Antigen browsing page

The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_smegmatis_MC2_155
Gene IDProtein IDProtein DetailsSequence
320154520YP_004191801.1 6-phosphofructokinase [Mycobacterium smegmatis str. MC2 155]MRIGVLTGGGDCPGLNAVIRAVVRTCDQRYGSSVVGFLDGWRGLLEDRRI
161598320YP_885251.2 monovalent cation/H+ antiporter subunit A [Mycobacterium smegmatis strMLAVLLAHAVATALAPLMVARWGRMAFFPLSLVPLGSLVWVALNWPSPDN
161598319YP_890167.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium smegmatis str. MC2 MTGQEYDVVVVGSGAAGMVAALTAAHQGLSTVVVEKAPHYGGSTARSGGG
118474056YP_886026.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MNSSTHTDVVIVGAGPNGLLLAGELALAGVRPVVLERLPQPSPELKANGI
118474055YP_888425.1 cupin [Mycobacterium smegmatis str. MC2 155]MMTGVQMSESEMERYVARYGEMKSSDKAYVDTLLPDHEREIFNVIGPGPT
118474054YP_889326.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MITGAGALVRLALRRDRVRLAVWIAVLTSTMVYAPNTIRMTYPDEAQRQS
118474053YP_891086.1 MmcI protein [Mycobacterium smegmatis str. MC2 155]MARPIRIGVTLQPANAPDYATWRSAVIHAEELGADLVFGWDHFHRPEMAE
118474052YP_889617.1 glutamate--ammonia ligase [Mycobacterium smegmatis str. MC2 155]MGSSFIAANGLWTQHQEEAAAKLVAQLDDLNLRQVRISWGDQHGILRGET
118474051YP_884869.1 DNA gyrase subunit A [Mycobacterium smegmatis str. MC2 155]MTATLDVPEQNPDLVLDQSADDYWNHYQLTFALYSVSDRAIPSAYDGLKP
118474050YP_889098.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MLTLKAAGLVDVDTGELIRPGVVRVEGDRIVGIGGPAEGEVIDLGDAILL
118474049YP_888427.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMSAASHDVMTPPGAIGEFRRSWAALTAVTVGIAIGVGVLPTYVNGLVIPE
118474048YP_890769.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTATLDYDGDIAVLDLGDDENRFTPQFLDEVDALLDAVLEKGAHGLVTTA
118474047YP_890642.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVDKIGVPAPPLWQLSRHVRRNLGGAEPPEAPQRAGSKPAVKNHDRWSA
118474046YP_889622.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
118474045YP_887215.1 short chain oxidoreductase [Mycobacterium smegmatis str. MC2 155]MPDLATYGPWAVIAGGSEGVGAEFARLLAEAGVNLVLIARKPGPLQDTAQ
118474044YP_888899.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFSPIDSYDDASVVFTFGGYSVGVWVFFLLSLALFVGFFVRMIQHENRAY
118474043YP_884702.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MHALNEVDRILRSLQGIWDEEAVDELEHALQAAARAQEDGADDELVLAAA
118474042YP_886510.1 trans-2-enoyl-CoA reductase [Mycobacterium smegmatis str. MC2 155]MKQLILTKFGDPEDTVRLVDTPEPVAGPGKVLVRLEAAAINPSDLLLLKG
118474041YP_887320.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARTYECERVDLDFIDRAPFRFVSTVDLPITGEQLFEVLADETSWPKWAT
118474040YP_891139.1 dnaA gene product [Mycobacterium smegmatis str. MC2 155]MTADPDPPFVAVWNSVVAELNGDVNGDRQGDPSLPVLTPQQRAWLKLVKP
118474039YP_890920.1 maleylacetate reductase [Mycobacterium smegmatis str. MC2 155]MIRDFTYESRPSRVVFAAGAVGLLQREVTRLAIRRLIVVCTPPQAGLAQA
118474038YP_885273.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTAPQATPALAGRAVPRVDGRLKVTGQARYAADAEVPDALFAVLVGATVA
118474037YP_887290.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MLSLSALLADPTLELTLLVPGSPGAVDREVLWLHNTELPDPSPYIRATEL
118474036YP_889981.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDFSFHPPTRPDAQWRPGLVGGTFADRGLCGCSMNRGLLRFHDADSAPAA
118474035YP_889083.1 aminoglycoside phosphotransferase [Mycobacterium smegmatis str. MC2 15MSTFQIDTMRLADWMDGAALPGKGEPLTARFLSGGTQNVIYELCRGDARC
118474034YP_887354.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEAREQALRVLPLPYSLALRLRDAGVAPDVVSEYLSIDESALEGFYRIA
118474033YP_886243.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLDLVLPLACGGCGAASTRWCPRCAAELTVRDDEPHLVTPRTDPGVPVFA
118474032YP_889618.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMPMTGQFGRVDRRPLYEQVADRLREFIDTSGMQPGDKLANVRDLAAELQV
118474031YP_890904.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
118474030YP_885083.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium smegmatis str. MC2 1MVLWGALAAVGISAGVGLAPVDINLAAVNQSYRTAIASVEPAPGAVVGIG
118474029YP_884492.1 antigen MTB48 [Mycobacterium smegmatis str. MC2 155]MSEELQYELPGLERKAHECESTRPEGPGDATKPDELATTASVYSKLMASA
118474028YP_889238.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MTELAVDPETPVEQRFRFASRPNAAQVARAAGVPVLDVVVPVFNEQAALA
118474027YP_886356.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMHPQANGKSLPLSGITVLSLEHAVAAPFATRQLADLGARVIKVERPGSGD
118474026YP_889137.1 methylmalonyl-CoA mutase- N-terminus of large subunit [Mycobacterium sMSEQAQPRVETPSGIPLAPVYGPQDRSGEPPPPGTYPFTRGNFASGYRGK
118474025YP_890314.1 Lsr2 protein [Mycobacterium smegmatis str. MC2 155]MAKKVTVTLVDDFDGEATADETVEFGLDGVTYEIDLSAKNAAKLRNDLKQ
118474024YP_889923.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAPLLQAQIDIDAPVERVWSLISDLRRMPEWSPQCRLMKTIGPLRPGAL
118474023YP_887398.1 SOUL heme-binding protein [Mycobacterium smegmatis str. MC2 155]MFNQVRELVVGVAQGAASVIGCRVGTEEPSYRAEQLADGVELRHYAPRLA
118474022YP_887604.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MENSRNTFAIDARDLCGRSRRPRDVDFRYGFFLVCAPVSPSSADTGDETS
118474021YP_888571.1 glnA gene product [Mycobacterium smegmatis str. MC2 155]MDRQKEFVLRTLEERDIRFVRLWFTDVLGYLKSVAIAPAELEGAFEEGIG
118474020YP_888358.1 CoA-binding protein [Mycobacterium smegmatis str. MC2 155]MTTRDLTALFDPKSVAVLGASNDETKYGNWMSVQALRMTGTRPVYLINRR
118474019YP_887008.1 folA gene product [Mycobacterium smegmatis str. MC2 155]MRLIWAQSTSGIIGRDNSIPWRLPEDLARFKEMTMGHPVVMGRLTWESLP
118474018YP_885801.1 RNA polymerase ECF-type sigma factor [Mycobacterium smegmatis str. MC2MSAETDAPRALLRLYDEALPVVYGYFVRRCGDRGTAEDLTSETFLAAMDA
118474017YP_890388.1 type II secretion system protein F [Mycobacterium smegmatis str. MC2 1MLPLPVALTAGVVAGTVVVRRRDRAAAQHRRDESAALQGALDVLVGELRV
118474016YP_886974.1 oxidoreductase- Gfo/Idh/MocA family protein [Mycobacterium smegmatis sMESAFRSADIANAPTACSAVQVNRPRLPASPADQIRHLSMTTRTLRIAMN
118474015YP_891099.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGDQPGGVSPAPLAPNRASADDRDLPSRNDPMSSALSQVIGGPVGRHAL
118474014YP_888834.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRIADVLKNKGTAVVTISPQATVTELLAGLAEMNIGAMVVMGKSGLEGIV
118474013YP_888060.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAARTGSTKPYGWRRAVPAAIAGGALATGLLIGAAAPTAYAVPSTKENDA
118474012YP_887099.1 OB-fold nucleic acid binding domain-containing protein [Mycobacterium MATAERYLRRLTRRLTEDPEQLDVEELSEEAAITGAQKAIDCQRGQEVTM
118474011YP_885179.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGIETVVMSEPGRTHVQFVAVGQDDPLAAPLLDELADEYSSRYGSTRDAV
118474010YP_890084.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSGVKLGYIGLGNQGAPMAKRLADWPGGLTVFDVRAEAMAPLVELGAEAA
118474009YP_890581.1 O-antigen export system- permease [Mycobacterium smegmatis str. MC2 15MTFTDAAAQSKTMARARRDLVEGFAKRELWAHLGWQDIKQRYRRSVLGPF
118474008YP_890623.1 Rieske 2Fe-2S family protein [Mycobacterium smegmatis str. MC2 155]MQVTSVGHAGFLIESRAGSILCDPWVNPAYFASWFPFPDNSQLDWDALGD
118474007YP_888534.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQQRLPGWDDRDGWRDDRDNHWDNERDNDWDKAGPVSQEVREYCDDWDAM
118474006YP_889974.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSQLFGGEMGRGDAITRDETGIRRLIGTVAIAMALICGALVQQTPVASAA
118474005YP_890352.1 magnesium or manganese-dependent protein phosphatase [Mycobacterium smMRAPFDRVIASPVDLTGPGQRRLSLLLVEDDRADAILVEELIADAPDIDF
118474004YP_884875.1 MmpS4 protein [Mycobacterium smegmatis str. MC2 155]MGYAVYRVMKRFWIPLLLVVVVAVGAYAIVRIREAAGAHAPTVAEGTALT
118474003YP_888420.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMTDGWSTPEPTRAAALGTDLHLELAVGAGLRSGLEDALRTAVRSGRLAPG
118474002YP_890025.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGRGRAKAKQTKVARELKYSSPQTDFERLQRELSGGSASDGVNDADDDWA
118474001YP_884936.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSSVNAARQRETVAIRAQRIRGQRVPPFRKNRGIGPSATRKLYDRTALLQ
118474000YP_886753.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MPKSGTRPTSDRVREAVFNALAARLDFAGLAVLDLYAGSGALGLEAISRG
118473999YP_885845.1 gamma-glutamyltranspeptidase [Mycobacterium smegmatis str. MC2 155]MSQVQRPPTLSTGAMVSSSHPAASFAGARVLADGGNAIDATLAMAAVTWL
118473998YP_889090.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMPKDTPEKSGPLAGFTVVALEQAVSAPMCTRVLADFGARVIKVENPKGGD
118473997YP_885887.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTEGPRRPAGAAVLVVVASISQEVGAAFAVGLFATLGTLGAVFTRFAVAG
118473996YP_886138.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMAICATCGNDYDKAFTVSWEGHTEAFDSIECAAAHVAPECAHCGCRILG
118473995YP_888765.1 era gene product [Mycobacterium smegmatis str. MC2 155]MALTEFRSGFVCFVGRPNTGKSTLTNALVGQKVAITSNRPQTTRHTIRGI
118473994YP_888045.1 pyrG gene product [Mycobacterium smegmatis str. MC2 155]MPALRKHPQTATKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKL
118473993YP_887058.1 recX gene product [Mycobacterium smegmatis str. MC2 155]MTSSRPRLTSEPSDVPDGEQAQDPRTREEQAKNVCLRLLTVRARTRAELE
118473992YP_887747.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAKDSKDDAATGAGDKTDPADNPPPGPTDHGREGGMATREVTPELVESDD
118473991YP_885710.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMSNTRWRMFALLLLLVTVNYVDRGSLSVALPAIKEDFHISAEVTGLLLSA
118473990YP_890739.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MAEFDAVTAFADAPAAVLSTLNADGAPHLVPVVFAVHVPHVEGQPARIYT
118473989YP_884615.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGKNRKRGQRAKKIATLSAATVTATALTAGIAPIGEANAAVVAREAALQ
118473988YP_888903.1 salicylate hydroxylase [Mycobacterium smegmatis str. MC2 155]MAASFLVVGAGITGLATAAALQRRGHDVCVAEARADTASGAGISIWPNAL
118473987YP_885903.1 rpsM gene product [Mycobacterium smegmatis str. MC2 155]MARLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTD
118473986YP_887928.1 ureC gene product [Mycobacterium smegmatis str. MC2 155]MTALSRSNYAALFGPTTGDRIRLADTDLLIEITEDRSGGPELAGDEAVFG
118473985YP_886402.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIVVVGVFFLGMGVYALAAPQAILRPFDYVLKTASSRAEVRGVYGGFGLA
118473984YP_884988.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMEMAYLGELRTHWQALTAATAGLSAGLALSAYTNAAMGPQFLAAFGWERS
118473983YP_885440.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSSPMVARSLDVDLLARELGNWRTSSQTGPAYLGLADAIRLLIVDGRLPV
118473982YP_885770.1 PAP2 superfamily protein [Mycobacterium smegmatis str. MC2 155]MTAVEDSATGVGPEPTTGDPADTRDRARTRRGGILRILRYVAIAIWAAVI
118473981YP_890003.1 tRNA-dihydrouridine synthase [Mycobacterium smegmatis str. MC2 155]MSLTALDPARSALQIGSIALHSPVVLAPMAGVTNVAFRTLCRELEIARAG
118473980YP_885203.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAKEQRARAESGAGDTGATADKAPVAPSTTGSENTTASPDTAPVRPPTRV
118473979YP_886500.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIERDGAPTFEDVQELLNRSELTDVALYEHAGRRVDDAVDDEFSLQVLTR
118473978YP_889080.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSDIATPAPTAGEPDLARPWAPHRRKAYVALTAMTGFAFTIAVVGVGTG
118473977YP_885512.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSEDVSEIHRSARENRLKPNALGLTSVVFMVVATAAPITAITSNMPIMVG
