAGADLLDYREYLDPVFRDEFDSWAAAYVNPYADLVDGD
AERNWNSDRRNADLDTEGIAGEVLYPNTIPPFFPSSSLAATPPETASELE
LRCAGLRAHNRWLADFCSLSPERRAGVGQVMLQDLDDAVAEVKQIAKLGL
RGGVLLPGIPPGAAIPQLYAEHWEPLWAACDDVGLVVNHHGGNAGPSPLD
GWGSSFAIWVYETHWFAHRALWHLIFSGVMDRHPDLTVVFTEQGAGWIPA
TLDSLDVAAARYAREGSAIARFAGPTAGSLSLKPSEFWARQCYVGASFMR
PVECAERHDIGVDRIMWGSDYPHLEGTGFFTREALRYTFSGVPAAEVAAI
LGGNAATVYGFDLAALQPLTDRIGPTVAEVAEPLDAVPAGASSTVFEPDP
IRTW
375141757YP_005002406.1 acetoacetate decarboxylase [Mycobacterium rhodesiae NBB3]MLSTNTVRYGPRPPEARVDHEIDATKAPIATEAVSVTYLTDPEIVAAVLP
KPLQPAAEPLVRISLQRVQIEGRPPFGSAVFSVTARHGDLAGDYPLFMPQ
STEQSVTGGRETFGEPKKLADIAVDRDGDSVTASVARLGYPLIAVSGRIT
GPAELPPDQVNTEFYFKFLRAPDGGGITDPHLVYGEYHRHYELLENIDGT
VELGESPLDPVADIVVREVRSITWCRRRTVQVGRIAERVPQEWLLPYVHQ
RYDDVALLAAPRPEPTTV
375141756YP_005002405.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MATMNDLQGKVAVVTGGAGGIGRAMGRRFGQEGMKVVLADVLAEPLDEAT
RALADDGIEALGVVADVTDYSSVESLAKEVLDRFGAVHVVCNNAGTGAVS
EGYMWEHDLADWRWGIDVNVLGVIHGIKAFVPILLEQGEGHVVNTCSGNG
GFAPIARGAMGGAATAVYPMTKAAVLCLTESLYTHLEMTGTRVRAHVLFP
GGFLNTGIWESWRHRPTQYAATQERHTPDTTLEKVVDRFESAGVHIEFTP
LETVADQVIDGIRADNFWMMGPPAPSDQVVSKKAASILARGEPDYLVDVL
GKSAENTSESEGGKRR
375141755YP_005002404.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAPRPSPQTERVVNLFEHLAEDGSRGVTLAEVSRHLSVHKASCHSMLSEL
LRAGWLLRDPVRKTYHLGPALVRLGREAAGRYPALVLARSVMTELSAATG
AHCVAFSVDENYSTVVDQVRSVHGGGHPMPIGTQFPHRPPYGAATAAWAE
PEVREDWLTALPEEVRDRYRTAIAAARERGYAVGLHILPDLRLQELALIV
RSAEVRSNRLSQLAQELTDELVHQEEWFPISLEPDGTYEVSHIDSPILGP
DSRVVLMLSLVPTAAPISGSAVVRMGSQLATATRRLSVALAGESRESAAQ
375141754YP_005002403.1 small-conductance mechanosensitive channel [Mycobacterium rhodesiaeMIEPAKTFSRTFRGYEPTAVDASIEAFATKQQFLLNDIESLTGRLKERDR
EVTVLRKELADLVETSNSPRAMQQRMAMMLQRAVDEVSEMQAEAQAEAEA
LIAAAAAEAEADQRKHRELLAEMVAKRDALSAEYEEAKNQLEEELAAMRA
ESESQIDAARQDAQERREQLLADAKQEADFYRDQARQEAQEAREQRVRVL
EQLMGVYRDLEEVPATLEAAYREAKDSQEAST
375141753YP_005002402.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MNFDLTDEQQMLAGTTRDVLAKAYDTETRNKVIESEDGWSREVWQQLAEI
GILGMGFDEDSGPTEVMVVMTEIGRRLAPEPVAAAALVPGAVIAAHGTDG
QRALLDGVAAGEQLLAFAHAEGDRRGAKSLSTKAAKQGDAWTLTGRKSPV
IAGDSADVILVSAALPDGGSGLFLVDGSQGDSGVTRTPYRTFDGQRGADI
TFDDAAAQQLGTGGDASAIVDETVIRFQSALCAEAVGAMDEALRLTTDYL
KTRKQFGVPLKTFQTLTQRAADMYVSLELARSMNYYAAVCVADGRFDMMA
AARAKIQIGRSGKHIAQEAIQMHGGIGVTAEYPIAHYAARLTAIDQTFGS
ATDHLRYLSGGLAEYGVVAL
375141752YP_005002401.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MDTGTNCGHIGSMSIIEERGAAAFTSSYRESDEATRESKVAIVRLALSDE
DAKFRDELRDFFTTKIPAEILERARNDELRFPEDMVTSQQILNAAGLAVP
NWPVEWGGKDWTPLQRQIWSDELRMARVPEPLAFNASMIGPVIAQFGSQE
MKQRFLPPTANLDIWWAQGFSEPEAGSDLASLRTTAVRDGDHYVINGQKT
WTTLGQYADWIFVLARTDPDAPKKQAGISILLAEMSTPGITLRPIKLIDG
SYEVNEVWFEDVRVPADQLVGEENAGWGYAKFLLSNERTGIARIGTTKVW
LDEVKQHAATVPIGDGDTTLLQDPIFASRVVEAECELLALELTQLRVSGD
EGTGKPNPASSILKLRGSQLQQTVTDLMVEVAGPNALPFGAAEAASPVWA
QHAAPKYLNYRKTSIYGGSSEVQRTIIASTILGL
375141751YP_005002400.1 deoxyribodipyrimidine photolyase-like protein [Mycobacterium rhodesMTTRDDTPLWLFADQLGPAVYGGEHSHREILLVEATSALSKRPYHRQKLH
LVLSALRHAERDLGDRATLIKADTYTDALERYGRPVLVHEPTSHAAEQFV
HRLKKQKLVTDVLPTPTFALPRAEFTDWAGDRARFRMEDFYRDQRRRFDI
LMDGPDPVGRRWNYDEENREPPPKKQATLGAPKPYQPREDDIDEQVRSDL
DRMDLNTVGVDGPRLFAVTPTEAKRALTRFIDHRLHIFGKYEDAIMGQDW
AMSHSLLSVPLNLGVLHPLDAVHAAEDAYRNNDAPLAAVEGFIRQILGWR
EYMWHLYWHFGPSYTHNNKLDARTRLPNWWTNLDADTVTAECLRHALAGV
RDRGWTHHIQRLMVLGNHALQRGYNPRQLTDWFATAYVDGFRWVMPTNVI
GMSQHADGGKLATKPYTSGGAYINKMSDHCGDCEYDPKKRLGDDACPFTA
GYWAFVHRHRDMLAKNNRTQRAVSSMDRLKDLDAVLEQERARTHF
375141750YP_005002399.1 putative permease [Mycobacterium rhodesiae NBB3]MPVVDLILIALAGVGAGAINAIVGSGTLITFPTLVALGYPPVTSTMSNAV
GLVAGSASGTWGYRRELRGQWNRLRWQLPASFFGAGLGAWLLLHLPEKVF
QQIVPVLLILALVLVVVGPRIQNWARQRSEAAGESAEHVSPRKMVMLVVA
TFAVGIYGGYFTAAQGIMLIAAMGALLPEDMQRMNAAKNLLSLVVNIVAA
VAYTIVAFDRISWLAAGLIALGSTIGGFLGAHYGRRLSQNALRAVIVVVG
LIGLWRLLTV
375141749YP_005002398.1 putative permease [Mycobacterium rhodesiae NBB3]MRSLLIFTFVGLGAQIVDGALGMAFGVTASTLLVLSGVASAQASAAVHLA
EVGTTFASGLSHWKFKNIDWTIVAKLGVPGAIGAFLGATVLSSLSTEDAA
PLMAAILLAIGVYVLLRFSLKTPPAVATGGSKLSAKFLTPLGLFGGFIDA
SGGGGWGPVTTSTLLSRGKTAPRTVIGSVSASEFLVAVSASLGFLVGLRE
EFLHNVPIVLGLTLGGVIAAPFAAWLVSRVSPALLGTAVGGVIVLTNSQK
LVKYFEVTAPWSTLIYTGIVAAWATFVFLAWRLSKAPAFVPAELETRVAE
AEAERIDAVDEAR
375141748YP_005002397.1 ribosome-associated GTPase EngA [Mycobacterium rhodesiae NBB3]MSSSDSDGTWADESDWELGAEDVAEAIEEAAAPPPVVAVVGRPNVGKSTL
VNRILGRREAVVQDVPGVTRDRVSYDANWLGRRFTVQDTGGWEPDAKGLQ
QLVAEQASVAMRTADAIIFVVDAVVGATAADQAAAKLLQRSGKPVFLAAN
KVDSERVEADAAELWSLGLGEPNPVSAIHGRGVADLLDKLIDVLPTVSEM
ASGGGGPRRVALVGKPNVGKSSLLNRLAAEERSVVHDVAGTTVDPVDSLI
EMDGKVWRFVDTAGLRRKVGQASGHEFYASVRTHGAIDAAEVAIVLIDAS
LPLTEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYLLEKEIDRELAQV
AWAPRVNISAMTGRAVQKLVPALEKSLESWDTRVPTGRLNTFFKEIVAAT
PPPVRGGKQPRILFVTQATARPPTFVLFTTGFLEAGYRRFLERRLRETFG
FEGSPIRINVRVREKRGSRSR
375141747YP_005002396.1 cytidylate kinase [Mycobacterium rhodesiae NBB3]MSTSLVIAVDGPAGTGKSSVSRGLARSLGARYLDTGAMYRIVTLAVVRGG
VDLTDTPAIELAAADVPLSVGYDPDEDKAYLDAEDVSREIRGDAVTKAVS
AVSAVPAVRARLVGLQRELASGPGSVVVEGRDIGTVVLPDADLKIFLTAS
AEERARRRNQQNIAAGRADEYETVLADVMRRDHLDSTRAVSPLRAADDAV
VVDTSGMNESEVIAHLTDLAQQRAGVSQ
375141746YP_005002395.1 pseudouridine synthase family protein [Mycobacterium rhodesiae NBB3MADSDGVRLQKVLSQAGIASRRVAEKMILDGRVEVDDRIVTELGTRVDPD
VSVIRVDGARITVDDTLVHLAINKPKGMHSTMSDDRGRPCVGDLVEHRVR
GNKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSYEVPKTYLATVLGSV
PRGLGRKLRDGIELDDGPARVDDFAVVDTVPGKTLVRVTLHEGRKRIVRR
MLAAVGFPVKELVRTDIGAVSLGDQRPGSIRVLSQKELGSLYKAVGM
375141745YP_005002394.1 segregation and condensation protein B [Mycobacterium rhodesiae NBBMTDNTPTDVAADSPAETPPETELDADLDLGIDVAEPPEMGDSELGAVLEA
LLLVVDTPATVEQLAAATGQPAYRVGARLQTMAAELRERDSGIDLREAGG
GWRMYTRARFAPYVERLLLDGARSKLTRAALETLAVVAYRQPVTRARVSA
VRGVNVDAVIRTLLARGLVTEAGVDPDSGAATFATTELFLERLGLTSLAD
LPDIAPLLPDVDVIDDLAESLSDEPRFMKLGAAPAAAAPMSFDVDKDADG
375141744YP_005002393.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTEAVTTAEPEESQQAGFQVRLSNFEGPFDLLLQLIFAHRLDVTEVALHQ
VTDEFIAYTRAIGPQLELDETTTFLVIAATLLDLKAARLLPAGEVHDEDD
LALLEVRDLLFARLLQYRAFKHVAEMFAELEAAALRSYPRSVALDERYQE
LLPEVMIGVDAETFAQIAAAAFTPRPVPTVATEHMHLVSVSVPEQVNNLM
ALLEGRGIGQWASFRDLVADCEAPIEIVGRFLALLELYRARAVAFEQPEA
LGVLQISWTGERPTHQHLAVEEDHYDG
375141743YP_005002392.1 chromosome partitioning ATPase [Mycobacterium rhodesiae NBB3]MSDDPEVPNVGLTGRPPRKIPIPEPKTSHGPAKVIAMCNQKGGVGKTTST
INLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELEHTVHNLLVEPRAS
IDDVLISTRVKNLDLVPSNIDLSAAEIQLVNEVGREQSLARALYPVLDRY
DYVLIDCQPSLGLLTVNGLACSDVVIIPTECEFFSLRGLALLTDTVDKVH
DRLNPKLSIGGILITRYDPRTVNSREVMARVLERFGDLVFDTVITRTVRF
PETSVAGEPITSWAPKSVGAEAYRSLAREVIDRFGA
375141742YP_005002391.1 putative O-methyltransferase [Mycobacterium rhodesiae NBB3]MSLKRRIPFLRWSFWRLAIGSRNITKTGQIGDGREAAAADYVVANARRGD
IDDVIAKIDDFAYDKSFLINIGDEKGELLDAAVRRAHTELALELGTYCGY
GSLRIARAAPTATVFSVELSEANARVAQRIWAHAGVADRVTCVVGTIGDG
GKTLDALANEHGFSAGKLDLLFIDHDKAAYLPDLQSILERGWLHPGGIVV
ADNMLIPGSPKYREYMREQQGKLFDTAEHKTHGEYQTLAPDLVLESEYLG
375141741YP_005002390.1 tyrosine recombinase XerD [Mycobacterium rhodesiae NBB3]MTTFRSTLDDQLQGYFDHLTIERGVATNTLSSYRRDLRRYSEHLALRGID
DLAKVTESDVSDFLVALRRGDPDAGTAPLSAVSAARALIAVRGLHRFAEA
EGITELNVASAVKPPTPSRRLPKSLTLDEVLALLDGAGGDSEADGPLTLR
NRALLELLYSTGARISEAVGLDIDDIDTRARSVLLRGKGGKQRLVPVGRP
AVTALDAYFVRGRPELARRGRGTPAIFLNARGGRLSRQSAWQVLQDSAER
AGITSAVSPHVLRHSFATHLLDGGADVRVVQELLGHASVTTTQIYTMVTV
SALREVWAGAHPRAQ
375141740YP_005002389.1 NTP pyrophosphohydrolase [Mycobacterium rhodesiae NBB3]MAEHDFETVSSETVYVGNIFALRADEVRMPGGKTAKREVVEHYGAVGVVA
LDDEDNVAMVYQYRHPIGRRLWELPAGLLDSGDEPPHVTAARELTEEAGL
AASDWRVLADLVSTPGFTDESVRVYLATGLRDVERPEAHDEEADLTLKWL
PLREAVRMVFAGEIVNSLAVVGILAAHSVEDRSSLRSVDAPWSDRPHAFA
ERKGKGRT
375141739YP_005002388.1 CTP synthase [Mycobacterium rhodesiae NBB3]MPALRKHPQAPTKHMFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKL
DPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRNLYGSANVT
TGQVYSSVIAKERRGEYLGDTVQVIPHITDEIKRRILEMAEPDPAGNRPD
VVITEIGGTVGDIESLPFLEAARQVRHEVGRENCFFLHCSLVPFMAPSGE
LKTKPTQHSVAALRSIGISPDALILRCDRDVPEPLKNKIALMCDVDIDGV
ISTPDAPSIYDIPKVLHREELDAYVVRRLNLPFRDVDWTQWNDLLHRVHE
PRETVRIALVGKYIDLSDAYLSVAEALRAGGFAHHAKVEMRWVASDDCES
ESGAAAALSDVHGILIPGGFGIRGIEGKIGAIRYARKRGLPVFGLCLGLQ
CIVIEAARSVGIADANSAEFDPKTSDPVISTMADQRDAVAGEADLGGTMR
LGAYPAVLEPNSIVAQAYGSREVSERHRHRYEVNNSYRERIAESGLRFSG
TSPDGHLVEFVEYAPEVHPFIVGTQAHPELKSRPTRPHPLFVAFVGAALD
YKAEERLPGMDIPEHSNGSEHPEEVGQPLREAGLQKTEARG
375141738YP_005002387.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MISLRSHAISLAAVFLALAIGVALGSGLLSNTVLSGLQDDKHELQNQIDT
LTDDKNALNEKLSAAGEFDALMAPRILRDSLGGKSVVMFRTPDAADDDVE
GLARLVADAGGSVAGTIDLTPEFVSANSAEKLLSVVNSPIVPAGKQLSTT
SVDQGSQAGDLLGISLLINRDPKVSVVDDAQRETVLATLRDTGFITYGNQ
RIGAANTALIVTGGKLGEDAGNQGATVARFAAGMAPHGSGTVLVGRDGSS
SGTAAVAVARSDAALSTAVSTVDDIDSESGRLTSVLALGDLAAGGKPGQY
GVGQGAASVTIPQ
375141737YP_005002386.1 putative membrane-anchored protein [Mycobacterium rhodesiae NBB3]MKMSALLSRNASSRPGITGTARVDRDIDRLLRRINPGDIVVLDALDLDRI
TADALVEAGVTAVVNASPSISGRYPNLGPEVLVANGVTLIDDTGAEVFKK
IKDGARLRLHDGGVYAGDKLLIQGVERTDHEIHELMHEAKSGLVAHLEAF
AGNTIEFIRSESPLLIDGIGIPDIDVDMNRRHVVIVAEEPSSAADLKALK
PFIKEYQPVLVGVGTGADVLRKAGYRPQLIVGDPDRISADALRCGAQVVL
PADADGHAAGLERIQDLGVGAMTFPAAGSAADLALLLCDHHGASLIVTAG
HSASIEEFFDRSRQQSNPSTFLTRLKVGEKLVDAKAVATLYRSRVSGGAI
ALLVLAMLVAVIVALWVSRADAALLDWVVDYWNQFSLWVQSWVT
375141736YP_005002385.1 lactoylglutathione lyase family protein [Mycobacterium rhodesiae NBMTNTSVRYIVDDVDAAVDFYTSRFQFEVAMRPGPGFAMLRRDGLRLLLNS
PGAGGAGQTLVDGSRPEPGGWNRFQLEVDDLDTAVATLRRAGTELRGEVI
TGRGGRQALVPDPSGNLVELFEAYT
375141735YP_005002384.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MSQKRQPDPRVGHSRRVICRAALEEFASAGYAGFRMEAVAARAGVGRSTL
YRHWPEKAALIADALETLNVQPDPNRELVSGTARQQVELLLGHLARALTD
SPVAACIPALIHGAETDSDVRDFFHGYSAQRRRRLTDAIAAGVTDGQFPA
RVDAEAASVALSGALFYRRLMTADAPDADFIADLIDTVLGA
375141734YP_005002383.1 DNA repair protein RecN [Mycobacterium rhodesiae NBB3]MLSEIRIESLGAISTATAEFDRGLTVLTGETGTGKTMVVTGLHLLGGARA
DATRVRSGAERAVVEGRFTTGDLGEDVTSQIDEILDSSGAERDDDGSVIA
ARSVARDGPSRAYLGGRSVPAKSLGTFTTELLTLHGQNDQLRLMRPDEQR
AALDRFVDVEKPLKRYQKLREDWLAARRDLVDRTQRARELAQEADRLKFG
LNEIDAVAPQPGEDDSLVNEIQRMSELDAVREATQTARASLSGSDDPSPE
SASALGFVAQAKSAIETTDDPALRALAAQLDGALVVIGDVASELGDFLAS
LPTDASMLETKLLRQSELRTLTRKYAANIDGVLQWAQESRDRLAQLDVSE
EALADLERQVNALHDEVVVAANELTKVRTKAAKGLSKAVTAELSGLAMAD
AEFTVSVAPLPARADDAAPLTVSAGVTLHAGQYGVDAVDFGFAAHRGMDV
LPLNKSASGGELSRVMLALEVVLAASTEGTTMVFDEVDAGVGGRAAVQIG
RRLARLARTHQVIVVTHLAQVAAYADVHLMVDSGGRGKASGVRRLDDDDR
VAELARMLAGLGESDSGRAHARELREAAQHEREAGA
375141733YP_005002382.1 putative sugar kinase [Mycobacterium rhodesiae NBB3]MTTERDILLVVHTGRDDATDVARRVHKVLGDNGIRLRVLSAEAVDRAPEH
LSPDDARALGSGIEVVDADEGVAEGCELVLVLGGDGSFLRGAELARNVEI
PVLGVNLGRIGFLAEAEAENIDSVLDHLITRDYRVEERMTLDVVVRAEGE
IIDRGWALNEASLEKGPRLGVLGAVLEVDGRPVSAFGCDGVLVATPTGST
AWAFSAGGPIVWPDLEAILVVPNNAHALFARPMVTSPDASIAIEVEASGH
DALVFCDGRREMVVPAGGRLEVTRCGTPLKWVRLDSAPFTDRLVRKFRLP
VTGWRGQ
375141732YP_005002381.1 hemolysin A [Mycobacterium rhodesiae NBB3]MARRARVDAELVRRGLARSRQQAAELIGAGRVSIDGMPAAKPATAIAVSA
ALTVDNTDERSWVSRGAHKLTGALDAFGLSVADRRCLDAGASTGGFTEVL
LDRGAREVVAVDVGYGQLAWPLRNDPRVNVMERTNVRDLTADAIGGPVGL
VVADLSFISLSTVLPALTSCADADADIVPMVKPQFEVGKDRVGAGGVVSD
PQLRADAVLTVARRAAALQWHTVAVTASPLPGPSGNVEYFLQLRSRTDSP
LEGELLEQAVLQAVAEGPQ
375141731YP_005002380.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVRAHPGRSASVNTDMSTDPDQIRAQIAELLADLPDPAQEGSGFDELADA
EIDVVAARLEQAHELLVQALESVEKG
375141730YP_005002379.1 putative HAD superfamily sugar phosphatase [Mycobacterium rhodesiaeMSELAQEHDCLLLDLDGTVFRGHEATEGAVETLSTVQARTLYVTNNASRS
PADVAKHLHELGFTAESEDVVTSAQSAANLLAGQLPSGASVLIVGTDALA
AEVSGVGLKPVRQFSDGPDAVVQGHSPQTGWSDLAEAALAIRSGALWVAA
NVDLTLPSERGLLPGNGSMVAALRAATNAEPQVAGKPQPTLLNDALARGT
FSAPLVVGDRLDTDIAGANAAGLPSLMVLTGVSTADDMIRAVSSERPDYL
AADLRSLNDRVDSLRVGPHPGWRIDIDASAVAVHATGRDVGDSLSVVRAI
ASAVWEADLDGRPFTISAGDDTARQALEPWSVLTPADRLA
375141729YP_005002378.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVQDGNNGNRGRGSRGSAPRSSGPNRARRAQPRSVENTPQDDGPPIPADI
EAKQLAPDIRGELTTLDRSTADTVARHLVVAGLLLDEDPEAALAHARAAR
ARSGRIAAVREAVGIAAYHSGDWAQALAELRAARRMGSKSALLPLIADCE
RGVGRPERAIELARSPEAAALTGDDADEMRIVAAGARCDLGQYEQAMAIL
STPQLDRTRVGQTAARLFYVYAETLLALGRSQEALQWFINAAAADLEGLT
DAEDRITELS
375141728YP_005002377.1 tyrosyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MTSTGASILDELEWRGLIAQSTDRDALAGELAAGPVTVYSGFDPTAPSLH
AGHLIPLLTLRRFQQAGHRPIVLAGGATGMIGDPRDVGERTLNTADTVAE
WAGRIRGQLERFVEFNDSATGAVVENNLTWTAEMPTIEFLRDVGKHFSVN
VMLDRDTVRRRLEGDGISYTEFSYMLLQANDFVELHQRYGCGLQIGGSDQ
WGNIIAGVRLVRQKAGATVHALTTPLVTDSEGQKFGKSTGGGSLWLDPDM
TSPYAWYQYFVNTADADVVRYLRWFTFLTREELAELEQATAERPHERAGQ
RRLARELTNLVHGEAATAAVEHASQALFGRGELSQLDEPTLAAALREASV
AELSAGEPDVITDLLVASGLSASKGAARRTIGEGGAYVNNVRIESEAWAP
QPSDFLHGRWLVLRRGKRNIAGVHRVG
375141727YP_005002376.1 DNA-3-methyladenine glycosylase [Mycobacterium rhodesiae NBB3]MSARRLSVDPLSAAGRLLGATLVGRGVSVMIVEVEAYGGPEGQPWPDAAA
HSYRGVGGRNAVMFGPPGRLYTYRSHGIHVCANVVCATDGVAGAVLLRAV
AIESGADVAQARRGESVRPAALGRGPGNLCSALGITMEDNGIDLFDGQSP
IQVTLGGKRDGVAGPRVGVSKAADRPWRMWLAGRPEVSLYRRSPRAPAPG
ESD
375141726YP_005002375.1 multidrug ABC transporter ATPase [Mycobacterium rhodesiae NBB3]MMSSSRDELTRRSSDVAIDVNDLRVERGKRVALDDISVRIARGTITGLLG
PSGCGKTTLMRCVVGTQIIEKGTVTVLGHPAGSADLRHRVGYVTQNPTIY
DDLKVIDNVRYFAALTGADSSDADDAVATVGLQDHRTAFCGNLSGGQRTR
ASLACALVSHPDLLVLDEPTVGLDPVLRVDLWERFDQLAEHGTTLLVSSH
VMDEADHCGDLLLMREGHLLAHTTPAKLREDTGCQSLEEAFLSVIRHSTA
A
375141725YP_005002374.1 ABC transporter efflux protein- DrrB family [Mycobacterium rhodesiaMSVTGGSVPVRHPAQHRSLKARNRLSPQAYLATTTRILRQLAADHRSVAM
ILVVPSLVITLMYFMFQDAPHRPGAPSPFNNACLIMLGVFPLIVMFLITS
ITMQRERVSGTLERILTTPLRRLDLLAAYGTAFSIAAAAQATLACIVSFW
FLGLDTAGSPILVFIIAIINAVLGVGLGLLCSAFARTEFQAVQFMPLVIA
PQLLLCGIIVPRDVLPVWLQWVSNVLPASYALEALQQVGAYAEPTFIAVR
DIAVVIGFAVVALCLAAATLRRRTP
375141724YP_005002373.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTTLTTNAERKRPGRPRGTSDTRERILSSARELFARNGIDKTSIRAIAAD
ADVDPALVHHYYGTKTELFAAAIHIPIDPMQVIGPLQQIPVEEIGRTLPL
LLLPLWDSEMGKGFIATLRSILAGSDPSLVRSFLQEVITKEVGSRVDNPP
GSGPLRVQFVASQLVGVVMARYILELDPFKSLAVEQIAETIAPNLQHYLT
GELPGFA
375141723YP_005002372.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLDDKLLAILVCPEDRGPLLLVNNECLYNPRLRRAYRIEDGVPVLLVDDA
VSVTDDAEHARLLERASGESG
375141722YP_005002371.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSETGKARIDWRRAVAGGVLAVGLMSGFGVSTAFAQPAAPTETETPTAQ
DTRQPGESCTGEDCAKPVAGEPETRAPGESCTGEDCAKPVAGEAEVPGGR
QANMTADEALMIIYNEYNMGEGGGQLSRLIDDVMNLRAQGFKASNANKLA
IQDALDHRPNQAPLIEALKATLQYQRKLQAQQQMAAAQQQQQQQQQVPGA
NLPVSPGG
375141721YP_005002370.1 poly(3-hydroxyalkanoate) synthetase [Mycobacterium rhodesiae NBB3]MDLSGLTRPVGRLVATAQNGLEVLRYGGLETGAVPSPFQIIQSVPMYRLR
RYFPPDSRPEAKKPGPPVLMVHPMMMSADMWDVTREEGAVGILHRAGIDP
WVIDFGSPDKIEGGMDRNLADHVVALSEAIDTVKEVTGRDVHLAGYSQGG
MFAYQSAAYRRSKDLASIIAFGSPVDTLAALPMNMPASIAPAAADFMADH
VFSRMDIPGWLARTGFQMLDPIKTAQSRIDFLRQLHDREALLPREQQRRF
LQSEGWIAWSGPAIAELLKQFIAHNRMMSGGFSIHGDLVTLSDIECPVLA
VVGEVDDIGQPASVRGIKRAAPKADVYEFLIRAGHFGLVVGSKASTQTWP
AVAQWVKWIDGTGDMPDGVTPMPLQPEEPNETGVSLSSRLVHGTNAATEM
VFTLARSATGALVAANKSARAIVVETYRTLPRLARLGQINDHTRISLGRI
MSEQARDLPNGEALLFDGRVHTYEAVDRRINNVVRGLIEVGVRQGAHVGV
LMETRPSALVAIAALSRLGAVAVLMPPDADLVTAARLGAVSDIIADPSNL
DAARKLNMRVLVLGGGEVRDLDLPEHADVIDMEKIDPDVVDLPGWYRPNP
GLARDLAFIGFTSIAGTFVARQITNHRWALSALGTASAANLGRGDTVYCL
TPLHHQSGLLVALGGAVVGGSRIALSRGLRPDRFLQEIRQYGVTVVSYTW
AMLRDVIDDPSFSLTGSHPVRLFIGSGMPTGLWQRVVEVFEPARIVEFFA
TSDGQAVLANVAGAKIGSKGRPLPGSGEIALAAYDAEDDLILEDERGFVR
RADTNEVGVLLAHPRGPVDPTASVKRGVFAPADTWVSSEYLFRRDEDGDY
WLVDNRSTVIHTPRGVVYAATVNDAVSRLGAVDLAVTYGVDADGEHLAVT
ALALRPGGTIPSADLSEALADLAVGNPPDIVHVVPEMTFSASCRPLISPL
RDAGIPKPSRNAWYLDRDTNRYKRLTVAVRTEIAGG
375141720YP_005002369.1 ABC transporter ATPase [Mycobacterium rhodesiae NBB3]MQSPDRAAWPATYHRAAMANLVNVERASVGYGTRTLLNAVSLGLDEGDAV
GVVGRNGDGKTTLLQVLTGTRSPDSGRVTHTSGLSVGYLRQSDEFGGATV
RDVIVGGRPDHVWAAEPGTRDVVSHLLSGVDLDSEVGRLSGGERRRVALA
TELIAGHDVLVLDEPTNHLDVEVIGWLAQHLNARRAKALVVVSHDRWFLD
AVCTSTWEVHDGVVDAYEGGYAAYVLARAERTRVAAGVEARRQNLMRKEL
AWLRRGPPARTSKPKFRIQAANDLIANEPPPRDSLGLQTFATTRLGKDVF
DLHRVRLEVGSNVVLDRIDWSIGPGARIGLVGVNGTGKTSVLRLLADELQ
PASGNIKRGKTLKIGYLSQALVELDGSERVLDAVENRRRITELAGGREIS
ADTLLKDFGFTGDKLTTRLSELSGGERRRLQFLRLLLDEPNVLLLDEPTN
DLDIDTLTVIEDYLDGWAGTLIVVTHDRYFLERVSDVTYALTGGGRCDLL
PGGIEQYLADRAARESVEPAAAEPQRGESASARERRTGKEMARIEGQLEK
LEKQIAAIHESMAEAAADHVRVGELNAELQDMLTRKESLEEAWLAAAED
375141719YP_005002368.1 argininosuccinate lyase [Mycobacterium rhodesiae NBB3]MSTNEGSLWGGRFTDGPSDALAALSKSTHFDWVLAPYDIAASKAHARVLS
RAGLLTDEQRDGLLVGLDNLASDVADGSFGPLVTDEDVHGALERGLIDRV
GEDLGGRLRAGRSRNDQVATQFRMWLRDAIRRIADGALEVVSALATQAAA
HPTAIMPGKTHLQSAQPILLAHHLLAHAHPLLRDVDRLVDFDKRAAVSPY
GSGALAGSSLGLDPDAIAEELGFDAAADNSVDATASRDFAAEASFVFSMI
GVDLSRLAEDIILWSTTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSVLQLELLLPAMAGL
VSTLRFDVDRMAELAPLGYTLATDVAEWLVQRGVPFRVAHEAAGAAVRAA
EARGVGLEDLEDAELAGIHPELTSQVREVLTIDGSVNSRDARGGTAPIQV
AKQLGVVHETADRLRHRLRR
375141718YP_005002367.1 argininosuccinate synthase [Mycobacterium rhodesiae NBB3]MPKSASERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMEV
VRQRAIDCGAVEAVVVDAKDEFAEQYCLPAIQSNALYMDRYPLVSALSRP
LIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLEVLAPVR
DYAWTREKAIAFAEENAIPINVSKRSPFSIDQNVWGRAVETGFLEHLWNA
PTKDVYDYTEDPTVNWNTPDEVIVGFERGVPVSIDGRDVSVLQAIEELNR
RGGEQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLEREL
GRFKRGTDQKWGELVYDGLWYSPLKAALESFVAKTQEHVSGEIRMVLHGG
HIAVNGRRSAESLYDFNLATYDEGDTFDQSSAKGFVHVHGLSSKISAQRD
LAGQ
375141717YP_005002366.1 arginine repressor [Mycobacterium rhodesiae NBB3]MTNAATRAGRQARIVSILSSQSIHSQGELATMLADEGIDVTQATLSRDLE
ELGAVKLRGADGGVGVYVVPEDGSPVRGVSGGTERMSRLLADLLVSTDAS
GNLAVLRTPPGAAHYLASAMDRAALPYVVGTVAGDDTILVIAREPMTGTE
LAAKLESIQQGGD