118473976YP_887510.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVSDAPAPTAPSRPAGGPRISRSRAAVIVVAALAVAGALLGVVWSVLAP
118473975YP_884912.1 regulator of polyketide synthase expression [Mycobacterium smegmatis sMSRDLPLTVAAALTVPPLDLGSVVAGQRGLTREVLWVDIMHAPAESFVRP
118473974YP_890369.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118473973YP_885224.1 glutamyl-tRNA(Gln) amidotransferase subunit A [Mycobacterium smegmatisMTAGVMAPLAYLSATEARKAFRSRELSPLDVLDAQISQIEAHNGDRDTGI
118473972YP_885738.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMTKQPGKLQPHFDEVQAHYDLSDDFFALFLDPSRTYSCAYFERDDMTLEE
118473971YP_886887.1 glyoxylate reductase [Mycobacterium smegmatis str. MC2 155]MSDDYVVGLTADGADATGATIFGDIGLHRLEEAGISWRLLPPIPAHGPVD
118473970YP_891127.1 trxB gene product [Mycobacterium smegmatis str. MC2 155]MSTSQTVHDVIIIGSGPAGYTAAIYAARAQLKPLVFEGTQFGGALMTTTE
118473969YP_888377.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSAVPVLLELAVGEAPSQVSLAEADAIAATAQDLGVTAVRLVDRVGEQPA
118473968YP_890265.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSLLSAGAGTSEEFAARDMVRSWAAASGAVAAVRESETDPGAWRAAYQGF
118473967YP_886252.1 Fatty acid desaturase [Mycobacterium smegmatis str. MC2 155]MAVTDVPAFAHLTEADIENLGIELDAIRQDIEDSRGERDARYIRRTIAVQ
118473966YP_891094.1 rplI gene product [Mycobacterium smegmatis str. MC2 155]MKLILTAEVEHLGAAGDTVEVKDGYGRNYLLPRGLAIVASRGAERQAEEI
118473965YP_886805.1 adenine deaminase [Mycobacterium smegmatis str. MC2 155]MPTLLVEDIGLLLHGDAAIEPVRDTTLLIEDGRIAGIGVDHPNPDQVLSA
118473964YP_887024.1 DNA translocase FtsK [Mycobacterium smegmatis str. MC2 155]MLIQRSLDGCPAYRENPFPNRFVPLSCYRYQAVTCVADGDSGADATRLAD
118473963YP_885407.1 aminoglycoside phosphotransferase [Mycobacterium smegmatis str. MC2 15MPGDVQQLPTLSEHDQQALQAWVRSEKIGSTVSDVEPLTGGTQNIVVRVH
118473962YP_885774.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALV
118473961YP_887808.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVFWRYVRIQLMVFVVGIVGPIFLLVYFAAQPDPTIKWMYYTGLLLTAG
118473960YP_886119.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MFATCGAGVTITGPDALTERFVRETEPVRDFLIRNAIRLTHQRADAEDLV
118473959YP_888495.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MSLFFQILGFALFIFWLLLIARVVVEFIRSFSRDWHPRGFTVVILELIMT
118473958YP_887366.1 integration host factor [Mycobacterium smegmatis str. MC2 155]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLTDAETDE
118473957YP_885686.1 uricase [Mycobacterium smegmatis str. MC2 155]MSDIILGKNQYGKAENRVVRIYRDSPRHEIRDLNVSTCLRGDFSGAHLTG
118473956YP_888909.1 pyruvate synthase [Mycobacterium smegmatis str. MC2 155]MGDNGNGTGAAPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLA
118473955YP_884534.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDVAVVDRRDEEFLLDLLNTTPVVDGQERDDLADDDSARAWMRARGVESS
118473954YP_887494.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MPQTEHALDALRRSRYALLRSRRRDGTAVDTPIWFVLQGRTLFFRTKIGP
118473953YP_889179.1 adenylate cyclase [Mycobacterium smegmatis str. MC2 155]MNADNSLARQLGRVLETVTRQNSRLPSGTPEYGSWILGRVTESQSRRRIR
118473952YP_888078.1 PfkB-family protein carbohydrate kinase [Mycobacterium smegmatis str. MQQTVRARVACLGEPLVLVSEAGDPHPAGAELNVAVGLAGLGVPASLLGR
118473951YP_888698.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSLRAAGVRAFGDAVQTLEIHAPRPLATDEVLIEVRSAGIGNWDDIIRTG
118473950YP_885694.1 rhizopine catabolism protein [Mycobacterium smegmatis str. MC2 155]MALTLDTYRLLGRSGLRVSPLALGSATFGTDWGWGAERDDARKLFDLYVE
118473949YP_890511.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MAREPRRAPGTLTADDWLQAGYELLASDGMRALKIERLCEQVGATRGSFY
118473948YP_891018.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MNQARIDVHHHVVPPQYRELLAAQTTNAGGRATPDWSVDSALGLMDSIGV
118473947YP_885715.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVGAFVGVLMLILGVGAVAGVVVAVSMGLPTLAIAIGLISGAFFAGRAV
118473946YP_887614.1 succinate semialdehyde dehydrogenase [Mycobacterium smegmatis str. MC2MTIHDPRTGELVGRTPIATASECDAAIARARGAAAGWARTPAGERAAVLT
118473945YP_890644.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNHVEVKSMSKTFAARLNRLFDTVYPPGRGPHTSAEVIAALKSEGITMSA
118473944YP_887577.1 maltose/maltodextrin-binding protein [Mycobacterium smegmatis str. MC2MMSRESQPGLHRQLSRRNMLAAMGLAGAAAVSLPVLSACGVGGRTNAPNG
118473943YP_884783.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MASEPTNQFYLSRLQVINWGVFDGYHSIPFSPAGTLITGSSGSGKSSLLD
118473942YP_890520.1 ligC gene product [Mycobacterium smegmatis str. MC2 155]MDLPVQPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALVFRDGDDVVLQ
118473941YP_887888.1 MmpS2 protein [Mycobacterium smegmatis str. MC2 155]MTLVATDQHACEAGDRTTTRRSVVPRTLQKGWLPAVAVIAVGVGSVTVWK
118473940YP_889830.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMEGVEWLSAAEYEMWRGYLDSTRLLLRALDRQLEVDAGISFADFEVLALL
118473939YP_890065.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAYHHGDLKAVILQHAATLVAERGADGISLRELARTAGVSHAAPAHHFTD
118473938YP_886898.1 gluconolactonase [Mycobacterium smegmatis str. MC2 155]MTTEAGPERTTELATGFCFGEGPRWFEGLLWFSDMLGEAVHTVTLGGSMT
118473937YP_888820.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MTTTDDPTAPVGGRALTAAESTGLERDALGPWGVFAQGLAAAAPSVAVAV
118473936YP_889797.1 HPP family protein [Mycobacterium smegmatis str. MC2 155]MTSVELLDAETSGTSGPSRSSWFRSAAPPRQRLSVIVVETIVSLVALAII
118473935YP_886561.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MSMRDAVICEPVRTPIGRYGGMFRSLTAVDLGVTALKGLLERTGIAADQV
118473934YP_890571.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMTPRDGNVWVIPAELSSAALVRNAAFEFAQLTLPAPSVGGATLRPVADRQ
118473933YP_887404.1 deoC gene product [Mycobacterium smegmatis str. MC2 155]MTTTDPSAAEIAALIDHTLLKPEATTADVDALVAEALELGTYSVCVSPSM
118473932YP_887790.1 katA gene product [Mycobacterium smegmatis str. MC2 155]MTEPRATTTDAGAPVPSDTHSLTIGPAGPILLHDHYLIEQMANFNRERIP
118473931YP_890481.1 FwdC/FmdC family protein [Mycobacterium smegmatis str. MC2 155]MDQVTVSLTEFDLRTTPLREVNAALHQPGLEGEFVIEHPAGAHNVAVGVD
118473930YP_890685.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKKFGFAAIAASGLTAAILGLAAPAQAAPAMAPVSTGVDATTITAGVDRL
118473929YP_885336.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRLATDLETPRRVAVLSVHTSPLAQPGTGDAGGMNVYVLQTALQLARRGV
118473928YP_885543.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKLKTDKRRDVFDEAVDDTEDAEVEALDVAESEDTATEPESDEVTGPSGE
118473927YP_890848.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMVGMDIGGTVRERAARELRDRILTGALPAGTRIDLDAITAEFATSRTPVR
118473926YP_888720.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCGADGGHLASRTRAEHDDVIPHVPDLSVDVSAVEGPGAPVAELGLCREY
118473925YP_887594.1 membrane transporter [Mycobacterium smegmatis str. MC2 155]MSETDRSRSARAPRDRRRPPAVLIGGLSLVVLTVAVLQTAVVPVLGVIAT
118473924YP_884793.1 MmpS4 protein [Mycobacterium smegmatis str. MC2 155]MRRLWIPLLVIAVVAVGGFTVSRLHNVFGAEKRPSYADTKAADSKPFDPK
118473923YP_887882.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MRSVLEANWFYWALSVAVGLPIGLVLLTELHNTLARHGSYLARPVSLLRN
118473922YP_889275.1 T/U mismatch-specific DNA glycosylase [Mycobacterium smegmatis str. MCMSSVLHGLPPIVGEAPRVLILGNMPSVMSLASSEYYGNPRNAFWRIMGSL
118473921YP_890638.1 rhodanese-like domain-containing protein [Mycobacterium smegmatis str.MDDVEVAKADISAVPTTFDQSVVLLDVREDDEWQRGHVAGAQHIPMGEVP
118473920YP_890357.1 membrane protein- TerC family protein [Mycobacterium smegmatis str. MCMHVTQLEWIITLSVTIAVLLFDVVIIGRRPHEPTRRETATYLSIYIGLAI
118473919YP_890719.1 nicotinamidase/pyrazinamidase [Mycobacterium smegmatis str. MC2 155]MRALIVVDVQNDFCEGGSLAVTGGAAVARGITELLAGDHGYDHVVATMDF
118473918YP_886468.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPPSRGFPPPDPATRRLPRPPRPTGPAGPDGPTEQLRAPRPEPPTEQMRA
118473917YP_886363.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAFAQFRANLKRANSRRRLYAKINALPDSTVREELIAIAQRHEFQDR
118473916YP_886918.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MSVVRDTAAVMRVLDEDPVAGCMVAARVAEFGAEPGAIGGELWTRRRPSE
118473915YP_885843.1 5-oxovalerate dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTVEGANFIDGQWIPAASGRTFARHNPADPDDLVGVFPASDGVDVRTAVD
118473914YP_885998.1 DNA repair polymerase [Mycobacterium smegmatis str. MC2 155]MPEGSRVLALWCMDWPAVAAAGAAGLPPTAPIAVTLANRVIACSAAARAA
118473913YP_888842.1 competence protein [Mycobacterium smegmatis str. MC2 155]MTDEPELLDLRLVPAALTAWLVTAAGIVWYIAGSVLVVIVVTLLAAAVTR
118473912YP_885640.1 ISMsm7- transposase orfB [Mycobacterium smegmatis str. MC2 155]MMYPLVLDLAADGVPVTVTCRVLGFSTQAFYRWRKAPVSQRDWDDAHLIN
118473911YP_888867.1 lppH gene product [Mycobacterium smegmatis str. MC2 155]MAVVVAIGAGVTVTVISGGSGKNTSTAESQPSAPPVPVGALRGLLLTPAE
118473910YP_887742.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLRSEPDFSSAHGATDGAEDPQDDAHDDQDAADGVQDRKAREVADQEKDD
118473909YP_886769.1 aldo/keto reductase [Mycobacterium smegmatis str. MC2 155]MRTKTLGTLTTSAVGLGCMAMSGPYGEADRAESIATVQAALDAGITLLDT
118473908YP_890498.1 recR gene product [Mycobacterium smegmatis str. MC2 155]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLGRIR
118473907YP_891065.1 cupin [Mycobacterium smegmatis str. MC2 155]MTTDDKPAEVVLGQAGASPAYWYRAVLWNVLMSADQTLGEFTLLEQVIPA
118473906YP_889810.1 repressor [Mycobacterium smegmatis str. MC2 155]MPEPTPEDLRLALRAATLYYLDGLTQAEIASRLGVSRPTAGRLVAKAKAN
118473905YP_885066.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium smegmatis strMDHFPAADYPDCMFKQIGPAPVPADDLAAALAPFGHSRMLPREAYVDPAV
118473904YP_885733.1 rplK gene product [Mycobacterium smegmatis str. MC2 155]MAPKKKVAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATES
118473903YP_884846.1 nitrite extrusion protein [Mycobacterium smegmatis str. MC2 155]MPTLLKPKRITNWDPEDVAAWEAGNKYVARRNLIWSVVAEHIGFSIWSIW
118473902YP_889317.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRIGGGAAIQAARHRAGRFMRTPMVGAAALAPLILAGAVGASAPPHHGSS
118473901YP_889558.1 multidrug ABC transporter ATPase [Mycobacterium smegmatis str. MC2 155MIEITRLVKRFGATVAVDDVTVSFPAGTVTGLLGLNGAGKTTLLRLIAGL
118473900YP_888528.1 cyclase/dehydrase [Mycobacterium smegmatis str. MC2 155]MADKTAQTIYIEADPKTVIDVIADIGSYPEWVAEYKETEVLEVDDNGNPK
118473899YP_887806.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTQQHTAKYEAPQSTSAVVDPVCGRWIRRVILLAVDLATGFGFWFAVPIS
118473898YP_888898.1 ammonium transporter [Mycobacterium smegmatis str. MC2 155]MPPDVQDALDTMATINNEFYYWVSIALMFLIHAGFLAYEVGASRSKNVLA
118473897YP_884486.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MTSTAAAADTSSVTPGRPSTTRVTILTGKRMTDLVLPATAPIETYIDETV
118473896YP_889735.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MITIPDRHADGKIAESWAIWDTLGMLQQLGLVPSSSGAQQPA
118473895YP_886421.1 nuoD gene product [Mycobacterium smegmatis str. MC2 155]MSTSTVPPDGGEKVVVVGGNDWHEVVAAARAGAAAQAGERIVVNMGPQHP
118473894YP_889453.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGRHSFRAFTQAEKERPEEETAEQTVEAAEEPELTEPAEEATSSDDVTP
118473893YP_886527.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMAEQLRPVTRPRLYEVIVEQLCAYIYSNEMEPGDRLPAERDLAAKLGVSR
118473892YP_889293.1 LprE protein [Mycobacterium smegmatis str. MC2 155]MKKVAGVVLATLALAGCGGGDSTVSKTPGPTASQPATAAPETTVAAPAPT