375141716YP_005002365.1 ornithine carbamoyltransferase [Mycobacterium rhodesiae NBB3]MTRHLLRDDDLTPEEQAEVLALAAELKNAPFGRRPLDGPRGVAVIFDKNS
TRTRFSFEIGIAQLGGHAVVVDGRSTQLGRDETLEDTGRVLSRYVDAIVW
RTFAQDRLTAMASGATVPIVNALSDEFHPCQVLADLQTLDERVGTLNGLR
LSYFGDGANNMAHSLMLGGVTAGIHVTIAAPVGFEPDPGVVSAAKKRAAE
TGASVTVTTDADAAADGTDVLVTDTWTSMGQENDGLDRVGPFKPFQVNSA
LLARAQMNAIVLHCLPAHRGEEITDDVIDGPQSAVWDEAENRLHAQKALL
VWLLERS
375141715YP_005002364.1 acetylornithine/succinylornithine aminotransferase [Mycobacterium rMSLTQRWEAVMMNNYGTPPLELASGDGAVVTDVDGKSYLDLVGGIAVNVL
GHRHPAVIEAVTRQLNTLGHTSNLYATEPGIALAEALVSLFGADPDVGAR
VFFCNSGAEANEVAFKISRLTGRTKLVAAQNAFHGRTMGALALTGQPAKQ
APFAPLPGDVTHVPYGDVGALEAAVDDETAAVFLEPIMGEGGVVTPPAGY
LVAAREITAAHGALLVLDEVQTGMGRTGAFFAHQHDGITPDVVTLAKGLG
GGLPIGACIATGKTAALLTPGLHGSTFGGNPVCTAAALAVLQVLADDDLV
GRAGVLGKTLHHGIESIRHPLVDHVRGRGLMCGIVLTSEVAKPVEAAARE
AGFLVNAAAPNVIRLVPPLILTEAQVDDFVGALPKMLDAGATGGSQ
375141714YP_005002363.1 acetylglutamate kinase [Mycobacterium rhodesiae NBB3]MTPATPVKAQVLAAALPWLKQLHGRIVVVKYGGNAMTDDTLKAAFAADMV
FLRNCGIRPVVVHGGGPQISAMLKKLGIEGDFKGGFRVTTPEVLDVARMV
LFGQVGRELVNLINAHGPYAVGVTGEDAHLFTAVRRDVTVDGVATDIGLV
GDVERVDADSLLDLIVAGRIPVVSTIAPDADGVVHNINADTAAAALAEAL
GAEKLVMLTDIEGLYTDWPDRNSLVSEIDTAALTQLLPTLESGMVPKIEA
CLRAVSGGVPSAHVIDGRVEHCVLVELFTDEGTGTKVVRPATTPERGTSS
GKETDRSGEA
375141713YP_005002362.1 glutamate N-acetyltransferase/amino-acid acetyltransferase [MycobacMTSEPEATNYEVADSSKLIRTQGVTAPAGFRATGIAAGIKVSGALDLALV
FNEGPDHAAAAVFTRNKVKAAPVLWSQQVLTTGRLRAVVLNSGGANACTG
PGGFQDTHATAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAG
ITAIVHEMAGGLTGGEEAARAIMTTDTVPKQVALHHSGNWTVGGMAKGAG
MLAPSLATMLSVITTDAAASSEALDQALRKATARTFDRLDVDGSCSTNDT
VLLLASGASEITPSQTDLEDAVLRVCDDLCAQLQADAEGVTKRILVTVTG
AESEQDALTAARVVARDSLVKTALFGSDPNWGRVLAAVGMAPVALEPDRI
TVSFNGSAVCVDGVGAPGAREVDLSGEVIDVTIDLGVGDSQASIRTTDLS
HAYVEENSAYSS
375141712YP_005002361.1 N-acetyl-gamma-glutamyl-phosphate reductase- common form [MycobacteMQNPCMTSVAVAGASGYAGGEILRLLLGHPAYADGRLTIGALTAAASAGS
TLGEHHPHLLPLANRTLDATDAQTLSDHDVVFLALPHGHSAALADELGAD
TVIVDCGADFRLTDAGAWERFYGSSHAGSWPYGLPELPGARERLRGAKRI
AVPGCYPTAALLALWPAIAEELIEPAVTVVAVSGTSGAGRAAKTDLLGSE
VIGSARAYNVGGKHRHTPEIAQGLKAVTDRDVTVSFTPVLIPTSRGILAT
CTARTTAPLSQIRAAYEKAYDAEPFIHLLPEDRLPTTGAVIGSNAAQLAV
TVDEDAATFIGIAAIDNLVKGTGGAAVQSMNLALGWPETEGLSIVGVAP
375141711YP_005002360.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIEVLEDMPEGVAGIRVSGKVTGDEISAFKPEMQKLLDADEVRIVEVIAP
DYDGFGHGGLVEDLKQGFGVLIKHHSAFKRVAVVADKEWVRHTVHAVGWM
MPYELEVFGLDDLERAKQWAAG
375141710YP_005002359.1 phenylalanyl-tRNA synthetase subunit beta [Mycobacterium rhodesiae MRLPYSWLRDVVQAGAPGWDVSADELEETFIRIGHEVEEVLPVGPVTGPL
TVGRVAEIEELTEFKKPIRAVKVDVGETELRDIVCGATNFAVGDLVVAAL
PGSVLPGDFAIATRKTYGRTSDGMICSTAELNLGTDHSGILVLPAGTAEP
GTPAADVLGLDDVVFNLAITPDRGYCLSVRGMAREIANAYDLAYVDPADI
APLPAEGEALPVTIDAGTGVQRFALRPVTGIDPKAVSPWWLQRRLLLSGI
RAISPAVDVTNYVMLEIGHPMHAHDRSLITGGFRVRFADPGETVVTLDDI
ERRLDPADVLIVDDVATAAIGGVMGAGTTEVRDSTTDVLLEAAVWDPAAV
SRTQRRLHLNSEAGRRYERTVDPAISVAALDRCSTLLAEISGGTVEPTLT
DWRGDPPRGDWSPAPVSMAIDLPDRVAGVEYAPGTTIKRLTQIGADVVVN
GDEVTATPPSWRPDLRQPADLVEEVLRLEGLEAIPSVLPLAPPGRGLSPT
QKRRRAIGKSLALNGYVEILPTPFLPAGVFDQWGLSADDPRRSTTQVTNP
LEADRPQLATTLLPGLLEALVRNVSRGAVDTELFALAQVVEATTDTRAVD
RIPTDRRPTSDEIAALDASLPRQPQHVGVVMAGLREPAGPWGRGRPVDAS
DAFEAVRVVGRAAGVELTLRPAQHLPWHPGRCAEVAVGDTVVGHAGQLHP
AVIERSGLPAGTCAVELNLDAIPLTESLPAPAVSPFPAVFQDIALIVGED
VAAADVIDAVRDGAGDLLEDVRLFDVYTGPQVGEGRKSLALALRFRAADR
TLTEDEASAARDAAVQAAADRVGAEQRR
375141709YP_005002358.1 phenylalanyl-tRNA synthetase subunit alpha [Mycobacterium rhodesiaeMAEQPVELSEEALTNAVSAARRAFDAAGDLDALARAKTEQLGDRSPIALA
RQALGSLPKTDRADAGKRVNVARTEAQQAYDERLAALRAERDAAVLIAER
IDVTLPSTRQPLGARHPITILAEHVADTFVAMGWELAEGPEVETEQFNFD
ALNFPPDHPARSEQDTFYVAPEGSRQVLRTHTSPVQIRALLERELPVYII
SIGRTFRTDELDSTHTPVFHQVEGLAVDKGLTMAHLRGTLDAFARSEFGP
EGRTRFRPHFFPFTEPSAEVDIWFANKKGGPGWVEWGGCGMVNPNVLRAC
GIDPEVYSGFAFGMGLERTLQFRNGIPDMRDMVEGDVRFSLPFGVGV
375141708YP_005002357.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRRLLFALVVAGSQTACGSTPGPLQAPFADGSTQAVAEAVDGVTAFPTEL
DPRIFTGAQMKPDLHDATLRIVDRIITDTGIKGLTVTGVELYGSNASYEY
DDTSDFGVHVFFTSDSMTSQELAPIPRLLNDDVERRQEGHVRFYGIPVEV
SFHAERGEGYQPQPGVGQYSITDRRWVTMPTRQPDHFDRTQMTADMSKFI
SAYNDLLSGYQQAPKGFDCSKFGALDDEMAAYRDEGFTEGLGSRSTQNLV
YRALRRLNVSVPDMVDTLQDECTFVNESVG
375141707YP_005002356.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRSVGRAGPVKVAALVLWQLRFDLVAILAIAALMVPIPDAIQAYSATAV
LSVLGIGATISSAFATATPTTGGGRRARWGAASSSTAGLCTTA
375141706YP_005002355.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDPMVAEFFHRLLRIRVTVAYAVIVTGVATELLYLGPRVQDRVIRHASTN
LHNLSHGRAGTLFVSAFVVDAGPIYLWLPGLVCLMALAEVLWGSSRLVIA
FAIGHVGATLLVAVGLTAAVERAWLPASVTRAIDVGMSYGAAAVLGSLTA
AIPRRFRPAWLGWWLAAGIATVVLGCDFTDVGHAAALALGMGVSTQFGDP
ARWTRSAFVLLGAGAAFGFLLLAGTGSAAYVAAASGLAGAAGSEMLASWR
VRRSKRDRSGQQLRPGVCQGEGDCASARTV
375141705YP_005002354.1 family 3 adenylate cyclase [Mycobacterium rhodesiae NBB3]MDDVESIDERSGRQSSGPVSWLKSTNRSPSVIAFLRRARRALPGDPEFGD
PLSAAGEGGPRAAARAADRLLHREAASREVSLGALQVWQALTERVSGKPA
YREATIVFTDLVGFSAWSLRAGDDATLKLLRRVSQVVEPPLLEAGGQIVK
RMGDGLMAVFSQPVTAVAAAIKAREGVKSLDVDGYTPRMRVGIHTGRPQR
IGSDWLGIDVNIAARVMERATRGELVVSQATLDGIADEDFDLLGVDAKRL
RKQVFAARQDGVPTDFVMYRLKSRRQLTGGDDEGEYAPEE
375141704YP_005002353.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTLRSTSSATDAKRGGDREADPLGPDSLTWKYFGDLRTGMLGVWIGAIQN
MYPELGAGVEDHSILLREPLQRVARSVYPIMGVVYDGDRAAQTGAQIKSY
HNTIKGVDGEGRRYHALNPETFYWAHATFFMLIIKTAEYFCGGLTEAEKR
QLFDEHVQWYRMYGMSMRPVPNSWEEFCEYWDAKCRDELEINRATLDIFS
IRIPKPWFVLMPTPIWDQLFKPMVGAQRWIAAGLFDPAVREKAGMRWTPG
DEVLLRIFGKLVELAFVAVPDEIRLHPRALSAYRRAQGKLPENAPLVEAP
GFMAPPRDRHGLPMHYVPPRKSLLDRAGSLVHTTFSLTGLRRPARGARDR
SGKAA
375141703YP_005002352.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MLEWTDVDLAVRDAVREFVDKEIRPHVDDLESGDMEPYPIIRKLFATFGI
ADMARDSLDKRLARLRDGGSSEKSSGGGGMFGGGSGGMGFVVVSELCKVS
MGIVTGMGVSLGLTVPTIQGRGTLAQQERWLPDLVTYDKIGAWAITEPDS
GSDAFGGMKSYVVRDGDDYILNGQKTFITNGPDADVVVVYAKLDEGDGAD
KRDRKVLTFVLDRGMEGFVQSKPFSKMGIHSSRTGELFFNNVRLGRDRLL
GETEDSSAGDGRASARSNFSAERIGVAAMSLGVIEECLRLCVDYAKTRKL
WGQEIGQFQLIQLKLANMEVARMNVRNILFRVIESAEKGIPISLPEASAI
KWYCSQAATDVAMEAVQVFGGNGYMTEYRVEQLARDAKSLMIYAGSNEVQ
ITHVARGLLSDR
375141702YP_005002351.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDSLEVKGIDLRYLLTAYLFDYGPATIDELVDALAYHGFRPAGRPSKSV
SEALRWEIFQGRAVRMRRGRYRPGKMPRATADRVYKRVRALHDNVAALSP
RSRRLTTPPIPPAA
375141701YP_005002350.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MDLKNKTALITGASGGIGEEFAVQLAERGVNLVLVARRAEKLAELRATLT
GRHPALTVDVVAADLAVPGSGPELASKVSELGATIDILVNNAGIGLHGKF
VGQDAAANSAQIQLNCGTLVDLTACYLPAMTTAGHGVVINVASTAAFQPT
PGMAVYGATKAFVLSFSEALWQECKGTGVKVLALCPGATETEFFARTGEE
FLTDGRQTPKQVVDTALAALDKSSPTVVSGWRNTLLANGYRITPRRLMVQ
ISEQLLKSN
375141700YP_005002349.1 rRNA methylase [Mycobacterium rhodesiae NBB3]MTAAVKLLRHVGRRRAARFLAEGPNLVEAALRRGLVSEVFVTEAAQARFA
SLLTDVQVHVVTERAAKALSDTVTPVGLVAVCSVPETSLDDVLAGSPRLL
AVAAEISEPGNAGTLIRVADAMGADAVVLAGHSVDPYNGKCLRASAGSIF
SIPVVSEPDAVAAVSPLSAAGLQVLATTVDGEISLDDVDLAAPTAWLFGA
EAHGLSAALAGMATHRVRIPMPGNAESLNVASAAAICLYQSARAHTRGS
375141699YP_005002348.1 50S ribosomal protein L20 [Mycobacterium rhodesiae NBB3]MARVKRAVNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAEIAV
SDPAAFTALVEVAKGALPADVNAPSGEAA
375141698YP_005002347.1 50S ribosomal protein L35 [Mycobacterium rhodesiae NBB3]MPKAKTHSGASKRFRATGTGKIVRQKANKRHLLEHKSSRRTRRLEGRTEV
AANDVKRVKKLLNG
375141697YP_005002346.1 translation initiation factor IF-3 [Mycobacterium rhodesiae NBB3]MGLLDDNIGGPISTETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAA
DADLDLVEVAPDAKPPVCKIMDYGKFKYETAQKARESRKNQQQTVVKEQK
LRPKIDPHDYETKKGHVVRFLQAGSKVKVTIMFRGREQSRPELGYRLLQR
LGADVADYGFVETSAKQDGRNMTMVLAPHRGAKTRAKAAHDADAPAAQRA
QPESAPTETPQN
375141696YP_005002345.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTQDPASPEPGAQLPTRELAEIPAVEVITRSAVMLMSAAAEKLGLSAEDP
DESPHRDLDEARRLITALAGLVTASAEYLGPHAGPVRDGLKSLQLAFREA
SAAPEEPGHGPGEKYTGPVW
375141695YP_005002344.1 lysophospholipase [Mycobacterium rhodesiae NBB3]MSDDRHVVLIHGAWSRGDQLSDARRAFEARGYTVHTPTLRHHELPPAEGA
SKIASLSLMDYVDDLVALVESLDSPPLIVGHSLGAYIGQLLAARIAHVGL
VAACPSSAGAAALTAPSLRITLGHFRQKRPWAMPVKLDWKVFRSAVAPTL
PDDLARQIYADLVYESRRVLFWELAHPRLDRKKAAAVDFARITTPVLIIA
GERDRIVPASHVRKVPSRFANARYVEIAGSDHMVLSGKALDVTMGHVDDW
LADSGLSVAN
375141694YP_005002343.1 lysyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MTVTSPPGSASTAKTRRSSAFRWVPAAAGWTVGIIATLSLFASVSPFFRS
LIKVPREFVNDYVFNFPDTSFAWAFVLVLLAAALAARKSIAWWILVGYMI
AALGWNVGDLLSGDESWLEESGEVIGLAFHVAAIAFLVLARKEFWAKVRR
GALIKAAATLVAGLVVGTLIGWGLLELFPGSLAREDRFFYALNRVGAFAG
ASADAFTGHPHVIVNALLGLFGALALMVAAIVLFQSQHAENALTGEDESA
IRGLLELYGKNDSLGYFATRRDKSVVFAPNGRAAVTYRVEVGVCLASGDP
VGDPKAWPQAIEAWLALCGDYGWAPGVMGASSAGAEAFRASGLNALQLGD
EAILYPDSFRLSGPDMRAVRQAVTRARRAGASVRIRRHRDLDADEMASVI
ERADSWRDTDDERGFSMALGRLGDPADGDCLLVEAVQPGAGGDQVVAMLS
LVPWGANGASLDLMRRSPQSPNGTIELMVSELCMQAEGIGVTRVSLNFAM
FRSAFEQGAQLGAGPIARLWRALLVFFSRWWQLETLYRSNMKYQPVWVPR
YACYEDARLVPRVGVASVIAEGFLVLPFSRRHEQPHTGHHTAVPQSIVDS
GLLHHDGTAPDVDQLQVGLDEEEQSRLPEQVRVRMAKLKALQDSGIDAYP
VGDEPSHTILAAVESEGAGTLTVAGRVLRIRDYGGVLFAQMRDWSGEVQL
LLDNSQLEEGTTVDFTHAIDLGDLIQVSGTMGYSKKGTRSLIVLSWRLIG
KCLRPLPDKWKGLTDQEARVRARYVDLAINTEARDLIRARSGVLHAIRET
LVGKGFLEVETPILQQIHGGANARPFLTHINAYDLDLYLRIAPELYLKRL
CVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYNVWIDGCREL
IQNAALAANGAHVFMRPRDDGTLEPVDISGVWTVKTVHDAISEALGEQIG
PETDLTTLRRLCDGAKIPYLTHWDTGAVVLELYEHLVEDRTEAPTFYKDF
PTSVSPLTRPHRSIPGVAERWDLVAWGVELGTAYSELTDPVEQRRRLQEQ
SLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGVDRVVMLITGRSIRE
TLPFPLAKPR
375141693YP_005002342.1 putative esterase [Mycobacterium rhodesiae NBB3]MLRHHHLSLLHGWIPLTIQILAGIAVVAAIVWGIRRRRSLWLPWAAVCGA
ALTSAAYWYVASQGLADNPAPHGLWIWTGLSGVAACVLIVGWPSAAWWRR
ALAATALPLCLVCSALAVDLWTGYWPTVEAAWNQVTAGPLPDETDQVTVM
ALQRNHQIPLKGTVVPVQTGDTASGFKHRGELVYLPPAWYATNPPPPLPT
IMMIGGEFNTPADWVRVGNAVTTADDFAATHGGNAPVMVFVDAVGTFNND
TECVNGSRGNAADHLTKEVVPFMVSNFGVSARPENWGIVGWSMGGTCAVD
LAVMHPDMFSAFEDIAGDIAPNSGNREQSISRLFGGNAAAYASFDPTAVM
ARHGRYNGVAGWFAINSQNSATQSAAANSLCGLGSADGIACAVVTSPGDH
DWPYASRAFAGALPWLAGQLHIPGSPPVPLPTPPPPPPIVQVAAK
375141692YP_005002341.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPDEPAKEPEATAEPDPAPTTAPTSDSAPVPPVDTGYAPTGVPTFESVRE
KIETRYGTAIGAAELDAETPEGRTVEEQYDARQRAAAERLAQIRESMRRP
ESQ
375141691YP_005002340.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKLMSDSGLWSTGPLVAPSPLQAVLEVSGAVLSWTVDEPAADPQITFTDL
SRADWLWRVLGETGHHALASTVESSPSEEPRGVDLEGVDVLPGSLDALRR
LAFGHWLRRWWPASQRDGIATLDAALLDAEIALLTAGAEDFFTDDTFDSD
VAEVLRPHVAALNAHVQEGDPRIVELVERCADLADEVGIAFDTPARSTRR
EDYALAAGGERGATTPATVASGVGSVQWSAVPSGIFDAAENTADWSVETA
EGVVTATVRVALSGLASPNGVAVRLRSGPWEGDGMLGADGRATFPVVDSD
RQPVSESAAWGHDWRATTLSIGAHTGESEQTRDRVRQFARARLAAPADDA
FLAEIVAAESDY
375141690YP_005002339.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTDTAVAVAHPRRAVIDRAWRAIGPGVEVLSGDDGGPLRRTVKRIIDPL
VLRLRSNTQFSAPFVAADVAEAMHHAIVARGAQLRAAAAWFELLKRERRR
LRITSGNAQELYFPVCFELAVTKGAPAQPDSGAAESVLRDIHADRDRTAI
EVLNTYSSDHLVISELAEQLRSSWSDVRAGTEITRPFLAGLTTVLGAADS
HGAASARQRVWQALIADATPYNLGAAAHDDASQLPWSIVALGLSSVEPQG
PPAIIGGSDSERPLNRSVIDRVRATLRRALDREELPDVPMLCEEEVDRCC
APWGLLAEDKQATLVAGIEVAVDLAPLSESATTRYDLARQIQARLRKEAY
VLHARRYLAEGGPIHPRQQQVIDDLAAFARPYLSRLWARLHGRDVWQEPC
DDVDDVRALLEGVARSVSLDHRQRIKTMLELQVAG
375141689YP_005002338.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSTYLHAFLMFLLVVTAATVLLSDRDAPVAADDTEADEADEADEADERL
ATTDDIVAIRAEFDRMLVVKGLVTDGQIDLIRHGTKSRAVVTGMRTTGHA
REDFREVELDVMVNRPGGGQFPAHETALIPASALTKVAPGSVVDTYYRSG
DESAVAVCVAPR
375141688YP_005002337.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGDVAVIHAVTGAESATLVLRFADVGIATYASLRVVGDPSRTVTWVLDEE
ALRAALDELTGALPDPIDEETRRDALERAITTGAFASPATEFTIAATLGT
HLIAPEAWGLIHDSRSGSATPRAVLFVSPSTRLARVPWGLVAMPGDDSRR
LIELVDVLMAAPPNIVHSPRQPAGWGGRRTEPPLLVLDPRVPGQRPDSPL
GSVLGRPSSDTPLARHFGELMQARRVLPDVAAPVDLFRRADADRAWLKNL
LAQAPSRLLYVGHATAADGDIGHADRAALHLADERPLTASDLMVQKLPFP
PRVGLLACASGGDYRFDEATGLVAAMILGGAELVTATLWSLPTAAGFRLF
APITDADPMAEAILAVDRAHEAGDAGRAVNDWQREQMRRWREGDLAASPL
YWAALATFAVDGAR
375141687YP_005002336.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTIVADLERARHLSLAANEDAAKDLLLSLIPAIEAADRDDWMLEVYAQLG
QLYLVRTAYNGTEESVSRIRECLATYAEVRAGTRPDLAEQVTMSDADVDH
MTCRYSRRAQFLQTGLAAAHGDHEAAEAALLVLTDDATDYPDLAVEHRRY
ITFARILCANALCDDDLHVQSLHLWEKVIDAIDGAPGGDEFDDYLFVLGG
TSYGRFCVETGRLGEAEPWLRRAGARAEARGWALGTARTQFERATVAWAV
GDRALAQHLAHESYPAIAEGLRAHDVSRCWLYFGLIALSIEELDDAEERF
GHAERHWREIEKPLHIHRILLQRSWVDIFRGDFDVARKRTEEARELLDSW
PRHSWLQYARLHDHVGSIWRADALADADPDSAAVKLERAAELKVPAALAV
DSVRHAIADADARMRWATHVSARMLAGAFAVASEWGNTELVSQLVEYHSA
RGTFSAEPDRESAEWTDTATAAVPLETVDEYALVAAGESPADAGSGLTRL
GPLPALQMDPSSGAILTHYRALAAERYGRAVTAVGPTWATWP
375141686YP_005002335.1 conserved lipoprotein/antigen [Mycobacterium rhodesiae NBB3]MNRVVAGVVGLAVGAAVLVGCSDDKPAAAPSSGNGNTQVSTSGKTEVKVG
GSDLAGLDLNSVTCVKQGGKINVASAAINGQAGLAVVMTDEATPTVESLG
MSVDGNALAVTNMMGAKTGSAEVKVDGATYTITGEAQGADMANPMAGMIT
KPFEIKVTCT
375141685YP_005002334.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRSFTVAERRARLARRHFLNAPAQSPAHVAGDVVGLHATDPATPYLSLWA
RVPGFVLADLDAELYETRNLVKHLAMRRTLWVVRAADLPHIQSGASDRVA
ANERRKLVADAQKAGLCGDGDAWLDTASKAVLSHLGEHGPTSAKDLRTAL
PELAGHHDPAPGKRWGGETPLAPRILTALSVRGDIVRGPNDGSWTVSRPQ
WAPMSDWLTMGDTVSPEEARTELVRRWLRAFGPATVTDIKWWFGNTLTWA
RQALVDLEAVEVDLEGTPGFVLPDDLEVEPDAEPWCALLPGLDVTTMGWF
DRDWYLGGHRSQVFDTNGNGGPTAWCDGRIVGAWGQDADGRIEVRLLEDV
GRAAHKALQKRADDLTDWLDGVRVSPRFPSPLSKGR
375141684YP_005002333.1 excinuclease ABC subunit A [Mycobacterium rhodesiae NBB3]MADRLVVKGAREHNLRSVDLELPRDALIVFTGLSGSGKSSLAFDTIFAEG
QRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVG
TITEVYDYLRLLYARAGTPHCPVCGERIARQTPQQIVDQVLAMDEGLRFQ
VLAPVVRTRKGEFVDLFDKLNSQGYSRVRVDGVVYPLTEPPTLKKQEKHD
IEVVVDRLTVKTSAKQRLTDSVETALNLADGIVVLEFVDREDDHPHREQR
FSEKLACPNGHPLAVDDLEPRSFSFNSPYGACPECVGLGIRKEVDPELVV
PDPDLTLAEGAIAPWAMGQTAEYFTRMLKGLGDQIGFDVDTPWKKLPAKA
RRSILEGCDEQVHVRYKNRYGRTRSYYADFEGVMAFLHRRMEQTDSEQMK
ERYEGFMRDVPCPECEGTRLKPEILAVTMTAGDYGPKSIAEVAELSIADC
SAFLNALTLGTRETAIAGQVLKEIQSRLGFLLDVGLDYLSLSRAAGTLSG
GEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLIRLRDLGN
TLIVVEHDLDTIAHADWVVDIGPAAGEHGGQIVHSGTYEDLLTNSNSITG
AYLSGKEEIEVPAMRRPADRKRQITVVGAREHNLREIDVTFPLGVLTSVT
GVSGSGKSTLVNDILASVLANKLNGARQVPGRHTRVTGLDKLDKLVRVDQ
SPIGRTPRSNPATYTGVFDKIRTLFAATTEAKVRGYQPGRFSFNVKGGRC
EACSGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTIAEVLD
MSIEDAAEFFKPITSIHRYLATLVDVGLGYVRLGQPAPTLSGGEAQRVKL
ASELQKRSTGRTIYILDEPTTGLHFEDIRKLLAVINGLVDKGNTVIVIEH
NLDVIKTSDWIVDMGPEGGAGGGSVVATGTPEDVALNTDSYTGHFLAEAL
GVSRPAPKKRKRSKVSA
375141683YP_005002332.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MTVVDDTYTGHVEAQTAARRTLPGASIVKVSVGPMDNNAYLVTCSQTGET
LLIDAANDPEILLELIERFAPKLSLIVTSHQHFDHVQALEQVARATGAPT
AAHQLDADALPVKPDRILAHGDTVKIGELSFDVIHLSGHTPGSVALALVG
ADEATHLFTGDCLFPGGVGKTWQEGDFDKLLGDVTSRVFDVYDDSTVVYP
GHGDDTTLGTERPHLGEWKERGW
375141682YP_005002331.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MERTRLVTRRDAPVAVVTGASRGAGLGIAHALGSHGCTVYVTGRTDGAGQ
SPLGGTIGETADLVTAAGGTGIAVRVDHADDEQTKALFEQVEREQGRLDI
LVNNAAVIRDEMMARTPFWEKPLDIIDILDVGLRSSYVATAYAAPLMVRQ
GHGLVVFTSAPGAAHYVFGPSYGVHKAGMDKMAADMAVDFKPFGVATVSI
WMGILLTERLKNIIDSAPDKLGHMLAEAETPELTGHLIWALFNDPALMEK
SGQTLIGAELAVEYGIKDDGDRQPPSYRDQHGIHPIRQFDRILR
375141681YP_005002330.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTSILHRTPIARRENGVPPPHVPLADIDLASLDFWARDDDIRDGAFATLR
RESPITFFEVADFPGFPAGAGHWALTRFDDIHHASRHPEIFSSIPTSTSL
NEVAPEVAEFTGSMINLDDPRHTWLRKIVNRAFTPKVLARIEGSVRDRAR
TIVTDMVANHHDGRADFVAEAAGLLPLQVICDMMGIPEEDEEKVFHWTNV
MLGFGDDEVSGDFDAIMVVVNEIVDYAMRLAEERRANPGDDLTTSLVQAE
VDGVRLTSSEYASFFILLSAAGNETTRNAISHGMVALSRYPEERQKWWND
FDGVAATAVEEIVRWASPVIFMRRNLTQDIELRGIEMKSGDKVSLWYNSG
NRDEAKFANPWLFDVTRDPNPHIGYGGGGAHFCLGANLARREIRVMFDEL
RRQIPDVVAVEEPAILHSAFIHGIKRLPVAWTP
375141680YP_005002329.1 fructose-1-6-bisphosphate aldolase [Mycobacterium rhodesiae NBB3]MNQDQLKKAQSGAGFIAALDQSGGSTPKALKLYGVSEDAYSGDEQMFDLV
HEMRTRIITSPAFNGDRIMGAILFEMTMDRQVEGRPTADYLWNVKNIVPF
LKIDKGLNDEQDGAQTMKPMPGLDELLDRAVANGVFGTKERSVIKLPGAG
LDAVVAQQFEVGQQVLAKGLVPIIEPEVDIKSPKKAEAEDQLNAALLAGV
NALGDDQKVMLKLTLPDTDNLYSELVDHPKVLRVVALSGGYNRDEACEKL
ARNNGVIASFSRALTEGLTAQQSDEEFNSTLDAAIGSIAKASAT
375141679YP_005002328.1 apolipoprotein N-acyltransferase [Mycobacterium rhodesiae NBB3]MGLVPLLFVIRAASTAAQGGIRAWIGMAGFVLVTQYWLWPSSGPLLVGLA
VVLGALWFPWGWAAHRLLSGHITTPRALTAVVVLPSAWVIAETVRSWHRL
GGPWGLLGASQWNQPMTLATASLGGVWLVSFLTVAVNTAVVGAILLRSWR
AAALPAVLAVLGPAWFWCGPVPAPGATVRVALVQPGDIAESAPRQAASEA
LTETLVGRRIDLVVWGESSVGVDLSSHPDTVERLVELRRRVGADLLVNVD
ARAPEGGIYKSSVLIGPDGVRGAYAKTRLVPFGEYVPLRPLLDWATRHTK
AAGEDRRRGDGPVVLQADSVAIGPMISFETTFSDLPRRVVRLGAQLLAYQ
SSTSSYQGSWAQPQLASMAAVHAVEVGRPAVHAGLSGVSTAFDARGRSLG
RLPAHDRGVLVLDVPLGSRTTLYDELGDWPIVLAALVFTAWCARSARRS
375141678YP_005002327.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMSGYTTIVVGTDGSDSSLRAVEKAGQIAAGSGAKVVVATAYFPQSEDQRA
ADVLKDEGYKMSGNAPIYAILREAKERAIQAGAKTVEEKAVVGAPVDALV
DLAEEVKADLVVVGNVGLSTIAGRLLGSVPANVARRSKTDVLIVHTTP
375141677YP_005002326.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADPLAVAVLAAAVSAAGAARPSFWFDEAATISASTRSLPDLWQLLHNID
AVHGLYYFFMHGWFAIVPATEFFSRFSSCLAVAVAAAGVVRLARQFSSRT
VAVCAGVMFAILPRTTWAGIETRPYALTAAVAVWLMVLLLVAARRNTAVL
WVAYGVALTISVVLNVFCVAMVLVHASAVAVVSEGKRSVKSFAVASSVAV
VAVIPFLAFCRTQIAQVRWISPPGWHTVLEIAKEQYFDDSAPFAVVAALV
LTGSLISRRFWPTDGGSRDLVKIAIAWITLPTLVLLAYSLWFEPVYYPRY
LSFTSPAIALLLAISVTALTRSRQGVAAVVMVFALAATPNYLTVQRGPYA
KEGMDYSAVADVIDAHASPGDCLILDNTADWAPGPIRPLTAARPSVYEKL
IDPGRGQRAVDRNRLWDAHLGIWGVADSVRQCTVLWTVSERDDTVPAHES
GPGLNPGPRLRRAPAYQVPHHMGFHVVERWQFSFAQVVKSTR
375141676YP_005002325.1 uracil-DNA glycosylase family domain protein [Mycobacterium rhodesiMPWQRRRPPSSTVFGAGSAAADMMLVGEQPGDQEDKAGAPFVGPAGRLLD
KALAAADVERERLYVTNAVKHFKFTLPERGQRRIHKTPSRTEVVSCRPWL