118473891YP_888725.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSAPASSTPTLPASVHTLVVGAGFAGLAAAAAVLREDPRADLLIIERADE
118473890YP_890784.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MVGARAALGGFRLRRPTVVGVYDQYDVIADDYAQHFPDDFASRPFDRALV
118473889YP_885484.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDFMPSQEQISAAFEFAGLPVPAERLAENHTTYAETLALIRKASTPGLG
118473888YP_884712.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MTQTVLRAARWVDVAAGVVRAPAVVVIEGNRITEVNPAAPLPDTAAVIDL
118473887YP_884709.1 fabG gene product [Mycobacterium smegmatis str. MC2 155]MNRVAVVTGGASGMGEATCHELGRRGHKVAVLDVDVDAAQRVTDHLRSEG
118473886YP_889377.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKKSVTAGTAVLAAGAIALGPVVSQAPEAQRAMRAADLALSAAANPIEAA
118473885YP_888314.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKKIGVATMIAGGVVGAVVGLAAPAAGATSGQTPAGISSVTISADRHRGW
118473884YP_884654.1 O-acetylhomoserine/O-acetylserine sulfhydrylase [Mycobacterium smegmatMTDRTFGLATRAIHAGQRPDAATGARVTPIYANASFVFNDTDDAANLFAL
118473883YP_888862.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTALDDLIRIAADEGFDPARRWPVAADFGVAHILSDLARQAAHRDAMRES
118473882YP_887144.1 sensor kinase [Mycobacterium smegmatis str. MC2 155]MATGELSGARRSLARQSVVIALLAAAVDVGIFASSGIFRVAFAAACAMTV
118473881YP_888146.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLDHMRKHLRLLIIGVGAMVTLGTMSACSSGTTSETATPAATTPAATSAA
118473880YP_885025.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MRTDNDQWDITISVGQTALFVAASRALEARKPHPLAVDHYAEVFCRAAGG
118473879YP_888295.1 vanillate O-demethylase [Mycobacterium smegmatis str. MC2 155]MITSPRSSRRPSPSPRQMVESFEIELRRSGRVVTVPSDRTALSAVRDVLP
118473878YP_890778.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLIPAPHKPTVLARWLEKHRVDGHDHGRHHEYPTKWTYFESALMSREMSR
118473877YP_888659.1 penicillin binding protein transpeptidase domain-containing protein [MMLAGFLAMLLLFPVFGGGGMLVMRLSDQVAQDSELVVEGEVPIVSTMVDA
118473876YP_885728.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadA [Mycobacterium smegmatisMALSSKIVGMHYRYPDFYEVGREKIREHALAIKNDETYFYDEDAAAELGH
118473875YP_891089.1 transposase subunit [Mycobacterium smegmatis str. MC2 155]MTCRVLKLARQPYYRWRANPITDAEIIEAYRANALFDAHRDDPEFGYRYL
118473874YP_887534.1 trpB gene product [Mycobacterium smegmatis str. MC2 155]MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVT
118473873YP_885610.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MSVLKVANLSRSFGGIHAVNDVSFDVEKAEIVGIIGPNGSGKSTLFNLLT
118473872YP_889677.1 ksgA gene product [Mycobacterium smegmatis str. MC2 155]MAKEIDFRPRKAFGQNFVHDANTVRRIVSASGVHRHDHVLEVGPGLGSLT
118473871YP_887351.1 metallopeptidase- M24 family protein [Mycobacterium smegmatis str. MC2MTISQRRERLRQRLAAADLDAMLVTDLVNVRYLSGFTGSNAALLVRVDDA
118473870YP_886921.1 penicillin-binding protein [Mycobacterium smegmatis str. MC2 155]MATRTSPVTRTAGLLAVIGVLAASALSGCTPRPNGPEPAAEMFFAALATG
118473869YP_891020.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKHSAERSRGISRRDALRYTAAASVLAGLGAGVSAAPASAAAPQLIDFAA
118473868YP_886022.1 NADH:flavin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MNTQPNVFTDVFSEAKLGPITLRNRIIKAATFEASTPDALVTEDLINYHR
118473867YP_886222.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPVDTKNGTIVFPVWSIVLLACAVVLWASCLVISVRSGSATTERRFYWIG
118473866YP_888938.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNQPHPGNQWQHVPSQVQYGQPYPPGYYPPPPPPPKKRKTWLWVLVALVV
118473865YP_890211.1 NAD dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MRALVTGAAGFIGSNLVDRLLADGHQVIGVDNFWTGDPSNLEWALEQGNS
118473864YP_888532.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLLVELGLAVALLGTASNPPSAGQQPHPPVSATSAPADAAPVQTFTLPDG
118473863YP_888394.1 cyclohexanecarboxylate-CoA ligase [Mycobacterium smegmatis str. MC2 15MTAPTERRLANVLNGQYTPIDDDTAANWRAAGWWENRSIRSLLADAAQAH
118473862YP_890999.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 1MRKINTVTVVGAGYMGGGIAQVLALNGFKVQIADVNAEATQEALKRLDRE
118473861YP_887711.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTEPSHALRLLLGTRPPRADAERNLNSLLAATKQIVLDGELNPSAAQIAD
118473860YP_888632.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTDLKTNAPVLSVRDLTVGIGRREIVHGVSFDVHREQTVGIVGESGSGKS
118473859YP_888671.1 isochorismatase hydrolase [Mycobacterium smegmatis str. MC2 155]MERANRITPLEPVELDPKALGFPPNNVASIPPLAKHWQDLDFREILSRPA
118473858YP_886853.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MIRSEVDLSGGRVSYLTWSPERPSGTVVLLHGGGVDNAELSWGGIAPGLA
118473857YP_889100.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTELHDPTAFRTALQDWLGRTDLTPPEDHSLEAHMTQFRRVQRALYDADF
118473856YP_891043.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMRRVAVLAVPDVVAFDLSIPIEVFGRVRLADGMNGYRVQVCGTEPTVSAG
118473855YP_888266.1 ampC gene product [Mycobacterium smegmatis str. MC2 155]MFTAGRICAALIVLVALISAAPTASADPSAAVARAFAPLLDQYDVPGMAV
118473854YP_889988.1 PE family protein [Mycobacterium smegmatis str. MC2 155]MTVGSAVRQLIAVGSVIAAGAIAVAPAVVADTVLTVGGTGSALVGDQGPW
118473853YP_888217.1 [NiFe] hydrogenase subunit alpha [Mycobacterium smegmatis str. MC2 155MNPEVRTLSVGALARVEGEGALHVTLRDGAVVGTQLNIYEPPRFFEAFLR
118473852YP_887657.1 TRAP transporter DctM-like membrane protein [Mycobacterium smegmatis sMTAATGVVLVVVLVLFFALLAIRLHIGLSLMASAFVGVLLLRGTGAGLST
118473851YP_884648.1 lipoprotein Lpps [Mycobacterium smegmatis str. MC2 155]MPKSAKRRLITAFMAAGLVGGLVMSPSASADPEVPAPPVPVEPAAPPAPP
118473850YP_888035.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAEREFRTAPSDLAALEPFWPSRRLMAFDEWCCARI
118473849YP_885587.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDLVLGLAMTSRAIRWVLVEGTTGAGDAIDRGAIAVDDAAAYEPDGLLRG
118473848YP_887262.1 ruvC gene product [Mycobacterium smegmatis str. MC2 155]MRVMGVDPGLTRCGLSMIESGKGRQVIALDVDVVRTPADTPLQKRLLTIS
118473847YP_884775.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MDVFDGVENEVPGELAERLRTVGLIDHHVHGASAVRVGRAEFEASINEAS
118473846YP_889996.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTQDTSETCPVTSGSARPAAGCPAALGGYEAPPEVLGPDSLTWKIFGDWR
118473845YP_890050.1 caax amino protease [Mycobacterium smegmatis str. MC2 155]MAPMTAAKFRALALAAALTAWNVVVDPRLPERCRPVVRALVGTALLGLSR
118473844YP_886979.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSMCRNITELRGLEPAATAEEIEAAARQYVRKVSGITRPTGDNVDVFES
118473843YP_886053.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMRRRPDVTLAQLRYFVKAATYLSMTKAADELHIAQSAVSAAISQLEQQIG
118473842YP_888033.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSQDQNTDVPPNHLSIDPRSDFYSEEALQRGVGIRFNGVEKNNVHEYDVA
118473841YP_889576.1 SIS domain-containing protein [Mycobacterium smegmatis str. MC2 155]MNPDAFVADLERKPAVLSRLATSLAAGNPWADVVPPGIERVVLIGMGSSA
118473840YP_888196.1 tRNA (adenine-N(1)-)-methyltransferase [Mycobacterium smegmatis str. MMAGNRPTGPFAEGDRVQLTDAKGRHYTMVLNHGGEFHTHRGIIAFDDVIG
118473839YP_888485.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MMENFDWLMQGFAEAATPMNLLYAVIGVLLGTAVGVLPGIGPAMTVALLL
118473838YP_888189.1 ectC gene product [Mycobacterium smegmatis str. MC2 155]MIVRTTDEITGTDRDVSVGTWRSKRIILADDKVGFSFHETTIESNSVNEY
118473837YP_889106.1 short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis str. MAINPSDILLTGRVAVVTGGGAGIGRGIAEGLAAFGARVAIWERDPETCE
118473836YP_889859.1 cyclododecanone monooxygenase [Mycobacterium smegmatis str. MC2 155]MSQTTCGPTDTPTDIDIDALREKYRVEREKRLRAEGSKQYVETRDQFAQF
118473835YP_887576.1 arabitol-phosphate dehydrogenase [Mycobacterium smegmatis str. MC2 155MSNQVPEKMQAVVCHGPHDYRLEEVAVPQRKPGEALIRVEAVGICASDLK
118473834YP_887486.1 DNA polymerase IV [Mycobacterium smegmatis str. MC2 155]MEGTVARTASRRWVLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVV
118473833YP_885935.1 eutC gene product [Mycobacterium smegmatis str. MC2 155]MTVSNDIAVQQFWDELRKTTQARIGLGRAGNSLPTQQVLELAAAHAAARD
118473832YP_888930.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMASDVMLQHLDYLLALASERHFGRAAARCHVSQPTLSVAIRRLERDLGIT
118473831YP_885000.1 rhaI gene product [Mycobacterium smegmatis str. MC2 155]MSAINVHPALDNLAIELPSWAFGNSGTRFKVFGTPGTPRTVEEKIADAAM
118473830YP_885956.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGERVDGTARPATAEDTIALGAQLGAHLKAGDVVVLSGPLGAGKTVLAKG
118473829YP_886080.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MRKLTWLAALLAALAMAMTLSGCGRSAEGGGGGDGDAKGTVGIAMPTKSS
118473828YP_888729.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSHELHLLAALSALSPPKLADVNADIREVCAAVTGLSPLPAESRGGAVDP
118473827YP_889904.1 prolyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MTIVTVNERNARVAAAVAAAGIEPAIRILDADAKTAAAAAEQLGCEVGAI
118473826YP_886470.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPTWSWIAIGVVVAVLVILAAICLVSMNRHKRSERLRSHFGPEYDRTVDT
118473825YP_889838.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MRRPRWRRVRMRMMADTSKLTPTRRAVLARRIRMFVAATITYNVIEAVVA
118473824YP_885664.1 gluconolactonase [Mycobacterium smegmatis str. MC2 155]MYTTRRNLLFGTAATIAAMTTGACSSSAAQQPQAQPSAPPTPSFQPNQRY
118473823YP_889135.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRLGVMIGAERGDMTRKVNKLAADIQWAEAAGLDSAWMPQVPDDFDCLSM
118473822YP_888515.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAMATYLIDLSPEDMQRRLPDALRVYVDAMRYPRGTEEQRAALWLEHTR
118473821YP_887698.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTAPTMSAVVPDPAWRDLRQQVRSFLADQLAAHRFEPGIDGWLTGWSDTF
118473820YP_886949.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSREPSWEPDVLPGFWQRTIDLGPDPDGEGDLFATLVRRGDPESTGRAE
118473819YP_890214.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNQPMTTPGALNWTAAPVQLPDMPPIQAGEDAMSMTIAALLPTLHASMTA
118473818YP_887724.1 gluconate 5-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTGLFDLTGRLAVVTGSSRGIGLAIAAGLAEAGARVVLNGVDGPRLEHTC
118473817YP_890990.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVVPARDGVCEARRALDEASLLAEVELDVDAVPESVDSVESAQPIPGGAN
118473816YP_885550.1 dihydrodipicolinate synthetase [Mycobacterium smegmatis str. MC2 155]MNGLMQPGVWGVLATPFSGSTLEVDDNGVAVLAEHAQAVGATGLTVLGVF
118473815YP_890152.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPARNEQGRTQTPDVGDLARSMLLLHGIHDDDDHPAGNQPGTGSWSKAPN
118473814YP_888103.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MTPSETPSSITVDDTYTGHVEPGTAARRTLADATIVKASVGPMDNNCYLV
118473813YP_889309.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MADRVDARRATWWSVVNILVIVYALIPVLWILSLSLKPTSSVKDGKLIPT
118473812YP_890024.1 glycine cleavage T-protein (aminomethyl transferase) [Mycobacterium smMSAVPTPEGSPDAGAVWHYGDPLGEQRSAATDAVVIDRSHRAVLALTGKD
118473811YP_886449.1 ftsE gene product [Mycobacterium smegmatis str. MC2 155]MITLDHVTKQYKSSARPALDDVSLKIDKGEFVFLIGPSGSGKSTFMRLLL
118473810YP_887754.1 dehII gene product [Mycobacterium smegmatis str. MC2 155]MALRALVFDVFGTLVDWRSGVADAFRSAGVVGDPDDLADAWRARYRPILD
118473809YP_886967.1 DHH family protein [Mycobacterium smegmatis str. MC2 155]MPVTTTDPKTGLLTGPDAQIAGARVDARGAADLLTAASSVSVICHVYPDA