LAEVDAVQPDVLLLLGATAAQSLMGSTFRLTAHRGEALRLPDAGDVGWDP
QVVATAHPSSVLRGRPEDREKAFEALVSDLRFAARLLAS
375141675YP_005002324.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MTATVDGLVRLRDGRSLAYTQYGAPHGFPVVNSHGGLACRLDVAAADSIA
VDAGVRLISPDRPGVGLSDPSPGRTLADWARDVEELLDHIGVDRFAAMGW
SMGGQYAVAVGHFLRPRATRVAIIAGALPLTEPGVFDQLPAMDRHLTRLS
QRAPWLARQWFQMMGFLPRVAPALYGRLAARALGPADAAVVAGDGFELFS
RMTRDAMRQPAGAAEEYRAWMRPWGFAPEDLDMPVDIWAGAQDQLVDPSW
AHRLASRIPNATLNVRDGGHFLAHLHYREIFDSLRGGSTL
375141674YP_005002323.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MILKRVVATAAFVGTLGFTAIGLSGVANAEQAVPNSPGVTWKLDKPHWND
RHDNDRGWRDARWDGPYYGGPCLWVPPAVSGWVPPAVC
375141673YP_005002322.1 polyketide cyclase/dehydrase and lipid transport [Mycobacterium rhoMAKLELSRDLSMSPEHAWEHVSDLSSLGDWLSMHEGWRSELPSELEVGTE
IVGVAGAKGMRNRVKWTIREYDPPRLIGITGHGVGGTKYALKMTVKPTKQ
GCSFTMKMELGGAPLFGPIGMAAVRAVKGDLDKSIRTFETLYG
375141672YP_005002321.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDVWLAADPPFFGGPGQGTRQIAELFVAFGLTALIGLERELQGKSAGVRT
QTIVGTASALILLVSKYGFSDVLQDGLVMVDPSRVAAQIVSGIGFLGAGI
IIFRRGSVHGLTTAAAVWESAAIGMAAGSGLLLLAVTVTAMHFLVVVGFL
PLARWLTSRLSGSVTMHVSYEEGKGVMSRLLQACERRQWQLTDLAADTAE
LTAAAGHAGVLMTLSGRGIVNAPMVLAGIDGVLGIHQYDDDPD
375141671YP_005002320.1 5''-methylthioadenosine/S-adenosylhomocysteine nucleosidase [MycobaMTIGLICAIPQELEALRSDLVEAHSEARAHARFVTGVLDGYDVVLAGSGM
GKVNAAIVTTLLADRFGCRTIVFSGVAGGLDPELSIGDVVVADRIIQHDA
GVLENEKIRTYQPGHAPIINETDRLGYPVDPGLLTRVRERLDGFEVPGHV
VYGTVLTGDQYLNCDSTRAWLLAELGGQAIEMEGGAVAQVCEAFNIPWLV
VRALSDLAGGNALFDFTAFVEQASATSATILRRLLPVL
375141670YP_005002319.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMSGVTVTAKTASGGWRELLGPKFLGASTVLAGGVALYATNEFLTISLLPS
TVADIGGQRLYVWVTTVYLVASVVAATTVSSVLARVGPRWAYLWGLAVFA
LGSLLCSLAPTMELLLVGRVVQGSAGGLLAGLGYAVINSTLPPSLWTKAS
ALVSAMWGVGTLIGPAAGGLFAQYGSWRWAFGVLVVLSVAISVLVPFALP
ARTGVPPARDPIPVWSLLLLGTAALSISVAGVPRNMAWTVALVALGAGLV
GVFLVVDRRTSAAVLPPTAFRPGPLKWIYLTLGMLMAATMVDLYVPFFGQ
RLAHLAPVAAGFLGVALAVGWTMSEIVSASVSRTKTVVRIVAVAPLVMAV
GLALAAASQFEDASGWLIAVWVAALTLAGVGVGMAWPHLSAWAMGSVDDS
SEGGRAAAAINTVQLIFGAFGAGLAGIVVNATDRGDATAARWMFATFAVL
AVVGVVASMRSGSGVTGRAATAAE
375141669YP_005002318.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFTLARSAVVTGIALTGACFWLAQQSDTRFESPPAVASPNVYLVDFSTPI
ADCAVVGCPAPGLGGAAVSSSAGLTMSGDLLGAFLAVFISNGTAERPNAG
LFFGNGWSAGADCVGTACNGGNGGFFMGNGGAGANGGRGGNAGLFGNGGD
GGNATAAGSAGGAGGNGGLLIGNGGAGGDGAFGTAGSAGGPGVKGDDGGA
GGAGGNGGSGGLFVGSGGQGGSGGMGGQGGAGGSGADALAATDPGADGDD
GEGGGDGGAGGVGGNAGAGGASGWFGTAGSAGANGDGGAGGNGAAGGNGG
DGADGADGANGPAGTGFGGHGTNGGNGQAGGDGGDGGSGGAAGGGGAAGS
GGTGGLTGISGNAGTMGDGGDGGDGGKGGVGGDGMAGGDASAATTPGARG
DNGQAGGNGGAGGVGGNAGAGGASDQFGIAGTAGVNGDGGAGGNGAAGGD
GGDGADGADGANGPAATAAGGHGTNGGNGVDGGDGGDGGSGGLAGSGGAA
GSGGTGGVTGLGGQAGATGDGGDGGDGGDGGHGGDGADGADVTRGTGGSG
GDGGDVGTGGHGGAGGAGTNPGTPGGGGSNGTVAGDGGDGGDASVVVGFA
TGGRGGNGGHNPNGTGGAGGDGGNATATDTGYADGGSGGTGGSSVTGDGG
RGGNAGSGTISGADAIGHTTGGVGGAGGSTDSGTGGRGGDGGNAGASNGG
YSGNTYAGSGGAGGASQSGAGGTGGNGGDAGASTGGSTNVNRTQGGNGGT
GGASQSGAGGAGGAGGSPGGAAGSPG
375141668YP_005002317.1 excinuclease ABC subunit B [Mycobacterium rhodesiae NBB3]MAFATEHPVLAHSEYRPVDAIVRTGGRFEVVSEHQPAGDQPTAIQELERR
ISAGERDVVLLGATGTGKSATTAWLIERLQRPTLVMAPNKTLAAQLANEL
REMLPHNAVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSAT
SSLLSRRDVVVVASVSCIYGLGTPQSYLDRSVELQVGQEVPRDALLRLLV
DVQYTRNDMSFTRGSFRVRGDTVEIIPSYEELAVRIEFFGDEIEALYYMH
PLTGDVVRQVDSLRVFPATHYVAGPERMAHAISTIEQELEERLAELEGQG
KLLEAQRLRMRTNYDVEMMRQVGFCSGIENYSRHIDARPAGSAPATLLDY
FPEDFLLVIDESHVTVPQIGGMYEGDMSRKRNLVDFGFRLPSAVDNRPLT
WEEFADRIGQTVYLSATPGPYELSQSGGEFVEQVIRPTGLVDPQVVLKPT
KGQIDDLIGEIRKRTERDERVLVTTLTKKMAEDLTDYLLEMGIRVRYLHS
EVDTLRRVELLRQLRLGDYDVLVGINLLREGLDLPEVSLVSILDADKEGF
LRSTRSLIQTIGRAARNVSGEVHMYADKITDSMKEAIDETDRRRAKQIAY
NEEHGIDPKPLRKKIADILDQVYREADDVEVGGSGRNASRGRRAQGEPGR
AVSAGIIEGRDTTNMPRAELADLIRDLTEQMMTAARDLQFELAARIRDEI
HDLKKELRGMDAAGLK
375141667YP_005002316.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRAVDTYTVEPWGLYMARPTPGRAQFHYLESWLLPSLGLRVTVFHFNPGH
EREQDFYLDVGRYTTGETVWQAEDHYLDLVVRTGIGVDLADVDELLTAVR
HRLLSPETAEQAVHTAVSTIEGLSRNDYDLDRLLAGHGITLTWRDGP
375141666YP_005002315.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTRSEKADDLALTWAKPVKSAVMSATRRQWSAIAATAAVGAGTLFSPATA
FAQPGAEPAEPQPAPVAEPAPEALHNVIYRARADGTSRDAVVAYKQDDVN
VNSATPTMLPGQTFEVNTVLDDPKKAGMELSIGWPYGSNLHCEILVDDQI
VAQADQFIAPRFFRVKDDPLYGTLQCGAPLDIPNAAAAPDAAPADPNAAP
PEAAPPAENPPPAA
375141665YP_005002314.1 dephospho-CoA kinase [Mycobacterium rhodesiae NBB3]MLRIGLSGGIGAGKSTVSSTFSDLGGIVVDGDVIAREVVEPGTEGLGKLV
DAFGKDILHDSGPMAGSLNRPALAAIAFSDDEKRQTLNGIVHPLVAHRRS
ELIASAMEAEKNPVIVEDIPLLVESGMAPMFPLVVIVHADIETRVSRLVQ
HRGFSEEDARARIAAQATEEQRRAVADVWLDNSGSAGELVEQARALWYRR
ILPFAHNLDDGQPARPEPVLVPSDPSWPDQARRIAARLNTACGHRAVRID
HIGSTAVAGLDAKDIIDMQVTVPSLEVADELAEVLFAAGYVCRPITADVG
KPDARSTVAQFDHSNDESLWHKRLHCSADPGRPTNVHIRVDGWPGQQFAL
LFVDWLRANPQVQADYLALKRRVAADAHPDTGAYADAKEPWFLDAYRRAW
EWADTTGWRP
375141664YP_005002313.1 30S ribosomal protein S1 [Mycobacterium rhodesiae NBB3]MPSPSVTSPQVAVNDIGSAEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLTKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVNVGDEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELSERHVEVPDQVVQVGDDAMVKVID
IDLERRRISLSLKQANEDYTEEFDPSKYGMADSYDEQGNYIFPEGFDAET
NEWLEGFEKQREEWESRYAEAERRHKMHTAQMEKFAAADEAAAAEAPRSA
NGSSSSGEPAAGGSLASDAQLAALREKLAGNA
375141663YP_005002312.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAYAGPPQQSWPVRPPFQRKVREVGAPLGVLILLGIIAGLIVIALTALNP
VGASIGFVLSGLAIAVVVLAYIWLDRWEPEPTRLLVFAFLWGASVAVVMS
VIIGLFLDALIAAEGSEESSWISIAVGAPIIEEAAKGAFLLLMMTGRRRN
ELNSLTDCLVYAGLVGAGFAWLEDILYIAGGESLGDSLLTAAIRLIMGPF
AHSLFTTMFGIGVWFALQNRNAIAKAGCILLGYVGAVIMHGLWNGSSVIG
PETYFAVYFFWMVPVFVFAIVLGVRSRRREQRIVAEKLPGMVAARLVTPS
EATWLNSIRNRKLAIGHVTRTAGKPAGKAVKAFAAQVVALAFVRDRIDRG
FGDERVYAMQTEEAYAVHAARMAAPALQALAGFHAPPVR
375141662YP_005002311.1 putative threonine efflux protein [Mycobacterium rhodesiae NBB3]MQVHHLIDVMPAFLLACVILAALPGPATALFLHRSVRDGRAAGLAAVVGN
EIGIFGWTIAGGAGLSMLLMANRALSVALHVVGAVVLIWLGISAWRHAKT
PADVELPLPPRGRTPASAFRASLLSIAANPKAAAFGIVVVPQFLPSTGPV
LPTLFVLAVIQLVLDTTWCAGVVLAADRARDVLGRTYIRRRVERVFGAAL
IGLGVGLAADAR
375141661YP_005002310.1 DNA polymerase I [Mycobacterium rhodesiae NBB3]MTASATTEKATEKPTLMLLDGNSLAFRAFYALPAENFKTQGGLTTNAVYG
FTAMLINLLRDEQPTHIAAAFDVSRQTFRKEKYPEYKEGRSATPDEFRGQ
IDITKEVLGALGITVLAEPGFEADDIIATLATQAEDEGYRVLVVTGDRDS
LQLVSPDVTVLYPRKGVSELTRFTPDAVLEKYGLTPRQYPDFAALRGDPS
DNLPGIPGVGEKTATKWIAEYGSLQTLVDRVDTVKGKVGDALRANLSSVV
LNRELTDLVKDVPLAQTPDTLRMQPWDRDQIHRLFDDLEFRVLRDRLFDT
LASADPEVDQGFDVQGGALEAGELAGWLAAHGSGKRFGMAVVGTHLAFDA
DATALAIVASDGDGRYLDTATLHPDDEAALASWLADPGQPKALHEAKLAI
HDLEGRGWTLAGITSDTALAAYLVRPGQRSFALDDLSLRYLKRELRADNP
EQQQLSLLDDSDGVDDQAVQTVLLRASAVMDLADALDEELARIDSSSLLN
SMELPVQRALAEMESAGIAVDLTLLSELQSEFADLIRDAAEAAYGVIGKQ
INLGSPKQLQVVLFDELEMPKTKRTKTGYTTDADALQSLFDKTGHPFLQH
LLAHRDATRLKVTVDGLLNSVASDGRIHTTFNQTIAATGRLSSTEPNLQN
IPIRTEAGRRIRDAFVVGKGFSELMTADYSQIEMRIMAHLSRDEGLIEAF
NTGEDLHSFVASRAFGVPIDEVTAELRRRVKAMSYGLAYGLSAYGLAAQL
KISTEEAKEQMEQYFDRFGGIRDYLRDVVDQARKDGYTSTVFGRRRYLPE
LDSSNRNVREAAERAALNAPIQGSAADIIKVAMINVDAALKEAGLKSRML
LQVHDELLFEVADGERDALEKLVRDKMGNAYPLDVPLEVSVGYGRSWDAA
AH
375141660YP_005002309.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPNPFKDWARMYGANKQYLESQGRPSSFFGQIGDIPNRIHEAADASEIGV
KMMRHSQLTNGGGLPATVTVEGVWQVGSYLNMSPVVRIQGRVQREDGTPQ
YGAVFDEVVAQMHNGRLQPGSTLAVFVDPQNPVDMAIDWIRTGQI
375141659YP_005002308.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGFFDKAKLAAQQASQAFAPPQNDGQVHVKGAGLIDPAILGGPSTRSVAA
DDPIWQPINGISLQDYAELARDAQARGINNEAGMITLAQERGWDPADTKA
ALDGWVQRMGQSMAVGQQFRKFLGY
375141658YP_005002307.1 putative nucleic-acid-binding protein containing a Zn-ribbon [MycobMRNWNTFQFHDRVRYADRVSASTQPAVEGWFATDESGAAYLIGSKCHLCG
TFVFPPRANNCPNPACEGDELAQVPLSRRGTLWSYTENRYAPPPPYPSPD
PFEPFAVAAVQLADEGLIVLGKVVEGTLAADLKVGIEMELTTMPLFVDDD
GVERVVHAWRIAS
375141657YP_005002306.1 acetyl-CoA acetyltransferase [Mycobacterium rhodesiae NBB3]MSPGAAPAATSSPDPVYILGAGMHPWGKWGRDFTEYGVVAARAALAEAGL
DWRQIQLVAGADTIRNGYPGFVAGATFAQKLGWNGVPVTSSYAACASGSQ
ALQSARAQILAGFCDVALVIGADTTPKGFFAPVGGERKNDPDWQRFHLIG
ATNTVYFALLARRRMDLYGATLEDFAQVKVKNAKHGLDNPNARYRKESSV
DDVLASPVVSDPLRLLDICATSDGAAALIVASKSFAEKHLGSLEGVPSVR
AVSLQTPQYPQHLPELPDIATDSTAAVPAPDRVFKDQILDAAYAEAGIGP
EDLSLAEVYDLSTALELDWYEHLGLCPKGEAEKLLRSGATTIGGKIPVNA
SGGLACFGEAIPAQAIAQVCELTWQLKGQATGRQVEGAKVGVTANQGLFG
HGSSVVVAR
375141656YP_005002305.1 branched-chain amino acid ABC transporter ATPase [Mycobacterium rhoMTTANDDTPDDRPVLLEVRDLVVQYGRIRALHGISLQVREGELVTLLGSN
GAGKTTTMRAISGLLPLTSGSVWFDGEDISKVKAHHRAIRGLVQAPEGRG
VFPGMTVIENLEMGCYGRKFATKVEHDERLDWVLETFPRLAERRNQVGGT
LSGGEQQMLAIGRALMARPRVLLLDEPSMGLAPMVISQIFKIIAEINAGG
TTVLLVEQNAQQALSRSDRAYILETGEVTRTGDARELLADNSIRAAYLGV
A
375141655YP_005002304.1 branched-chain amino acid ABC transporter ATPase [Mycobacterium rhoMSIEELAGVHRDIEAAEGETLLQTKDLTVKFGGLTALDSVTFDIRRGEIL
GMIGPNGAGKTTCFNAITGVYRPTSGTVTFDGAPLGRIKRHQITRRGIAR
TFQNIRLWGEMTALENVMVGTDARHFTSVPGALVRTPRHRREERSAIERS
AALLHFVGIAHRGEEKAKNLPYGDQRRLEIARALATEPKLLCLDEPAAGF
NPREKAALIELIQKIRDDGYTVLLIEHDMRLVMGVTDRIVVLEFGRKIAD
GLPADIREDPKVIAAYLGVPDDDSQ
375141654YP_005002303.1 branched-chain amino acid ABC transporter permease [Mycobacterium rMSTNEKPMSLSDKLMAPGDGLRRWWDRLSRVQKWGFGVIGFGLLALLPLF
PPPFLNTPNISFGGTMAQFAMVAIIAIGLNVVVGQTGLLDLGYVGFYAVG
AYTVALLTSPNSPWNQLGPTGWFHESWAWLACVPLAMAITALSGLILGTP
TLRLRGDYLAIVTLGFGEIIRLLADNLSDITNGPRGLNEVAYPRVGQSER
LPDGVFSSGNSMGDANYGTWWFWLGIVMIVIILLLVGNLERSRVGRAWVA
VREDEDAAEVMGVNTFKFKLWAFVIGAAIGGLSGALYAGQVQFVAPPTFN
IINSMLFLCAVVLGGQGNKLGVVFGAFIIVYLPNRLLGVEFLGINLGDLK
YLFFGMALVALMIFRPQGLFPARQQLLAYGKAAREFLRSPEKESAK
375141653YP_005002302.1 branched-chain amino acid ABC transporter permease [Mycobacterium rMIHQYVDAGAQYTYLAANINFNLDGLRNGFWQLTIDGLSWGAIYALVAVG
YTLVFGVLRLINFAHSEIFMLGMFGAYFCLDIILGFTPSGNDYEKGVALT
VLYLGVAMLFAMLVSGSAAVGLEFIAYRPLRRRGARSLTFLITAIGMSFV
LQEFVHFVLPKLLPGYGGSNAQQPIILMQPKTQFTIFGATVSNVTLVIVA
SALAFALLTDIAINRTKFGRGIRAVAQDPTTATLMGVSRERIIMSTFLLG
GLLAGAAALLYTLKVPQGIIYSGGFLLGIKAFSAAVLGGIGNLRGALLGG
LLLGIMENYGQAVFGTQWRDVVAFVLLVLVLLIRPTGILGESLGKARA
375141652YP_005002301.1 branched-chain amino acid ABC transporter periplasmic protein [MycoMRGHVARKAFAIGSASLVVLGIAGCQQQSEPSEGGAGATDLKIVEQVQID
ENGAEVKPAADVKPLDPAGDGNAQCPPVSIAMAGALNGPDAALGINIKNG
IQLAVDQHNAANEGCQVQLKTFDTEGDPQKATQVAPQIINDAFTIGLIGP
AFSGETNATGDVFNQAGLVAATASATNVTLSEKGWKTFFRGLANDGVQGP
SVANYLKNTLGHKKVCVVDDSTDYGLGLAQAVRETLGPVADSACNISVKK
GDKDFSAAVTQVKGANPDSVFFAGYYAEAAPFVQQLKDGGFEGTFVSADG
TKDPEFVKQAGEASAGAILACPCGPATGTFAEEYKKAFNQEPGTYSVEGY
DLGAIMLKGIDSGKITRPDLLEFVRTYDGQGIGRKYQWTPTGELTTTLIW
IYKVQ
375141651YP_005002300.1 response regulator with putative antiterminator output domain [MycoMAVPRESPTGNEKPRRVVVAEDEALIRMDLAEMLREEGYEIVGEAGDGQE
AVDLAESLQPDLVIMDVKMPRRDGIDAASEIAGKRIAPIVILTAFSQREL
VERARDAGAMAYLVKPFNINDLIPAIEVAVSRFSEIAALEKEVAELSDRL
ETRKLVERAKGLLQAKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETL
DTPKDASPSS
375141650YP_005002299.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRSVGKHYRQLRNWHALTVGAMLFPNLHAHGGNLLRGRVELIVFPLDRDG
STDGGSGGGSRNKSSAPAPLISAA
375141649YP_005002298.1 family 3 adenylate cyclase [Mycobacterium rhodesiae NBB3]MLNVTAMISAAITVFFGIQGLLLGQDWWVTLVNLISAVAFVMIPRLCGMH
EIVAPVVFFVVSYLIITVLCIYLGTGSGLQFYYVVAAAIMLVVLGTDHIV
LAATLSAIGAVTVILLEFLVPNDTGTQPPWSFRTSFILTVITAWILVIAT
IWFALREIRRAREAMEAEYERSEQLLTNILPATIADRLKDPSRTIIADKY
DDASILFADIAGYTKRASETTPGDLVRFLDRLYTDLDRLVDQHGLEKVKT
SGDSYMVVSGVPEPRPDHAEALACLALDMAAAVADLEDPQGRAVPLRIGL
ASGPVVAGVVGARKFFYDVWGDAVNVASRMEATDVEGRIQVPEDVYERLK
HAFVLEERGEVEIKGKGVMRTWYLVGRRDERAVRRAVEGGAAATI
375141648YP_005002297.1 DNA-binding ferritin-like protein [Mycobacterium rhodesiae NBB3]MSTNRRDETDVQGFQASPELSENLQRVLVDLVELHLQGKQAHWNVVGTNF
RDLHLQLDELVDFAREASDTVAERMRALWAVPDGRSDTVVSSTTLPQFPA
YEHGTDEVVDLITARVYAAVDTLRTVHDAVDAEDPSTADILHQLIDGLEK
LAWLIKSENRKV
375141647YP_005002296.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSPMTEPQRAIIARVSADFSAISQYMARVSTDLAALDRLLAEQSQPARAA
QPVPQPQPYPVPYWPQYQASVAASPMAVPQAPAVPRPQRDQGWIGKLLAV
AGVAVTLIGVVLLVVLAAQAGILRPEIRVAGGVLLAGALVGASLWLYSRP
GGRVGAVALAATGIAAAYIDVIAITTIYDWVSAPVGLVVAALVAGGGLTL
ARRWDAQQLGVLVLVPLIVLAPVVTDGITLLLVGFMLALAAASLPVQLGK
DWIWLHCARIAASTFPLLIALLALHFDDRRDLWLLGACAIAAGLAIAAAL
ILLPKTTNRVLMALVTGAGVLPALCVVLVADRVVAAMMAAVLAAVFLAIV
LIGDRLPGVNGVVRQIWAALSAICATIAVLVAFSGDVAAPVMLAMAIVVA
VAARHAVMARWIALGLAVVGAAFYLSYAPPSSLFYSSETATATAVSTLIA
SLLLIAFVVVIVWTLEEPDSVMWAIAAVVAAYAITTFTVTAGVLIGGEER
GFFAGHMAATICWIVMAAALFVYAARIPRADRSMPIGGGLALVAAAMAKL
FLFDLGTLDGIFRVAVFIVVGLILLGMGAGYARLLDKQDQQQDGKV
375141646YP_005002295.1 response regulator containing a CheY-like receiver domain and an HTMGADSTPTVMVVDDHPIWRDAVARDLADDGFAVVATADGVAAARRRAAVV
LPDVVVMDMRLGDGDGAQATAEVLSVSPSSRILVLSASDEREDVLEAVKA
GATGYLVKSASKQELGDAVRATAEGRAVFTPGLAGLVLGEYRRIAQSPMT
GQSGAAAPSLTERETEILRHVAKGLTAKQIATRLSLSHRTVENHVQATFR
KLQVANRVELARYAIEHGLDE
375141645YP_005002294.1 histidine kinase [Mycobacterium rhodesiae NBB3]MSAHPPDPATPLWRAAQVFRLLSCLYALGFQIAVNGELARPATGRALFAV
LIAWSAMCAFAYLRGFGRRASWVVAEIVVVVALILSTEFVASDRWALDNQ
SWPTTLWATNATISAAILAGPIAGMLAGVAVMIASTIVKGFINYDLGRNA
TIVIELAVGLAVGMAAQTARRAHAELEQAARLSASHQERERLSRQVHDGA
IQVLALVSRRGREIGGQTAELAELAGEQERALRRLVSSADTESPAGEKTD
VGALLRKRASDLVSVSVPADPVLLDTGTATELCAAAVNALDNVAKHAGPA
AHAYILLEDLGDSVTVSIRDDGVGIADGRLDEAVGEGRMGVAKSIVGRMD
WLGGSAKLTTGPGCGTEWELTVPRR
375141644YP_005002293.1 polar amino acid ABC transporter ATPase [Mycobacterium rhodesiae NBMTPMVKAESVCKSFGALDVLKGITLEIGKGEVLCMVGPSGSGKSTFLRCI
NHLEEVNAGRLYVDGELIGYKERGGKLHEMSPRDAAKQRRDIGMVFQHFN
LFPHRTALENVIEAPIRVKRIKKDVAVARGRDLLEQVGLSPKADAYPAQL
SGGQQQRVAIARALAMNPKLMLFDEPTSALDPELVGEVLEVMKKLAAEGM
TMVVVTHEMGFAREVANHLVFMDGGVVVEGGPPREILSNPQHERTKAFLS
KVL
375141643YP_005002292.1 amine acid ABC transporter permease [Mycobacterium rhodesiae NBB3]MTDVDTSPPAAPAAIDAVPLRHPWRWVAAVVIIVLVALFLWGAATNPAYR
WSVFREYLFNERVLTVGLLNTLQLTVYSMVLAIVLGVVLAVMRLSPNPIF
KAVSWVYLWIFRGTPIYVQLVFWGLIPTIYQNIRLGVPFGPTFFQLNLQM
LSIPFLLAILGLALNEAAYMAEIIRAGISSVPEGQLEASTALGMPWGMAM
RRTVLPQAMRVIIPPTGNEVISMLKTTSLVTAVPFTLDLYGITSREIAAR
TFEPVPLLLVAAFWYLVVTSVLMVGQYYLERHFARGASRKLTTRQLEALA
KAQIQNPGM
375141642YP_005002291.1 periplasmic component of amino acid ABC-type transporter/signal traMLRECQNRRGKLWQFAAVFAATGALLLSGCASGTNSSDSPSGTTTAAADK
VEEIANTVPEAIKESGKLVVGVNIPYAPNEFKDPSGKIVGFDVDLMNAIA
GTLGLTAEYRESDFAKIIPSIQGGTYNVGMSSFTDTKEREESVDFVTYFS
AGIQWAQRPGSPVDPNNACGKKVAVQATTTEETEELPAKSKACTDAGKPA
IEIVSFDGQDAATNAVVLGQVDAMSADSPVTAYAIKQSNGKLEAAGEIFD
SAPYGWPVQKGSPLAQSLQKALEHLIESGKYEEIAKNWGVEAGMIDKPVI
NGAVS
375141641YP_005002290.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MESPAPPSLLKHLWLSTLLSGILAIIVGVLAWTWPTLTIIVTAIFFGAYL
LVTGITQVVFAFSLHVSAGGRVLLFISGAAALILALLCFRSLQESILLLS
IWIGIGFIFRGVATAVSAISDPTLPGRAWEIVIGVLSLLAGIFMLAWPLQ
SLETLTRVVGIWLIVIGVFEVVSAFGIRKASKHLGGTTPAPAAEEPVS
375141640YP_005002289.1 cytochrome bd-type quinol oxidase subunit 1 [Mycobacterium rhodesiaMDALDVSRWQFGTTTVYHFILVPLTIGLAPLIAAMQTAWIVTGNPAWYRL
TRFFGKLFLINFALGVATGIVQEFQFGMNWSEYSRFVGDIFGAPLAFEGL
IAFFFESTFLGLWIFGWTRLPRLVHLACIWIVAFAVNASAFFIIAANSFM
QHPVGAKYNPETGRAELVDFVALLTNNTAIWAFLHAVAGAFLTAGVFVAA
VSAWLMVRSHKRPDESAEARSMYRPATIAGSLVALVAAGGLFFTGDFQGK
LMFVQQPMKMASAESLCHTETDPDFSILTVGTHNNCDSVTHLIEVPYVLP
FLAESRFSGVTLEGVNDLQQSYEQKFGPGDYRPNLFVTYWAFRAMIGLLL
VPVAFALAALWLTRRGRIPDQRWFSRFALITLPTPFLANSAGWIFTEMGR
QPWVVVPNPTGDQLVRMTVQEGVSGHSAGMVVLSLSIFTLLYGALGVIWF
WLLRRYVVEGPLEHDSEPVPPRAPDDEDVAPLSFAY
375141639YP_005002288.1 cytochrome d oxidase cyd subunit II [Mycobacterium rhodesiae NBB3]MGLQEMWFFIIAVLFGGFVLLEGFDFGVGMLMAPFGAAGKAAGADSEPRR
RAALNTIGPVWDGNEVWLITAGAAMFAAFPNWYATLFSALYLPLLAILVG
MIVRVVGIEWRGKVDDRRWRAWADAGIAAGSWLPAILWGVAFAILLQGLP
IDADGQAHLSIGDVLSGYTILGGLATVSLFAFYGAVFVALKTAGPVRDDA
FRFARVLSLPAVVFAGGFGLWTQLAHGKTWTWVPLGVAVVALLTAVALMV
ARRREGFAFASTMVVVAAVVVLLFGSMYPNLLPSTLNPDWSVTIYNGSST
PYTLAIMSWASLTLLPLVLGYQAWTYWVFRKRITADAIPASIGLSRQRT
375141638YP_005002287.1 cysteine export CydDC family ABC transporter permease subunit/ATP-bMSGPVDPRLWRASTAMRRFLVSSTVCGVLIACATIASAVVLADIVARVIT
DPDARSLSRLAAPLLILLLLWTFRTLVTWQQGRLAQRGASEVIADLSRSV
LGATTSLPPRRLAGHRDDAAILVTRGLDGLRLYFTAYLPALLTAVILTPA
TVAVIAVYDWRSAVIVSIALPLIPIFMVLIGLTTSERSAAALRAMATLQS
RLLDLVAGLPTLRALRRVGGSATRIAELGAAHRRSTMATLRIAFLSSLVL
ELLATLGVALVAVSVGLRLVYGEMTLTAGLTALLLAPEVFWPLRRVGAAY
HAAQDGKTAADNAFRLADALPRRIGGTREVTAAGATIDMTAYGAAAGPGQ
VTVIAGPNGVGKSTLLQAVLGLDEPVPGRILVDGMDVADLDLSAWWAQVA
WLPHRPTIIAGTVRQNLELFGPIKDIETACRKACFDKVIADLPDGMNTRL
GSGGVGLSLGQRQRLGLARALGSTASVLLLDEPTAHLDAETEQRVLWAIS
ARAAAGATVIVVGHRAPVLAIGDRVVQLGSLVDV
375141637YP_005002286.1 ABC transporter ATPase/permease [Mycobacterium rhodesiae NBB3]MFELLRPRLGRLLLAILFGVLSLGSALALAGVAAWLITRAWEMPPVLHLT
VAVVAVRALGISRGVLGYCERLASHDNALRAAADVRERLYSRLASGPVDA
VMRRNTGELVSDIGSSVDELSDVLVRAVVPIAVAAILGSAATIAIAIISP
AAAVVLAVCLLVAGVAAPALTAHAAVAAEHLAAQHRSQRDTAAMLALEHA
PELRVGGCLDELLADADSQQRDWGRAIDRAAAPAALAAATPIAAIGASVL
GAVVCGVVSAATLAPTALAVLMLLPLSAFEATTALPGAGVQLARSRVAAR
RLTVLTDAGVDESRRPSVPSIQLEPGARLAVTGPSGSGKTTLLMNLAGLL
PEETPSDTAFFAEDAHLFATTVRDNLLVARGDAADDELRAALYRVGLGDW
LDSLPEGLSTVLVGGAAAVSAGQRRRLLLARALTSSASTVLLDEPTEHLD
ATDGRRFLTELLTPDALFPAERTVVVATHHLPADFACTTVKLGACE
375141636YP_005002285.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSEPEHPETPPPPPPSTPPPPPPPGAPPPPSYGAYQGGYPPPPQGAPYGG
YTAPVSAPKNGLGIASLVVAIISLLSVVGGVVLGFVAIVLGFMGRGRAKR
GEANNGGIALAGIILGFLSIIEAIVVIGLMVWGFKEVGGTDYVDCLSRAG
SDQEAVQQCADQFTDNLETQFSITVTTPTP
375141635YP_005002284.1 acyl-CoA thioesterase [Mycobacterium rhodesiae NBB3]MSTADLQELLAILDLRQVDDDTYLGSHPSKNPVRTFGGQMVAQSLMAASR
SLTFALPPSALSVTFIAGGDPEKDLEFHITRLRDERRFANRRVDVEQDGR
LLTTAMVSYLSGGRSLEHGIAPPELPGPLTVPGVDDLLRGYEDVVPHFVN
ALRPIDWRYTNDPAWVMRSKGETLTYNRVWMKAHGTIPDDPALHAAALVY
ASDTTVLDSIITTHGLSWGFDRIFAVTTNHSVWFHRPVRFDEWVLYSTSS
PVAADSRGLGTGHFFDQSGQLLATVVQEGIVKHFPR
375141634YP_005002283.1 pyruvate kinase [Mycobacterium rhodesiae NBB3]MLAGVNRRGKIVCTLGPATATEDAVKALVEAGMDVARLNFSHGEYSEHEA
NYKRVRAASDATGRAVGILADLQGPKIRLGRFADGPTVWADGETVRITVD
DCEGTHDRVSTTYKRLAEDATVGDRVLVDDGNVGLVVEEIDGNDVVCTVT
EGGPVSNNKGMSLPGMNVSAPALSEKDIEDLEFALQVGVDLVALSFVRSP
ADIELVHEIMDRVGRRVPVIAKLEKPEAIDNLEAIVLAFDAIMVARGDLG
VELPLEEVPLVQKRAIQMARENAKPVIVATQMLESMIENSRPTRAEASDV
ANAVLDGADAVMLSGETSVGKYPLEAVKTMARIVRAVEENSVVVPPLTHV
PRTKRGVISYAARDIGERLDAKALVAYTQSGDTVRRLARLHTPLPLLAFT
SLPEVRSQLALSWGTETFIVPHIQTTDGMIKQVDKSLLELGRYKRGDLVV
IIAGAPPGTVGSTNLIHVHRIGEDDV
375141633YP_005002282.1 NADH/NADPH-dependent glutamate synthase small subunit [MycobacteriuMADPTGFLKVPKVDATKRAVDERVGDWREVYEQQDPHQRAGEVSQQARRC
MDCGIPFCHSGTAGCPLGNLIPEWNDLVRRGRWDAASDRLHATNNFPEFT
GRLCPAPCEAACVLSIGEERTGGSVTIKRIEQTIADQAWMDGIVEPQPAA
IATGRRVAIVGSGPAGLAAAQQLTRAGHDVTVYERDDRIGGLMRYGIPEY
KLEKATLNQRLAQMRAEGTRFVTECEVGVDLPVEQLRQQYDAVVLAVGAL
RARDSDVEGRRLRGVHLAMDHLVPANKECEGDGASPISAAGKNVVIIGGG
DTGADCLGTAHRQGAKSVTQLDYNPEPPEYRDESRSPWPMWPIVLRTRLS
PAHAEGGDRRYEVAVQRFLGDERGNLRAMEIAEVKVERDAEGRRIITPVG
ETLELPCELALLAIGFDGVEHMPLLDGLGLELNRRGALPCGSDWQTDAPG
VFVCGDAHRGASLIVWAIAEGRSAAHAVDKYLMGESDLPAPVVPGALPLA
VA
375141632YP_005002281.1 glutamate synthase family protein [Mycobacterium rhodesiae NBB3]MLYSAFPEPQGLYDPDNESDSCGVAMITDIQGRRSHAIVVEGLVALEHLE
HRGAAGAEPNSGDGAGILIQLPVELLREVVDFALPSPTAEGANTFAAGIC
FLPQDPAERTAAREHVEAVAADEGLSVLGWREVPTDPDGAEIGATALGCM
PHMEQLFVASPHHLAGIDLDRRVYPLRKRAERTGVYFPSLSSRTIVYKGM
LTTMQLPQYFPDLRDERCRSAIAIVHSRFSTNTFPSWPLAHPFRFVAHNG
EINTVRGNRNRMHAREAMLASANIGGDLSRLSPICTPEASDSASFDEVLE
LLHLGGRSLPHAVLMMIPEAWENSTTMGPGERAFWQFHASLMEPWDGPAC
VTFTDGTLVGAVLDRNGLRPGRWWRTLDDRIILASESGVLDVPSAQIVAK
GRLQPGKMFLIDTAAGRIVSDDEIKESLAAQEPYGEWLHAGLLDIATLPD
RARVQPNHESVVRRQIAFGYTEEDLRILLTPMAASGAEPLGSMGTDTPTA
VLSQRSRLLYDYFVELFAQVTNPPLDAIREEVVTSMARVMGPEQNLLEPT
AASCRQIVLRWPVLDNDELNKIVHINDDGEHGGLRTAVLKALYDVERGGE
GLADALEDLRLRACDAIGKGARTLVISDRDSDHTRAPIPSLLAVSAVHHH
LVRTKERTTVALVVESGDAREVHHIAMLIGFGAAAVNPYLAFESIEDLVR
EGELTGIEPAAAVRNYLKALGKGVTKVMSKMGISTVASYTAAQAFEAVGI
DKHVIDEYFTGTPSQLGGVALDVLAEEVKVRHRRAYPENPTERVHRRLEV
GGEYAFRREGELHLFTPEVVFLLQHSTRTGRHDIFKQYSDEVNRLSREGG
TLRGLFSFKKHRPPVPLEEVESVDSIVTRFNTGAMSYGSISAEAHETMAV
AMNNLGGRSNSGEGGEDVDRLYDPRRRSAVKQVASGRFGVTSDYLVNASD
IQIKMAQGAKPGEGGQLPGYKVYPNIAKTRHSTPGVGLISPPPHHDIYSI
EDLAQLIHDLKNANADARIHVKLVSSVGVGTVAAGVSKAHADVVLISGYD
GGTGAAPLTSLKHAGAPWEIGLADTQQTLMLNGLRDRITVQCDGGMRTAR
DVVVAMLLGAEEYGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPELRAR
FNGKPEFVENYFRFIAEDIRHYLAELGFRTIDEAVGQADMLDTDEGIAHW
KSRGLDLAPVFAVPNSAERRRTRAQEHGLEEALDRTLIQLAEGALEDAHP
VRLELPVRNVNRTVGTLLGSEVTRRYGAAGLPDNTIHVTLTGSAGQSIGA
FLPAGITLELVGDANDYVGKGLSGGRVIVRPPDDVLFLPEDNVIAGNTLL
FGATSGELYLRGRVGERFAARNSGALTVVEGVGDHACEYMTGGRVVILGK
TGRNMAAGMSGGIAFVLGLDPKKVNTEMVELQRLEPEDLTWLRDVIATHA
KHTRSTLADSVLSDWPRRSAQFTKIMPRDYQRVLEATLVARREGRDVDTA
IMEASRG
375141631YP_005002280.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MALSTAPTRGRLYTALGTGAVVVGALAYIGLGDPHRPNFFLPCPFHAATG
LYCPGCGGLRMVHDVLHLDLSAAVVDNVVALIGLPLLLAWIVLRRRSERP
WMTPVAAVTIVAIAVTWTVVRNLPGFPLVPTVLDG
375141630YP_005002279.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLSVMTEPQFGGNEYGSQPTPPPPPQPGYGPPPVGQYPQAYQDPSAPFGR
HPLTGEPFSDKSKTIAGLLQLLGLFGLVGIGRMYLGQVGLGVAQLLVGLV
TCGIGALVWGIVDAVLIFTDKVRDPEGRPLRDGT
375141629YP_005002278.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTRAQSQAQTRADLVRTARRLFFEDGYHPTSLEKVADAAGFSKGAVYSNF
RNKDELCTAVLDEVRGERIAEILDIMARPDLPSRIEALRDWAERVIGDPG
WTSLEVEFAVHARRNEQLRTDMASRLTFILQTLTGATESTDLTDPAMPRD
EIATVMLALGIGLGLLRSIDPGVPVNGLTDILSLVSGQS
375141628YP_005002277.1 short-chain alcohol dehydrogenase [Mycobacterium rhodesiae NBB3]MAYPAIEVDGAVVAVTGGARGIGKATAHLFASRGATVCVGDLDPADSSDV
FVVDVTSRHSFGAFVDAVIARHGRIDILVNNAGVMPVGDFLSEDDAISGT
TLGVNVWGLIHGMRAVMPHMIERGRGHVVNVASMAGKLVVPGLAVYNASK
FAAVGLSVAVREEYRSSGVSVSAVLPSAVRTRLASGVPLGHGMPTVDAED
VARAIVCSVRRRRAEITVPRYLAAWDLVSAATPEPVMRLGRKLIVTDGR
375141627YP_005002276.1 putative flavoprotein involved in K+ transport [Mycobacterium rhodeMTREPRVVIIGAGIAGIATAVTLQRAGFGDFTILEKGSDVGGVWHWNRYP
GLTCDVPSQLYQFSFAPKPDWSGLFAPGAEIQRYLRDVVDGCGLGDRLLL
NTEVVSATFSGTDWRVTTSGGVELEADFVIAATGVLHHPFTPDIPGLDTF
AGDVVHTARWHDDTVTDGRRIAVIGTGSTGVQVVSALQPGAARISHLVRS
PQWVMWAPMGLRQPAAVGRLLRKRPALHRKLYAVFLWGSGILADIATRPS
WRRRLVQTYARWSLRTQVRNPELRDRLTPDYQPLCKRQVVSSSYYRAIRA
DNAEVVTAPIDRVTPRGIALSDGREIDVDLLVLATGFHTHNYMRPMRIRG
RDGISLDDAWAKGPRAYRMTAIPGFPNLFTVLGPNSPTGSISLQYSSELT
ARYITQWLRRFRDGEVDTVEVTEEATAKFNDDAGQALGPTVWNTGCNSWY
LTDEGNVDLWPYDRKTMTAMLSRPDYRDFHVQKGGGL
375141626YP_005002275.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFDFERDRDLLQVMGEATREESTCIAQRLLAVAELYTRHEGALADMEWCL
VDYCAATAADVSAVQNISHARAVGQVQFACALAYRLPAVAKVFVRGTIDF
RMVSTIINRTDNVDDELMPKLDEAIARHCEKWMKLSRPKLQDRVDQWVAK
FDPAGVRVPPKVEQNRYFDVDAAAPGMAFASGHLRAADGAALDARLEALA
ATVCEHDPRSHNQRRADAAGALGRQEAALVCLCGRQDCTAAQGDAQHTAA
TAVIHVLAEQGTLEGSSDTPGYLRGLGILPAESVREVAKTARLKPLTIPT
GAAPDPGYRPTARTREFLGWRDLTCRWPGCDKPVEKCDVDHTVPYPNGPT
HPSNTKHYCRIHHLVKTFCGWNDRQLPDGTIVLTSPTGYTCTTEPHGAAM
FPTLATPTGELDLPPTAHEPDAPAERLAMMPRRKQTRAQDRRDRINAERR
ERTELIAEQQRQHQAWLAANYKPPPF
375141625YP_005002274.1 response regulator of citrate/malate metabolism [Mycobacterium rhodMVAANEPIDPRVRLAISQWPDDAPRGAVSTFCAEHGISRKSFYALRNRAK
TDGSAAVLEPRTRRPKSSPSTLSDAVKEQAVAVRAALEASGLDHGPISVH
EKMHAMGLDQVPSTASLARIFREAGVARLEPKKKPRSAWRRFVYPAPNAC
WQLDATEYVLSRGRTCVIFQLIDDHSRYALASHVAWGETAAAAIVVFDKA
VAAHGVPQRLLSDNGIALNPSRRGHLGQLVAHVGALGVQAITGKPYKPTT
QGKNERFHQTLFRYLDKQPLAETLEDLQTQVDEFDHVYNTQRPHQGLPGR
ITPLAAWEATPKADPPRPKLDRPIYQRVTRRYQRPRAQAPADLPAGTCIR
TVNTSGTISLDGVHYKVDVDLAFQQVLVISTGDNTGDAIIITDLLGEILA
EHSRPAPGIRYVGNGQRPGTRPTNPPPLPKS
375141624YP_005002273.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVSGGLSVASLALHAGIAQAQAPTVIPEAAAQTIVDVVSESTGFVPTDVE
CPSGVDAVVGQQFECAVTGPEGPYTAYMQISKVDGTYVEYQITTRRD
375141623YP_005002272.1 cytochrome P450 [Mycobacterium rhodesiae NBB3]MTTLVTGLPTIAYEHATSPAEAHELIRNARRRGPIAMGPHGPEVLSYDLV
RTVLRDDGFAMPKGLALTAQGITSGELWDIALKGLLSLDGAEHRRQRRLL
SKAFTPRAAERLRETCTDIIGELVDSQMNAGACDAVADIARRYPIPIICA
MLGTPAADWHLFSDWADDVFKIFDWNVVNDEADIVRAWNALTDYLDEMVT
RRRDALGDDLLSDLIRAEIDGDRLSHDELLTLGATLLMAGTDTTRNQLAA
AVQVFCEHPDQWALLAEHPELAPRAVEEAMRYSPVIFTTMRVAVDDVELD
GFRIGAGTPVIVNTAAANRDPEVYPNADQFDITRENAPAMLTFGGGIHYC
LGAHLARIELAEALTTMARRMPDIRSAGDVSWKSITGISGPASLPIAFTA
CP
375141622YP_005002271.1 phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthasMSVLTDWFLTDEERGNPHSSLAGWCDGNRAEPLIHGATYFDHLVTEVEAL
RAGDHLFFTDWRGDPDQKMREGGPTIRELFCRAAERGVVVKGLVWRSHLD
KLAYSEEENRHLGEAIEEAGGEVLLDQRVRIGGSHHQKLVVLRHPGAPER
DVAFVGGIDLCHSRRDDASHRGDPQAVQMAKRYGENPPWHDVQLRVQGPA
VGALDTTFRERWQDPASLDMLNPLAWLRDKFGGADMNADPLPDQPADPPP
CGPHAIQVLRTYPDAHFAYDFAPHGERSIARAYNKVVPRARKLIYVEDQY
LWSKRVATLFAQALKDNPDLHLVAVIPRHPDVDGRLELPPNLIGRWQALE
TCHAASPERVHIFDVENAEGTPVYVHAKVCVIDDVWSCVGSDNLNRRSWT
HDSELTCAVLDAEGDFARDLRLRLLREHLDRAADGSDDRGLGDPATAVRE
IVDAADGLEQWYASGRRGPRPPGRLRPHKAERPSLFTRLWAEPVYRLTYD
PDGRSYRDRLRGRL
375141621YP_005002270.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium rMPIVRRLLAALFVLVLIGGCSSGTQPDESAPTDAGTDDSRADAVMRAVRD
TMASEHLKAVIVRVTVDGQEIVTDAVGESMTGVPAAANMHFRNGAVAISY
VSTLLLKLVDEQKLSLDDKLSKFLPEIPNSDRVTLGQLAQMTSGYVDYVI
GNTKMNEALYADPFRRWTVHDLLQFAVNQPLLYEPGTNWNYAHTNYLLLG
LALEKATGEQIPKLLSEKVLRPLGLTNTVNSLTPEIPAPALHAFSSERRA
FLKVPPGTPFYEESTFWDPSWTITHGAIQTTDIYDMEATAVGIGSGKLLS
ADSYQKMVSTELRGKTHKQPGCTTCEAMDDVYTYGLGMVISGNWLLQNPL
LSGYAAVEAYLPAQKIAIAVAVTYLPEAFDDQGDYPNAADTLFRKIGAVL
APDDAPPVRKPK
375141620YP_005002269.1 GMP synthase [Mycobacterium rhodesiae NBB3]MAPKVLFLVNEHLATEGLLGEAFVDQGFDVELFEVVPAERIDDPAVDVAF
PDPAGYDVIAPLGARWPVYDEALRRTWVSTEAQLVRDAADAGVALLGVCF
GGQLLAQAFGGSVARSSEPEIGWYEVTSDRPDLIPGGPWFQWHFDRWTVP
PGATEIARTPCASQAFVLGRALALQFHPEVDTELLERWLADDRDGEVAGI
GRTHDELRSRTTELAQSASARVRDLVAGFVTHVVRQPCPSS
375141619YP_005002268.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGIEIETVVDHPLTEVFDWHSRRGAMRRLVPPWQPMKVVAEADSLADGCA
VLALPGGLRWVAQHDPTEYDPPHRFVDVLSSRGPRSWPPRLVGHWTHTHE
FGEAPSGTRVYDRIDAPVPAAALRPMFAYRHRQLADDLAAHRDAREAGLT
PLTVAITGATGLVGTALSAFLTTGGHRVIRLVRHAAQSQDERQWDPDRPA
AHLLSGVDAVVHLAGASIAGRFTAGHKEAVRDSRIGPTRRLAELAAASAF
QGPFISASAIGIYGYDRGDDLLSEESVRGDGFLADVCADWEAATAPAAAA
GLRVVNVRTGIVQSAGGGTLRLLRPLFAAGLGGRVGSGRQWLSWIALDDL
LDVYYRALYDARLSGPVNAVAPTPVRNADYTKALASVLRRPALLPVPSLG
PRLLLGEQGSRELAEADQRVAATKLESLGHRFRHPGIDGALAHELGHG
375141618YP_005002267.1 putative phosphoribosyltransferase [Mycobacterium rhodesiae NBB3]MSGLRGLSRREAARVFRDRREAGDVLAQQMTSYADKPNLLVLGLARGGVP
VAWQVAHALRAPLDVFLVRKLGVPQWQELAMGALASGGGVVINDNLVRSL
GISDDQLQSAIERETDELHRREQAYRGDRPPIDVTGKTVILVDDGIATGA
SMLAAVRAVKAQGPAQVVVAVPVGPASACRELATEADDVVCATMPPGFEA
VGQVFEDFHQVSDDEVRELLARG
375141617YP_005002266.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLIVALVLAVIGLAALVTAVVTSNELIAWVCIVASVIGVVLLIVDAVRDR
SRGDADDAEGEPVSEFDEDYPEDAAPEAEPEYEAETTVVEQADDVAGDER
NR
375141616YP_005002265.1 DivIVA domain-containing protein [Mycobacterium rhodesiae NBB3]MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENADLR
QRVAELDQELGGDGGGSGAQSTQAIPQYEAPAPTPPPAPEPAQQPQYEAA
PTSANTEEQAIKAARVLALAQDTADRLTGTAKAESDKMLADARAQADALV
SEARQTAETTVTEARQRADAMLADAQTRSETQLRQAQEKADALQADAERK
HSEIMGTINQQRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA
APVDSSANNDAGGFNQFNRGNN
375141615YP_005002264.1 putative integral membrane protein [Mycobacterium rhodesiae NBB3]MALFFDILGFALFVFWLLLIARIVVEFIRSFSRDWQPKGATVVILELIMT
VTDPPVKLLRRLIPQLTIGAVRFDLSIMVLLLAAFIGMQLAFGAAV
375141614YP_005002263.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSTLHKVKAYFGMAPMDDYDDEYYEDDERAASRGYSRRSREDRFEEDEGY
GRRGGYDDYDDAPAGYRGGFRDEDRFEPRVRGPRDFERASSRLGPLRGAT
RGALAMDPRRMAELFEAGSPLSKITTLRPKDYGEARTIGERFRDGTPVIM
DLVTMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVTAEER
RRIAEAGFYSYQ
375141613YP_005002262.1 pyridoxal phosphate enzyme- YggS family [Mycobacterium rhodesiae NBMTAIVTTRETELAEALAAVRARLTAAAEAAGRNSDEIELLPITKFFPASD
VTILHHLGCEAFGESREQEAANKAAEVANMVGGAPIRWHMVGRIQRNKAR
SIAAWAYAAHSVDSVRLVNALDRAAAGALADGDRTAPLRIYIQVSLDGDT
QRGGVDIADPALVDQVCAAVQAGDGLEFVGLMAVPPLGADPREAFGRLQS
ELERVQRDYPQRLELSAGMSGDLEAAVEYGSTCVRVGTALLGQRPLTSPG
VVTPVTSSSQTPESKVIRRVER
375141612YP_005002261.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTTSMCRPSCATDTAAILGNVTVRIRRVTTTRAGGVSAPPFDTFNLGDH
VGDDPAAVAANRKRLAAAVGLGNDNVVWMNQVHGDRVVMVDGPSAETIDD
TDALVTTTPRLALAVVTADCVPVLLGDARAGVVAAVHAGRVGAQNGVVVR
AVETMLAAGAHAEDISVLLGPSVSGRNYEVPAAMAAEVEATLPGSRTTTA
ANTPGLDLRAGIARQLTDLGITSIAIDPRCTVADRNLYSHRRDAPTGRLA
SLVWME
375141611YP_005002260.1 cell division protein FtsZ [Mycobacterium rhodesiae NBB3]MTPPHNYLAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMS
DADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDDIEELLRGADMVFVTA
GEGGGTGTGGAPVVATIARKLGALTVGVVTRPFSFEGKRRSNQAETGITA
LRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITT
PGLINVDFADVKGVMSGAGTALMGIGSARGDGRALKAAEIAINSPLLEAS
MEGAQGVLLSVAGGSDLGLFEINEAASLVQEAAHADANIIFGTVIDDSLG
DEVRVTVIAAGFDSAGPGRKPVVGAGQAIAAGTAGKVTSQLFEPADAASV
PVHTNGATVSIGGGDDDDDVDVPPFMRH
375141610YP_005002259.1 cell division septal protein [Mycobacterium rhodesiae NBB3]MSQPTEPTDEGESDEAPAQTEQSEPVTAADAEPDFEGPRRRARREREERR
AAQARATAIEEARREAKRRVTGTVSTKKLGRGTVRGLKVLMYSALISVIV
VGLGLLLYFTPIMSARNIVVVGLGAVSKDEVINAAAVAPGTPLLQVNTDT
VAERVAAIRRVASVRVQREYPSTLRITVVERVPVVVKDYPDGPHLFDRDG
VDFAIGVPPQGVPYLDTKNPGPDDPPTKAALEVMTSLRPEVATQVARVDA
PSVAGITLQLTDGRQVIWGTTDRTEEKALTLGALLTQPGKIYDVSSPDLP
TVK
375141609YP_005002258.1 UDP-N-acetylmuramate--L-alanine ligase [Mycobacterium rhodesiae NBBMSAKSLPEELQRVHMVGIGGAGMSGIARILLDRGGLVSGSDAKESRGVVA
LQARGASIRIGHDESSLDLLPGGPTAVVTTHAAIPKTNPELVEARRRGIP
VILRPVVLAKLMAGHTTLMVTGTHGKTTTTSMLIVALQHCGFDPSFAVGG
DLGEAGTNAHHGSGDCFVAEADESDGSLLEYSPDIAVVTNVDADHLDFYG
SVQAYRAVFDDFVERIKPGGALVVCVDDPGAAALAERTAALGIRVLRYGS
DPAVATDALLVSWEQHDTGAVAHVRLGDDPQPWVMRLAVPGRHMALNALA
ALLAAVNAGAPVDAVLDGLAGFEGVRRRMELVGTVSGVRVFDDYAHHPTE
VHANLSTLRAVARTGRSVVVFQPHLYSRTEAFAREFAQALDAADEVFVLD
VYAAREQPIAGVSGASIAEHVTVPVTYIPDFSAVAERVAAALRPGDVVVT
MGAGDVTLLGKEIVTALRAKANRSAPGGPVTG
375141608YP_005002257.1 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyMKSTSSRRGERWAHARSNGDDRGISVVLAGGGTAGHVEPAMAVADALRAI
DPDVRITALGTERGLETRLVPQRGYDLELITPVPLPRKPSADLARLPWRI
GRAVRQTRAVLDDVDADVVIGFGGYVALPAYLAARRRVPVVVHEANASAG
WANRVGARSARRVLSAVPDPGLRDVEVVGVPVRAAITSLDRMALRAEARA
HFGFDETANVLLVFGGSQGAQSLNRAVSGAAKDLAAAGISVLHAHGPKNT
LALRDPADGDPPYVAVPYLDRMDLAYSAADLAICRSGAMTVAEVSAVGLP
AVYVPLPIGNGEQRLNALPVVNAGGGVLVDDADLSPQFVGETVTGLFTET
GRLQAMTAAAALAGHRDAAQKVAEIALDVARKGLR
375141607YP_005002256.1 cell division protein FtsW [Mycobacterium rhodesiae NBB3]MSNILTRLRLRRTGDDTSTETAPVEKEPRTRFGAWLGRPMTSFHLIIAVA
ALLVTLGLTMVLSASGVYSYDTDGSPWMVFARQVLWTFVGLFAFYVAMRM
PVSVMRRLAFSGFAVTIVLLVLVLIPGIGKVANGSRGWFVIAGLSMQPSE
LAKIAFLLWGAHLLATRRMERASLREMLIPLVPAAVVALALIVAQPDLGQ
TVSLGIILLGLLWYAGLPLRVFVSSLFAVMLSAAVLAMAEGYRSDRVMSW
LNPGADSQGSGYQARQARFALANGGIFGDGLGQGTAKWNYLPNAHNDFIF
AIIGEELGFVGAAGLLCLFGLFAYTGMRIARRSADPFLRLLTATATLWVM
GQVFINVGYVVGLLPVTGLQLPLISAGGTSTATTLLMVGIMANAARHEPE
AVAALRAGRDDRVNRLLRLPLPSPYVPSRTESVRDRLRTQKKESRPRPTA
NSRGAKSAKAGTRTARKPAGENRRQTPTPARAVRAPRHHGDGRDRSGRRA
RTLEGQRYG
375141606YP_005002255.1 UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mycobacterium rhodMGETDLLVPGARVLVTGAGITGRSVSAVLEPKGVRLTICDDDPLALQRLI
TPAKVVTTAEAQTHIADYDLVVTSPGFSPTTPVLAAAANAGVPIWGDVEL
AWRLDSSGHFGAPRQWLVVTGTNGKTTTTSMLHAMLIADGRRTALCGNIG
NPVIDVLGEPSDVLAVELSSFQLHWAPSLRPEAGVVLNVAEDHLDWHGSM
AAYAADKARVLGGRVAVGGLDDPVAAELLAASPAPMRVGFRLGEPAAGEL
GVAGGVLVDNAFGDRVPLADAASIPVAGPVGVLDALGAAALARAIGVRPD
SVAGALAGFQVGRHRAEIIGTHNGVTYVDDSKATNPHAAQASIAAYPRVV
WIAGGLLKGASVDELVAAVGNRLVGAVLIGRDRELIANALSRHAPDVPVV
QPVTGEDFGVHGKDETGVTGEAVMATVIDAASRLAGPGDTVLLAPAGASF
DQFSGYGHRGDAFAAAVRALSR
375141605YP_005002254.1 phospho-N-acetylmuramoyl-pentapeptide-transferase [Mycobacterium rhMRQILIAVGIALTVSILLTPVLIRLFTRQGFGHEIREDGPPSHHKKRGTP
SMGGVAIVAGIWASYLGTHLVGVVIDGRGPSASGLLVLGLATALGFVGFV
DDMIKIRRSRNLGLNKTAKTVGILSAAVLFGVLALQFRNSDGLTPGSADL
SYVREIATVTLPPALFILFCVTMIYAWSNAVNFTDGLDGLAAGAMAMVCA
AYVLITFWQFRNACAISPGLGCYNVRDPLDLAILAAATAGACIGFLWWNA
APAKIFMGDTGSLALGGIIAGLSVTSRTEMLAVVLGALFVAEVTSVVVQI
MAFRTTGRRVFRMAPFHHHFELVGWAETTVIIRFWLLTAIACGLGVALFY
SEWFTAVGG
375141604YP_005002253.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacMINMTIAEIADIVGGTLADITPEQAAATRVTGTVEFDSRAVGPGGLFLAL
PGARSDGHDFAAAAVEKGAVAVLAARSVGVPAIVVEPGVAGDRNSGVLEH
DTDGSGAAVLAALARLAGAVAAKLVADGLTIVGVTGSSGKTSTKDLLAAV
LTPLGEVIAPPGSFNNELGHPWTVLRATESTDYLVLEMSARHRGNIAALA
AIAPPSIAVVLNVGTAHLGEFGSREAIAETKGELPQAVPSSGAVILNIDD
TAVAAMAAKTAARVVRVSREPGARDVDVWADAVTLDELARPRFTLHAGDS
QVDVALAVHGDHYVSNALCAAAVALECGATLQQVADALGSAGPASRHRMQ
VVTRPDGVTIINDAYNANPDSMRAGLKALAWMAREGRGGRRSWAVLGEMA
ELGDDAISEHDNIGRLAVRLDVSRLIVIGTGRAMSAMHHGAVMEGSWGSE
ASMVADADAALAVLRSELRAGDVVLVKGSNAAGLGALADLLIADAGDPTA
375141603YP_005002252.1 UDP-N-acetylmuramyl tripeptide synthetase [Mycobacterium rhodesiae MNLRPSHPAGTALGQLAEQVAAVSADGGEVADVRITGVTLRSQDVEAGDL
FAALAGASSHGARFAAEAVSRGAAAILTDPAGVAEIGNDLAVPVLVHPDP
RSVLGDVAATVYGHPSEQLRVIGVTGTSGKTTTTYLVEAGLRSADRVPGL
VGTVGIRIGGRDQPSALTTPEAPDLQALLAVMVEQGVDTVVMEVSSHALT
LGRVDGVRFAVGGFTNLSRDHLDFHPTMQDYFNAKAQLFDPESATHASIS
VICIDDEAGRAMATVAHDPVSVSVTGQDADWRVEEVHTIGADADGTQEFL
ALDPAGVHHGLRIGLPGRYNVANCLLAVALLDAVGVSPEQAAPGLRAATV
PGRLEPVDRGQPFLALVDYAHKPGALKAVLQTLREQSTGRLAVVFGAGGN
RDPGKREPMGRVAAELADLVVVTDDNPRDEDPAAIRAAIVAGTTEGTAEV
VELGDRREAIDFAVAWAQPGDVVLVAGKGHEPGQTSHGVTRPFDDRDELA
AALEALGRRT
375141602YP_005002251.1 transposase [Mycobacterium rhodesiae NBB3]MALAEHCRHARYVWNLAVEQQRHWQPGRCAPQYNEQCAQLTSARAEYDWL
AAGSQTVQQQALRDFAQAMRNFFGGTHRRPTWRKAGVHEGFRQVAVKSHH
VERLNHRLGRVWVPKVGWVRFRLSRAVPEDVKSYRVTQDRAGRWHIAFAH
IPDPVAGPGEGSIVGIDRGIAVSAALSTGELLHAPGLTPGEVRRIRALQQ
RLARARPGSNRRARTKRAIAKLRARETDRRKDWVEKTTTDIARRFDTIRI
EALDVRAMMSSARGTVEKPGRRVNQKRGLNRGISRSGWGLLASRLQDKAA
GRVEQIPAAYTSQRCAACGHIASRNRKSQAVFECEACNGESCNADVNAAR
NIAAGRAVTVRGDLGTSRSMNREPQLCPSAA
375141601YP_005002250.1 cell division protein FtsI/penicillin-binding protein 2 [MycobacterMSRGKSPARAGDKPKARAVKSQERSARSRRTRTPAPETGVRSASFVFRHR
VGNAAIFLVLIVAAAQLFNLQVPRAEGLRAEAASQLKVTDVDKAVRGAIV
DRNNDKLAFTIEARALTFQPARVRKQLEEARAKSPEAPDPEKRLRDIAAE
VSLRLNNKPTAAQVLKKLKSNETFVYLARAVDPAIADAITTKFPEVGSER
QDLRQYPGGALAANIVGGIDWDGHGLLGMEDSLDAVLSGTDGSVTYDRGS
DGVVIPGSYRNRHDAVDGSTVVLTLDDDIQFYVQQQVQLAKDRSGAKNVS
AVVLDAKTGEVLAMANDNTFDPSQDVGRQENRQLGNLSVSSPFEPGSVNK
IITAASVIEFGLSNPDEVLQVPGSIDMGGVTVGDAWEHGTMPYTTTGVFG
KSSNVGTLMLAQRIGPERYAEMVRKFGLGQRTGVGLPGESAGLVPPIDQW
SGSTFSNLPIGQGLSMTLLQMTGMYQTIANDGVRVPPRIVKSTIASDGTR
TDEPRPEGVRVVSPQTAQTVRQMLRATLQRDPMGVQQGTGSQGAVEGYQL
SGKTGTAQQINPACGCYYSDVYWITFAGIATTDNPRYVVGVMMDNPHRTA
DGSPGTTAAPLFHNISSWLLQRENVPLSPEGPRLTLQAD
375141600YP_005002249.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKTMRTKQGKQAKQDKQPKKVKRSVSARANDERRRNPRNGRRPAEAPPRR
KPTREQRPTRSAPQTGPIPRPKNGPARPKNADQARARAKARKAKAPKVVR
PPLRERIIVKLASIDLNPRTLVARVPFVVLVIGSLGAGLGTTLWLSTDAA
ERSYQLGTARETNQALLQQKEALERDVLEAQAAPALAEAARGLGMIPSRD
TAHLVQDPSGNWIVVGTPKPAEGVPPPPLNTPLPDEAPPAPPPPPAARVT
DPREITVRVPQQPVPGAQLPPGAQFSPPGAAPLAAQPAPGAEVPHAAGAT
APAPGPLPVAPPAMSPAAPAAPILQQPLTVPLPGAPA
375141599YP_005002248.1 S-adenosyl-methyltransferase MraW [Mycobacterium rhodesiae NBB3]MNLCTTLFEGAAEAALDRHVALASWPLPEPALAYFPDARSALSDRDLGAG
TFTGSDAMPDHIPVLLDRCVELLAPALTRTAADGSGAVLVDATLGAGGHT
EKFLTEFPGLRVIGLDRDPNALRIAGERLSPFGDRVMLVRTRYDGIKGVL
ADSGYRADKVDGVLFDLGVSSMQLDRTDRGFSYASDAPLDMRMDPDAPLT
AADVVNTYDERTLARLLREFGEERFASRIAAQIARRRADRPFSTTGELVE
LLYQAIPAPARRTGGHPAKRTFQALRIAVNGELDSLRDALPAALDVLANG
GRIVVMAYQSLEDRIVKNQFSAATASRTPPGLPVELPGHEPEFVALTRGA
ERAAAEEIALNPRSASVRLRALEKVGGHL
375141598YP_005002247.1 mraZ protein [Mycobacterium rhodesiae NBB3]MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKGQDHSLAVYPRAEFEE
LARRASQASRSNPEARAFLRNLAAATDEQHPDSQGRITLSADHRRYANLS
KDCVVIGSVDFLEIWDSAAWQEYQQTHEENFSAATDESLHDII