118473808YP_889329.1 glgC gene product [Mycobacterium smegmatis str. MC2 155]MRELPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVN
118473807YP_889953.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVERLAAEKD
118473806YP_890495.1 mur ligase [Mycobacterium smegmatis str. MC2 155]MLTVRGRAALAAGAAARWASRVTGRGAGAMIGGLVAMTLDRSVLRQLGQG
118473805YP_888664.1 monooxygenase- NtaA/SnaA/SoxA family protein [Mycobacterium smegmatis MTKQIILNAFDMNCVTHIVAGTWRHPESQARRYKDIEYWTDLAKVLEKGL
118473804YP_886057.1 endoribonuclease L-PSP superfamily protein [Mycobacterium smegmatis stMTMTDIATPTHTRIRPFNTKDTYPEQNLDNDLCQAVVAGGVVYLRGQIGQ
118473803YP_889116.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MDFERKTIVVDGLTTAYLEAGDPARDAVVLLHGGEFGVSAELGWERTIGA
118473802YP_890060.1 purS gene product [Mycobacterium smegmatis str. MC2 155]MNAVAKVVVHVMPKAEILDPQGQAIVGALGRLGHKGISDVRQGKRFELEV
118473801YP_889520.1 purT gene product [Mycobacterium smegmatis str. MC2 155]MTTIGTPLSPRATKVMLLGSGELGREVLIALQRLGVETIAVDRYENAPGH
118473800YP_887069.1 GTP-binding protein [Mycobacterium smegmatis str. MC2 155]MTYPENSVAPSTGELALEDRASLRRVAGLSTELADVSEVEYRQLRLERVV
118473799YP_886506.1 transposition helper protein [Mycobacterium smegmatis str. MC2 155]MTPTPRTAKNTATVTEEPPSTAASRYQKLRSHLAELKLHAAAAALPAVLD
118473798YP_886027.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MTPSDPLKQQRSLSFGSEAAAYERGRPSYPPEAIDWLLPDGAHDVLDLGA
118473797YP_887300.1 branched-chain amino acid ABC transporter permease [Mycobacterium smegMDILIGQLATGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIMAGCYTA
118473796YP_885010.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTAKAKEYAERGVAELHYARKMFEAGALRLEPPQHMLALVADIRTWGEIG
118473795YP_889842.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MENVWVLGGYQSDFARNLTRENLDFADLTREVVENTLAHAKIDASDIGVV
118473794YP_885170.1 Na+/H+ antiporter [Mycobacterium smegmatis str. MC2 155]MGASLLAALVVAVLVAAVARRFDVSAPLVLVVAGLAGSTLPGFGDVALDP
118473793YP_885713.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGRSVAGIVGVASGLIWLLIVFVILKSAFPSSASADPHGYGRIFGVLMY
118473792YP_888099.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMPSLATESDHSVIFVGFEGEIMKLHGATALVTGANRGLGHHLAVELIRRG
118473791YP_889746.1 alkaline phosphatase [Mycobacterium smegmatis str. MC2 155]MPDTDRLIISRRTLLRASLAGALLVPAAACGTPSSAPSSTGLIANRPRLT
118473790YP_887449.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTRRPPGTRHLLAERVCGGELSPDTSSSTGPIGVGQQLRLPSGPPEHLEY
118473789YP_888753.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRGNAREERRSGGCGDDERRRRRRGFWCSTSFVLKVTGCLSGQVGAR
118473788YP_886564.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MIDRTGLAEFLRHRRESLQPEDVGLPRGRRRRTNGLRREEVAALCHMSTD
118473787YP_885860.1 transporter LysE family protein [Mycobacterium smegmatis str. MC2 155]MAVHSIIGDWKLWLGFLLVAIPVCLSPGAGAIQSMSSGLTHGLVRSYWSI
118473786YP_887251.1 HIT family protein hydrolase [Mycobacterium smegmatis str. MC2 155]MTDPDERQIVDRGVGDPDHLQRLWTPHRMSYIAEAPMKKRGEGGSAGSAE
118473785YP_887384.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTFQGWLNVSPSTPNAIVGTIRAVVCAPLRVVLPARGTDAPPQSQAPQT
118473784YP_890410.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MSDLQHPAYGLLRPVTGSASVLLCNNPGLMTLEGTNTWVLRAPRSDEIVV
118473783YP_890790.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MHLVTAAVMFGVAAVRIRRDGGLYDSLGELSLKS
118473782YP_888316.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSASKVIERALPLSASDKIGAILGRYGLVIVIGWIGALKFADFEAHQIQP
118473781YP_884893.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMTSEPQNKSDQAFVEIERMIVLGEIAPGSLVSEKQLMELTGLGRTPVREA
118473780YP_886794.1 translation initiation inhibitor [Mycobacterium smegmatis str. MC2 155MSVRERLSALGIEIPPPAEPKGAYFPSRLVGDQLWISGTTSRRPTEPGAF
118473779YP_886401.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPTPIPTPLPRTCYPAVWLWPGQGLYSGPALGLQPHSGSVWCLVVGVDAP
118473778YP_890418.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MTDPARTLPLSAMISGAAGMLIPLAGARDPGDDPLVSDVALHEPGEPADY
118473777YP_888175.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCGNGDSEQDQGEKVSGPQGSDPAQPWPGQQPEPGRDQPAGGEAWQPPTG
118473776YP_886845.1 carboxyvinyl-carboxyphosphonate phosphorylmutase [Mycobacterium smegmaMEARRKLNAQIESGTLTVAPGVYDGLTAALVKRREFNAAYMSGAAVAASL
118473775YP_889493.1 PhoH family protein [Mycobacterium smegmatis str. MC2 155]MTEQAVRTYVLDTSVLLSDPWACTRFAEHEVVVPLVVISELEAKRHHHEL
118473774YP_889805.1 ATP-dependent DNA ligase [Mycobacterium smegmatis str. MC2 155]MERYERVRLTNPDKVLYPATGTTKAEVFDYYLSIAQVMVPHIAGRPVTRK
118473773YP_885231.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMTEPADAALAETARRRKRMDHDHPFYKWIALSNTTLGTLMATINASIVLI
118473772YP_887087.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNATLTSPELTRADRCDRCGAAARVRAKLPSGAELLFCQHHANEHEAKLI
118473771YP_888337.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMNEEATRQCGVSYGNTLQTASRALARALSEGLRNRRPVRRAG
118473770YP_885095.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAHSHSHSHSLSGPSPLGPLAARIVVGLLVAIGVVVIVGAALLWPSRQKV
118473769YP_887940.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGEVAMSDTNVWLSLLAILAVVLLTFGTAVFVAAEFSLTALERSTVEANA
118473768YP_890456.1 two-component system- regulatory protein [Mycobacterium smegmatis str.MTVTTREIRLALVDDHAILRQGLRSLLEREDDLVVVGEASSEAEAEAMVA
118473767YP_890548.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MNFLQQALAFIFTAENWAGPSGLGARIVEHLEYTAVAVFFSALIAVPLGM
118473766YP_886790.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAIQESTLLPNGLTVDTAKAEAARAYELDRAHVFHSWSAQEEISPMTVT
118473765YP_890653.1 monooxygenase- flavin-binding family protein [Mycobacterium smegmatis MTEHFDVVIVGAGISGISTAWHLQDRCPTKSYVILERRANIGGTWDLFKY
118473764YP_888031.1 dipeptidase 2 [Mycobacterium smegmatis str. MC2 155]MLIDGHNDLAWAMRQEYDADLDAVDLTAMAPRLHTDLKRLEAGGVTGQFW
118473763YP_887918.1 zinc-binding alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 1MSSSAMTAWQVVSPGPVDTRPLHRATVPRPEPGDGELLVAVRACGVCRTD
118473762YP_886294.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALK
118473761YP_890137.1 quinone binding protein [Mycobacterium smegmatis str. MC2 155]MALQPISAVIEIVATDLSRSLDFYRLLGLDVPEPDGPHVEVALPGGNKLA
118473760YP_889548.1 aerobic C4-dicarboxylate transporter [Mycobacterium smegmatis str. MC2MSTTLDRQPEPAPPRRRDRTHWLYIAVIVAVVAGVAVGLLAPEVGKSVGV
118473759YP_888539.1 ubiquinol-cytochrome C reductase iron-sulfur subunit [Mycobacterium smMDRIASMSQDSPDIKGTDAPGQTGVPGQPTDAELAEMSREELVKLGGKID
118473758YP_886447.1 transporter small conductance mechanosensitive ion channel (MscS) famiMTISSSAATVLAFSVADRWHDFWHGEIGVWILTKGLRIALLLIGGLLAAR
118473757YP_889430.1 alpha-methylacyl-CoA racemase [Mycobacterium smegmatis str. MC2 155]MAGPLQGLRVVELAGIGPGPHAAMILGDLGADVVRIERPGKGGGVPAGDR
118473756YP_889595.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTRKRLAIAGLAFGLLALIAGVLQVSVYLINDGPRHLVVGIFAVSVGVSV
118473755YP_885310.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADSDASAGELTREMEMAHRMFRREFGLAVDVVRGVAAGEVARAGVIADH
118473754YP_884935.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTVWFITGASRGLGAQIARTALDHGADVAVGVRNPDLLPSDIAERAFAVR
118473753YP_885995.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKQLTRRLTVIAGGAAVIGMISFTAACGSEEEAPETTTPTTTTTTTTTSP
118473752YP_890079.1 purD gene product [Mycobacterium smegmatis str. MC2 155]MAPGNAGTSSIADQYDVDVTSGEAVVKLAQRIGADLVVIGPEVPLVLGVA
118473751YP_890582.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MAGPVSVLSENECWRLLASVPIGRFVTTIGTRLEIYPVNFAVQERTVLFR
118473750YP_885837.1 multidrug resistance protein [Mycobacterium smegmatis str. MC2 155]MTDVRQTPTPDAAPPTGADTGTPLGLAALLAGTLVGTVSNNVVNVPLDAI
118473749YP_887903.1 LacI family transcriptional regulator [Mycobacterium smegmatis str. MCMRLGTTAFAIASATALGLGLTACGAGDPAANSDTTRIGVTVYDMSSFITA
118473748YP_886989.1 iron repressor protein [Mycobacterium smegmatis str. MC2 155]MSPDGDHRDLSSVAQDYLKVIWTAQEWSREKVSTKLLAERIGVSASTASE
118473747YP_884483.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAMNTDAAVLAKEAANFERISGELKGVIAQVESTGSALAAQMVGQAGTA
118473746YP_888931.1 oxidoreductase alpha (molybdopterin) subunit [Mycobacterium smegmatis MTRASDVRDYDADYDDHDVITSGPKHEAAGVKAVMVSMQRGLTQMGPVRT
118473745YP_890689.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRPVVTTALTGLLLATVTAPHAAAATVPEVPVDPDRTVFTDNPRIVDQHP
118473744YP_886717.1 wrbA gene product [Mycobacterium smegmatis str. MC2 155]MTSSATKVAVIYYSATGHGTTMAQRVAASAEAAGAEVRLRHIAETQDPQT
118473743YP_884461.1 extradiol ring-cleavage dioxygenase- class III enzyme- subunit B [MycoMDQWSTTRPSLEDVPSVMPAAFVGHGSPLNAIESNRYTAAWKRFGQAVPR
118473742YP_886075.1 pentachlorophenol 4-monooxygenase [Mycobacterium smegmatis str. MC2 15MTIATDVLIVGAGPVGLAAAMVLTQQGRDVTVVDGQAEGANTSRAAVVHA
118473741YP_886088.1 ABC transporter periplasmic protein [Mycobacterium smegmatis str. MC2 MRKMFAAAIGVVAVAAAVTACGSGKAPGSEGGSAPDGALTLGFAQVGAES
118473740YP_889814.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMTDSLPGLDKDENRTWAHFLESTTLILDELNRQLMSCHDMTLPDVQLLDL
118473739YP_890432.1 manganese containing catalase [Mycobacterium smegmatis str. MC2 155]MFIHNKDLQFEVRVTQPDPRFATLLQEQFGGANGELKAAMQYFTQAFVLR
118473738YP_887609.1 response regulator receiver domain-containing protein [Mycobacterium sMALPAVSDDWLVALATGGFGHQSSLVTMGLTNSEQEDMMTTATTPLVPPF
118473737YP_885953.1 glutamate decarboxylase [Mycobacterium smegmatis str. MC2 155]MSHKQSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPSAAYRFIHDELMLD
118473736YP_888586.1 low molecular weight protein-tyrosine-phosphatase [Mycobacterium smegmMSELHVTFVCSGNICRSPMAEKMFAHQIAERGLRDVVRVTSAGTGSWHAG
118473735YP_888301.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MICELTPGRITHQPPHEQGELACRSERARRIEPTTVALTAWMRPSTSSST
118473734YP_886283.1 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [MycobaMKMAEDVRAEIVASVLEVVVHEGDQIGEGDTLVLLESMKMEIPVLAEVAG
118473733YP_886652.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSETPVELHEYQPTVPKVYIALAWLWVAVPFAYGVYQLLLKVGQLFG
118473732YP_888673.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKLGLRLPQRLNVDLRHDVVWAARAAEAAGFASLWTYERLLFPADPVESY
118473731YP_887922.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAEVLVTGGDTELGRAIAQGFRDAGHNVVIAGARRDDLEVAAKELDIESI
118473730YP_887459.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGPHVIPFLPAYIPVEICDIAGIDPAVPDAVAQCMAAVQADVREDGVSA
118473728YP_885079.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDLPPQPPSDQEASAPVPLPEAHWEFPDLQPENRPRERSIEHKMLTPVFG
118473727YP_887264.1 ruvB gene product [Mycobacterium smegmatis str. MC2 155]MGRFEDDAEVEDREVSPALTVGEGDIDASLRPRSLGEFIGQPRVREQLQL
118473726YP_888550.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MKLLGRKNNDDDKNVASDAADSAVDEQNGPAAEDRPRTTPPKGRPTPKRS
118473725YP_887423.1 ABC transporter ATPase [Mycobacterium smegmatis str. MC2 155]MASVTFSKVEKSYGAVTVVKDLDLELADGSLTVLVGPSGCGKTTSLRMLA
118473724YP_889342.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARYPDFASQLADTVFKLGMRPAAADLLRGPVGELARFEAFARR