375141597YP_005002246.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPLSDHEQRMLDQIESALYAEDPKFASSVRGGTLRAPSTRRRLQGAALFV
IGLAMLVAGIAIPATRIGDFAILSVIGFIVMFGGVVFAITGPRVAGGRDR
GVTDQVGQQRQKRAKGSGGSFTSRMEDRFRRRFDE
375141596YP_005002245.1 acetyltransferase [Mycobacterium rhodesiae NBB3]MATFLIDLSPSDMQRRLGDALAVYVDAMRYPRGTEDQRASMWLEHTQRGG
WKAVAAIEVPDQDGSEGGSTPEPQLGSAPLLGIAYGYCGAPDQWWQQQVV
AGLHRVGADSTRIAELMTSYFELTELHIHPRAQGRGLGEALARRLLADRG
ESRVLLSTPEINGEGNRAWRLYRRLGFGDIIRGYHFAGDPRAFAILGRSL
PL
375141595YP_005002244.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRVQHLRNRRLLAIGLLILIVLPSVVGCVRIRTSLTVSPDDRVSGQIVAA
AKPRNADDKGPQLLNNLTFANKVAVSEYSREDYVGSQAVFSDLTFAELPQ
LANMNRDAAGVDIALRRAGDLVILEGRVDLTSLSDPDADVSLSVSFPGEV
TSTNGDQVSAEIVEWKLRPGVVTTMNAQARYTDPSARSFTGAAIWLAVGS
FVVAGIIGGLAYYNRDQSPRIGERRGDAPL
375141594YP_005002243.1 geranylgeranyl pyrophosphate synthase [Mycobacterium rhodesiae NBB3MHSGASRAQGKGRPLSVYAAAPSAVELTKAVTEQLRAYLAERRSDCAYMG
DDYGELTAALEEFVLRGGKRLRPAFAYWGWRAVADSPGAKDEEQALRLFS
ALELLHACALVHDDVIDASATRRGLPTVHRLFSEKHRTHDWHGRSDQFGI
SAAILLGDLALVWADDIVATVDLPIDAHRRVHRIWGAIRTEVLGGQYLDI
VAEASGAESVASAMKVNVYKTASYTISRPLQLGAAAAADRPDVEALFHEV
GNSLGVAFQLRDDVLGVFGDPAVTGKPSGDDLRSGKRTVLLAEAVELAEK
QDPMGAKLLRTSIGTELTEAQVKDLCLVIESVGALAAVEDRIDQLTRQAL
AILAAAPIDGQAKAGLSELARLAANRSA
375141593YP_005002242.1 carotene biosynthesis associated membrane protein [Mycobacterium rhMAQRISQFAAFATSPEAKPARLGAVGAVLITAGGLGAGSTRLHDPLLESL
HLSWLRFGHGLVLSSILLWVGVALMLLAWLRLGRSVIDRTATEYTMKATT
GFWLTPLLLSVPVFSRDTYSYLAQGALLRDGFDPYVVGPIDNPNSLLENV
SPIWTTTTAPYGPAFILVAKFVTLLVGDDVVAGTMLLRLCMLPGLALLIW
AAPRVARHVGANGAAALWICVLNPLVIIHLMGGVHNEMLMVGLMMAAIAL
TFSGHHFWGVSLIAVAVAVKATAGLALPFMVWVWTRDLRQRRGFRPIKAF
AAATAASALIFVAVFAVLSLAAGVGLGWLTALAGSVKIINWLTLPTAASN
VINVVGGLFMTVNFYAVLDVARIIGIAVIGISLPLLWWRFRHTDREALVG
IALVMGVVVLFVPAALPWYYTWPLAVVSALAQSRQSIALIAGLSTWITVI
WKPDGAHGMYSWPHVLLAIACAVGAWYSLYKTPVNKLAPGPDVPPHGPGE
SAARQPAGH
375141592YP_005002241.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSSIPAADDVIDPGEDVYDLPAVADLLGVPVTKVHQHLRQGHLIGVRRDG
AVVVPKIFFDDTGHVVKGLHGLLVVLHDGGYHETEIIRWLFTPDSSLTIS
RDGASDKQANARPVDALHSHQAREVVRRAQALAY
375141591YP_005002240.1 serine/threonine protein kinase [Mycobacterium rhodesiae NBB3]MCFVEPYQQSAPLVGTVLDGRYRVDTMIATGGTSSVYRGLDLRLDRPVAL
KVMESRYAGDQQFLTRFQREARAVARLNDPGLVAVYDQGIDGRHPFLVME
LIEGGTLRELLRERGPMPPHAVAAVLGPVLGGLAVAHAAGLVHRDIKPEN
VLISDRGEVKIADFGLVRAVAEAKITSTSVILGTAAYLSPEQVSTGDADP
RSDVYSVGILAYELLTGTTPFTGDTALTVAYRRIDHDVPAPGSVITGVPR
QFDEFVMHATVRDPAGRYTDAREMADDLHAIVEELGLPAFRVPAPANSAQ
HAAALTTATTARKPPPVPQHTREITRDDIPPSEPEYQPVSGQFGGVDIDE
FYWARQRAKRALVFWVIAVITLTGLVAAGAWTLGGNIVAIL
375141590YP_005002239.1 3-deoxy-7-phosphoheptulonate synthase- class II [Mycobacterium rhodMNWTVDVPIDQLPPLPPLPDELRHRLDSALAKPAAQQPSWDADQAKAMRT
VLESVPPVTVASEVERLKGLLADVARGEAFLLQGGDCAETFADNTEPHIR
GNIRTLLQMAVVLTYGASMPVIKVARIAGQYAKPRSSDTDALGLKSYRGD
MINAFAPDAAAREHDPSRLVRAYANASAAMNLTRALTAGGLASLDLVHDW
NREFVRTSPAGARYEALAGEIDRGLRFMNACGVNDPNLQTAEIYASHEAL
VLDYERAMLRLAENSAGETALFNLSAHYVWVGERTRQLDGAHIAFAEVIA
NPIGVKLGPTMTPELAVEYVERLDPNNEPGRLTLVTRFGNNKIRDLLPPI
IEKVQATGHQVIWQCDPMHGNTHEASTGYKTRHFDRIVDEVQGFFEVHRA
LGTHPGGIHVEITGENVTECLGGAQDISDSDLAGRYETTCDPRLNTQQSL
ELAFLVAEMLRD
375141589YP_005002238.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKYFYDTEFIDNGRTIELISIGVAAEDGREYYAISTEFDPERAGSWVRKH
VLPKLPSPSSQLWRSRRRIRSDLEDFFGIDGDEPIELWAWVGAYDHVVLC
QLWGPMTDLPPAIPRFTRELRQFWEERGSPRMPPRPRDAHDALVDARHNL
MRFQLMTGEVPV
375141588YP_005002237.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDEGFDLDFAIPHGRMPLVFCLVAFILTFFVTRTIVRYIRSHANSDAPRK
WWQPRNISAGGGLHIHHVVIGVILVMISGVSMVTLSVNGGVPEFTVAATF
FGIGAALVLDEFALILHLQDVYWAEDGRTSVDAVFAAVAVAGLLVLGFNP
LSFFDVDIWQNDHSVAARASVIILAAFTLMLAVVVLLKGKVWTGLVGMFI
TPLLFIGAIRLSRPHAPWARWRYGDRPRKMHRALIRERRLRRPVVQAKLW
LQHVVAGEPHFPDDSEVNSELDREIHAAPQPERTAARV
375141587YP_005002236.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLAWRLFQLLTVAALVWAGWRLLGHTPYRIDIDVYRMGGQAWLDGRPLYA
DGVMFRTRGGLDLPFTYPPLAAVAFAPFALLSLDVASIAITLTTLILLIV
ATTILLTRLDVWPDPAAGRSLATAEPAWLRRTWLAAAIVAPAVIFFEPVR
SNFDFGQINVVLMTLVIADCVPRKTPWPRGMLVGLAIALKLTPAVFLLYF
LLRRDTRALIVAAASTAIATLAGFAFAWRDSLEYWTETVRNTDRIGTATL
NTNQNIAGALARLGLGEEVRFVLWTVACFGVLGLTVWAARRALKAQQPVL
ALICVAMFGLVVSPVSWSHHWVWVVPTVVVTSIVAYRQRHAALGVVSAAG
IALMIWTPIPLMPEHQETSASLWRQLAGGSYVWWAMVVIVVAGTVTLRPA
TRSAAAIDEARVPAVN
375141586YP_005002235.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium rhodeMWYWLFKYIFMGPLLTLLGRPKVEGLEYIPRSGPMILASNHLAVADSFYK
PLVVSRRITFLAKSEYFTGTGIKGWFQRWFYTAAGQVPIDRSDADSAQAA
LTTAARVLGEGKLLGMYPEGTRSPDGRLYKGKTGLARLALETGVPVIPVA
MIGTDSVNPPGSKMWRFGRVTVKFGKPMDFSRFEGLAGNRFIERAVIDEV
MYELMRLSGQEYVDLYAADVKDGNAELAAKPSARMPEVAAG
375141585YP_005002234.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNGEHSDLGPELRQLAQTILDRLDPALRMAAARASAGSSPGKCQQVWCPV
CALAALASGEQHPLLTVIADHSVALLTVVRAILEQSENTAQTAQERSADD
QPPDGPPPPPPPDGGQPPPPPGPSRYQHIPVTVEE
375141584YP_005002233.1 arsenite-activated ATPase ArsA [Mycobacterium rhodesiae NBB3]MNPSPPAARISLFVGKGGVGKSTLATANAVRDARAGMRVLIVSTDQAHSI
GDVLGTSITPTGRREPTRVFAELESGRDAEGGFLDALAIDTLALLEARWR
DIVGLLAGKFPESDVGTIAPEELSALPGIQEVLGLHEVGELAASGEWDHV
VVDCASTADALRMLTLPATFALYLERAWPRHRRLSSVDDARSAAVVGLLE
RIGAGTGRLSELLTDGSVLSAHLVMTAERVVAAEAARTLGSLALMGVRVE
ELIVNQILVQDDSFEYRNLPEHPAFDWYSERICEQRAVLDDLDSLIGDVQ
LVLVPHLAGEPIGVKALGELLDAARRRDGSPPPGPLKPIVDRESGSGLEA
VYRMRLELPQVDSSALSLGRVDDDLIIGAGGMRRRVRLASVLRRCIVMDA
QLRGTELTVRFRPNPEVWPK
375141583YP_005002232.1 oligoketide cyclase/lipid transport protein [Mycobacterium rhodesiaMGKSEVADKTAQTIHIEADPSTVMGVIADIASYPEWVNEYQDCEVLEADP
EGYPKTARLVLDAAVLKDTMVLAYDWREVDRGSVEWTLVSSSLLKSLNGA
YRLSPKGSGTDVTYELSVDLIIPMIGLLKRKAERRLTDTALKDLKKRAEA
E
375141582YP_005002231.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MNSIQIADETFISADPVEVGMAVGDPASWRRWWPDLRLTVVEDRGEVGHR
WTVTGALTGTMEVWLQPVLDGVILHYFLHAEPSGVAAWQLAKMNLTKMNH
QRRVAGKEMAFEVKRRLEATRPIGVSRLA
375141581YP_005002230.1 AMP-forming long-chain acyl-CoA synthetase [Mycobacterium rhodesiaeMIVREFSVPASFTVGEHDNVVSSVFSHERDDPDHVIFQRLVDGVWTDVTC
KEAAEQIRSTALGLIAEGVAPGDRVAILSATRYEWVILDYAILAIGAVTV
PIYETSSPDQVRWVLEDSGAVLAFVEIEAHALMVDALLAELPSLRKVAVI
ESATSSALDALAEAGASVDRKLLEERLAGIRAANPATLIYTSGTTGRPKG
CQLTHSNLLYETRGAAASFPSLLRKGERLLVFLPLAHVLARALSMTAFAN
GVTIGYTSDIKNLVPMFGLFKPTVIVSVPRVFEKVYNTAELNAQDSGKGA
IFAKAVETAIAWSQAQDSGGPGLMLRAKHAVFDRLVYGKLRAATGGDCRA
SISGGAPLGARLGHFYRGIGLTIYEGYGLTETSAAITANRIGELKIGTVG
KLLPGNSMAVANDGELLVKGGVVFEGYWRNEAATSESIVNGWFHTGDLGS
IDDDGFLSIVGRKKEIIVTAGGKNVAPAVLEDQLRAHPLISQAMAVGDAK
PFIAALIAIDPEAFDVWKAHHGKNAAASVQDLTDDPDLVAEIDLAVKNAN
RAVSKAEAIRKFAILPVDFTVLTGELTPTLKVKRKVVAEKFASEIENLYV
KN
375141580YP_005002229.1 glycosyltransferase [Mycobacterium rhodesiae NBB3]MSRVLLVSNDFPPRRGGIQSYLQELVNHLVDGGGHTLTVYAPKWKGSDEF
DHAASYEVVRHPTTLMLPEPSVAGRMRRLVEHHNAETVWFGAAAPLALMA
PLARDAGADRVIASTHGHEVGWSMLPVARTALRRIGSSTDAVTYISRYTR
RRFASAFGPHAALEHLPAGVDTERFAPDEVARAELRARYRLGDRPVVACV
SRLVPRKGQDMLIRALPAIRQRVPDAALVIVGGGPYRTSLHKLAHSFGVS
EDVVFTDGVPGDELPAHHAMADVFAMPCRTRGAGLDVEGLGIVYLEASAS
GVPVVAGRSGGAPETVLDDETGVVVDGWDVGAIAATVADLLADPDRAARM
GAAGRRWVVDNWQWKTQAARLAGLL
375141579YP_005002228.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTIEGPRSRAKSRTTLAALLIAELVCALLFVGRAGPAPAGPQIAAPASLT
TPTSRSTTQTLRDGRTVRLIGLGDRTAPLLRRISAQLDDAADAVTAFWGP
NWPRAIAVVAAGTDAQFAAVGGGDTHTAATATGERIMFAPGAAEMDDPSL
RIVLRHELFHYAARAATAVDAPRWLTEGVADFVARPPIPLSANADATIAR
GLPTDAELDGPQRSSAYDRAWWFTRFVADTYGIAALRDLYIRACGHGHPD
LAFAMQQSLGGDPAEVLAAWRRWAKG
375141578YP_005002227.1 cell wall-associated hydrolase- invasion-associated protein [MycobaMRLHSRRLLTHVLKRPAVGVLAGIVLFGGILASTVQADPADDALAKLNEL
SRQAEQTTEAMHSAQLDLDKKVAAQQAAEAKHAADASALDSAREQLATFQ
NQVDKIAASQYMGGRPDGLNALLTASSPQGLIDQMSIQRVMAASISSQMK
SFKEAGAQAAVAEEASAKSAAEAKTAAEQAAAVRADLQSKQSKLQVDMAI
VKSQYEALTPNQREALAALPPGPPPPPPPAPLPPGDPAILAMAPPGIGGP
PAGAVVPPPGIPPGDMAPAPAGGHSPTVIQAALSRIGSPYSWGGSGPNAF
DCSGLVMWSFQQAGISLPHSSQALANGGSPVSMDQIQPGDVINYYSDASH
TAIYIGNGMMVHASTYGTPVRVAPMDNAPIYNIRRY
375141577YP_005002226.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTHDERPDTGTVTIDCDDCAVRGPGCQDCVVSVLLGAPESLLDDERRALE
VLADVGLAPRLRLVPIHRGNNSGVA
375141576YP_005002225.1 exonuclease- DNA polymerase III- epsilon subunit family [MycobacterMAPPSLPVFVGPVPYRQRMGQLSFADVDPLADVALRETTFVVVDLETTGG
RASGDNHDAITEIGAVKVRGGEVLGEFATLVDPGRSIPPQIVSLTGITTA
MVCDAPRIESVLPAFLEFSRGAVLVAHNAGFDIGFLRAAAERAHITWSRP
PVLCTVRLARRVLTRDEAPSVRLSALARLFNASTTPTHRALDDARATVDV
LHGLIERVGNQGVHTYTELRSYLPDVSPAQRRNRHLATHLPRRPGVYLFR
GPASEVLYVGTAVDLRRRVSQYFNGADPRTRIKEMASLAIAVDHVECAHD
LEAGVRELRLLAAHAPPYNRRSKFPHRWWWVVLTDEAFPRFSVVRSPKHE
CVLGPFRSRADAVQTAALLARFTGVRTCTTRLGRSASHGPKCPEREVSPC
PAAHGFSAADYAHTPRRARDLIEGIDSRALADVLAHITDLAERARYETAA
RLRDHATVAIDTLWRGQRLRALADVGEMVAARPDGAGGWHLAVIRHGQLA
AAGNAQRGVPPMPVVDAICAGAQAILPNQAPLGGALVEETALIARWLARP
GVRIVRADSGYASPAGSAGRFAAWSASARSARIAAEQLAEADSELLTEPH
PTREQLFGGAGVDGLGRLGQTSLPRGNPLGVAG
375141575YP_005002224.1 anthranilate phosphoribosyltransferase [Mycobacterium rhodesiae NBBMTSGDSPTWPQVLGRLTTGQALAPGQAGWAMDQIMTGAATPAQIAAFGVS
MRMKRPTPAEVTELADTMLKHARRVPTETIGNDTVDVVGTGGDGANTVNL
STMAAIVVAAAGVPVIKHGNRAASSLSGGADTLEALGVRIDLSPDDVARS
VAEVGIGFCFAPQFHPSYRHAGVVRREIGVPTVFNLLGPLTNPASPRAGL
IGCAWADLAEVMAGVFATRGSSVLVVHGDDGLDELTTTTTSTIWRVQAGT
VERLTFDPGAFGFARAELSELVGGDAEANAASVRAVLGGATGPVRDAVVL
NAAGAMVAHAGLASDAKWVPAWQAGLAKAAETIDSGAAEKLLARWVGFGK
KL
375141574YP_005002223.1 heme/copper-type cytochrome/quinol oxidase- subunit 3 [MycobacteriuMTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTA
RSQAGGNWPPEPTELNLVQAVPVTAVLIASSFTCQMGVFAAERGDVFGLR
RWYVITFLMGLFFVLGQGYEYFHLVQHGTTLSSSAYGSVFYLATGFHGLH
VIGGLVAFIFLLARTTMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY
FVR
375141573YP_005002222.1 cytochrome c- mono- and diheme variants family [Mycobacterium rhodeMTVKATGTGKPSIVKRRRLRRRLSAAMLLLVGLGIAGGVAATLTPTPQVA
VADESQSALLRTGKQLFDTSCITCHGANLQGVADRGPSLLGVGEAAVYFQ
VSTGRMPAMRGEAQAPQKPPQFDEAQIDALGAYVQANGGGPVVPRDENGQ
IANESLLGNDVARGGDLFRLNCSSCHNFTGKGGALSSGKYAPELSGANPA
QIYTAMLTGPQNMPKFSDRQLTPEEKRDIVAYVRMASTAPDPGGYGLGGF
GPTSEGMAAWIIGIVAVVIAALWIGARA
375141572YP_005002221.1 Rieske Fe-S protein [Mycobacterium rhodesiae NBB3]MSDGDIKGSDTPGQKGEPGQPTDAELANMSREELLELGGKIDGVEIVYKD
ERWPIPGTKAEKRAERLVALWLLIGGLSGLALLGVFLFWPWEYRSGSEPD
HLWYDLATPLYGLTFGLSILAIGIGAVLYQKKFIPEEISIQERHDGASPE
LQRKTVVANLSDALESSTIKRRKLIGLSLGVGMGAFGLGTLVAFAGGLIK
NPWKPVVQTADGKKAVLWTSGWTPRFKGETIYLARATGNGTYAKMRPEDI
DAGGMETVFPWRESDGDGTTVESHHRLSEITMGVRNPVMLIRIKPVDLPR
VVKRKNQESFNFGDLFAFTKVCSHLGCPSSLYEQQTYRILCPCHQSQFDA
LHFAKPIFGPAARALAQLPITIDKDGYLVANGDFIQPVGPAFWEQTN
375141571YP_005002220.1 cytochrome b subunit of the bc complex [Mycobacterium rhodesiae NBBMAQIAAGQGNAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIAMYSFIVLL
LTGVYLSLFFDPSMAEIVYDGVYQPLRGIEMSKAYASTLDISFEVRGGLF
VRQVHHWAALLFAAAIMVHLARIFFTGAFRRPREANWIIGSLLLILAMFE
GYFGYSLPDDLLSGIGLRAAMSSITLGMPVIGTWLHWALFGGDFPCGGVG
YQCSQDGYWLPRMYSLHILLIPGIILALIGIHLALVWFQKHTQFPGPGRT
ETNVVGVRVMPVFAVKSGAFFAMTVGILGLMGGLLQINPIWQLGPYKPSH
VSAGSQPDFYMMWTEGLARIFPAWELYFLGHTVPAPVWVALIMGLVFMLL
PAWPFLEKKFTGDDAHHNLLQRPRDAPVRTAIGAMAIALYMVLTLSAMND
VIALKFHISLNATTWIGRIGMIVVPAIVYYIAYRWAIGLQRSDRAVLEHG
IETGIIKRLPHGAYIELHQPLGPVDDHGHPLPLEYQGAAVPKRMNKLGFA
GAPGSGSFLRGDSLSENEQLVEAAHAAERKALTALREHQDRNGSSNGHTK
GSSNGHTNGHH
375141570YP_005002219.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSYTTDSVRVRQPLDPGEFDRTDRILLGACAAIWLAALGAGVAATVALVD
LGSSQSEPSGDSGTPWLLYIVIAISAAVIIGAVPLLIRARRDAMADPEPP
ARPAPGGVPGRRQESAQADATEKMRISGSTAGRIHSGPGYAAAVTHSTSL
PAPLVAAIDQVWLRCAVLIACAIGIAMVAIGVATYLMAVESDTASWVFFG
LSGLVTLAMPAIPWFYLRELRTLLDDQSA
375141569YP_005002218.1 mycobacterial membrane protein [Mycobacterium rhodesiae NBB3]MSGPNPPGSGVPEGADVPGQEPGGRPESSEPDTYSQAYSAPESEQFTSGP
YVPADSGLYDYDNYEPEHVVTTEPPRWPWVVGVVAIVAAIALVVSVSVLV
TRTDTSNLSKPETSTTTPPPVPPVQDEITTTTPPPPPPPPPPSEPPPPPE
TVTVTEEPAPAPAPPPPPPAEPPPPPPETAAPPPPPTTRAGPRQVTYSVT
GTKAPGDIITVTYIDASGRSRTQRNVYIPWSLTVTPISQSEVGSVQASSL
FLVSRLNCSITTSDGTVLSSNTNNSAQTAC
375141568YP_005002217.1 Cytochrome c oxidase subunit IV [Mycobacterium rhodesiae NBB3]MHIEARLFEFLTAFFVLAAVVYGVLTAMFQYGGIEWAGTTALVLTAGLTL
ITGTFFRFVARRLDTRPEDYEDAEISDGAGELGFFSPHSWWPVFIALSAS
VAAVGVALWLPWLIVAGVCFVLTTVGGLVFEYYTGPEKH
375141567YP_005002216.1 heme/copper-type cytochrome/quinol oxidase subunit 2 [MycobacteriumMTPRGVKVVALSVVLGSMTVLLSGCDWSEVLGLGWPRGITPEAHLNRELW
IGSVIASLVVGAIVWGLIFWTSAFHRHKKGDTELPRQFGYNMPLELVLTV
LPFLIISVLFYFTVVVQEKMLHKEPNPEVVIDVTAFQWNWKFGYQKVNYA
DGTFNYEGADAERKEAVASGPEGVEGEHGGEFGVIAGKNPEDRSYLNFDR
IETLGTSSEIPVLVVPSGKRIEFQIASADVIHGFWVPEFLFKRDVMPNPE
DNNSDNKFQISEINQNGAFVGRCTEMCGTYHSMMNFELRVVSPNDFKAYL
EQRQDGATNAEALQAIDQDPLAVTTKPFDSRRGEQAPQLTQASK
375141566YP_005002215.1 asparagine synthase [Mycobacterium rhodesiae NBB3]MCGLLALVTDPSAEVSQDLVDAVSGASHLMRHRGPDEPGTWADNAAHPTT
VLGFNRLSIIDIAHSHQPLRWGPPESPDRYVLVFNGEIYNYLELREQLRG
EHGAVFATEGDSEAIVVAYHYWGTEALTRLRGMFAFALWDTVEGELFCAR
DPFGIKPLYMATGNGGTVFGSEKKCLLDLAGVVGIDLGIDERATQHYTVL
QYVPEPETLHRGIRRLESGSYARVRPGQPPRVTRYFTPRFAAVGFTTGGE
RARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAMRHNPRLI
TFTTGFEREGYSEVDVAVASAEAIGARHVTKVVSQAEFVAALPEIVWYLD
EPVADPALVPLFFIAREARKHVKVVLSGEGADELFGGYTIYREPLSLKPF
DYLPRPVRKSLGKASRPLPEGMRGKSLLHRGSQTLQERYYGNARSFSDEQ
LRAVLPGFRQEWTHTDVTAAVYAASDGWDPVARMQHIDLFTWLRGDILVK
ADKMTMANSLELRVPFLDPEVFAVASRLPLEQKITRTTTKFALRRALEPI
VPAHVLNRPKLGFPVPIRHWLQAGELQDWAYRMVAESQAGHLIDLNAVTR
MLDEHRSGTSDHSRRLWTVLIFMLWHAIFVEHTVTPQISEPTYPVQL
375141565YP_005002214.1 sugar kinase [Mycobacterium rhodesiae NBB3]MTIAVTGSIATDHLMRFPGKFSEQLLPEHLQKVSLSFLVDDLVVHRGGVA
GNMAFAIGVLGGDVALVGAVGKDFDDYRSWLEAVGVDTDSVLVSDSAYTA
RFVCTTDEAMAQIASFYPGAMSEARNISLADVVKRVGTPELVIVGANDPE
AMFLHTEECRKLGLAFAADPSQQLARLSGEEIRKLIDGATYLFTNDYEWD
LLLQKSGWSEAQVMSQIGMRITTLGPKGVDLVGAGGTFTHVDVVPEKRQA
DPTGIGDAFRAGFLTGRSAGLSDERSAQLASLVAVLVFEAPGPQEWTWDR
EEAVARLTDAYGAEAGAEISEALGADR
375141564YP_005002213.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPGPYPPEYGAGPGGPQMYPTTGPQWFPQQQNPEPYPDNPPSAYPGMLPP
PVQYPKRRRWPLVLGALLVVAVVAVVVSIVLATRGGDQASASGALSDASA
KTAIQEYLDAMTNGDDETVARHTLCGLFDAVREKRSDLALAGLASDAFRQ
QYGRAEVTSIDKIVMWSPHQAQVLFTMKVEPKGSRRNEPRAQGEQQGVAQ
LLTQGNEVLVCSYLPRTAGQY
375141563YP_005002212.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGQGEAAAATVAVAAASFDQMSVVVVSSVSCRRVVSLICAGWLPQDRDFE
SELAAI
375141562YP_005002211.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLPDNVIAHRTDADHSKTLAVTTEFVIWTPWAGYSPSSTANDQHQPASSL
ATAMLATTDRFLR
375141561YP_005002210.1 transposase [Mycobacterium rhodesiae NBB3]MVGQRTSVGLDVHARSVVACGLDRETGEVVERRLTPEHREILDWIGDLPG
PVAVTYEAGPTGFCLARALDAAGVECQVAAPSKLIRPAGDRVKTDARDAA
HLARLLHLGQITAVAIPSADQEAARDLVRAREDCRGDLMAARHRLSKLLL
RQGIVYYGGATWTSRHELWLRQQRFDNRALQLTYDATFDAMTACVDRRER
LEAAIEEMAADSEFTAVVRRLGCLRGIATLTAFGLATEIGDWHRLTGRTI
GAYLGLVPSEFSSGGSRVQGEVTKTGNKHVRRLLVEAAWHHRSPYRPGAV
LRRRWDLACPAARARGQAANRRLHQRWANFDQRKKRSVVANIAVARELAG
WCWSLAVLDGE
375141560YP_005002209.1 Iron-sulfur cluster assembly accessory protein [Mycobacterium rhodeMTVQGESATGTATHGAKLTDAAAAKAKALLDQEGRDDLALRIAVQPGGCA
GLRYNLFFDDRSLDGDVTAEFGGVSLTIDRMSAPYVEGAVIDFVDTIEKQ
GFTIDNPNATGSCACGDSFN
375141559YP_005002208.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MCGVLRQRYLVPALFPSLSTEALPCTSASGSNLTGVNLLGRKKDNSPTPE
PDVSEDTIDSGSNGDAKASGPTAPKGRPTPKRSEASRKRGPVAPAPMTTA
EARKRRKEMRTKLSREERKAEKVTRRADMAERREKMMAGDDAYLLPRDKG
PVRRYVRDIVDSRRNVLGLFMPAALALIFVMLSVPSVQVQQLISPAMLVL
VLIMVIDGFILGRKVNRLADAKFPDNTESGWKLGFYAASRASQLRRMRAP
RPQVERGASVG
375141558YP_005002207.1 adenosyl cobinamide kinase [Mycobacterium rhodesiae NBB3]MLGGIRSGKSQWAESAIAGSVDGSAAVRYLATGPLPEGDVEWSARVEAHR
RRRPATWSTVESVDVAAQLRSDDPPATVVDDVGGWLTAAMDRNGAWTGGS
VSADIDDLVDAVGSFGSYLALVSPEVGLTVVPATESGRRFADELGSLNQR
LAAVCDRVVLVVAGQPVTVKDSLS
375141557YP_005002206.1 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferMTGFDAVTAPDADVAARARARQDRLTKPSGSLGRLEDLAVWVSSCQGVCP
PRQFERARVVVFAGDHGVAAAGVSAYPAEVTAAMVANFDAGGAAINVLAE
AAGATVRVVDIAVDAAEPLTPSIGAHKVRRGSGNIAVEDALTDEEVAAAL
DAGRRIADDEIDSGADILIAGDMGIGNTTPATTLIAALTDSEPVAVVGRG
TGIDDAGWARKTAAIRDALFRTRALAGDPVALLRVCGGADLAAMAGFCAQ
AAVRRTPLLLDGVVVTAAALVAEKLAPGARQWWQAGHRSTEPAHAQALQQ
LDLEPIVDLRMRLGEGTGAAVALPVVRAAVATLSSMATFAEAGISQAPEK
Q
375141556YP_005002205.1 cobalamin-5-phosphate synthase [Mycobacterium rhodesiae NBB3]MIRSVAGALAFGTVVPVRSAAPFGRGALTALPLVGVALGAAAAATLMASE
WAFGRSNPLGGVLAVAVLLVGTRGLHADGLSDTADGLGCYGPPARALEVM
RDGSAGPFGVATLVVVLLAQALAFTTCGAEGVIVAVTAGRVAAVLACRRS
VPAAAGSSLGARVAGSQPIAVAGLWVVVVAAAATMAGPRPWQGPLAVLVA
LACGAALVAHCVRRFGGITGDVLGAAVEITTTVAAVGLAIVPRI
375141555YP_005002204.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPTFRHLTAVIAAAAAASSLGVAALVSAGMAGATTTDDMFVSVLADQGIQ
PPSTKEAVSLAADVCKMFDKGQSLYDAVGSVSTTTDLTTDDSAFFVGAAV
ATYCPEHDAALG
375141554YP_005002203.1 branched-chain amino acid aminotransferase- group II [MycobacteriumMTDTGLEFTVERNANPASDEVRASILANPGFGQFHTDHMVSIDYVEGKGW
HDARVVPYGPIELDPSAIVLHYAQEIFEGLKAYRWADGSIVSFRPESNAR
RLRTSAQRLAIPELPEELFIESLRQLIAVDQQWVPSPGGEESLYLRPFVI
ATEPGLGVRPASEYRYLVIASPAGAYFKGGIKPVSVWLSTEYVRACPGGT
GAAKFGGNYAASLLAQAQAIEHDCDQVVWLDAAERRYVEEMGGMNLFFVF
GSGGSARLVTPELSGSILPGVTRDSLLQLASDAGFTVEERKIDVDEWQKQ
AAAGEITEVFACGTAAVITPVAHVKHADGEFTISDGGPGEITMALRDTLT
GIQRGTFADTHGWMARLS
375141553YP_005002202.1 glycine cleavage system T protein [Mycobacterium rhodesiae NBB3]MSEVLQGPLEERHRQLGASFAEFGGWLMPVSYAGTVSEHTATRNAVGLFD
VSHLGKALVRGPGAAEYINSALTNDLRRIGPGKAQYTLCCTDSGGVIDDL
IAYYVSDDEIFLVPNAANTAAVVAALADRAPAGLTITDEHRSFAVLAVQG
PKSADVVGALGLSTDMDYMGYVDGEFGGVPVRVCRTGYTGEHGYELLPPW
DQAHVVFDALVDAVGAAGGELAGLGARDTLRTEMGYPLYGHELSLELSPL
QARCGWAIGWKKDAFWGRDALLAEKEAGPQRLLRGLKAVGRGVLRPDLTV
LDGDTPVGVTTSGTFSPTLKVGIALALLDTSADIADGQHVSVDVRGRKLE
CEVVKPPFVDAKTR
375141552YP_005002201.1 family 3 adenylate cyclase [Mycobacterium rhodesiae NBB3]MVDFEALEAAGIANARARAGLIDYLDKLGFTADDMVEAERRGRLFGLAGD
ALQGPGRPTYSLRTAADALGVSLDELATAWTALGLTIASPDALALSQRDV
DGLATWVAIKGLVGDGPALAFLRILGNAMARVAEAGGTMVRMAQPDLLMA
ISGDELTTAMAYRGITEITQTFGVLIDAVFRQHIISARAHFEGVITDASA
NITCGVGFADLTGFTQLTQVMDPTDLFDLLTEFGGSVSDMVHADGGRVVK
FIGDEVMWVTSTPELLVKVAMDLVEHPRARETGLQVRAGLAYGSLLGIGG
DYFGTPVNLAARLVAAAAPGQILASTDVRDRLPEWPAIPQEPLILKGFDD
PVPAYDLHLSR
375141551YP_005002200.1 leucyl aminopeptidase [Mycobacterium rhodesiae NBB3]MSPASTGFQVPTVTVSSSLPKRKVDDAVLIVAVVSGTDEDSRATVVSNPF
LDAEGVGEIEVALEALGAKGGSEQVTRVVAPSLPVASVLAVGLGKNRDAW
PADAIRRAAGVAARSLNGTETVITTLSDIDVSAAIEGLILGAYRFSDFRS
EKTAPKDNGLRSITALTADTKSKTKDAAARATDIAAAVATARDFVNTPPS
HLFPAEFAKRAEALGKAAGLEVEVVDDKALAKDGYGGIVGVGKGSSRPPR
LVRLSHRGGKGRKPKKVALVGKGITFDTGGISIKPAANMHHMTSDMGGAA
AVIATVVLAARQKLPIDVVATVPMAENMPSATAQRPGDVLTQYGGITVEV
LNTDAEGRLILADAIVRACEDDPDYLIETSTLTGAQTVALGARTPGVMGS
DEFRDRVAERSQEVGENAWPMPLPEELKDDLKSTVADLANVSGSRYAGML
VAGTYLREFVADGVQWAHIDVAAPAYNTGGPWGYTGKGGTGVPTRTMFAV
LEDIAVNG
375141550YP_005002199.1 short-chain dehydrogenase [Mycobacterium rhodesiae NBB3]MRFVDSSGDVQIAVYEEGNPDGPTLVLVHGWPDSHVLWDGVVPLLADRFR
IVRYDNRGVGHSSAPKSTSEYRMSCYADDFAAVIDSAAPGEKVHVLAHDW
GSVGIWEYLSRSGASDHIASFTSISGPSADHMNRFIIGSLKRPYHPRRFL
RGLSQLLRLSYMIFFSIPVLAPVAVRLFIADGIKRALTLRDGIPADRLQH
SESYERDAASSIKVYGANYFRTLRSARKDHYVNVPVQVIVTTRDQFVRPF
IYDEINHWVPRLWRRDIKSGHWAPMSHAPMIAASVAEFVDHLEGKQTARG
LLRAQVGRRRDDFGDTLVSVTGAGSGIGRATALEFAKRGAEVVISDVNEA
GVKQTAATIAERGGVAHAYTLDVADADAVERFAEQICEEHGVPDIVVNNA
GVGHTGMFLDTPAVEYDRVLDINFGGVVNGCRSFGRRLVDRGTGGHIVNV
SSMAAYSPQQSMNAYSTSKAAVFMFGDCLRAELDQAGVGLTTICPGVIDT
DIVRTTRFDVPADKADRVDARRAQIEKAFAARRYGPEKVAKAIVSSVQKN
KAIRPVAPEAYVLYGVSRVLPQVMRSTARGKVL
375141549YP_005002198.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGLFDRFGRGGRKRKSGGSDPAADLKYLRQWVAEHHGVEAFVEPRTTVTD
LTVVLVAADGEWTRRRAGGDAGARRLSDRLNIPVYDVQKVGYPQRMRDFD
ARRRIERKRAAREELEER
375141548YP_005002197.1 2-oxoglutarate dehydrogenase- E2 component- dihydrolipoamide succinMAISVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPS
PAAGVLKKIVAQEDDTVEVGGELAVIGEEGESGGDDAGSDEKPDETSDEE
PAEEEKPAEEPAAQEEPAAEEQEDEPEPEPASEPESKPAAKSSGSATSVK
MPELGESVTEGTVTRWLKKVGDTVEVDEPLVEVSTDKVDTEIPSPVAGTL
VSITAEEDDTVEVGGELAKIGDADAASDDEPEPEPEPEPEPKEEPKEEKK
PEPKAEPNEEPKAEPKEEPKQEPKPEPKAEPKEEPKAEPKSEPAAQAPSG
DGSPYVTPLVRKLAAENDIDLASVKGTGVGGRIRKQDVVAAAEAKKAPAA
EPAAKAPSGGAAPKEAPAPAPALAHLRGTTQKANRIRQITAKKTRESLQA
TAQLTQTHEVDMTKIVALRARAKNDFAEREGVNLTYLPFIARAVIDALKT
HPNVNASYDEESKEITYYDAEHLGFAVDTEQGLLSPVVKNAGDLSLAGLA
RAIADIAERARSGDLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAML
GTGAIVKRPRVIVDSLGNESIGVRSVCYLPLTYDHRLIDGADAGRFVTTI
KRRLEEGAFEADLSL
375141547YP_005002196.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAVIAIAGSSGLIGSALVYALRATDRRVLRIVRRAPSSADEVFWNPDTG
EFDPSSLADVDAVVNLCGVNVGDKRWSGAFKQSLRDSRIGPTEVLSAAVV
DAGVPVLINASAVGYYGDTGSRVVDETAPAGGGFLSQLCQDWEAATAVAD
NDGARVVLLRTGLVLTEAGGVLGRLKRLFSLGLGARLGKGRQYMPWISLE
DQVRAVLFAITHDTLSGPVNLTGPAPVTNAEFTAAMGRAVNRPTPLMVPG
FALRAAFGEFADEGLLGGQRAIPAALERAGFEFHHNTIGEALAFATAPKA
G
375141546YP_005002195.1 lipoate-protein ligase B [Mycobacterium rhodesiae NBB3]MTPVSIRSVNTPIDVRRLGTVDYRQAWDLQRDVAEARIAGGPDTLLLLEH
PSVYTAGRRTLPEERPADDTPVIDTDRGGKITWHGPGQLVGYPVIGLAEP
LDVVNFVRRLEESLIKVCADLGLQTRRIEGRSGVWVAGSTGPARKVAAVG
IRVSRSTTLHGFALNCDCDLGAFSAIVPCGISDAGVTSLTAELGRRIGVE
DVAEPVADAVADALDGRLSVALTQ
375141545YP_005002194.1 lipoate synthase [Mycobacterium rhodesiae NBB3]MTVARGSNVAGHAAPGSNVAGHAAPEGRKLLRLEVRNAETPIERKPPWIK
TRAKMGPEYQELKALVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQ
CTRRCDFCQIDTGKPAELDRDEPRRVAESVQAMGLRYSTVTGVARDDLPD
GGAWLYAETVRAIKELNPNTGVELLIPDFNADPDLLAQVFASRPEVLAHN
VETVPRIFKRIRPGFRYERSLSVLTAARADGLVTKSNLILGMGETPDEVR
DALTDLHRAGCDLVTITQYLRPSVRHHPVERWVKPEEFVEHERFAAELGF
AGVLAGPLVRSSYRAGRLYVQAVASRASDPAVS
375141544YP_005002193.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAKTRNAAANKAAKAEAKAARKAASKERRSQLWQAFQIQRKEDKRLLPYM
IGAFVLIVAASVALGLFAGGFTTYLMIPLGVVFGALVAFIIFGRRAQKSV
YRKAEGQTGAAAWALDNLRGKWRVTPGVAATGHFDAVHRVIGRPGVIFVG
EGSATRVKPLLAQEKKRTARLVGDVPIYDIVIGNGDDQVPLAKLERHLNK
LPANITVKQMDSLESRLAALGTKIGPAAMPKGPLPTQAKMRGVQRTVRRK
375141543YP_005002192.1 putative TIM-barrel fold metal-dependent hydrolase [Mycobacterium rMCTACEWAPHFAAFGGKRRARLTRRTLLTAAAVTAGVAAANACSVQPGTG
ERETSAGADPDRADFVFRNGPIYTVSTAAPWAQALAVTGTTISYVGDEAG
AMALAGAQTRVIDLDGRLLMPGFVEGHIHPFLGAFLTTGVDLQVPTGADA
LAAIAKYAKENPDGPVRGFGWRVDMFGPNGPTRADLDKVLPDRPGFFFAI
DGHSLWANSKALEVAGVTRESEDPIPGFSYYVRDENGEPTGYVLEVNAVL
ALVNAIEPISPETMGTLMEAWLPKASAAGITSVFDAGVPPIGDDQGALIE
LYADTEAKGALPFRVVASYSVKSAPVDDAVAKLTDIRNRISTELIGVGAV
KVIGDGTQGGYTAWLIEPYADKPDSTGASPFTEEQWRRLVAEVDAAGFDV
HVHACGERTTRTALDAVERAIAANPPRDRRHTIAHLVYVQDPDNQRFGEL
GVVAQFSANWISADPDTVVNMAARYGRPRQDLMYRPQDVLKAGGRISFGT
DWPAAGYFSTYKPLDSIQLGVTRQLIGQPDAPVLAPADQRLSVAQAVHAN
TLGAAYQIRLDDKVGSLEQGKLADMIVLDRNILEVDPHDIHQATVMLTMM
NGQIRHEA
375141542YP_005002191.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLHRRQPHVAPKLRNAAATAADHWSRCPHILNSMARPLGSWLSGSAPGSY
PGPNDYPGQRLGLPESGPGSIAGFGRRIAALMIDWFIAYGLVGLVVALGL
MSQQNFLYTPMGSTSIAVVWVVLGIISVRLFGFTPGQLVLGLRVASIDNR
IHVGIGRATVRGILVFFVIPALFTDSDLRGYQDRFTNTAVVRR
375141541YP_005002190.1 glutamine synthetase- type I [Mycobacterium rhodesiae NBB3]MADKTADDVIKLIKDEEVEYVDIRFCDLPGVVQHFSIPASAFDESVFEDG
LAFDGSSVRGFQSIHESDMMLLPDPETARIDPFRAAKTVNLNFFVHDPFT
REAYSRDPRNVARKAENYLASTGIADTAYFGAEAEFYIFDSVSFDSKMNG
TFYEIDSEAGWWNSGEPFEADGSPNRGYKVRPKGGYFPVAPYDHYVDLRD
QITTNLQNAGFEIERGHHEVGTAGQAEINYKFNTLLHAADDLLLFKYIVK
NTAWAAGKTVTFMPKPLFGDNGSGMHAHQSLWKDGSPLFHDESGYAGLSD
IARHYIGGILHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSAA
VRIPITGNNPKAKRLEFRAPDSSGNPYLAFAAMMMAGLDGIKKKIEPQSP
VDKDLYELPPDEAASIPQAPTSLSAVIDKLEEDHEYLTEGGVFTEDLIET
WISYKRENEIMPVQIRPHPYEIALYYDV
375141540YP_005002189.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTNLDARLAGYHSPVLSLFRIVFGLLFTMHGTQKLFDWPIASPAPIEAG
SFPFWWAGLLELVLGILITLGLFTRIAAFIASGEMAFAYFYAHWPILKGD
ATQPFWPIANGGELAVLYCFGFLLLATTGAGVWAVDSRRRSRVGGVAPSR
VVTGTAAPAGYATGAPVRRGGLLSRFRRR
375141539YP_005002188.1 putative F420-dependent oxidoreductase- Rv2161c family [MycobacteriMKIYVSAAFLDTGEVVEIARAADDLGYDGLGIPDHVINLETLKTPYPYTK
DGKRRWEAFTDWPDPWVLIGALAMVTTRLRFVTTVYLPAMRDPYSAAKSI
GTAAVLAGGRLELGIGVGWCEEEFTLMGQQFARRGKRTDEMLELMKELWK
PGWTEFDGEFYQTPRLEMEPTPPHIPVFVGGLSDIALRRAARHDGWIGDL
ISTDQALIRVEKLREMRADKGLSMDGFTVITPLTDAFTPEHYERAQAGGI
DGIITMPWMFYSGPLATLDEKIDGMRKFRKDMALD
375141538YP_005002187.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSMDFGFDLISDEEYERQRALYGPLTQALRRLIEAGLHTEVDEDTVREAH
DRIEALTQLLESKQRAVTTTLRHEATGRPLAWANPAVGLRNAIAPPMVIH
HEDDGNCWSEFTLSGAYEGPPGWVHGGICALVLDHLLGEAASEGLTQPKF
TGTISLRYLRGTPLGPLRAEAFVERTEGVKTFARGYLKDAEGPTVEAEGV
FIRPAWARDAG
375141537YP_005002186.1 glutamine synthetase [Mycobacterium rhodesiae NBB3]MAKPATQRPKLPSVGRLGLVEPSAPADLNRLGWDTDAHVELLWSLSRAPD
ADTALATMVRLLDALGSGWGELNSELVSDRGLRGRLFGVLGSSLALGDHL
VAHPDSWRLLAGKVELPSAQNLRTQFAELAEKATGATDALQPLQTLYRDR
MLVLAGLDLASIVENEPVLPFTTVGEHLSDLADAALGAALTVAHKTVGDD
GSSRLAVIAMGKCGARELNYVSDVDVIFVAEDSKNNLATATRVAGEMMRF
AADAFFEVDAALRPEGKQGQLVRTLESHVAYYQRWAKTWEFQALMKARPA
VGDAELGKQYIDALMPMVWTACEREDFVSEVQAMRRRVVENVPAGVRTRE
IKLGKGGLRDVEFAVQLLQLVHGRNDESLHVASTVDALAALGAGGYIGRD
DTANLTASYEFLRLLEHRLQLQRLKRTHMLPEEDDEEAMRWLARAAHMRP
DGTHDALGVLREELKRQNMRVSRLHAKLFYQPLLESFGAFGIPDGMSSGA
AERQLAALGYEGPQSALTHLRALIGDSGRRGQVQRVLLPTLLDWLSDTPD
PDAGLLSYRRISEALADARWYLSTLRDEGAVAKRLMHVLGISAYVPELLM
RAPEVIQLYADGPDGPKLCDVEPEGVARALVASAGRHADPVRAIAAARTL
RRRELARIASADLLGMLEVTDVCRALTSVWVAVLQAALEAVIRDNTGDDG
APARIAVIGMGRLGGAELGYGSDADVMFVCEPNPGVEESVAVKWSVSVAE
KVRTLVGTPSADPPLEIDANLRPEGRNGPLVRTLASYEAYYQKYAQTWEV
QALLRAHRVAGDVDLGERFLLMIDKTRYPSGGVSQEAVQEIRRIKARVDA
ERLPRGADPNTHTKLGRGGLADIEWTVQLLQLRHAHKVPALHCTSTLEAL
NAIGAAELIAEADVELLRQAWLTATRARNALVLVRGKPTDQLPGPGRQLN
AVALAAGWDGDDGGEFLDNYLRVTRRAKAVVRKVFGG
375141536YP_005002185.1 glutamine synthetase- type I [Mycobacterium rhodesiae NBB3]MDRQKEFVLRTLEERDIRFVRLWFTDVLGYLKSVAIAPAELEGAFEEGIG
FDGSAIEGFARVSEADMVARPDPSTFQVLPWTSSAGDHHSARMFCDITMP
DGSPSWADSRHVLRRQLSKASDLGFSCYVHPEIEFFLLKPGDYDGSIPVP
ADNGGYFDQAVHDAAPNFRRHAIDALEQMGISVEFSHHEGAPGQQEIDLR
YADALSMADNVMTFRYVVKEVALGDGVRASFMPKPFSEHPGSAMHTHMSL
FEGETNAFHSPDDVLQLSDVAKSFIAGILEHANEISAVTNQWVNSYKRLV
HGGEAPTAASWGAANRSALVRVPMYTPRKASSRRVEVRSPDSACNPYLTF
AVLLAAGLRGIEKNYVLGPQAEDNVWNLTPEERRAMGYKELPGSLGVALS
EMENSELVAEALGEHVFDYFLRNKRAEWENYRSHVTPFELKTYLSL
375141535YP_005002184.1 acetyltransferase [Mycobacterium rhodesiae NBB3]MRLSIAAVTASDLGELLPMLRAYCDFYQVDPSDDRLLALATALIDDPDEG
VQLIARGDDAPLGFATIYWTWQTLYAARVGVLNDLYVNAAARGSGTGRKL
IERGLELCRERGAEKLVWETAPDNATAQRLYDGIGAAKSTWLSYELDA
375141534YP_005002183.1 alpha/beta hydrolase [Mycobacterium rhodesiae NBB3]MSLKIGVLLTTLLLLVAGCTKMVEGRGIVAVPPPGSPIEWGKCETTSSDG
EPAPADAECGKLSVPVDYAKPDGEVAQLAMVRFEATGDKIGSLIVNPGGP
GESGVDAAVSMVGMLPDSVRERFDLVGFDPRGVANSTPALWCNSDADNDR
LRADPQVDYTPEGVEHIEKETKDFVQRCVDKMGDEFLANIGTDNVVKDLD
AIREAVGDEKLTYLGYSYGTRIGGLYAEAYPDKVRAMILDGAVDPNADPT
EANIRQAKAFQTAFDDYAADCAANDAACPLGNDPKKAVDVYRSLVDPLVD
KPLKTRDPRGLSYSDAIVGTILPLYSPNLWRHLTQALTEMKDGEGDTMLA
LSDLYMGRDENGHYNNSTDVRVAVNCVDKPAVTDRAKVVEEDRRAREAAP
FMSYGEFTGHAPLATCAFWPVPPTTEPHEIKVDGLPPILVISTTNDPATP
YQAGVDLARQLGGSLLTFEGTQHTVAFQGDTCVDKIAAKYLIDVVVPPNG
ARCD
375141533YP_005002182.1 acyltransferase- WS/DGAT/MGAT [Mycobacterium rhodesiae NBB3]MDFLTVGPTTPTIGDMQRLSGLDASFLYLETAKQPLHVCSILELDTSTMP
GGYTFDRFRDAFDLRIKAMPQFREKLADSRFNLDHPVWVDDKDFDIDRHL
HRIGLPSPGGRRELAEICGHIASLPLDRSRPLWEKWVIENVEGTDPQEGG
RIVVMTKVHHAGVDGVSGANLMSQLCSTEADAPPPDPVDGPGDASSLEIA
VSGAVKYASRPLKLINTIPSTLSTVVDTARRAVGGNAMTAPFAAPKTPWN
TNVTGHRNVAFTQLDLDDVKTVKNHFGVKVNDVVMALVSGVLRKFLDDRG
ELPENSLVAMVPVSVHDKSDRPGRNQVSGMFSTLETSIDDPADRLKAIAA
ANSVAKQHSSAIGATLLQDWTQFAAPAVFGVAMRVYAASRLSGARPVHNL
VVSNVPGPQVPLYYLGCEVDAMYPLGPIFHGSGLNITVMSLQGTLNVGIV
SCPELVPDLWDMADDFKAALSELLSATKQATR
375141532YP_005002181.1 3-methyl-2-oxobutanoate hydroxymethyltransferase [Mycobacterium rhoMSEQTVYGAAEAKPRTSAELPAPRTKVRTHHLQKWKAEGHKWAMLTAYDF
STARIFDEAGIPVLLVGDSAANVIYGYDTTVPVTVDELIPLVRGVVRGAP
HALVVADLPFGSYESGPAQALATATRFMKETGAHAVKLEGGERVADQIAT
LTQAGIPVVAHIGFTPQSVNGLGGFRVQGRGDAAEQTVHDAIAVQEAGAI
AVVLEMVPAELATQITGKLTISTVGIGAGPNCDAQVLVWQDMAGMTSGKT
AKFVKRFADVGAELRSAATQYANEVASGTFPAEEHSF
375141531YP_005002180.1 enoyl-CoA hydratase/carnithine racemase [Mycobacterium rhodesiae NBMSDYETIKFEQTGPIARITLNRPDAANGMNDTMTRELADVARRCDTAATK
VVVLTGSGRFFCAGGDLKSFASAPDRGLHIKGVANDLHRAISSFSRMGAV
LIVAVNGTAAGAGFSIAVTGDLVLAAESASFTMAYTKVGLSPDGSSSYFL
PRLIGITKTKELMLTNRVLSAQVAAEWGLVTEVVPDEELAARADALAEKM
AATCSGSNETVKALMLSTFNSGLEEQMEFESRLIAERANSADGREGVDAF
MAKRKPKFS
375141530YP_005002179.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRTMGKSTSTYTEVERKFDIVESTVTPSFDGLSAVSRVERSPSQQLDAVY
FDTPGRDLAAHKVTLRRRTGGSDAGWHLKLPAGADARTEVREPLGGTDEA
EVPEALRDVVLAIVRDRPLAPVARISTSRTVDLLRAADGTALAEFCDDQV
SAQAGADGPQQQWREWELELTEAGSRDLLERLSHRLLDAGAVPAGHGSKL
ARVLESATDAQEPGRPEPPDDPIHRAVARHVEELLEWDRAVRADVYDSVH
QMRVTTRKIRSLLQSSEDAFGITDDAWILDELRQLAAVLGVARDAEVLAE
RYENALKELPEELVRGPIWERLVDGAKRQYSSGLRRSLIAMRSQRYFRLL
DALEALVAAEPPPPLPGEEGRGPVTVESAYKKVRKAAKAADQAEEDTEHD
EALHRIRKRAKRLRYTAAATGADDVASAAKSVQSLLGDHQDSVVSRGHLS
KVAQAAHAAGEDTFTYGLLYQQEDDLARRSSDELGAALKQLRKSVRKTL
375141529YP_005002178.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAYESSAARIASQLRTEILHGDVAPGSKLGQVALADRFGVSRIPVRDALA
LLAGEGLVQPLSNATAVVTGMSIEELQELYDLRLSIEPRTTEIAVPNVGR
ADILYMRKQLAIMASPIDARTWLAANTEFHAAVYRRANRPRTIELIEQLR
RLTDRYVFMHLQEVGTSGLINSEHEQILAAVERGDAAGTARLTSVHLANA
HDNILGYLLDHPAVLDPHAVFTP
375141528YP_005002177.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVEKVDTAAIADDLERARTDFHRVLQVVGDEEWTQPTSGTQWTNEQLLFH
MVFGYMVVRRLLVLVGLFSRSPRRVSRGFAALLNAGTPPFHRINYFGTCA
AALVYNRRRMGAKMDRVIDGLQRSLARRHENALRRSMHFPTGWDPYFRES
MTLADVYQYPGKHYEHHRRQLSVAKLK
375141527YP_005002176.1 protein-tyrosine-phosphatase [Mycobacterium rhodesiae NBB3]MKPTSRLAVLFVCVKNGGKSQMAAGLMRKLSSGSVHVEPIPGPVFERWET
DEPTDRGIGGIDRMRFVRDDIARRVTDLMARI
375141526YP_005002175.1 protein-tyrosine-phosphatase [Mycobacterium rhodesiae NBB3]MSDSPLSLAAHIRRELSIDQQLALTTAATRLQSEFDGTFGVATIERFLHS
SYDQFAGRATIANFLPLLAERFARQRLNALARVEGKVSDGKPTVLFLCTH
NAGRSQMALGYFTFLAGENGVAWSGGSEPGNEINPSAVQAMSEVGIDITG
EFPKPWTDEIVRAADVVVTMGCGDACPIFPGKRYENWDLPDPAGQGIDAV
RPIRDDIEERIRRLLADLGITPTR
375141525YP_005002174.1 arsenical-resistance protein [Mycobacterium rhodesiae NBB3]MTASVTSNNHMNVVEKLSILDRFLPVWIGIAMTAGLLLGRLVPGFNTALN
QVQVDGISLPIAIGLLVMMYPVLAKVRYDRLHTVTGDRKLLISSLLLNWV
LGPALMFTLAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAA
AVLVAFNSVFQVLMFAVLGWFYLSVLPGWLGLPQTTITTSPWQIAKSVLI
FLGVPLLAGYLSRQLGEKIRGRTWYESTFLPRVGPWALYGLLFTIVILFA
LQGNQITSRPLDVVRIAFPLLAYFAIMWVGGYLLGAALGLGYQRTTTLAF
TAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVALVYVSLALR
RRFAQPSPTTVIPTATKDSTHE
375141524YP_005002173.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MSKSELPLSEVDSCGYAPMVREPLSPEAAVDIAIKLKALADPVRLRLFSL
VASHSGGEACVCDISSDIDVSQPTVSHHLKVLKEAGLLSSERRASWVYYS
VVPQGLATLSAVLSVVADDELTARAGA
375141523YP_005002172.1 DNA-binding domain-containing protein [Mycobacterium rhodesiae NBB3MSQVPPARYLLRAKDLVDARYADPITVDDLAAAAGLSRAHFSRMFTRTFG
ESPRAYLQTRRLERAASLLRHTDRSVADICVMVGLQSVGSFTTSFSRVYG
MPPAAYRASMPPAAIYARVPSCILARDTRPPADSRVRKTAHGEKTSDGSR
P
375141522YP_005002171.1 lactoylglutathione lyase-like lyase [Mycobacterium rhodesiae NBB3]MIKIASAHLWVHDQDVALKFWTENVGMEVRQDVSLPDMDNTFRWLTVGPP
GQDDVSIVLMAVPGEPVMDAVTRKQVQELTAKGFAGTVFLTTEDIQSDYD
DMTARGVEFTEPPHQMPYGIDSGFRDPSGNSVRLTQLAPPPANTV
375141521YP_005002170.1 putative protein-S-isoprenylcysteine methyltransferase [MycobacteriMRTTSAALGSAAFFVVAPGTFVGLGPWLITGWEIPESSPPLRVVLGTVFI
VVGLIPPVHAFVQFARAGGTPMPLAPTERLVVTGFNRFVRNPMYVGLLTA
ILGQALLFDSPWLVIYAVIGWVATASFVHWYEEPTLVRTYGEQYEKYRRN
VPAWTPRLTPWRPA
375141520YP_005002169.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium rMDSAADALAPGLISHPGGAERLPDMSTRHCIIDSRLGELTVVADGDALTG
VYFRHHWHRPDQSSFRTLIDAHSDVLLAAIPHGATVTYGELANALADGTT
PQEVGQAVCRNGQLTGYAGGLKRKQFLLDFEEPADVVKAARLF
375141519YP_005002168.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MHQERVDSGDWDAITAELNDFGGALLPRLLTDAETDAIKRLYPDDRVFRS
TVDMRRYRFGEGEYRYFHQPYPEPIEALKQALYPRLLPIARDWWAKLGRE
SPWPDTLDDWLDMCHAARQQKSTAILLKYGIGDWNALHRDLYGELMFPLQ
VVINLSEPNVDHTGGEFLLVEQRPRAQSRGTSTLLPRGHGFAFTTRERPV
RSARGWSASPVRHGVSAVRSGQRFTLGLVFHNAT
375141518YP_005002167.1 methyltransferase family protein [Mycobacterium rhodesiae NBB3]MVWPFLKGDDMSTPDAKEHWEQHYGERERVWSGRVNARLAEVAPELPVGR
ALDLGCGEGADSVWLAERGWDVVGVDISDTALQRARSAAEARGVGDRIDF
QQHDLSQTFPDGEFDLVSAHFFHSTLPLDRTRIFVRAAEAVKPRGTMLIV
DHSGPPPGETKLDHHHHLFVRPEEVVAALDLPDAEWEPAQTRVVERVVTW
ADREPFTWHDNVIVLRRRSFG
375141517YP_005002166.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDNIWDCIIVGGGGSHAAAAVVQSLMADEYGLAVPEGRRHVNA
375141516YP_005002165.1 putative transcriptional regulator [Mycobacterium rhodesiae NBB3]MQANDQDSVDLRVRKRLRDLRMQRGLTLEEVASRSSIDVSTLSRLESGKR
RLALDHLPRLAAALLVSTDELLRAPEAEDPRVRANSHTRHGITYWPLTRQ
AAGGLHAYKIRIGARRRTPPAELPVHEGQEWMYVLSGQVRLILGERDFIV
KPGEAVEFSTWTPHWFGVLDGPAEAITIFGIHGERLHLHG
375141515YP_005002164.1 fructose-2-6-bisphosphatase [Mycobacterium rhodesiae NBB3]MKVIVEADGGSRGNPGPAGYGAVVWTVDRRTVLAERKQAIGHSTNNVAEY
SGLIAGLEEAATLGASEVEVNMDSKLVVEQMSGRWKVKHPDMVPLHQQAT
ALSTRFDRVTYTWVPREKNSHADRLANEAMDAAAELDTPPTEVAEEQRPN
PAGWTGARGAPTRFLLLRHGQTELSVERRYSGRGNPALTDLGRRQAEAAA
QFVAEKGGIGAVITSPLQRAYDTAEAAAKALGLDVSVDADLIETDFGDWE
GLTFGEAAERDPQLHKRWLRNTSVAPPNGESFDVAAERVGRARARIIAEH
PGETVLVVSHVTPIKTLLRIALDAGASILYRLHLDLASLSIAEFYPDGAA
SVRLVNQTAYLA
375141514YP_005002163.1 Zn-ribbon protein- possibly nucleic acid-binding protein [MycobacteMKAEVIQQRSLLELAELDAERARIEHRAGHLVELQRLEEIQAMHREANDR
LAALQIALEDLDEQVRKFEAEIDAVRQREDRDRGLLDSGATDAKQLTELQ
HELETLERRQSSLEDSLLEVMERREELQTEQAAELTKIDELQRDLGEAQQ
AYDDARSELDQLREQSLSRRDELVAGLDPDLVALYERQRTGGGAGAGLLQ
GGRCGACRIEIDRGELARISAAAEDDVLRCPECGAILLRVKGSGK
375141513YP_005002162.1 dinuclear metal center protein- YbgI/SA1388 family [Mycobacterium rMSAHLSDVIDVLEAAYPPRLAQDWDSVGLVCGDPSETVGNVTVAVDATAA
VVNEVPDGGLLLAHHPLLLRGVDTVAADTAKGALLHRMIRSGRALFTAHT
NADAASPGVSDALAAALGLTVEEVLEPIPTGIGLDKWVVFVPAENTDAVR
EAMFAAGAGRIGDYSHCSWSATGIGQFLPHDGAAPAIGTIGTVERVPEER
VEMIAPSRVRGHLLASMRTAHPYEEPAFDVFELAPLPGDVGLGRVGSLPR
PESLSAFVSRVHDALPGTSWGIRASGDPEAQVSRVAVCGGAGDSLLDTVA
AAGVQAYVTADLRHHPADEHRRASEVALVDVAHWASEYPWCTQAADLLRD
HFGDALPVRVSAVRTDPWNVERTRHES
375141512YP_005002161.1 PLP-dependent enzyme- histidinol-phosphate/aromatic aminotransferasMASQSRPGARYHGDQAAAPGMLDFAVNVRADGPPSWLVDRLTARMADLGR
YPSEADETRARTAVAARHGRSVDEVALLAGGAEGFALLPNLRPRSAALIA
PSFTEPEAALAAAGVPLHHVVLAPPYRLGDGVVPEDADLVVVGNPTNPTS
VLHTREQLAALRRPGRIVVVDEAFADAVPGEPESLAAQSLPDVIVLRSLT
KTWALAGLRVGYAFAPAALLDRLTARRPHWPLGVLQLEAITACSAPDAVA
EADRGAQRLHQLRAEMVDGLTSIGVDVVDGCAPFVLFAVEDAELMRKHLD
GKGVAVRRCDTFVGLDGQFLRAAVRPEWPALVEAMAEVMP
375141511YP_005002160.1 haloacid dehalogenase superfamily protein [Mycobacterium rhodesiae MTARPQLVIFDLDGTLTDSAEGIVASFRHALATIGADVPDGDLASMIVGP
PMHHTLREMGLGEQADDAIAAYRADYLARGWAMNRPFDGIASLLADLRAA
GIRLAVATSKAEPTAHRILDHFGLDEHFEVIAGASVDGLRATKSAVVKHA
LAQLEPLPDRLLMVGDRSHDVEGAAEHGIDTVVVGWGYGGADFDGPDAVV
PHARVATVNELREVLGV
375141510YP_005002159.1 protein-tyrosine-phosphatase [Mycobacterium rhodesiae NBB3]MSRSSFEPLHITFICSGNICRSPMAEKMFAHQISERGLADAVRVTSAGTG
GWHAGEPADRRASHVLRAHGYPTSHRAAQIDDDHLSADLVIALGRNHVRM
LKDLGVEDDRVRMLRSFDPRSGAHPMDVEDPYYGNHDDFEDVFAVIDASL
PGLHQWVDEQLTERGIAS
375141509YP_005002158.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MKRLAFLLRPSWLVLFVVVLAFAYLCFTVLAPWQLGKNTKTSRENDQISH
SVTAEPVPVTTLLPQQDSSAPDEQWRRVTATGKYLPDAQVLARLRSVEGE
PAFEVLVPFAVKNGPTVLVNRGYVRPEGGSKVPAIPAPPTQEVTITARLR
DSEGLVQGKEPFRQDGAQQVYSINTEQIAAVTGVPLTGSYLQVVEDQPGG
LGVMGLPNLDAGPFLSYGIQWIAFGIIAPIGLGYFIRAEIQQRRREKVAK
EAVRPDAPVTTEAKLADRYGRRR
375141508YP_005002157.1 cobalamin biosynthesis protein CobD [Mycobacterium rhodesiae NBB3]MPAPRRTGRAAGIATGWLADLMFGDPSRGHPVAMFGRGAALFERLTYADT