118473723YP_887511.1 lipase [Mycobacterium smegmatis str. MC2 155]MDLSSAAKAADAEWIGRAPHEELDRDARPGLPGEDPFYLPPAGYHHAEPG
118473722YP_885318.1 polyphosphate kinase [Mycobacterium smegmatis str. MC2 155]MSDFDDDDLAGDLPTLWTHEPHQHLAFRQGDQVSRIKTDGTPGFRGSKSD
118473721YP_885416.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAVVAATDRSVRLEVTDRAPQERGDAARNRAAILDAARRLIAERGPDAVS
118473720YP_886459.1 peptidase M20/M25/M40 [Mycobacterium smegmatis str. MC2 155]MEFDFEKFADLIDESLIVDLAKRVIETPSPTGEEYDLAVLLKEVYGDLGL
118473719YP_888797.1 coproporphyrinogen III oxidase [Mycobacterium smegmatis str. MC2 155]MTTRTAPLGQPDLAPTPGRPFGIYIHVPFCATRCGYCDFNTYTPSELGGA
118473718YP_888958.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNVPERGLWIEDPRDRGDLMTFVDRSLRLDEAAVVRLRQRTQNERVVAWV
118473717YP_885461.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTYLESILKVLVVGLILGAGLPALFATGLLAFAGTDADADGTAAARNPVM
118473716YP_890686.1 tetracenomycin polyketide synthesis O-methyltransferase TcmP [MycobactMTDKLKVDLSGAPQTMLATFYAKALDARLPTPILGDDMAAEIAERIDYDW
118473715YP_885296.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGTPNGNQEGGLAAIYLVAGAVVLIVGVVALFVAKDARLERRLYWATAA
118473714YP_886347.1 major facilitator family protein transporter [Mycobacterium smegmatis MSTPALNDASPTGTHAVPLTETPEQARRRQRRMALAAVVGTAVEWYDFYL
118473713YP_886942.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTDGSTTSNRRATDDIFTKVTPGRASEMILDQIRSLIRDGHLKPGDRLP
118473712YP_890706.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVIFSLRTGVRMAAAIVSVAALGVVPACSAGLGGPPSSRTAADGVIRFTF
118473711YP_886328.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRFWLAVLSALVLAVGLVACDTDDDGWNPEAQFAPVKRPAFGARETDGKL
118473710YP_886267.1 DNA-binding HTH domain-containing protein [Mycobacterium smegmatis strMLCGRDRELSELGEHVAAAEHTARLVVLTGEPGIGKTALLRDLTQRHGAW
118473709YP_886439.1 antigen 85-C [Mycobacterium smegmatis str. MC2 155]MTFIDKIRGHWARRMTVAAVAALLLPGLVGVVGGSATAGAFSRPGLPVEY
118473708YP_887704.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MNRVTDEAVELSGSDARRIAFAAFVGTALEWYDYFLFGTAAALVFNRLFF
118473707YP_886992.1 LppU protein [Mycobacterium smegmatis str. MC2 155]MQAGDCLELGGTFDQPEATRAECGSKKSNYKVVQTVADSARCPADVDSYY
118473706YP_884756.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMHSGGVLIVVDSPPGTAKARTRDPDRKNRILLAASELIGRRGFHAVSIAD
118473705YP_890379.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
118473704YP_888889.1 rplU gene product [Mycobacterium smegmatis str. MC2 155]MATYAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTS
118473703YP_889730.1 acetyl-CoA carboxylase carboxyltransferase [Mycobacterium smegmatis stMTALHSTIDATSPGFNEAAAVMTAKLSELDAEHAKALGGGGPKYVDRHHA
118473702YP_887060.1 glutamate permease [Mycobacterium smegmatis str. MC2 155]MEIFDEYRDEIFAAFWTTIQLTVYSAVGALILGTVLAAMRLAPVPVMNWM
118473701YP_889243.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKIKYTLAGLGAAAAVSMGAFGVLGGSGLSGSAQFDEALGPTMGETSTQT
118473700YP_886837.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSRFITVSLDKRGVSCVARLLDEVAPRTCAAVWDALPLSAQVFHGKYARN
118473699YP_886489.1 long-chain-fatty-acid--ACP ligase [Mycobacterium smegmatis str. MC2 15MNVLSAALTEAMTTSSADLVVFEPETRTWHRHPWGQVHLRAQNVAERIGQ
118473698YP_890764.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTIYRLHVVADDVAEVVGNAAGLIVDHVMAGWRVTVELAGGEGIRPLEIL
118473697YP_885397.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MAPRSATVTVVLPCLDEEQSLPAVLAAIPHGYQALVVDNNSTDRTAEVAR
118473696YP_891057.1 3-isopropylmalate dehydratase small subunit [Mycobacterium smegmatis sMTGRVWVFGDSLNTDAMYPPDAMKLDVAAAAKMVFYQVRPGWTDEVQRGD
118473695YP_890666.1 [NADP+] succinate-semialdehyde dehydrogenase [Mycobacterium smegmatis MNMTQYAVTDPATAEVVATYPTATDAEVQAAIEAAHKTGRTWAKSTTVAE
118473694YP_886814.1 oxidoreductase YdbC [Mycobacterium smegmatis str. MC2 155]MGASTFALGSFTVHRVGFGAMQLPGPHVFGPPRDHDQAIAVLRRAIELGV
118473693YP_884642.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAKSVAPRGFARERVLEAALNLFAEHGVNGTSLQMIADRLGVSKAAVYYQ
118473692YP_887587.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAFNAEVTSTPARSGALMAMGSMACVQIGLAVAVSLIDEIGAEGAAWLRL
118473691YP_885019.1 methyltransferase- - family protein [Mycobacterium smegmatis str. MC2 MGDTPNPDAGRAVADTGLLVAAIRAAESRREDRLFEDPFAEKLAGETGRR
118473690YP_885525.1 tryptophan-rich sensory protein [Mycobacterium smegmatis str. MC2 155]MRPITLAKTASAVIATGVVGGLASRGSQTAWYQSLRKPSFQPPPAAFPIA
118473689YP_888413.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MAVYIGLNVEYFLLDHPSTSIWQGTADLRPDALNHGWREYGARVGIWRTI
118473688YP_886061.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGPFEEITAQARARLQTLEAVAEELARLRADQSERSDAASRRRVLDGLV
118473687YP_890864.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGESAAGWSLHFYDFQRRFVSVDDVVPGLGDIADWAKRNGARDGTPFFL
118473686YP_889259.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MLWALLRQYVRPYRWLLAVVAVLQVISNMASLYLPTVNAAIIDDGVAKGD
118473685YP_885046.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGDNLRVNDDIDIKDIERVKYRYLRALDTKNWDEFADTLTEDVRGDYGQS
118473684YP_889610.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MESALQWVSLRPSAFVSNFLGMWAPQLQAGDVVAGPYATASMAPIAEHDI
118473683YP_887824.1 molybdopterin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTSGTATNATGTEWHHTACILCECNCGIVVQVENRTLAKVRGDKDHPASR
118473682YP_887517.1 transporter LysE family protein [Mycobacterium smegmatis str. MC2 155]MEWHVWLAFFGAAIAISVSPGAGAIQSMATGLTHGVRRGYWSILGLEIGL
118473681YP_890878.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTRMSRWALLGLWSVFLVLPVLATLLYSLATVWRGRAFPDGYTLAWWVQA
118473680YP_888595.1 alkyl hydroperoxide reductase [Mycobacterium smegmatis str. MC2 155]MLDVGTPAPDFTLRDQNNRPVTLSDYRTGENPRDVLVVFFPLAFTGVCEG
118473679YP_888920.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSTQADLDLESHKVVHDERVKEQNKLQRLIIRPEMGAAVGAIAIFILFLI
118473678YP_888935.1 clpP gene product [Mycobacterium smegmatis str. MC2 155]MSNIHPSLDARLQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGV
118473677YP_885002.1 rhaB gene product [Mycobacterium smegmatis str. MC2 155]MSAIQVAAVDLGATSGRVMVADIDGDRLDMRTVARFPNDPVTLWNGTGDE
118473676YP_884441.1 panD gene product [Mycobacterium smegmatis str. MC2 155]MQRVLLASKIHRATVTQADLHYVGSITIDAELMAAADIVEGEQVHVVDIT
118473675YP_885379.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVADVLAYVAARLVLVAVLAAVIYVVGRMVVGDFPIVVALLFSFVIALPL
118473674YP_886740.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVGSSGVGISIVALPSSVGPPGGGASSLVGSSVGISTVALPSLVSGAVVS
118473673YP_889961.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MSYPRDMVGYGRTPPDPQWPGGAAIAVQFVLNYEEGAENCVLDGDPASET
118473672YP_886841.1 transporter ATPase [Mycobacterium smegmatis str. MC2 155]MTDQRSVRPIVEVSGCVQRFGGLHALGPIDLTIRSGEFVSIVGPSGCGKS
118473671YP_889931.1 moaA gene product [Mycobacterium smegmatis str. MC2 155]MTVTALGLPTVARSTGDGSAGASPAPADGPLVDTYGRAATDLRVSLTDRC
118473670YP_890277.1 LamB/YcsF family protein [Mycobacterium smegmatis str. MC2 155]MPSTVDLNADLGESFGVWQLGDDEAMLGLVTSANVACGFHAGDPALLLRT
118473669YP_888837.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWRLRVVHSTGYAYKSPVTASFNEVRLTPRSDSRQNVILNRVETVPATRS
118473668YP_888897.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MYVRWHKNLRRGKELKGVFLRRISGVLTVYRSYANPCCVSRRSPRVKSG
118473667YP_886581.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MSVAETGTSDAVRYEVNDAGVAVITLNRPERLNSWGADISAGVYASFDRA
118473666YP_886909.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGIVTTSSETAFPQSAETVYDFVTNPANWTKTYPGSAHIEGLPDRLPLQV
118473665YP_886115.1 Fatty acid desaturase [Mycobacterium smegmatis str. MC2 155]MSTPTYTLTPDQAEEFGRELDAIRERVIADLGERDATYIRNVIKAQRTLE
118473664YP_886668.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMTVKHAVVIGAFAVAAVAGQLAVAAPAEAKRCPAGTVEKFEGVCIKGSG
118473663YP_890125.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MHRDRTMLKVGIFTMVMLLVAAGLVVVFGEFRFAAGQSYHATFSEASRLK
118473662YP_888469.1 inositol monophosphatase [Mycobacterium smegmatis str. MC2 155]MTSTDAELAAAVAKEAGELLLGIREEVGFYDPYYLGDEGDRRSNALILKR
118473661YP_887972.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSYQNKFYLTGSINQPTVADAFRFVGSRLQPAVTRVPDGEPGERANWVLT
118473660YP_885162.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTHDNHDNTALPQPMWPGDDAAPAGLREPGSPLARLAARLFPWRYDRQLL
118473659YP_888761.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNAMPDLLQRLSTVLAEVMSVAEEADGALTITSGGSVALVRVVAIAEDLE
118473658YP_884717.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDGIGRNLLQLREVAIPEPAHGEILVRVSAVALNHRDKMVTENGRGLQLT
118473657YP_890955.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MPRTVQFAEYGDTDVLTVVDTPAPEPGPGQVRLKVRAAGLNPIDWKIVAG
118473656YP_887890.1 D-serine/D-alanine/glycine transporter [Mycobacterium smegmatis str. MMSEQTLPEAEHLSRQLSNRHIQLIAIGGAIGTGLFMGSGKTVSLAGPSVI
118473655YP_889477.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDTRVIVYPGTDNELHGVVVEDFADLAGTAVEIAGERIVGPARRYAVNVD
118473654YP_887097.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMAFGKRKKSAADDKRTGDQPVAAHAAPSAADEQPDEDLQGPFDIEDFDD
118473653YP_886614.1 hybA gene product [Mycobacterium smegmatis str. MC2 155]MASVLWFQGGACSGNTMSFLNADEPNVVDLIVDFGLDLLWHPSLGLELGN
118473652YP_889943.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRFTTGEGDPVAGVSFIEGGARFEEVAEKFGTARPDETWEGGSAPRAYDR
118473651YP_884560.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAIASPVSERLTVTALLLLTVATGLVDAISVLVLGHVFVANMTGNVIFLG
118473650YP_888258.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARPPPESGVHRGVACRRRRPREDVVERARRGGCRGRDRRLRLHRERADP
118473649YP_887706.1 LamB/YcsF family protein [Mycobacterium smegmatis str. MC2 155]MTVIDLNADLGESFGVYTYGADAEMMPLITSANIACGGHGGDPAVMRTSV
118473648YP_885422.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MTAGTNSAPTASAAAPFLSRERIVAPPGWSRWLVPPAALSIHLSVGAAYS
118473647YP_890852.1 malyl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MTNLLRRSELALPACNDHMFDKGVTCGADLVFLDLEDATPVGLKVESRAK
118473646YP_885104.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MQPKPTVDTPIGELMSQLSAQTSRLVRDEMRLAQKEFTESAKHAGIGAGL
118473645YP_885502.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MRHVVPRELRHRASSSSVSHVNLAYDERGKGEAVLFIAGRGGAGRTWHLN
118473644YP_890843.1 mdcB gene product [Mycobacterium smegmatis str. MC2 155]MTTTEVLDVAGLPAAQIATAAVAALHTEALLTPKPGLVDTHGNASHPDMT
118473643YP_887335.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVLRANGSQPTSTAGAAGDLGAGSDVSGAPGIRDVDGVLEKYRRTRLQRA
118473642YP_886237.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVDFGQMQDAIAHMASYEREVTSCLEDIDRTMASLRQSWHGEASDAQAHA
118473641YP_887716.1 MOSC domain-containing protein [Mycobacterium smegmatis str. MC2 155]MQIVAIHIAPGRKVPTRSVQEVRAEAGKGLVGDRYHGAKHRHVTIQSREL
118473640YP_888119.1 glutamine synthetase [Mycobacterium smegmatis str. MC2 155]MADHVAMTQLEVADYDLGLRGKLVRSSKTHGASGLAFCTILYGLSLIDDV