RRAGVVHTAALIGALGATGVLVERATGRAGQVGVAAVTAPATFVALGGTS
LARTGDQMAAHLNAGDLDSARRLLPSLCGRDPSVLDAEGLTRAALESVAE
NTSDAHVAPALWGALGGVPAILVYRGANTLDAMIGHRSSRYTRFGWAAAR
LDDAANYLAARVTGALVVVCAPVVGGSPLGAWRAWRSDAARHPSPNAGVV
EAAFAGALGVRLGGPTQYAHELEIRPTLGDGPAPKTSDLARAVRLSRAVQ
AAAAIVAVVLSVAVRTGRRASPPS
375141507YP_005002156.1 putative ring-cleavage extradiol dioxygenase [Mycobacterium rhodesiMPFPALNHVAVTVRDLEVSGPWYRALLESEPVIDEHTDAGFHHLVWAFDN
GTLFGIHQHDQAAPDERFSEFRVGLDHVGFGCADRAELERWVTRLDELGV
QHSGIVDESYGSGLSFRDPDGVALEFFALPG
375141506YP_005002155.1 universal stress protein UspA-like protein [Mycobacterium rhodesiaeMSTRSSHHGVVVGTDGSPSSHAALRWAAREATLHHVPLTVVHVAAPLAVA
SSTLAWPAGGVPEEIFALQENDARRIVEEAIAAIADSAVGGDRPEVDSEL
LFGRPVPTLVDLSKDAQLVVVGCRGRTGKHRRLLGSVSTGLIHHAHCPVA
VVHDEVSSSVESSQLPVLVGIDGSPTSEPAIATAFDEASRRGVDLVALHV
WSDADMTLDYGIEDSALQRAADKTLAESLAGWQERYPDVTVHRVVELDRP
ASQLLDRAERAQLVVVGSHGRGGFAGMMLGSVSTVVAQEAGVPVIVTRQR
375141505YP_005002154.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDFELNRTDLHDTRFVAAEPPELADGEALLRIDSFGLTANNITYAVFGDA
MRYWDFFPASDPGWGKLNVWGYAHVEDSGNSGVREGMRVYGYLPCASRLV
VVPSRITEKGFTDASPHRANLPSAYQGYRDIETDPVYSPDQENEHILFFP
LFFTSFLIDDFLADENFFSADTVVISSASSKTAIIAAYLLAKRDAIEVVG
LTSAGNREFVEGLDIYDSVGLYDSVSELPGERAVYVDISGDGAVRSDVHA
HYGDRLTHSSTVGATHWTQMAPGAGELAGPSPVFFFAPDRITKRGNDWGT
AELDRRVAESWAPFAQWAAGWLRVERISTEEEIQTAYLELLDGKVDPASG
IVVRLS
375141504YP_005002153.1 nitroreductase [Mycobacterium rhodesiae NBB3]MTQHESLTMSLEEAMRTQRAIRRIKPDPVDDALLLHILELAMKAPTGSNA
QNWEFIVVKDREVVAKLGRLNRTAINLGGEMYKRMLGNRMDEKMLRNEKA
VRWQAEHFDEIPVVIVACLKGVVPPWPPVAVTSAYGSIYPAVQNLLLAAR
AAGLGAALITIPLWSKLLARRVLGLPWNVTPCAVIPMGWPIGKYGPTTRR
PVGELVSLDRYGNRPFM
375141503YP_005002152.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTTADETENPPPSIPAQADEATAMTPSHPQPDAHVVSVVELIRKRFSMGT
375141502YP_005002151.1 peroxiredoxin [Mycobacterium rhodesiae NBB3]MIDVGTEAPDFTLKDQNGQPVTLSDFRGAKNVLLVFFPLAFTGICQGELD
EIRDHLADYDNDDTATLTISVGPPPTHKVWATQSGFEFPVLSDFWPHGAV
AQAYGVFNDDAGFANRGTFVVDRTGAVRFAEMKGPGEARDQAVWTDALAA
LRSG
375141501YP_005002150.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVAADDAPSFAQRLGIQKDQVVQELGWDEDTDDDIRADIEEACGGELLDE
DADDVIDVVLLWWRDDDGDLVDRLMDAITPLADDGVIWVVTPKTGKPGHV
QPADIAESAPTAGLMQTSSANLGDWIASRLVQPKSKAAGRR
375141500YP_005002149.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MVTGWLCPRRLRFAALVVGSIAASAMIVVGCSNVTEGKPSVDSADAPVYR
ASVSASIQESIASSSARESERQESLTQEAVHTSCESLSTSSVDAITAVNA
YVDAFNQSAADAEAKAGPAIDALNHSADLVGGSVSDPLTPELKDAMRSWV
DAARRLAVAIAGNYGPDEFNAAITKLNDTKTSALNLCDAAY
375141499YP_005002148.1 pyruvate dehydrogenase E1 component- homodimeric type [MycobacteriuMTTEFARQDLAQNSTNAAEPDRVRVIREGVASYLPDIDTEETSEWLESFD
DLLERSGPARARYLMLRLLERAGEQRVAIPALTSTDYVNTIPTELEPWFP
GDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGFN
HFFRGKAHPGGGDQVFIQGHASPGIYARAFLEGRLTADDLDGFRQEHSHP
GGGLPSYPHPRLMPDFWEFPTVSMGLGPMNAIYQARFNHYLDDRGIKDTS
DQHVWAFLGDGEMDEPESRGLIQVAANEGLDNLTFVINCNLQRLDGPVRG
NGKIIQELESFFRGAGWNVIKVVWGREWDTLLHADRDGALVNLMNTTPDG
DYQTYKANDGAYVRDHFFGRDPRTKQLVEKMSDGEIWNLKRGGHDYRKVY
AAYRAATDHKGQPTVILAKTIKGYSLGAHFQGRNATHQMKKLALQDLKYF
RDSTRIPISDEQLEENPYLPPYYHPGPEAPEIRYMLERRRALGGFLPERR
THAKVLPLPDRDTYKALKKGSGNQEVATTMATVRTFKELLRDKEIGWRIV
PIIPDEARTFGMDSWFPSLKIYNRNGQLYTAVDAELMLAYKESEVGQILH
EGINEAGSTASFTAVGTSYSTHNEPMIPLYIFYSMFGFQRTGDGFWAAAD
QMARGFVLGATAGRTTLVGEGLQHADGHSMLLAASNPAVVAYDPAFAYEI
AYIVESGLARMYGEEPENVYFYITIYNEPYVQPAEPEGVDVEALLRGIYR
YKPAPEKRTHTAQILASGVAMPEALRAAQLLADEWDVAADVWSVTSWNEL
NRDGVQIEKQRLRHPDREAGTPFVTKALADAAGPVIAVSDWMRAVPEQIR
PWVPGTYVTLGTDGFGFSDTRPAARRYYNTDAESVAVAVLEGLARDGNID
QSVAVEAARKYEIDDVLAAPEQTSDPGVA
375141498YP_005002147.1 regulator of polyketide synthase expression [Mycobacterium rhodesiaMPDNRFVPPKSTVEVLETVPDAVLRRLKQFSGQLATQTVHALEERLPFFA
ELEASQRASVQLVVQTAVVNFVEWMRNPQSNVSYTAQAFDVVPQELRRRI
ALRQSVEMVRTTMEFLEEMVPLLARSDEQLTALTAGILRYSRDLAFAAAT
AYADQAEARGAWDTRMEANVVDAVVRGDTGPELQSQAAALNWDATAPATV
IVGLPHPDRSEMSSDDVRDVVTGHGRAALSDVHGTWLVAIVSGALSPTDR
FLSALMTVFADGPVVIGPTAPTLAAAHRSATEAIAGMNAVVGWTGAPRPV
AARELLPERALLGDATAIAALEVEVMRPLGDAGPALAETLDAYLDSGGAI
EACARKLFVHPNTVRYRLKRIADFTGRDPTVPRDAYVLRVAASLGRLGRQ
THLASTRNKVTNG
375141497YP_005002146.1 (acyl-carrier-protein) S-malonyltransferase [Mycobacterium rhodesiaMLAPGQGSQTPGMLAPWLELPGAADRISTWSQISGLDLARLGTTATAEEI
TDTAVTQPLVVAATLLAHEELTRRGLLDGKNTVVAGHSVGEIAAYAIAGV
ISADDAVKLAATRGAEMAKACALEPTGMSAVLGGDEAEVLARLEALDLVP
ANRNAAGQIVAAGAVAALEKLAEDPPAKARVRQLATAGAFHTHFMATAAE
GYAAAAEAVTTSEPTATLLSNADGQPVASAADAMAKLVNQMTKPVRWDLC
TETMRSTNVSAIVEFPPAGTLAGIAKRELRGVPTHAVKSPADLDGLAEL
375141496YP_005002145.1 acyl carrier protein [Mycobacterium rhodesiae NBB3]MATTQDEIIAGIAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQ
TEDKYGVKIPDEDLAGLRTVGDVVTYIQKLEEENPEAAAAIRAQMGSGDQ
375141495YP_005002144.1 3-oxoacyl-ACP synthase [Mycobacterium rhodesiae NBB3]MTRPSTANGGFPSVVVTAVTATTSLTPDIESTWKGLLAGESGIRILEDDF
VEKWDLPVKIGGHLKEPLDPLMTRLEHRRMSYVQRMAKYVGNQLWENAGK
PEVDPDRFSVVIGTGLGGGEKIVEMYDAMNEGGPRKVSPLAVQMVMPNGA
AAVVGLELGARAGVITPVSACSSGSEAIAHAWRQIVMGDADFAVCGGVEG
MIEALPIAGFSMMRAMSTNNENPEGASRPFDKNRDGFVFGEAGAMMIIET
EEHAKARGAKPLARLMGAGITSDAFHMVAPAADGLRAGHAMKRAMETAGL
DPKDIDHINAHATATPIGDTAEANAIRAAGVEHAAVYAPKSALGHSIGAV
GALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGEPRYGEYQYAINN
SFGFGGHNVALAFGRY
375141494YP_005002143.1 3-oxoacyl-ACP synthase [Mycobacterium rhodesiae NBB3]MAALTQLSTGSGFPNVVVTGFAMTTALATDADTTWQRLLDGQSGIRLLDD
PFVEQYDLPVRIGGHLLENFEDELTRVELRRLSYLQRMSTVLGRRVWEHA
GTPDVDPRRLMVSIGTGMGSSEQLLYAYEDLRAKGLRAVSPLAVQMYMPN
AAAAAVGLERKARAGVSTPISACASGSEGIAQAWRQIVLGEADMAICGGV
ETKIEAVPIAGFAQMRIVLSTTNDDPAGACRPFDRDRNGFVFGEAGALMV
IETEEHAKARGATIHARLMGASITSDGFHIVAPDPNGEQAGHAMTRAIQL
AGLSPTDIDHVNAHATGTSVGDVAEGKAIDNALGTHRAAVYAPKGALGHS
VGAVGAVESILTVLALKNGVIPPTLNLKNLDPEIDLDVVAGSPRPGNYQY
AINNSFGFGGHNVALAFGKY
375141493YP_005002142.1 acetyl-CoA carboxylase- carboxyl transferase subunit alpha [MycobacMTIMAPDAVDESLDPRDPLLRLSAFFDDNSVELLHERDRSGVLAASGTVN
GVRTIAFCTDGTVMGGAMGVEGCAHIVNAYDTAIEEQSPIVGIWHSGGAR
LAEGVKALHAVGLVFEAMIRASGYIPQISVVVGFAAGGAAYGPALTDVIV
MAPDSKVFVTGPDVVRSVTGEDVDMVSLGGPDAHHKKSGVCHIVADDELD
AYERGRRLVGLFCQQGHFDRSKAEAGDTDLHALLPESPRRAYDVHPLVEA
LLDEGVPFEEFQGKWAPSIVVGLGRLAGRTVGVIANNPLRLGGCLNSESA
EKSARFVRLCDAFGIPLVVIVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
SSVPRVTLVTRKIYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAASDDEREALHEELAAEHERIAGGVDSAIEIGVVDEKIDPSHT
RSKLTQVLAEAPARRGRHKNIPL
375141492YP_005002141.1 glycerol-3-phosphate dehydrogenase [Mycobacterium rhodesiae NBB3]MTSSTALNEARRAAELTALADGDTIDVVVIGGGITGVGIALDAVTRGLSV
ALVEKHDLAFGTSRWSSKLVHGGLRYLASGNVGIARRSAVERGILMTRNA
PHLVSAMPQLVPLLPSMNAASRALVRFGFAAGDGLRKLAGTPSSTLPRSR
RIDARRAVELAPTVRRDGLAGALLAYDGQLIDDARLVTAVARTAAQHGAV
ILTHVAASNATGTSVTLTDQRSGESFDVSARAVINATGVWAGEVDASVRL
RPSRGTHLVFDAASFGNPVAALTIPIPGEINRFVFAMPEQLGRVYLGLTD
EDAPGPIPDVPQPTPEETTFLLDTVNTALDVALQPDDVIGAYAGLRPLID
AGGGRTADVSREHRVDESPSGLISVIGGKLTEYRFMAEDVLDRAVALRGL
SAAGCRTRNLPLVGAPSNSVATLRSPIELPSSLVSRYGAEAPNVIAAASC
DRPTDQVADGIDVIRAEFEYAVTHEGALTVDDIVDRRTRIGLVSADRDRV
VDVAKEFVV
375141491YP_005002140.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MLSISNDESAPIGDRILAAAADCVLAFGVDRVTLAEIARRAGVSRPTVYR
RWSDTRSVLAALLTSRVVGVLDDVPNEQVGREPLVERIVSVVARLRRDDV
VMSVLRSAPDLAMIYIAERLGTSQQVLLDAVAADIKLAQEEGSVRPGDPR
QLAAMCLLISQSTIQSGQIVAPILDADALAVELAHSLNGYLKP
375141490YP_005002139.1 FAD/FMN-dependent dehydrogenase [Mycobacterium rhodesiae NBB3]MTRTDDQHTALLPPMKWNAWGDPAAAKPLSDGIRALLKQALGVDGPSTQE
LDASDVTLRPSALTDADREALTAIVGVDYCRVDDQGRLLRAGGKSTLDLL
RRKDSGVQDAPDAVLLPGSEEDIAEIFRFCSDHGIAIVPFGGGTSVVGGL
DPIRGDFSAVVSLDLRRLTELHSLDEVSGEAELGAGLTGPEAERLLGERG
YSLGHFPQSFQFATIGGFAATRSSGQDSAGYGRFNDMVRGLRTVTPAGVL
DLGRAPESAAGPDLRQLLIGSEGVFGIITRVRVKVHPTPTATAYEAWSFP
DFATGADALRAVVQTGTGPTVIRLSDEAETGVNLATTESIGEDQITGGCL
AITAFEGSQAHVESRHAETRAVMQAAGGTSLGEGPARAWEHGRFNAPYLR
DSLLSAGALCETLETATSWSNVPALKAAVTEALTKSLAESGTPALVLCHI
SHVYPTGASLYFTVVAGQRGNPIEQWSTAKAAASEAMMRTGATITHHHAV
GADHRPWMRDEVGDLGVEVLRAVKATLDPAGILNPGKLIP
375141489YP_005002138.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIELGRVTMLTNPASGHGSAPHAAERAVARLHKRGVDVVAIAGTDAAHAR
RLVDGALERGMDALVVVGGDGIISLALQVLAQTDIPLGIIPSGTGNDHAR
EFGIPAKDPEAAADIVVDGVAQTYDLGRIKGADGTQKWFGTVMAAGFDSL
VTDRTNRMRWPHGRMRYNVAMVAELSKLRLLPFRLTFDGRELDTELTLAA
FGNTKSYGGGMLICPDADPTDGLLDVTMVSSASRTKLIRLFPTVFKGTHV
DLDEVRTERARTITVDSPGINAYADGEFACPLPVEVSAVPGALKVLRSAD
QRSGQ
375141488YP_005002137.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFTIRLLTATAFAAGALCTAATASASPATDALFAALNGLGYPITPQDAVM
AGDLACDSSTSGLARDLIASEVAEKTGLDPAQSSTFVGIAIAVYCPLR
375141487YP_005002136.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRASNQFADAASGVVYIHASPAAVAPHVEWALSSTLSARANLKWTPQPAM
PGQLRAVTNWIGPVGTGAALASALRSWSVLRFEVTEDPSAGVDGHRWCHT
PQLGMWSGTMSANGDVMVGEMRLRSLMRSGAEMLAAELDSVLGTAWDEAL
EPYRDGGDTAEVSWLARGVG
375141486YP_005002135.1 penicillin-binding protein- beta-lactamase class C [Mycobacterium rMAALDAIEDWPVPTVAAAVIGPSGVLAQHGDLGHRFELASVTKPLAARAA
QIAVEEGVVDLDTQAGPPGSTIRHLLAHASGYSMHSADLMAEPGKRRVYS
NYGFGVLADTIEQASDIEFGRYLTEAVCEPLGMSDTALQGGAEAAGYGTT
STVADLVAFAGDLLRPVTVSQQMHAEATGVQFPGLSGVLPGFGTQRPNDW
GLGFEIRNGKSPHWTGSANSGATYGHFGQSGTFLWVDPDADLALVVLTDR
KFGDWAYPRWPELSDGVLREFDAH
375141485YP_005002134.1 homocysteine/selenocysteine methylase [Mycobacterium rhodesiae NBB3MTRERLPELTGDDLFVADGGLETELIFHHGIDLPAFAAFPLLDHPSTRDL
LRRYYDGYLAVARRHGAGFVVSTPTWRANPDWAAQLGYSPERLDAVNRAA
VQLAEEVRAAAAADGLTAVVSGCMGPRGDGYDPSDAMTVEDAERYHAVQI
ATFADTTADQVAAMTITNAPEAIGIVRAAAAADIPAVISFTVETDGRLPT
GQPLHDAIDQVDAETGGSAAYFMVNCAHPTHFSDALEHDGPWRQRLVGLR
ANASSKSHAELDESTELDEGDPEDLGARHAALRDRLPNVTVLGGCCGTDA
RHVAAICAAWSAQ
375141484YP_005002133.1 methylase involved in ubiquinone/menaquinone biosynthesis [MycobactMTLNENPATDTTEEFAGRIAAAIDSASLAILLSIGHQTKLFDTLAELPPA
TSAQIADAAGLDERYVREWLGGVASGRVVEFHPQTQTYSLPRHRAAVLTH
AAGPDNLARVAQFVSLLGEVEQQIIGCFRRGGGLSYAAYPRFHTLMAEMS
GEVFDAALIEGILPMADGLPELLRAGADVADIGTGSGHAVNVMAQAFPAS
RFTGIDFSDEGLATGRVEAERLGLTNATFVAKDVATLELSETFDVITVFD
AIHDQAHPATVLENIHRALRPGGIFLMIDIKASTQLEDNVGVPLATYLYT
VSTMHCMSVSLGLGGEGLGTCWGRQLATSMLADAGFAEVAVREIESDAFN
YYYIARK
375141483YP_005002132.1 response regulator containing a CheY-like receiver domain and an HTMDTRVDIHTDLLLAARTAHDQRDWHASYAAFVRAGENTPLSTDDLDAMAV
AAWRLGRGKESLRVAERVYTQLARTDPPAAAMKAVELGLAWITRGDVNIG
RGWINRARRLLDGESEGPTHGYLMYLEALVAMISSEPETLAARVTTLRNI
CGRLETPALTALCRVAEALAAIGESRIADAYALIDEAMLPILADEVPIDW
AGDIYCVVLNQCHRLADLPRMREWTRSMEQWCTDFAASANYGGVCDVHRL
QLQAAGDDYLMLEERLVAASSALEEVNGYAAAEGYYQLGEVRRLRGNAAG
ALGAFARARALGKDPQPGEALLRCGQGDSDRAWTDLRVALAGEDRSGRMR
LLHAAVGVALARDDLDEAERYCAELESGAASFGTPGFRAWASHSWGAVLV
RREQHAEAIDVLQAALREYRTQQSRFETAQVYEWMAVAHKGLGNHELAAA
DAATAENIYLQLGVEPARVCGATGAGLTKRETEILRRVAAGATNKQIAEQ
IFISEKTVARHLANLYAKLGVSSRTAAVAWAHENNVLN
375141482YP_005002131.1 mycothiol-dependent formaldehyde dehydrogenase [Mycobacterium rhodeMTQTVRGVISRKKGEPVEVVEVVIPDPGPGEVVVDVIACGVCHTDLTYRE
GGINDEFPFLLGHEAAGTVESVGAGVTNVEPGDFVILNWRAVCGQCRACK
RGRPHLCFDTFNAEQPMTLTDGTALTPALGIGAFADKTLVHEGQCTKVDP
AADPAVAGLLGCGVMAGIGAAINTGAVNRDDTVAVIGCGGVGDAAIAGAA
LVGARRIIAVDTDNKKLDWARGFGATHTINAKELDAVETIQDLTDGFGAD
VVIDAVGRPETWKQAFYARDLAGTVVLVGVPTPDMTLEMPLIDFFSRGGS
LKSSWYGDCLPERDFPTLISLYLQGRLPLDKFVSERIGLGDIEDAFHKMH
AGEVLRSVVIL
375141481YP_005002130.1 Zn-dependent hydrolase [Mycobacterium rhodesiae NBB3]MAINIDRVVTSGTFELDGGSWEVDNNIWLVGDDDDVIVFDAAHDAGPIVM
AVGGRNVVAVVCTHGHNDHITVAPELSDALDAPILLHPADDVLWRMTHPD
RDFRTVDDGETLRVGGIELHALHTPGHSPGSVCWHAPELNAVFSGDTLFQ
GGPGATGRSYSDFPTILSSISERLGKLPGDTVVYTGHGDTTTIGGELVNY
DEWVKRGS
375141480YP_005002129.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRLAPRIAIVVSVLTLIASVLGFIAVLVLNTFVLDEYDAYGEVAIPGSTS
LQLPEGEMTVSFHTMTTGRPTSGFPIPDLSFSITPTAGLPEPKVTENIGG
TTAVNSDVRVRIWTVDIPKAGTYNVQADGAVAGYINPHLAFGHDSSRNWL
LWLFGGLFGLGLLELFVAVTWSLRAKKKARLLEPDELVTTDPPISTLAPD
GPSSFTPTDQGVRLEQIRQLAALRDSGALTEAEYTAEKRRILGNS
375141479YP_005002128.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MAARRVAIKTVAREMLAEKSVAEISLRELSDRVGLAKSNVLRYYDSREAI
FLEVLDEEFVMWLSDVEERLGRPRARKPAYANEIRVATVIADSLLTRPLF
GELLGSMASVLERNISHDFARDFKARTMARMASLAELVGRHLPWLPAEFT
AFFAEGSLMLTAGGYPFSVPTEPVRAAIEQIGLPDPGQRFGEGLRVGLQT
WLIGAAAQTNP
375141478YP_005002127.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MVRAADVTVPDQTGKLAVVTGANSGLGLGIATRLAAAGADVVMAIRNRTK
GEEAIAQIRATVPDAKLSIKPLDLSSLASVKALGDELNAEGRPIDLLVNN
AGIMQPPKRETTADGFELQFGCNHLGHFALTGHLLPLLRAAGDARVHSLS
SSAARFGGVRFDDLQWEKKYNASLAYAQSKSANLMFAIELDRRSRHHGWG
ILSNASHPGLCKTNLQLSGPSHGQASPTLLERFYRVSRQVMPFMWQEIDE
GILPSLYGATSPDAKGGAFYGPRGFLELAGGGVTDAKILPRASDEADGRR
LWEISERLTSVTYPQ
375141477YP_005002126.1 SAM dependent carboxyl methyltransferase [Mycobacterium rhodesiae NMPESSIVVRPEPMDSGSYTAASRLQAAGLPAAMALFEKAAGAVPLPKQPQ
PIVIADYGASTGHNSLLPMCAAISVLRKRTRHDHSILVVHTDLPENDFTV
TFQTLSDDPDSYLQKDAATFASAVGRSFYAQILPSNSINLGWSSWAIQWL
SRVPSPITDHLHVAYSTDERIRAEYARQAAHDWHEFVAFRGRELAPGGRI
VVMTPGVDEAGQIGYHPLLDSMYDAVCELTAAGVITEDEKRGMSLPIVGR
SAADFRACFAPSGRFESLEIEQLEVFDAEDRFFKQYQIDGDADTFGAQWA
SFCRAAAFPSFASALEGGHDDPRRSALFDQLEAGVASRLAAAPQQTQIPM
AHVVLVKKQLK
375141476YP_005002125.1 transcriptional regulator containing an amidase domain and an AraC-MHVVAVLALPDTIAFDLATPIEAFGRIRLPSGAPGYRVVVCGSQPEVSAG
LFRIATDHGLDTLAEADTIIVPGLNDVSVDAPEEVLVALTAAHSRGVRIA
SICSGAFVLAATGLLDGKRATTHWIAAESFRARFPAVDLDADVLYVDEGQ
VLTSAGASAGLDLCLHMIARDYGAAVAADAARLAVAPLHRSGGQAQFILR
NRAAVKHIAERTELDDVLAWIEQEAHRDVTLHDIAARASVSIRTLNRRFQ
AETGQTPMQWLTGVRVRHAQQLLESTSYGVERVGREVGFASAANFREQFR
RLTGVAPMNYRNTFRERMAG
375141475YP_005002124.1 transcriptional regulator containing an amidase domain and an AraC-MYAQIVLFDGFDPLDATAPFEVLAAGSEAARGDLTVELVSAEGPREVVSG
TLRMALRATAHLDPAKPGFIVVPGASGPIEGDPDEVDTIPVLLARFAASA
AIPLLRKAMENPDVTVATVCGGSLALAMAGLLEGRTAVTHHLGMDLLEAT
GVTGVNARVVDDGDLVTSGAVTSGLDLALHLLDRTYGAQVALEVEELFAY
ERRGTVWTR
375141474YP_005002123.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDAMSNMSVAGDWDVTIKTPIGSLAVVYTFTEHDGALAGTATAKDEEVPL
QDIAVDGQRITWRQSVTRPMRLNLDFDVTVDGDLLAGHSRAGRLPRSAVA
GIRRI
375141473YP_005002122.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTDSTPGRFAPARRTDGLLFDPNTYDPTQFDAETRRLLRATIDWFEGQGK
KRILDDDLAAQWPGDFVDFVKREKLFATFLTPSEFADGNPDKRWDAARNA
ALSEILGFYGLTYWYTEQVTILGLGPIWQSENKDAKLRAADDLDAGEVMA
FGLSERARGADVYNTDMVLTPASEEDRADGILYRATGEKYYIGNGNVASM
VSVFGRRGDIEGQDAYVWFVADSQHDNYHLIDNVVHMQIYVSTFRLENYP
VREEDILDTGVEAFAAALNTVNVGKFNLCSCSVGMAEHAFYEAITHAQNR
ILYGNPVTEFTHVRTNFVDAYTRLIAMKLFSQRSVDYFRSASLDDRRYLL
FNPMTKAKVTMEGETVLRSLHDVIAAKGYEKNTMFREVSQLIGTLPRLEG
TVHVNVGLVLKFMPNYMLNPKEYPEIPTRNDAADDTFFWNQGPTRGAGKV
QFADWTPVYEQHSGIPNVAVFYEQAKAFRDLLLTAAPDAEQQQDLDFLLT
VGHLFSLIVYGQLILEQAALTGLDIDMLDQIFDFQVRDFNTYAVALHGKP
TATAAQQDWALSAIRKPVPDAQRFLRIWERVKAYDGAYEMAP
375141472YP_005002121.1 molecular chaperone [Mycobacterium rhodesiae NBB3]MSDGVGLSVGASNLAAVVVGRAALSRTSVLTRFPHRPPEVGVPSENPNLN
ERGLILTDFVDRVGDPVGIVAADGSTHQADVVLADALRALLLALTGGRPP
AGEIVVTHPAHWPRAAIDGLRGALATVPELGQPNPAPLVSDAVAALTALQ
DEAGVPTRGVIALCDFGGTGTSITLVDAGAGYAQLAPTVRHTDLSGDLVD
QALLTHVINELSAAGSIDLSGTSAIGSLSQLRMQCRGAKERLSTASVTSL
VADLPGHHGEVRLTRNELDDAIRQPVADFAAVLRDTLERNGVREMAAVAS
VGGGARIPIVTTTLSEQFRVPIITSAQPELAAAIGGGIAAVRGTIEDGNT
SMAAAAPAAAAAAAALAATSMAPEVPAPDDAPPSGTFGALAWSDATDVPD
VAPTDPYDYDSPAEPVGTGEIRPQIDFQRDPYQDTRAAAPLPWYRRPEVA
MGAGVLGVLVALAAAVLFVMRTGDTPPAPASTTAPPTTSAAPPPASETQE
PTQESVTQEAPPPPVTETVTASSSEPPPSPPPPSTTTEPPPPPTTTPPPP
TTTQPPPSTPPPPPTIPTLPYETIPGLPFVPNPIQPPQPAP
375141471YP_005002120.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTVDSQKKRIVIWGTGFVGKMVIAEIVKHPLFELVGVGVSNPDKVGRDVG
EVCGLGTTLGLTATDDVDALIALKPDALVHYGPTAAHADDNISLITRFLR
AGIDVCSTAMTPWVWPTMHLNPPNWIEPITEACELGESSCFTTGIDPGFA
NDLFPMTLMGLCSEVRTVRASELLDYTNYTGDYEREMGIGRPPEKKAMLE
NTDVLVFAWGGTVPMIAHAAGIMLDEITTTYEKWVTPTERKSAKGVIPAG
HVAAVRFTINGVYQGETRIQLEHVNRIGDDAAPDWPTGNQNDVYLVDIEG
TPSIFQETAFRFTDGSGRDAAAAGCLATGLRALNAVPAVNELSPGWVTAL
DLPLVPGAGTIR
375141470YP_005002119.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MDSADKSASSNDDAAVWGGVGPKPWWFDDPEIVAARRKVLEEFGGEPDES
AVSDEPEPEVSDIAASSNDDADLSDGVWGGVGPKPWWFDDPEPDAILNDM
LSGASVRELCQARDDLARAQARYDEAIRSARICGLSWGEIGAALGVARQL
LHRRYARRLGSRRGPIER
375141469YP_005002118.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTSASGSVQRLAGRRALVTGASRGIGAEIVRRLAADGAAVAFTYGASKAE
AEKLAAEVAAEGATVVAIQADAANPEQVRRSVEQTVAELGGLDILVNNAG
IAILGDAATFPADQFEKIVAINIRGVFVAIQAALAHLGEGGRIINIGSIN
ADQVPGPGLAVYAMTKAAVAGLTRGLARDLGPSGITVNNVQPGPINTDMN
PDQGPFAELAKKVMAGGKYGQPSDVAGVVSYLAGPDTGYITGAHWNVDGG
FTV
375141468YP_005002117.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRFIKGLVVASLGVAAALGLAGPTHAQGPAAQAPGVLEGVYDVNIGGQAS
TTWTVSPICVPTVGDLREPLLLPVACRLKVAPFRAAGGEAVMIRGQWQYT
IDDANGRTCPDGSTAPQTTIYRFDGYTLKGEMKVLTGADCGQQPAMVVAP
MTMSLREPLSTPVTQYPLICEPGGLRRCF
375141467YP_005002116.1 dipeptide ABC transporter periplasmic protein [Mycobacterium rhodesMRRLAALVAVVVLLSGLTACSTGERVDLGGDSSGNLIAAIAGEPDQLDPH
KTSAYFSFEVLENVFDTLVEPDANLEMKPALAQSWEVSPDQLTWTFHLRR
GVTFHDGSPFTADDVVYSYRRIIDEQLTNVDKFSAVTDVSAPNADTVVIR
LKQPTPNLLTNIGGFKGMAIVSRRNVEDGQISTHPIGTGPFSFSGQKSGD
SITLKANPSYWGTAPKISGVTFRFISEPTTALSALQAGEVDWTDSIPPQR
VAQLRDDDSIHLAVTPSNDYWYLALNEARTPWNDVRVRQAIAYGIDRDAI
VAATSYGTAAANQLAIPKGNPWYTAYDRYSYDIDKAGGLLREAGVTDTDL
DMLVTSEYPETVTAAQVIADNLAPLGITVNIRTVDFATWLDEQNTGHFDM
LMMGWLGNIDPDDFYYAQHHTDGTSNAQKFTDPEVDQLLDGGRVETNRQA
RADLYARAATIIADQISYIYLYNPSVIQAWSTGLTGFESRRDGAIRFRTT
TLDRGQTS
375141466YP_005002115.1 dipeptide/oligopeptide/nickel ABC transporter permease [MycobacteriMSRFITHPVTRFLARRLLYSAVVLIGVLVVVFALVHLVPGDPVRIALGTR
YSPQAYDALRSASGLDKPIVEQFFSYIGSALTGDLGVSFRNGDPVTVILL
ERLPATISLALAGIVIALLIALPAGIWSALREGRVSDALIRVASQFGVSV
PDFWMGILLIALFATTLGWLPTSGYQPLLDNPGGWLRHIALPALTVGLVA
GAIMTRYVRSAVLEVASMGYVRTARSKGLPPRVVTFRHTVRNALIPVLTI
TGIQLATILGGVIVVEVVFAWPGLGRLVYNAVAARDYPVIQGAVLLIAAL
FLLINLIVDVLYAVVDPRIRLS