118473639YP_890533.1 haloalkane dehalogenase [Mycobacterium smegmatis str. MC2 155]MQTLRTPDERFAQLPEFPYAPMYCDIDDGEGGRLRVAWVEDGPAHAEPVL
118473638YP_886047.1 succinate dehydrogenase hydrophobic membrane anchor protein SdhD [MycoMSAPGAGESRLGRPAPVMEREHDRPAALDHPRAPRKPRGIPYFEKYAWLF
118473637YP_887377.1 priA gene product [Mycobacterium smegmatis str. MC2 155]MTLTRRAAEHEPIARVLPMLSVPHLDREFDYLVSEELSDNAQPGVRAKVR
118473636YP_887410.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLAGRAVGATTVVGVGASVVIDVVSSCGLGKFGGRRFFSSYSAAKVD
118473635YP_884555.1 mce-family protein mce1f [Mycobacterium smegmatis str. MC2 155]MLLTRFIKMQLVIFLTLTLVALVVLALFYLRLPTWAGLGMYKLNADLPNS
118473634YP_891121.1 MutT/nudix family protein [Mycobacterium smegmatis str. MC2 155]MSDGEQAKPRRRRGRRRGHRRAQRAAGPPAAGAEHHTEPAADARTESRAD
118473633YP_886869.1 aroQ gene product [Mycobacterium smegmatis str. MC2 155]MRRRTVSTYSGEKMTQSSTKVFGWQRTGTRPLLITLIDGPNMPNLGNRNK
118473632YP_890762.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDVGYRRERRAQAGRPGQDLRTQRHASGQYRRRQPAHQRQELGLHRRTGS
118473631YP_889223.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGTMLHVPTLTGPRVRLREPVPDDAEALYTRVASDPEVTRYLSWKPHADV
118473630YP_884695.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MTATTPTRFHPDLERVARYIPRHMVNRATLPVFQRLTRLMGRRVPPGCEV
118473629YP_890039.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMGEDIEERDDRLLDVVTEILETEGYEAVQLREVARRARTSLATIYKRFAT
118473628YP_889559.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MERLFSLVVGVLMAVAGAAAPPAQAQDFAITDEVPTLEELTSQLQLLVAT
118473627YP_885264.1 psd gene product [Mycobacterium smegmatis str. MC2 155]MARRPDLQSGPERLAALVRSSIPPMHSAGLPFVGASLAVALLGRKRRWMR
118473626YP_884766.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLAAQEVSEPEAAQPQSDSGPRRSVRVLAYVVIPLLIVGLAACAGYLQWR
118473625YP_884922.1 D-tagatose-bisphosphate aldolase non-catalytic subunit [Mycobacterium MTSHWIRETIAQHKTGDPVGVYSVCSAHPTVVTAAVMQAAADNSFVLVEA
118473624YP_886722.1 sugar transporter family protein [Mycobacterium smegmatis str. MC2 155MELRFDILRSRDSMERMAAPVIGTLRRWSMLVIALTSTMCANVFINGAAF
118473623YP_889924.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEPADRAEGSDLGSAAAADAPGLESVLRGAVDVARAALTEFSGADTVGE
118473622YP_888481.1 peptidase S8/S53 subtilisin kexin sedolisin [Mycobacterium smegmatis sMDETDSTESSRWPSRVLCALATLEGLGQHPTDAATLKEAVAARYAAEFVE
118473621YP_889743.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSTSAPQNGSMRAADTDRIQVAQQLTDAAASGRLPMDEYEDRLAKAYTAE
118473620YP_888293.1 oxidoreductase- 2OG-Fe(II) oxygenase [Mycobacterium smegmatis str. MC2MLSIPPVDLIEAAADPASRRRQFELLDAAFSEVGYVHVVGHRIPSSVFTE
118473619YP_885254.1 citrate transporter [Mycobacterium smegmatis str. MC2 155]MLAPVLALTIFVVAFWFIATERADKVKTVLVAAGLMTLLGLVPGAEVFYS
118473618YP_890180.1 cell surface polysaccharide biosynthesis [Mycobacterium smegmatis str.MTYLRLLRIRWRWLVWGVLLALAVATVVLILQPPMYQSKATVLVRTPGDV
118473617YP_889638.1 recQ gene product [Mycobacterium smegmatis str. MC2 155]MRDAIDRLGRPPVAALTATASGVVRREVIDILGLRKPVVIASGFDRPNIA
118473616YP_890302.1 DNA integrity scanning protein DisA [Mycobacterium smegmatis str. MC2 MAVKSGARSGRNVVHLARPTLRETLGRLAPGTPLRDGLERILRGRTGALI
118473615YP_889659.1 iron permease [Mycobacterium smegmatis str. MC2 155]MTPITDVPTSILAASNITSQLLGSGLIGLREGLEAAIVVSILVAFLVKSE
118473614YP_885617.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSRRNRQKRAAKQKDRRRASSQQGRWNTAPEYDRVAVLDHLIARLHHCAM
118473613YP_886379.1 modB gene product [Mycobacterium smegmatis str. MC2 155]MITWRRTRGRVEVGLPAWIFVPATLGALFVVIPLVAILVRVEWSQFISLI
118473612YP_886601.1 two-component system sensor kinase [Mycobacterium smegmatis str. MC2 1MHWGIVVATAFIVAEIVLVHLFKRVAPENAFGAIFLMGVLVVSAGWSMPL
118473611YP_885476.1 large subunit of N-N-dimethylformamidase [Mycobacterium smegmatis str.MNTNGNAGTVADTDDYPELMRLTGYGSKWSVEQGDSVDFYVNCDGPATYR
118473610YP_889584.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAEKSAPRRTSGGPVLLDDVTTAIEKAFFEELAAVGYGRLSVDAVARRAG
118473609YP_885444.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MTDDPLVPLPAATVMLIRDVHREGRADLEVFLMRRHAAMDFVAGVMVFPG
118473608YP_890488.1 mgtE gene product [Mycobacterium smegmatis str. MC2 155]MTTRDATIDLRQTVASNTPKAVELWLEVTTDSDERERQLAALSPAERRGL
118473607YP_890956.1 ABC transporter ATPase [Mycobacterium smegmatis str. MC2 155]MGTMTATLVAKNVAGGFAHRTLFEGLDLTVARGDVIGVVGANGAGKSTLL
118473606YP_888025.1 pqqA gene product [Mycobacterium smegmatis str. MC2 155]MEKKSAGALQKWERPTFAEIRVSAEVTAYVAVLDGDD
118473605YP_888074.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATRATSTDTASDPLGLDSLTWKYFGDLRTGMLGVWIGAIQNMYPELGAG
118473604YP_886444.1 inositol monophosphatase [Mycobacterium smegmatis str. MC2 155]MSTVADDLTLALELADQADALTMDRFGALDLRVETKPDLTPVTDADRGAE
118473603YP_889095.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MRLTPLPADEWDDEVRLALSVMLPEERLNPEGAGTALSTLARHPRLTKAF
118473602YP_884706.1 dioxygenase- TauD/TfdA family protein [Mycobacterium smegmatis str. MCMSVLTINKLTASVGAEVVGIDSERLATDDGIAAAVLDALEDNGVLVFRGL
118473601YP_887360.1 pyrC gene product [Mycobacterium smegmatis str. MC2 155]MRDHNSTAPVLIRGVKPYGEGDPVDVLVDDGQIARIGADLPVPETADVID
118473600YP_888476.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTNIQRGLLPPGWDKVVEEDSSDEYDWVPLRLPPDVTRVSASLRLSIEAE
118473599YP_884850.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSIPEPEHRGTASVGSAYYPMFVAVFTALVIISNVTATKGVAFGPIITDG
118473598YP_890508.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MVTLDRLINVLGGYGIHLKLCSTPRSTELRSVVMHEPGPVVGDVLLAVGA
118473597YP_884494.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGDTKLAAAAATPIIAFGLRTMTIMSNLTGVEGPEHGDRYGQGAEAFSGV
118473596YP_885811.1 transmembrane efflux protein [Mycobacterium smegmatis str. MC2 155]MTDALVEPGQNIDSRMAELSVRQRYWLLIVACLDVSLVISSMVALNAALP
118473595YP_890234.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPDTPSQPASRRDELLQLAATMFADRGLKATTVRDIADSAGILSGSLYH
118473594YP_890733.1 orotate phosphoribosyltransferase [Mycobacterium smegmatis str. MC2 15MPAAIERPDTWQAAFNLIRTRGYEHREEPFRLASGQLSHDYIDGKYAIDT
118473593YP_886701.1 mnmA gene product [Mycobacterium smegmatis str. MC2 155]MRVLVAMSGGVDSSVAAARMVDAGHDVVGVHLALSSAPGTLRTGSRGCCS
118473592YP_889075.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTKKIHVDLGLCESNGVCMGVIPEVFDLDEEDYLHVLSDEVTPENEARVR
118473591YP_885106.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRDCLGLSVGTTNLVAVADQSPVIRRAVLTLFPHRGPEVGGPPDGSACDG
118473590YP_888944.1 formamidopyrimidine-DNA glycosylase [Mycobacterium smegmatis str. MC2 MPEGHTLHRLARLHQRRFGRTAVVVSSPQGRFADGAAAVSGQIFKRATAW
118473589YP_889398.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKFTWKAISTGMIAAAGALPVAVALSGAANAEPAPVPPAPMPNLPVVNQL
118473588YP_890052.1 purL gene product [Mycobacterium smegmatis str. MC2 155]MTSELTHQTDTVERAAATPDQPQPYRELGLKDDEYQRIRDILGRRPTDAE
118473587YP_890960.1 endoglucanase A [Mycobacterium smegmatis str. MC2 155]MAVTALAGAGALAEPVRPGAAIEVRLASDGNPLAGQTFYVDPNSKAMRAL
118473586YP_884595.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMLPDLSVNRSTTVERVSDALRAAVLSGELTPGTPLREVDLAERMKVSRGS
118473585YP_889247.1 oppC gene product [Mycobacterium smegmatis str. MC2 155]MTDTSAESARSGLHTEEFATRRTLVFRRFVRNKPAVVSLAVLVLMFVGCY
118473584YP_886126.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSAATAHATPPRSVSASVLSKQTVDGKDYIVSDITIEPGGSTGWHTHEG
118473583YP_889542.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRAPTSSPLASNVTSGLRHHDPPASWKNQVRGLLRAISRP
118473582YP_887031.1 membrane alanine rich protein [Mycobacterium smegmatis str. MC2 155]MTTKTGRPEAWRSLLQRGIDTAAEVSGAVAEKLNAAADPRAKLLRKRRWA
118473581YP_891029.1 caax amino protease [Mycobacterium smegmatis str. MC2 155]MRIAAVFVGVTAIWMLLGAGVGAILGEEYSRPAHIVRAVGATVLTVPAIF
118473580YP_888440.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGGNRGVLIFIVLRHPAQRADHALIATDSAPWGGGLRIGVGARVVINESW
118473579YP_887766.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSDVYEAVISRRAVRGFTDRPVPKAVLARVLSAAAWSPSSSNTQPWNIYV
118473578YP_885598.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDKSPRQSMSKKSGQSLKQKRAEKRAKTDSASPTDSVHEMRKR
118473577YP_886633.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
118473576YP_887663.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVLVHHVGRKTGKAAVTPMMYLPSDDDPGTIYVFASKAGAASNPAWYYNL
118473575YP_886710.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPERQRRRYAPRLPREQRRQQLLDAALTVLADCPLHELSMEAVAEAAGVG
118473574YP_885708.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MTDKKIQVCVGIDVDSCAGWLGSYGGQDSPNDMQRGVFAGEVGVPRMLKL
118473573YP_889775.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTLSPTVKQVAAVLTVVVPLFVPEVVLSFTPFHADAAMVMAGMLPTVLAW
118473572YP_887897.1 anthranilate dioxygenase reductase [Mycobacterium smegmatis str. MC2 1MTAASTFVIIGGGLAGAKAAEALRDNDFDGQVLLFAAEEKLPYERPPLSK
118473571YP_890703.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMSWRHEITRTQWLVLAGTTLGWGLDGFAGSLYILVLGPTMTELLPHGGIE
118473570YP_888211.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPADVGAPDLVEPLYARALVLESDRSSAVVEVQPPGRASYRAELRSGTDP
118473569YP_884583.1 transmembrane transporter [Mycobacterium smegmatis str. MC2 155]MTSSAQPTYREVVDDNGRVYRIGETDRDILGRSRAWMVWLPWISMMAISS
118473568YP_885239.1 sodC gene product [Mycobacterium smegmatis str. MC2 155]MLKPVSVAVLFATPVLALSACSPPGETASSEPGTTPAIWTGSPSPAAPSG
118473567YP_888332.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMIEKQTLPLDGIRVVAIEQAVAAPLCSRHLADLGADVIKIERPGGGDFAR
118473566YP_887976.1 malQ gene product [Mycobacterium smegmatis str. MC2 155]MTTTSDTSGAPGPGSASPVLAELASRYGVAVDYEDWAGRRIAVPESTLVA
118473565YP_887174.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVVRTLHPRLTRELRRPVDVAGRLGDHTSFYGRALAGTPHAAMHYRREVI
118473564YP_886095.1 IS1137- transposase orfB [Mycobacterium smegmatis str. MC2 155]MEFISAHQHMRVGVDGLKWGVESMCAVLSEYGVTIAPSTYYAHRARQGPS
118473563YP_886995.1 beta-lactamase [Mycobacterium smegmatis str. MC2 155]MTNLSRRSVLIGSLAVMAAAGVRMPTASAAPVDDRIADLERRNNASIGIY
118473562YP_890070.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIDDYLRDHDGVITLAQAREAGLSENSVRRRVRSGRWLRCSRGVYFATDR
118473561YP_887392.1 ggt gene product [Mycobacterium smegmatis str. MC2 155]MLIASGCSDGAERPRRPAPGPCEIVSNGTPVPKTPESPPPPPGAPAGRDI
118473560YP_885159.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPNPSEPNEDHTPSSEDPTEPSRQSADAPTEKVTLSSEHEPATEVFGLPT
118473559YP_886874.1 transporter protein [Mycobacterium smegmatis str. MC2 155]MANAPGNNLTPKSDDSARRSALRKVNLRLMPFIFLLYLVNYVDRTALGIA
118473558YP_884823.1 MmpL protein [Mycobacterium smegmatis str. MC2 155]MRKLADLVVRWPLVVIGVWLAMAVALPLSFPSLGEMAEKHPLQVLPAEAP
118473557YP_885465.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSVPESSSGDSQTLRREFSLWSAFAFAFAFISPIVALYGIFGLALSAAGP
118473556YP_886063.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLALFADTGTIRAHGAACAAHTADLAALAAVLRTLPSHLPSLGPAADRFA
118473555YP_887399.1 nucleoside-diphosphate sugar epimerase [Mycobacterium smegmatis str. MMMCSERVFSTVVDAPRDEVFAWHARPGAIHRLFPPWQPLRIEAEAASLAD
118473554YP_887639.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLVIVGLVVLLVAVIVGFTGALLNAGPAHPLTENFDVFGYHVTGSTGTLF
118473553YP_889662.1 nucleoside triphosphate pyrophosphohydrolase [Mycobacterium smegmatis MIVVLVDPRRPALVPVDAVEFLTGDVQYTEEMPVKVPWSLPSARPAYDGE
118473552YP_884696.1 choline dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNVEINQRYDFIVCGSGSSGSVVARRLAENPDADVLLLEAGGSDDVPEVQ
118473551YP_888838.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLARNAESLYWIGRYVERADDTARILDVTVHQLLEDSSVDPDQASRTLLR
118473550YP_887982.1 phosphohydrolase [Mycobacterium smegmatis str. MC2 155]MNGMPKLSAGVLLYRVVDDVVEVLIAHPGGPFWARRDDGAWSVPKGEYTD
118473549YP_886883.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPIPRLRRAMRDEVRDALLAMLMDGRLAAGTSVSIDRLSRDLGVSQTP
118473548YP_889822.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKLRMSTLAGCLLVGGAAAAIGLAPLAGAEPVDPKEPHLLPQCEVTGGSS
118473547YP_890376.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
118473546YP_887844.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIRPYRDRCEEFPTTMETRAVPIRDALDRLTDDTDASRVFGEPYVTPDGA
118473545YP_890564.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSRPPSSPTEPSELDQPQRVEHGHRGRIDEILPEHRTLGGVDRPLSQGR
118473544YP_886426.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTLQTVLTANTGHWTLAPDRSTVRFRTRTMWGLVPVNGTFTEVSGSGAV
118473543YP_884755.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGRMTSEVMTHDVSLLWQNIFTWASWVITLAMIAIAIRMGLRQRTPFYLF
118473542YP_887980.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MPLAAGETFAGYNIIRLLGSGGMGEVYLAAHPRLPRQDALKVLPTSISAD
118473541YP_884607.1 BadF/BadG/BcrA/BcrD ATPase [Mycobacterium smegmatis str. MC2 155]MWPQDADSPSQSHEAHGAPGLAAQRGVTAARDAVCAAVSPLLNDRAGLRL
118473540YP_885188.1 pta gene product [Mycobacterium smegmatis str. MC2 155]MPEGEAATAIYIASPEGDTGKSTIALGILHRLAATVPKVGVFRPITRLGE
118473539YP_887383.1 ribD gene product [Mycobacterium smegmatis str. MC2 155]MSISVEAAMRLAIDQAEQVKGATYPNPPVGAVILDRDGQVAGVGGTQPTG
118473538YP_889460.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MLAVEQPTERMLELYANHVDPLRRYAFRLTSNQTRSEDIVQETFLRAWRH
118473537YP_886880.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPDTPDTLDRMPARTASAVTFLYALGYPIGNAAVAAMSPMALLVFRFSLA
118473536YP_887434.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTPRSGRSDAASSTRSPDVPVLLRGVTKRYGSTTAVSELDLEVQRAEVLA
118473535YP_890894.1 glutaryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTLTAPSKKSTYAPLELFDTDRLLDQDERDIAATVRQFVDTRLKPNVEGW
118473534YP_887403.1 secG gene product [Mycobacterium smegmatis str. MC2 155]MQLALQIVLVVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
118473533YP_885402.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MQIGRRELVAVIIAILLVTAAFVVPHLDLGIVTPLINSTPAQIYSFADTA
118473532YP_887100.1 integral membrane alanine and leucine rich protein [Mycobacterium smegMTQADNSPLPESAGEAEVPRARGGRAVLEQMGGISGLIYSSLPVVVFVPV
118473531YP_885171.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLRRSRRRESRPTPRTCEHLTADIAEPRPQTPGYCQDCAELGERTWAHLR
118473530YP_885909.1 cutinase [Mycobacterium smegmatis str. MC2 155]MVEHSSSPQLLKWLSAVVIVAATAVALVVAPTVTTRGLPMAGAAPCADVE
118473529YP_887110.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSAEPAQFRTAVAAMNATTVRPEIELGPIRPPQRLAPYSYALGAEVRHP
118473528YP_885411.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTAESVPQGSNGSAGATAAQARRSRGDRQREAIVAAVRELLEEQPFADIS
118473527YP_886987.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTATSATRIGSAKDALIEAARLSAVFAEGAGARDADRRLPHDEIRALKES
118473526YP_885263.1 CDP-diacylglycerol--serine O-phosphatidyltransferase [Mycobacterium smMIKARIKRPSFTVRMLPSALTVAAICLGLSAVKMALDNRPTEAMAFLAAA
118473525YP_890643.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIIWVIAGLLGLATGLRIGWALVNKQSLVSSAMIVALGSLGAVAALNWQP
118473524YP_890896.1 CAIB/BAIF family protein [Mycobacterium smegmatis str. MC2 155]MSAAALEGVVVADFSRVLAGPYATMMLADFGAEVIKIERPGTGDDTRQWG
118473523YP_887339.1 recombination factor protein RarA [Mycobacterium smegmatis str. MC2 15MSDSLFDVPGGGAESGDAIAATGAVGPSSPLAVRMRPAGLDEVVGQSHLL
118473522YP_890522.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MRVEEEDGLVRARGLRYGTAARFTRAEPTPLWEGVLDATRSGPACPQRPS
118473521YP_886336.1 propane monooxygenase hydroxylase large subunit [Mycobacterium smegmatMSRQSLTKAHAKISELTWEPTFATPATRFGTDYTFEKAPKKDPLKQIMRS
118473520YP_885462.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTETTTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQ
118473519YP_890485.1 thiocyanate hydrolase subunit beta [Mycobacterium smegmatis str. MC2 1MGRLKAHFPEIPDAPPPDLLDHDRFLAYMKTVHDVGGEPDAPMKYENKEY
118473518YP_887573.1 xylulose kinase [Mycobacterium smegmatis str. MC2 155]MIATETVSHSMDLPRPGWAEVDAEKLWWAEVCQIASKLMAQMPSGGVLAG
118473517YP_888648.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MTDSTTELTPAAPVSWPDGKTCAVAFTFDVDAESPLLTTDPAFADRMGTM
118473516YP_889436.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGERPGGRTAAVRRAVLSAAEDLLIEAGFDGLELTVVAERAGVGKSTVY
118473515YP_889874.1 amylo-alpha-1-6-glucosidase [Mycobacterium smegmatis str. MC2 155]MTVTPTILNGGEPASIGFGGGTVTLVEGATFCLSDRHGDVLAGRSHGLFF
118473514YP_889212.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFSQKRIARIARIPKARFKIVSGIVGMAAVIAMAALGVMSSYAPDNGPDY
118473513YP_889252.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMDPQLDLNLLLALDALLDERSVGGAAERLHTSAPAMSRTLARLRRVLDDP
118473512YP_886961.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAPDPKLPSADLPSQKQVIELLDGEFARAGYEIDDVVVNAATRPARITIV
118473511YP_886104.1 IS6120- transposase [Mycobacterium smegmatis str. MC2 155]MLTVVHDTEDANDKASGAGRSLLDEIVRDGARQMLAAALQAEVAAYVAQF
118473510YP_889107.1 caib/baif family protein [Mycobacterium smegmatis str. MC2 155]MTAPLEGYTVLDLTSGIAGGYATKLIADGGADVVKVEAPDGDPLRRWSAS
118473509YP_891072.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MTDIVGASAGRHLQAIGPEALIGSVELLARSVRVALVSPAGQIVRRAEKE
118473508YP_887641.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCKPHKRRGHGRATKDPVSVRRRVGLKRRYSRRTVSDRDEL
118473507YP_885164.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPRPLRGLPTVGIDDVDAHHRVIVTGSAGDLAAVLTRLLKADRLDVEVAH
118473506YP_886404.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMKAEASPLGKGVGAGRPRDPRIDAAILRATAELLVEIGYANLTMAAVAER
118473505YP_885865.1 secY gene product [Mycobacterium smegmatis str. MC2 155]MLSAFISSLRTADLRRKILFTLGLVILYRVGASIPSPGVNYPNVQQCIAQ
118473504YP_886109.1 RNA pseudouridine synthase [Mycobacterium smegmatis str. MC2 155]MRRPAASPKGLPERPGHEGIGPARLKVQGGRLVDELERRFGAGWKVRAGE
118473503YP_889049.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRRASSTLVKFGVFAVVMAVLTAFLFMTFSEYRGGSYAGYSAVFDDASRL
118473502YP_890609.1 antigen 85-C [Mycobacterium smegmatis str. MC2 155]MRRGLSLVRALMLTVVLAAGLWTVSATSGAPARADGVEYLMVPSAAMGRD
118473501YP_887275.1 NAD dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MTIETREDRFNRRIDHLFETDPQFAAARPDEAISAAAADPELRLPAAVKQ
118473500YP_887931.1 ComA operon protein 2 [Mycobacterium smegmatis str. MC2 155]MNAGIGKGFDSEIGLNYTELGPDGGRAELKITEKLLQPWGIVHGGVYCSI
118473499YP_888620.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWGHPVRGRRPLGIWARLSPPPAQQQTDEHSHDENDDQDEPHRRIDGHPQ
118473498YP_887362.1 carA gene product [Mycobacterium smegmatis str. MC2 155]MTRNGKRGGEKAVLVLEDGRVFTGVSFGAVGQTLGEAVFSTGMSGYQETL
118473497YP_884745.1 2-nitropropane dioxygenase [Mycobacterium smegmatis str. MC2 155]MNPLPTAWSGRLVLPVIAAPMTSVSGPELVIAACRAGVIGSFPTHNATSP
118473496YP_886309.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MANSTHPAEPHIGSVASKLNWLRAGVLGANDGIVSTAGIVVGVAAATASR
118473495YP_885056.1 transporter [Mycobacterium smegmatis str. MC2 155]MTTEITRPPAPPSRPSESRKPSLPGLLHLVAIAAVLATIVSAWAIDFVPT
118473494YP_887117.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MVPMRDQLVRALRVSGVVVPVMSLAVLTACTPMFAADPRYATDSGAHPQG
118473493YP_885983.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKPDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDEEFAKTSWQ
118473492YP_890537.1 diol dehydratase reactivation protein [Mycobacterium smegmatis str. MCMIPAGLIAGIDVGNHTTEIVLARVTDGTVHPVGHGQAPTRGRKGSRESLE
118473491YP_885631.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNAAVLRMALQFGNGTHLDSREGIGRFGMGLPSASISQCKRVEVWSWQDG
118473490YP_888216.1 peptidase M52- hydrogen uptake protein [Mycobacterium smegmatis str. MMTVLVIGIGNEARRDDGVGIAAVHEIAQRRLPGVEAMVTSGDPGELLDAW
118473489YP_887915.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAAQHPHPLMAQLAALHHFRIYVDIAIVVVVLAMTNLIAHFTTPWASIAT
118473488YP_890613.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MRISLWLSVLVVAGLFGWGAWQRRWIADDGLIVLRTVRNLLAGNGPVFNA
118473487YP_888254.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSIRTRRRIAILAGTLTVTALFAVGCQSSTEQEPSPPSTTTTTTTTTTTP
118473486YP_888255.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLVHRFDRRVLVACAGAALIAMTAACGDGDTSTPPTSGPTSEETSVTTTT
118473485YP_888678.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118473484YP_889626.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MKFTQYYLDCLSHASYLIADETTGRAVVVDPQRDVAGYLADAEEFGYTIE
118473483YP_888605.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKLEGKSAVVAAGAKNLGGLISTTLASRGVNVAVHYNSASTEADADKTV
118473482YP_885950.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLFGEPSWPDHVSMSSPNRAGLFGGLGMTFVGGSVAVSGALAEAPLHTAQ
118473481YP_886354.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAHLSTPYLRDMGAKAADLVASSLTPAAAAYLNQPVDHLASLPWPFADD
118473480YP_890334.1 dacB gene product [Mycobacterium smegmatis str. MC2 155]MSDRLTRRGGSPRSIESRGSMRPTRWRRSTHVAVGVAVLALVVAVVAAAA
118473479YP_887939.1 ABC transporter ferric iron-binding periplasmic protein [MycobacteriumMSLMSKVNSVRSVAVVATVAAAAALTLGACGSGSDEADSADKIVVYSGRS
118473478YP_886616.1 peptidase M52- hydrogen uptake protein [Mycobacterium smegmatis str. MMVGCGNLLRGDDGVGPVLVRHLWERGVPAGARLVDGGTAGMDVAFQMRGA
118473477YP_885027.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGPVNPDDRRSFSSRTPVNENPDGVQYRRGFVTRHQVSGWRFVMRRIAS
118473476YP_891050.1 C4 decarboxylate transporter [Mycobacterium smegmatis str. MC2 155]MTLLKQIWRGLDTVFEALGLLCLCAVLLVVLWQVWDRQVLGSTPGWTEET
118473475YP_889754.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNNGPVGTRQARELLRVAFGPSVVALVIIAAVVLLQLVIANSDMTGAFGA
118473474YP_886678.1 amino acid carrier protein [Mycobacterium smegmatis str. MC2 155]MSEFLDLINSYVWSSWLVYLCLAAGVYFSIRTRLLQIRQVPEMIRLMVKG
118473473YP_889213.1 peptide synthetase ScpsB [Mycobacterium smegmatis str. MC2 155]MTSSRQDHTATETATLVRPVDALERLFYRYSDRNPVHFMLVAEFDDVLDE
118473472YP_885523.1 D-amino-acid dehydrogenase [Mycobacterium smegmatis str. MC2 155]MVGFGRIDGGPRSAIVVGAGTVGLSAAWFLQERGVAVTVVDRVGVGTGAS
118473471YP_884739.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MSNDGMWGVLPDVLDRACAYYGERTAILDAATGASVTYRELGQWRNQIAH