375141465YP_005002114.1 dipeptide/oligopeptide/nickel ABC transporter permease [MycobacteriMSSAADTSSRMSSWRLLLGNPVTVVSVAILLVVSFAAVTANWIAPYGIND
VNVPDALQAPSGAHWFGTDELGRDVFSRVLVATQASMRVAVISVAFAAVA
GVTIGVVSGYRGGWLDTIFMRIVDVMFAFPVLLLALAVVAVLGPGVTTTI
LAIGVVYTPIFARVARASTLGVRVEPYVSVSRSMGTGHLYILGRHILPNI
AGPLVVQTSLSLAFAILSEAALSFLGLGIQPPQPSLGRMIFDSQGFVTMA
WWMAVFPGAAIFVTVLAFNLLGDGLRDVLDPKQRTMIEARARKERKSLER
AK
375141464YP_005002113.1 ATPase component of various ABC-type transport systems with duplicaMSASALSVRDLRVRIGTREIVHGISFDVEREQTLGIVGESGSGKSMTVLA
ATGLLDAPGAAVTGTSTLAGGQGDVQLVGASDRVLRSVHGGRIGFVFQDP
GTSLNPLLTLERQITESLEAHRRMTRRQANSRALELLEAVGLPDPETRLH
AYPHQLSGGQKQRVMIAIAMACDPEVLIADEPTTALDVTTQAQIIELVRE
LQRDFGTAVVWISHDLGVIGQVADEVTVLQNGDPVEQAPVIDIFDRPQQP
YTRELLQARPVVGASGPPPPPADAEAVLDVDGLDVRFDVRTPVGKSTVHA
VKDLSFAIRRGTTLGLVGESGSGKSTVAAALTGLVKPDAGVATLDGDDVI
GVRGSAEKSLRRRISLVFQDPFSTLNPRARVGTAINEPLRVHRVVDGKQA
RKARVDELLELVGLPTSFAQRYPHELSGGERQRVSIARALAGEPELLILD
EATASLDVSVQARVLELLGALQREMGLTYLFIAHDLAVVQQVSHDVLVMR
DGAAVEHRPAAELFAAPEHDYTRGLLAAVPPERPRVST
375141463YP_005002112.1 dehydrogenase [Mycobacterium rhodesiae NBB3]MTQLSDKVALITGVSSGLGAVVAQVFAERGAKVFGIARRADEMAAVFTDV
PGGKYASVDISSPDACRDAVAQTVDAFGRLDILVNVAGYHQMRHTTTMTD
EEWDRDLAVNLNGPFYLCRAALPHLLETAGNIVNVTSIAGVEGEVYSAGY
CAAKHGLVGLTRALAIEFTKEKIRVNAICPGGMPTPQATEFTAPANADWD
LILRIASPRGFMDPVDVAKSVAFLASDDAAAIHGAVYRVDNGKGAG
375141462YP_005002111.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MGAPLEFCSKRGVVAVLASGVVISLTALTGGIAPAFAQPGDDSGATTTVV
APEPEATAPEPEATQAPAEVPQAPVETQAPQIPTQVQLPETQATAEVEAT
ATAEAPATTVAPSSTVAPAEPSETAVTTTAQAPVTTTAPATTSAETPSTT
ASAESSTAATTTSAAPTSETSATTATSSPSATASSTTESASNSDDSETPT
VSIEQAAKIETVLPQTLEAPAADVELASKAAIVDETIPAAAPEQDLASFS
NSIQTSLKLPGLDVNTSATTNFAVDPPLELVSPVKQWRPEWVQYDEYYRP
IIINPYRDPVRIVYMYEMQPRIMIVPPMGRMMFEAAQYAAYSFTAAVLSP
VVAAANVAQTLTNIAVGSFFGGGYYPGVGMPPPPPPPPVLRYDNVPVLVN
YSNARYEPFRVRQIVDVGTDAQFGENKVLLDGVTPAWGVWSQGPGGERTF
EVHRTQQFPGLGAPAEGPLPGDYKLKLASDEASTGGLTGRDIFLMVSAGV
IGTLGFGAIGLAFFLGRRRNQGI
375141461YP_005002110.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MWHPGVAISCVAIAATTLVACGSATEKPISTSTAETYTTPESTFTSAPPA
TPEPRAKDWFDLDVGDCLVALPHVEAGEVSVDLVDCTRPHAGEVFLRAPT
EVNAAIADVADSQCAAGVVDYTGRPGDDAFTVTYLIDSNQDRTSANPLPS
TVICLLQARDGRQLTGSARSR
375141460YP_005002109.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRIAIVVLGLLVAFFGIVFTLQGFGVIVSDSPMTNTTTWSILGPIIAVVG
IVLAVGASRRRG
375141459YP_005002108.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MAWDFSTEPEFQRKLDWVKQFCEEKVEPLDHVFPHAVRLPDPAVKAYVRE
LQQEVKDQGLWAIFLDEELGGPGFGQLKLGLLNEVIGRYAGAPHMFGASA
PDTGNMEMLAAYGTEEQKERWLKPLLNQDIFSAYSMTEPQGGSDPNLFRT
TAVRYGDEWVINGEKWFTSAGRVADILFVMCTNGMFVVPRDTPGVEIMPE
PRNHNHIIYRDVRVPLDHLLGPEDGAKTLAQRRLGGGRIHHAMRTIAQCN
LAFDMMCERALSRESHGRLISDHQMVQEKIAESYAMIKMLRLFVLETAWK
IDNTSTQEARTEIAAVKFTMSKTLREVSFNALHILGSLGTTDLTPIQAMY
AAAPTMGIADGVDEVHKATVARRVLGNYTRHEGNFPTEFLPYKREEARKK
MQPLLDARPELAAAAEAYQKYLGRRR
375141458YP_005002107.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIILGIILLLIGYFTSLSILYTIGAILIVVGVVLWILGAVGRPVGGRKVW
F
375141457YP_005002106.1 transglycosylase [Mycobacterium rhodesiae NBB3]MRHTRTVREQRCRKGARHQLLIFVAGACLLAGCTHSAPPAAPPEPTVAPS
SIPAQTLDQPTSPGPATIPLGAQPAIASDPAQLADDLVADEQALRAPSTP
EPALTSAARRQQAAYRAIGRTPEWDPIIRPRIPPWLIATYDLNVDARRQL
YPMTEVKDTVPAWRIVAPAPADALLAHYREAEAATGVGWNYLAAIHLIET
RFGSIEGTSTAGAQGPMQFLPSTFEAYGDGGDIHSLRDSIMAAGRYLAAN
DFANNRDNAIFRYNNSDRYVRAVHDYAGVLAADPAAFAGYYRWEVYYRTT
AGDVLLPVGYMSTTPIPVATYLADHPQ
375141456YP_005002105.1 family 3 adenylate cyclase [Mycobacterium rhodesiae NBB3]MSAIPETVYARDADAHLAYQVVDNAGPDLLFVPTPRFPIDLIWDDYTVAD
QLRRLASFGRLILTDLLGVGSSDAVPIYERPAMQGWTDGLIAVLDAAGSE
RASVFAMAGSALPAMLLAATHPERVRSLVLWSPYAYFLRTPDQPFAIPEQ
SLDKLSDLVGQTAGSGAAIEVLAPSWRKDAAKRRWYGRGERLAGGRGYFK
AVSDLFQHTDMRPVLESIQAPTLVLHRRDDPFVVAGHAKYVADRIPNARR
VTLDGNDHEWFAGDSDRVLDEIGAFLTGGRRARPTNRVLSTVLFTDIVGS
TERATALGDHAWGSILAAHNQAVEREAIDARGKVVKFTGDGALATFDGPA
RAINCACAIRDAVGKFGLHIRAGLHTGEVEIEDDDVHGIAVHIAARIMGI
AGPDEVLVSGAVPPLVLGSGLAFDERGSYELKGVPDRWPVLAVHN
375141455YP_005002104.1 methionyl-tRNA synthetase [Mycobacterium rhodesiae NBB3]MTGHNIDVIFTPPPTPDGGLHVGHIAGPYLRADLNRRLLEAVGSPAAHVS
HIDNYQTYVTKKAQQLGKETNQFRDEMTAQIGSDFDGFGIHFDQSIDNTA
DAYRVYLASGLAELFDNERAIRQPEIVGQDTRYGAVESFVSGTCPNCLQR
AFINVCENCGSPMDLARALSPVEESTGRCEFVQVNDSRVPTAFMIDYQDI
AWLQGWHLEIDSDSPSLIRLIRELEPSRIALTFRSDYGYMVTPGRVVNPW
FEIFFAHCYALGQLLGLPADLSFGQLRTELSKADLRPWVTYYFGFDNSFY
YGVLFPLLAHILDVPTMMPDTLKANRFLKINGAKVSSSRGNAIWARDLAS
RHPVATLRGALAAVTPEVAELDFHEDMLTAISSWPDPSDSARPIFDSPAT
LTGKNLRSTLELLSCPERFSVAELLNRIGNAVAFAESPHAFDAERVELIG
MVAHLRNVLDI
375141454YP_005002103.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAPQQPRFGVSKVLDGFLDSPLSGIAPWILLSVVGSPGHYEAAIAIAFGF
SLVVLWAGRRRGDRLHSLTLFGVVFFGMLLVVRVLVGSGVEAWLSTWTGE
MSNIALTLFALTTLATGRPFTLSYAKDMTPEELWDTPVFLRTNFVISAVW
AAAFAFCAAMGFIGIIWLHDSDNFWTGWILQLGATFFAVAFTDVYPDYVG
AKLDRMAGESTEPVPSLLPIVDWIPMYVLIVGVIGWVIDAVPDWLAITMI
AVGATGSALVRRFAPSTDSEP
375141453YP_005002102.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MQSIRGRPRDRRIDDAVLRATIELLEEVGYTRLTIPLVAARAGATPPAVY
RRWPTKVELVYEAVFPTPPNAELPLTGSIDDAVRTLVRSSVALFSAPAVH
TAWSGLMAELPSEPGLSARLLGQQQDSTYRRLQGFLDEAASEGRAAPGVD
ARVLVDMIGGTVLMALANERMIDDAWIEQTSALIVDGLAR
375141452YP_005002101.1 sulfotransferase family protein [Mycobacterium rhodesiae NBB3]MQRRLRSRGVIHIAIDAPPRPLPIRVLNLGYRTARRFGARPMKLRKRALM
DRASRQANGLKDFGDPRFEEGLDRLIDALESEDRLNGIGRIIATSHITNL
LRQRLLLTEHLRTHPEIRLEVIEKPIFLVGAPRTGTTITHHLLSQDDRFR
YPLTWECDELHPPLDPATMQTDPRIKRSQKLIDRSLSLAPDLDAAHPMGA
WEAQECALLHAYAFHSETFHVMFNCQSYDRWLAEQDRTWVYEEQRLLLQY
MQSGGLRPAESWLLKTPPHMNNIDKILTVFPDARLVTTYREPTEVVASSC
KLTGTVFAMVDDNVDWHDHGRYMRWRTGGMLERNVELREQFAARSDQFLD
FPMDRMVGEPMACVEEIYSHFGIELTEQTRRKMVRFMAKRGQSARKPNIY
DAADYGLDVDELWPQFQYYRDFYGIEDTRDRPQQ
375141451YP_005002100.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTDHSSSAIRAAWGRFRELHDELLDLALGQGDLDDGTVAALLGHMVGHIQ
YMGLQLRSDPAHPTLINAQYSPWNWGHSNPDTLYLSARINDAHDYRVYGR
LGSAAQTTFGVYAGKDDQAHAVKALADDLVVEPDGSFEIFFSREKMGKAA
NWFQLPPGADSFCCYQTFGDWDAQLKGAIRIECLNPGTPAGPNSVEQSVA
SFDAHLTASRDLFTMWVKDIPARVFGSLPKNFVIAPMQPPSAMAGAWFVP
IAWELRDDEAAVIEYEVPPGAPYVGICLTNAWSEMIDIETRQTSLNLGQS
VVDDGRVRILLSTNDFGVQNWLDARGYRSGIVTWRASTPEQPAAPALTVI
KTNEIGDHFDAKQRVTEAERAAAIGSRLRHFAARNTP
375141450YP_005002099.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLNIAVTVGTLAATTALGLSAAAAASAAPSGVSAVDQTIGDLRSEGYNVI
VSRTGTGSPDQCTVTGVRPGQTYSRTDSGVPGNLLGTPGPNIATTVLNKT
AYVTLSC
375141449YP_005002098.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MADKSPGKSRRKPTLSIKERRAAKRARVLETASVVRKRKG
375141448YP_005002097.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLTITENITNGSTRRPAIANLRMQLKPAHRSCGFVQGAWWPRSAQLDREL
PSLLAALSLRVGAIDSVLYHENDWSPGPLSIEHEGDQVIVSGRQEWPNVV
SLFGPRFGRLDLLVVPPYTEPTHAYDVVKRAASVNDASTPDQLLGITRRA
DDRLLSPIALQRWEADGGALPLASRSGSQMQDA
375141447YP_005002096.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSGYWKAVEVAIPVNMHPVHINSFVTAEIHMLARRAGETVADVRIGAPRE
PRGDFIAWSASYLPARQMIPA
375141446YP_005002095.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MEPPELLTLDVGSEPTLELGLLVDVVDSAAEVVVSAAPFPSDVDALPVAL
LVPADVDDALLVPADVDDALLVPADVDDALLVPADVDDVGSAWAKPLPRL
SAARPRKPAIALAAVSFLMVSRLFMVVAFRCLLLSNRESGQNLNESSMGC
ELARGCLVMGDVLASGEASSRRAFAIALVLQHRPPAELRAADS
375141445YP_005002094.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRQLEDMYKQSLPGVREIVLEEYKKRLNDLQNRTSPPAP
375141444YP_005002093.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MQERTLVKAAGASLSIVAVAVVAIHVPTMTEPRDEWSFRVGYAAVSSPSH
VRSVVSGDGLGRETFCAEVLTRTIAEGQLLGLRTGEFLRGCKSAVGDAME
375141443YP_005002092.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPLTTIPAINDAAGMSVAMTVDHPKAAIRMMRAILRRKPPRDPDLAR
375141442YP_005002091.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MPPSRSPSRRRRSVRCIARFRDIRNARRVRCITGLWRVHRTGYVWRVTRL
WSIRNTWHIRHIGHGRCGGRWRRRRLRIRDSNTGSYGSRGQSCRNRRSHF
LSAVVHRSSFPSRSGCVFTMGNSCCEIAEEAESPRNARKPLHQRTIRGNP
RSFSREFPTGTVTVTSSPFRRCGFPVRRCRGSGSSCNGCRRSAAV
375141441YP_005002090.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSAHTANSEMPVSATPVRMVVRKLPLVTVLFWILKVVATTLGETGGDLLA
QTLHVGYLHSTVIFFGLLVVALVVQLRARRFRPAIFWTVIALTSTAGTTL
SDLMNRTGGIGYTGGAVLLSTGLAIVFLAWWRSGQTLDVENIATFRGEML
YWVAILFSNSLGTSSGDFLSDSLGFGFGTSALVLSVVMGVLLPLHYLTRV
NGMVLFWIAFVLTRPLGATVGDYLSKPLDHGGLAWGTMWTSAALLAALVA
LVAYQTAADRRHPLQLLPEPRHRRTGKPQRLNGELVTVTVPVGNSLEKDL
GFPRIVR
375141440YP_005002089.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTNSTHSADVLSPRGMLSKVPEITVWFWIIKILCTTVGESFADWINMTLG
LGLNATALIFTAVLAVVLVWQLCLSRYVPFVYWLTVVVVSVTGTLYTDIL
TDDLGVPLALSTSVFAAILVVVFGVWWARERTLSIHSITTLPRELFYWLA
ILVTFALGTAAGDWTLELTGWGPGTSVLLPAALIVAVVIGWRLGANPVLS
FWLAYVLTRPLGANLGDWLAFPPEQQGLGLGTALTSVIFLAAILATVVYL
TITRADVIEKTTSAEAFARPKSLTRERLMLGYYAVIGLVAATFLTWAAEQ
PHAAAPASEEESGASAAVTLAPGQSATEKWPPAEVATFRTIVSDTLTKVQ
AGDQTGARARITDLETAWDNDQPTLQPMDDTGWTVLDGQIDSALTAVRAG
NPDSATETQALTELLTSLK
375141439YP_005002088.1 membrane-associated phospholipid phosphatase [Mycobacterium rhodesiMPVKHSQHLLREAAGTFLAVHAGSEIAVGGLLVSTVAVAAGWGLRNRMPG
WAAASLRVAGLVSAIVVLACQARGAGWLTGVDRSVTMWLADHRNPTVDAL
ALTVTNGFGPIVTTGLTAAFGLLVGMRSRSILNGLVIVCTVGGASLLCWL
IKLVVERPRPPLLIQVTPETDFSFPSGHVTGAAALFGILAVIVGMVGSRL
ATLVIGAVGVLTVSAVALSRLYLGVHWLTDVLASVLLAAVVLMFAAALLP
TMRVLPSALSPANNAAEKPY
375141438YP_005002087.1 response regulator with CheY-like receiver domain and winged-helix MRVLVVEDEVQLAELIRRGLVAQGFVVEVEHRGDAGFETIISDTFDAIVL
DIMLPGMNGYEIVRGVRSRGVWTPVLMLSAKDGEYDLADAFDLGADDYLI
KPFSFVVLIARLRALMRRGAPERPAVLTVGELELDPSRHRVLCAGAELAL
TPREYSVLEFLMRHRDAVVTKDEILRSVWDTNYSGDDNIVEVYIGYLRRK
IDSASSGHQIETVRGVGYRLVDE
375141437YP_005002086.1 signal transduction histidine kinase [Mycobacterium rhodesiae NBB3]MRTTVAATLVVLMCLLLAGAALLMVLYHSLASSAQSTADARAAQVADQLQ
TEPPPDLDRAMLATDSQVGVVQVIDRQGDVVVASAASPETALSSTFLEPG
ARRFFGRVEIDPSNDFWVTGVGAQTPTGPVTVLVAADREPVESVVATVAG
LLAVGVPIVICLVAYGTHRLVGAALQPVERIRAKVSLVTSGKLAERIPVP
LAEDEVTRLAVTMNEMLDRLEAGQAAQQRFISDASHELRSPLATITTALE
LAHDQPEMLDDALIEESLLPEANRMQRLVADLLLLARTDEDSALRSYADV
DVDDLLIIEAERVKTITGLSVATHISHVRVVGDPRALARLVRNLVDNATR
HARSCIALQCRRVGDHAQIVIQDDGPGVPVAERARVFDRFVRLDSPRTRE
SGGAGLGLSIVAQIVETHRGRVTLDESPSGGARFVVELPLFVDQPVADTA
DGLDLMPGRG
375141436YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix MDEPVRVLVVEDEVRLAETIRRGLESEGFVVDVEHRGDDGFHTAVSGTFD
AIILDIMLPGKNGYDFVRDLRDQNVWTPVLMLSAKDGEYDLADAFDLGAD
DYLVKPFSFVVLFARLRALIRRGAPERPPVLTAGDVELDPARHKVSRAGI
ELSLTPREYSVLEFLMRHRDRVVSKTEIVNAVWDNHYGGDENIVEVYIRY
LRRKIDLPFSGQSIETVRGVGYRFVGS
375141435YP_005002084.1 type II secretory pathway- component PulD [Mycobacterium rhodesiae MKFIARGVVAIGVTLSALVAPSATSHAGLDNELSLVDGQDRTLTVQQWDT
FLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADKFEGTLELGYQIGFPWS
LGVGINFSYTTPNLLIDDASIAPNLTPGSPFGPTVGTGFAPLGSIITPNL
FPGVSISADLGNGPGIQEVATFSVDVAGPQGGVAVSNAHGTVTGAAGGVL
LRPFARLISKSGDSVTTYGEPWNMN
375141434YP_005002083.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MSDENLAERIGGLVAMSSGDGRLDTLMRLTCGRALSLPPLPMEVDLIDGG
AEHEPLVCTFTEQFATDVSGIGDNQRKLLAQALGDNVFRTVVMMFVADLV
PRVWAGFEALGLRRHGNGGDIAWDHDSDPTDALLNGFLPAVARLRGLDPV
TTEVVRLRGAAQHNCRLCKSRRETNALDAGGSEDLYGEIERYETSEKLTD
AHKAALQYVDAMIWTPSQISPELATGVRKHFSEDQAFELTLDIMRNAANK
IMVSLGVDAPLVTDGTELFSVDEDGQTVSASK
375141433YP_005002082.1 putative Zn-dependent protease-like protein [Mycobacterium rhodesiaMIGAQRVVDLALAEAERGGKADETIVLVTDRAGASLRWANNSMTTNGESV
SRSTTVISIVRQGDTARVGSVVTSEVDPAAIAALVTASQDAALSAPEARD
NAPALPGTDAPEDWEAPVPGTDVQAFLGVAGSLAARGFSGADQLYGFARH
DVETTFLGTSSGLRRRFTQPTGSVEINGKRDGASAWVGFSTPDFADVPTD
SMLERLSTRLGWARRTVELPAGRYETIMPPSTVADMMIYLWWSMDGRGAE
EGRTALSAPGGGTRIGEKLTDLPLTMYSDPHADGLACTPFVTASASSERG
SVFDNGLDIGRTDWIRDGTVNALAYPRASAAEFGAPVAAPADNLLMTGGT
ASLADMIASTERGLLLTTLWYIREVDPALLLMTGLTRDGVYLVEDGQVTA
AVNNFRFNESPLDLLRRATEAGATDRTLPREWGDWVTRVTMPSLRIPDFH
MSSVSQAQ
375141432YP_005002081.1 putative Zn-dependent protease-like protein [Mycobacterium rhodesiaMTAQRRVDTDFLELPRHELADAALSAALAAGAGYADLRIHAITTEHIQLR
DGELEAAVVNREIGLAVRVIVDGTWGFASHAELDPATAADTARRAVHVAA
TLKPLNAERIELAPEPVYSDVTWVSDYSIDPFAVATSEKIAVLGEYSGRL
MAADGVDYASAALHAMKEQTFYADTFGSSITQQRVRLMPTLEAVTVDAAA
GTFETMRTLVPPMARGWEVVAGDDVWNWSDEIAEMPSLLAEKAKAPSVVA
GPTDLVIDPTNLWLTIHESIGHATEYDRAIGYEAAYAGTSFATPDKLGSM
RYGSPIMNVTADRTVEYGLASVGFDDEGVRSQSWDLVKDGIFVGYQLDRV
FAPRLGVARSNGCSYADSPHHVPIQRMANVSLQPGTDDLSTDDLISRVQD
GIYIVGDKSWSIDMQRYNFQFTGQRFFRIRDGRLDGQLRDVAYQATTTDF
WGSMEAVGGPSTWRLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTR
DESGR
375141431YP_005002080.1 ABC-type cobalt transport system- permease component CbiQ [MycobactMTAPTSAKRRQRRPVVLLRPVPGDSAVHRMWAGSKLLMVAAIGVLMTFYP
GWVPIAAVAVLVLVAARIAKIPRGALPSIPGWLWILLFFGGLTATFAGGS
PVIDIGSVTVGLGGLFNFLRITALSIVLLGLGAMVSWTTNVAEIAPAVAT
LGRPLRALRIPVDEWAVALALALRAFPMLIDEFRVLYAARRLRPKDVAIS
RRGRLRGVWLEIIDLLAVAITVALRRADEMGDAITARGGTGQISAFPSRP
KMVDLWAFVIVIVVCGTALALELTILGTSAVTT
375141430YP_005002079.1 ATPase component of various ABC-type transport systems with duplicaMAVTGDSSMSRRSGSLSPGELAQASVIAALTAATAIISIVVPFAGALSLV
GTVPMGLLAYRYRLRVLITATVAGSIIAFLIAGLGGFMVVLNCAYIGGLT
GIVKRRGRGTVTVFFSSLVAGAILGTIFVIALAVLSRLRHLIFESVTANV
NGVAAIIARIPDMQPLADRLKRDFATALDYWPYLFFTYSTAAIAVVTLIG
WWALSRVLSRLFGIPDVHKLESSDAAGTIAPVPTRLRDVRFRYPGADHDA
LGPVSLDVEPGEHLAITGANGSGKTTLMLMLSGREPTAGTVERPGAVGLG
KLGGTAVIMQHPESQVLGTRVADDVVWGLPPGTTTDVHKLLDEVGLDGLA
ERDTGGLSGGELQRLAVAAALAREPSLLIADEVTSMVDQDGREALMSVLS
GLTQHHQVSLVHITHYNDEAETADRAVNLTGNGGAADNTEMVETESAPAA
TVAPGHHSDTPVLELVGVGHEYASGTPWASTALSDINFTVNEGDGLLIHG
LNGSGKSTLAWIMAGLTEPTAGSCLLDGIPVSDQVGAVAISFQAARLQLM
RGRVDLEIASSGGFSHRDRKRVADALATVGLDPALGKRRIDQLSGGQMRR
VVLAGLLARSPRAVILDEPLAGLDAASQRGLLRLLAELRRNAGLTVIMIS
HDFSGLEEVCPRILHLQDGVLAPVATTAGGMS
375141429YP_005002078.1 transcriptional regulator [Mycobacterium rhodesiae NBB3]MTQTLGADLLSVVARINRLATQRARLPLPYAQARLLSTIEDQGPTRISDL
AALDHCSQPTMTTQVRRLEDGGFVSRTVDPGDARAVLIQITPKGVETLRQ
VRLDRGAAVDPYLERLDATDRETLAEAVRVLRGLLADASAPTTAK
375141428YP_005002077.1 arabinose efflux permease family protein [Mycobacterium rhodesiae NMWRQPKAVWAVAFASVVAFMGIGLVDPILKPIADNLNASPSQVSLLFTSY
MAVMGVAMLVTGVVASRIGPKRTLLLGLVVIIAGAGLAGMSENVTEIVGW
RALWGLGNALFIATALATIVNSARGSVAQAIILYEAALGLGIAVGPLVGG
VLGSISWRGPFFGVSALMAFAVVVTAFLLPSTPPAERATTLADPFRALRH
RGLLGVAVTALLYNFGFFTLLAFTPFPLDMSAHEIGLIFFGWGIALAFTS
VVVAPRLQHRFGTVPTLLVNLLAMTATLVVMAIGTENKAVLATCVVVAGL
FIGINNTLITETVMKAAPVERGVASAAYSFVRFSGAALAPWLAGVLGERV
NVHAPYWVGAAAVLMAAGVLALSRSHLSGIDADEELDELSEATAISVGSD
S
375141427YP_005002076.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MRVLFRMAVVCCLLLPMCGVASATTAEPTYLGQQQFASDTVFDSTVVGGL
SGISYDPGSQLYYIISDDRSSKNAARFYTARITLSDNTIDHVEFVSTRPW
LDVSGEAFPRLDTTARPPVVPPDPEGIAFDERRKLLYWSSEGERIADDPH
GPVLRDPWVRIATLDGGYVGEFALPPMLRMSAEPTGPRQNNVLEGLTLSP
SGRYLWAGMEGPGYNDGETPTETAGALTRITRFDVESRVATAQYAYPLDP
VTAGAGGGNGLSDLVALDDENFLAIERGFGTHTAARIYRVSVGDAEDVLA
RPSLTGPSVRTMRKTLLVDLANTIQPLDNVEGITMGPLLPDGRQSLVLVS
DDNFSPTQITQFLAFAL
375141426YP_005002075.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MAAPTGVPHIGGHSHADVTGGWLRAATFGAMDGLVSNTALIAGVAAAASA
HTVVISGVAGLLAGAFSMALGEYTSVMTANEQLESEVLVERKAFQTHPRA
EKAELVAMLVDMGMTRETAAKATEEVHRDEDRALNFHLVQELGVDPREKP
SPWVAAGSSFVLFAIGAIIPLIPYLLGFESLWAGLLCGGVGLLIAGGLAS
RFTRRPFWFASLRQLAFGAIAIAATYGVGSVIGTVF
375141425YP_005002074.1 acyl-CoA dehydrogenase [Mycobacterium rhodesiae NBB3]MTTTAEHLRNTLDGRWRDVKNRMREELSGEVFKPHYTPNTVIARTKVAEQ
LKIMAAQGAAEDGFKKEHGGNGDVGAAVTQIEMLAMSDLSLMVKAGVQWG
LFGGAVENLGTERHHEAYVQRIIDLDLLGCFAMTETGHGSDVQALETTAT
YDPATQEFVIDSPTRTSRKDYIGGAAETARVAAVFAQLITPDGEGHGVHC
FVVPIRDDEGNDLPGVTTGDCHYKGGLPGVDNGRIQFDHVRIPRENLLNR
YADVAEDGTYSSPIENQGRRFFTMLGTLIRGRVTVGGSAGAAARVGLDIA
TRYALERRQFEAPGEDQEVLLMDYLVHQRRLFPLIAKSYALQFAQNELVA
KCHELQTSDDPDVEEQRELESRAAGLKAANTWHATRAIQEAREACGGAGY
LAENRLIALKADTDVFTTFEGDNHVLTQLVAKELLTAYADDIKGMSPVEW
VRFAANFAGERVLKRTAAETIMQTILDTRQDNEEEGSLFNRGTQVKMFED
REEYMLATVARRLQGKSKEMSAFDAFNSVQDHVLHTARVHIERIILEAFV
AGIDACEDEEAREILNMVCDLYALSVIEEDRAWFMEHRFLSTERAKAVTR
GINERCRNLRPYAEVLVDGFGIPEQLRYAEMLHPENIASPDSP
375141424YP_005002073.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MFSSRWPKLGLSAAVLVATAAVVGALAPPAQAFQIQNHERVTRDALTPLG
VDQAAMGQILVGPPPGAGAVGSDAFFFDKFRHIDGANNPAEICDLTTQAW
NFFTPIILNGAKPSGPGGTDLIDGPAARAAFGGLAHALQDFYSHSNWVED
NIAVNDLYRMPPPLMPTCDPAALPPGLHTGFFDALTNHDDPIGGCPPGGP
PPGVVECHSTLNKDNWDTPRGGIIVPGTNPPINNFDLAAQLATTATTGLY
WQVRDLVIADAGVCAADNLFQADRRQACW
375141423YP_005002072.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLIRRTSHWILGTAMAAAVAHVTTMAQTFADAFEPDLESWETLPVALAAE
HDRVGLYQQA
375141422YP_005002071.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MATSVRYQRLVRGFAAGALTIAALGLTAPMAAADAGESTQSSADSPSAEQ
SAPSPRPKPAPKPAYGRPVAEKPAQNAA
375141421YP_005002070.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MLRVISYASKLLIAAGLVAGGLVGFSGTAAAGPTCWGWISGGWAHRPFTN
SSSDTAGCTHQQDWSDSSMPDLAGAGSFPGGSSEISASPWTQVP
375141420YP_005002069.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MIRYVAVLAVGYVLGTKAGRRRYEQIAGTYKAVTESPAAKAVIDAGRRKI
ADRVNPDPPMVTLTEIDHGTAVIGPETVPKGRQR
375141419YP_005002068.1 hypothetical protein [Mycobacterium rhodesiae NBB3]MTSTKNRARKLIATGAFAVAAVAAPFAASALSTTDSSDAVALPPGCLSHV
GNVEDGICTGYSQGNGISAGTPGIGFNGSEGGGFGVNTGPMFPGTTINRG
IN
375141418YP_005002067.1 DNA primase- catalytic core [Mycobacterium rhodesiae NBB3]MAGRIPDRDIAAIRERVRIEDVVGDYVQLRRAGADSLKGLCPFHDEKSPS
FHVRPNHGHFHCFGCGEGGDVYAFVQKIEHVSFVEAVELLADRVGYTVTY
TGASSTNVQRDRGSRSRLLAANAAAQEFYAEALKSDEAAPAREYLLNRNF
DVDAAARFGCGFAPSGWETLTKHLLRKGFEFKELEAAGLSREGRRGPMDR
FHRRLLWPIRAAGGEVIGFGARRIFDDDQMEAKYVNTPETVLYKKSSVLF
GLDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTAVASCGTAFGDEHLSM
LRRLMMDDNFFRGELIYVFDGDAAGRAAAVKAFEGEQNLAGQSFVAVADD
GMDPCDLRLKAGDGALRDLVARRTPLFEFAIRTALADHDLDSAEGRVNAL
RQCVPMVARIKEPMLRDEYARRLAGWVGWEDVAQVIARVREEAQRRGMPE
RAGRRRTSATDEPSSRQARHAAGAAHRPDPKDPTLWPQREALKSALQYPA
LAGPVFDSLTVESFTHPGYAAVRAAIGAAGGAAAGQSGGQWIDAVRGHAA
SEAGASLVNELGVEAIKVDDDERMPRYIA