118473470YP_889456.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAERSTVGFNFLAEPELPAPQVSEAQAEQILATHYGLQAKAASLGSQQD
118473469YP_886277.1 catA gene product [Mycobacterium smegmatis str. MC2 155]MTTFEAPHIEKIELAEKAGKATAAASGASATERFHLDKSPFDAVRDVPAE
118473468YP_889779.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MRRGETLPIYNRIAVLRAERRMSRAELAGLINVNPQTVGALERGDHYPSL
118473467YP_889087.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTPPQGQAEAARPYETLLAKGEDRRQRILSVAERLLARNGWRNTSLAQIA
118473466YP_886170.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMDDEVIARRVFSAGVIGTALEWYDFILYGTASALVFATVFFPEEDPALAT
118473465YP_890940.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MASHTTQHPRPSTAVTDDQWLQTYYLLRAAVAGVWVAAAFIVGTQVSTVA
118473464YP_888436.1 transposase [Mycobacterium smegmatis str. MC2 155]MTALDPNSTLGLLGRLMAGVRSEFRRDVLEFAADDAVFGGGSCRVTDCGR
118473463YP_886655.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSLAENVQFGIFTPPHQVDYADLLRVWTEADEIPEIAHAWLFDHLIPIAG
118473462YP_887817.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MITPRTLHTITDDDWTRIALLARFAFGDIEPEQTQAAWRSMVPEDATVVV
118473461YP_890647.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGLFTRRKSRATRRAEARAIKAKAKLEARLAAKNEARRIKADRKAEQKAL
118473460YP_890572.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLGVLPQLRSSWSLLPQHSLFAWWCCHVYLRTDGTQRVISRLSKN
118473459YP_886473.1 glucose-6-phosphate isomerase [Mycobacterium smegmatis str. MC2 155]MKPGTFVKVPAHARHNLTNTGTDDLVFLVIYDSAEPRLSRGPAESLSGQT
118473458YP_884788.1 phospholipase D [Mycobacterium smegmatis str. MC2 155]MMAGLADWFLTAEERGNPHTSLPDWFTGNNVEVLVHGATYFDRLTDEVEK
118473457YP_885818.1 rpsJ gene product [Mycobacterium smegmatis str. MC2 155]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
118473456YP_888472.1 phosphoglycerate mutase [Mycobacterium smegmatis str. MC2 155]MTVILLRHGRSTSNTAHTLAGRSDGVDLDDRGREQAEGVVSRIGDLPVRA
118473455YP_885748.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRAVAARVAGSAVFVDEIDERERRLRASNLASALPRPGTSEGRQLRRWLT
118473454YP_884735.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]METGGRGQPLHGRAAECDALRRSIADVQSAQSRVLVLRGEAGVGKTALLD
118473453YP_890802.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDHQHIVDVLTRYATGIDRRDWRLFRTVFTDDCAIDYGEIGAWNSVDAV
118473452YP_889787.1 stas domain-containing protein [Mycobacterium smegmatis str. MC2 155]MTRSRSPITISVTSRGEITLLTVDGVLDSTTYREVRDTVIKAALSEPRAV
118473451YP_891040.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MCPDWREREAFCSGPGELLDALIDHWEQHGDRDRLHYERFQPKIGGDAGA
118473450YP_888578.1 fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 155]MKIEDYLDADGNIAIPDGVTLTSYFDRNVAELADTPAYRYLDFEHDGRVV
118473449YP_891111.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPPDPSFAPTQLAARAAYLLRGNDLGTMTTAAPLLYPHMWSWDAAFVAIG
118473448YP_888461.1 arabinose-proton symporter [Mycobacterium smegmatis str. MC2 155]MNVIGITLLPRGRIMSHGPVSDDTPSIFGDDDQAASSGRTAVRIAAVAAL
118473447YP_887301.1 periplasmic binding protein [Mycobacterium smegmatis str. MC2 155]MRVRGRATIRRSALATGSVITVAGLLLAGCGSKASETDAANAESCVDTSG
118473446YP_889458.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSIWKWVGLAGVAGVVAGGVLVARDQRRRKAYTPEDIRARLHERLAEAN
118473445YP_884819.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSHYKSNVRDQVFNLFEVFGVDKVLGADKFSDLDADTAREMLTEIARLAE
118473444YP_889564.1 glutamine ABC transporter permease/substrate-binding protein [MycobactMLAVAALVGLIPMVAPATASAEGETYVVATDITFAPFEFQDASGKFVGID
118473443YP_890714.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAEIITYQADHPLLLAVPAFAPAIVVAGVVAYIAIRDRRRKDPPKDQPA
118473442YP_886747.1 morphine 6-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTASHGQAAAIPTVTLNDDNTLPVVGIGVGELSDSEAERSVSAALEAGYR
118473441YP_884991.1 Fis family transcriptional regulator [Mycobacterium smegmatis str. MC2MVSVSEVVGVRALGLRGVLMGRGDADIRWVATSELPDPTPFLEGGEILLT
118473440YP_887444.1 HTH-type transcriptional regulator [Mycobacterium smegmatis str. MC2 1MRRTGDQLKADCRAAALAEVAVAGLAGLTVEGVARRASAAKTSVYRHWAS
118473439YP_886202.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPRLNHPRSRRGRDIRGPLLPRSVPGWRSRAERFDMAVLEAYEPIERRWS
118473438YP_885181.1 metallo-beta-lactamase superfamily protein [Mycobacterium smegmatis stMAVALNKITDRVHFARTELVNWTLVTGDDGVLLIDAGFPGQREDVLDSVR
118473437YP_890289.1 rpmG gene product [Mycobacterium smegmatis str. MC2 155]MARNEIRPIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEF
118473436YP_886831.1 acetylornithine deacetylase [Mycobacterium smegmatis str. MC2 155]MGISAYEQAVLDRLDETLMVDLTVALVRSAGENPPGEEAATVRTLADAAA
118473435YP_889255.1 DNA repair exonuclease [Mycobacterium smegmatis str. MC2 155]MRFLHTADWQLGMTRHFLNGEAQPRYSASRREAVASLGEIAKRTGAEFVV
118473434YP_887763.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRGHRDPAPVAGQRSRASAGMGDLHTRKVLDLVIRLAEVMLSSGSGTADV
118473433YP_889417.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATIDGNTLEGISATTPWTLHHRASGAKRSNVVRFLAPLLAAIVTSAGCG
118473432YP_889571.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVTHGGVDFCRPIGVTTGGSAVPRSVDPDDVCAVLVALDLVLERVDPYR
118473431YP_888095.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTIAGELERARHLMLSADEDQARDLLVSLMPRIEQADRDDYALEVFALLG
118473430YP_889682.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTPNAPHIVVIGGGYAGVLAANHLQQAAHAKITLVNPRPEFVERIRLHQL
118473429YP_887104.1 RNA methyltransferase [Mycobacterium smegmatis str. MC2 155]MTELTLTTGAPANGGSCVARHDGRVVFVRYALPGETVRVRVVDERGSFWR
118473428YP_888235.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MGVGEWLGSVVWSRNPLVRRRDRIEGALRLAAVVLCVLAIPLTASIGISV
118473427YP_888273.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSSNAHNVAPAWALSAIYPLQNDLPVLAETDVLVVGAGASGVAAATTAAE
118473426YP_884612.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MKFGMALPQYGPALGSAKDLARFATRLEELGYDTLWAAERLVMPLKIHSD
118473425YP_890671.1 gltD gene product [Mycobacterium smegmatis str. MC2 155]MADPRGFLKHTTRELPKRRPVDLRLKDWKEVYEDFDHAPLQTQASRCMDC
118473424YP_887847.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPGMTSIEGKVRFGVGLGADTTPEDLPGIVDYLESSGADSVWFSELVYSP
118473423YP_887543.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFAVPAVSRWREGSLTDMTDERAGEPGSDRPEPTESSGQPSDPGQTPPPT
118473422YP_889002.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTAIPPVVDLETWRAALGDLRRREKAATRELDAIAAARRRLPMVELPEY
118473421YP_885902.1 rpmJ gene product [Mycobacterium smegmatis str. MC2 155]MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
118473420YP_888416.1 lysine decarboxylase superfamily protein [Mycobacterium smegmatis str.MKICIFMSATDLDERYTVHARQFARLVGRGGHTLIWGGSDTGLMKLVADE
118473419YP_885994.1 kumamolisin [Mycobacterium smegmatis str. MC2 155]MAGTTRHVGVSIRNPGGFRHWHTHWSLALIMIGALLISVFRITSGPDGHG
118473418YP_886697.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MELAEAVRARRSTRKFLPDKPVPHELIEEALTLAMRAPSNSNVQPWRVYF
118473417YP_887647.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSNPYAAGTPGWPAPAWSGYTAPAAPRPRRRVRRIALAVTGIVAVVGIGS
118473416YP_889554.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTMAKNILRAITAIVRRDAKTPDTDDSAGSVTFDGALDDLDVAGLVEVGR
118473415YP_885108.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVTLVRGRFRDVDVSPSSSLVCDRVRGGVRGADDSDVVSSPSDGGVSVP
118473414YP_884996.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMIKVMQGVRVLEVAQFTFVPAAGAILADWGADVIKVEHPVRGDTQRGFIN
118473413YP_890168.1 peroxisomal multifunctional enzyme type 2 [Mycobacterium smegmatis strMPIDLDKALGAELEPIEFSWTSSDIQLYHLGLGAGADPMDERELRYLVDG
118473412YP_887819.1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase [Mycobacterium smegmMGRVAGKVALISGGARGMGAAHARALVAEGAKVVIGDILDDEGAALAAEL
118473411YP_890816.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGADGLTAREAKRLQTRERLMGAAIAEFKRAGMADADVGTIVAAAGVAH
118473410YP_886594.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MLFTVPAVAEAVAAAIPDRPLIVQGERRHTYRQVMDRSNRLASYLHSQGL
118473409YP_889799.1 NAD(P)H dehydrogenase- quinone family protein [Mycobacterium smegmatisMKVLWVFAHPEQASLNGSLMQEGLGILEELGHEYQVSDLYAMKWKAALDR
118473408YP_890325.1 folE gene product [Mycobacterium smegmatis str. MC2 155]MTQSLRGHQNNNVRRVFDQPRAEAAVRELLIAIGEDPEREGLVDTPARVA
118473407YP_884552.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRTLQGSDRFRKGLMGVIVVALIIGVGSTLTSVPMLFAVPTYYGQFADTG
118473406YP_886649.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium smeMEQRISLITLGVDNLAASRRFFEEGLGWTATGAYDEVVFYQLPGIALALF
118473405YP_886451.1 smpB gene product [Mycobacterium smegmatis str. MC2 155]MTKKSASSNNKVVATNRKARHNYTILDTYEAGIVLMGTEVKSLREGQASL
118473404YP_884951.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MYLPPKFALSPERIDAVLAEAGFAQLVSHTTAGLVVTPLPLLYDAERHAL
118473403YP_884541.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTSLAQRVVAGLKDKIFAGDLPPGHKLPSEAELIDEFGVSRTVVREAVT
118473402YP_889636.1 sensor protein KdpD [Mycobacterium smegmatis str. MC2 155]MTTRASNASKRGELRIYLGAAPGVGKTYAMLGEAHRRLDRGTDLVAAVVE
118473401YP_885622.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTRRALAEDRGLQAERTALAWTRTALAIAASGVLVLLRDSHIQDDPGRLV
118473400YP_885544.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MESKQGRAALSMKRFGALIGAALTVVALATAASAGASVVSFCDDLAGRMD
118473399YP_886145.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMTIPTTLQPPLPDAQGRISAAVISELKGRAPHNHLEPVWVPLRDADPLG
118473398YP_889671.1 pth gene product [Mycobacterium smegmatis str. MC2 155]MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEV
118473397YP_890222.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGSVEQ
118473396YP_886010.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARTAPIPVTATDARPDRKGGSFDARTGIGWLVCGVAGTLTIAWYILAAP
118473395YP_884608.1 RpiR family transcriptional regulator protein [Mycobacterium smegmatisMARQDATATLADIRAVRPTLAPSERRVADVVLADPARASGFSISVLAEHA
118473394YP_888617.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQTRTLAVQLAELTVQLAELTVQRAELAVHRAVLAVCEVRRPAELSGRA
118473393YP_885022.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MSEVTAELVATGAGTVRGLLAADHRVFYGIPYAAPPQGRARFTAPEPYEP
118473392YP_890850.1 nitrilotriacetate monooxygenase component A [Mycobacterium smegmatis sMGQRRTDKMSLVAFMQAGSASVYAGSWRHPATEHGYLDAAYYAKVGRQLE
118473391YP_887332.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADWYDVARIAAALPETDEQTPRTWRVRKKRIAWERPLRKADLAALGADA
118473390YP_885572.1 allantoate amidohydrolase [Mycobacterium smegmatis str. MC2 155]MKPLDQRFETTWADLQPVGRDKLSGGYHRFAWTGPDADMRAWFSDQAHSR
118473389YP_886180.1 Fe-S metabolism associated SufE [Mycobacterium smegmatis str. MC2 155]MPAALAEVVSDFQEVAGQDKLQLLLEFANELPPLPAHLEEAAMEPVPECQ
118473388YP_890170.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MKSTDESPYDAIVVGSGAAGSWAAKELTESGLRVVLLEAGRAVDPARDFP
118473387YP_891001.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVTGERPEIILTDVDFNRRDHPDRPLRPIPPGRDHFADQWRRMREIMFG
118473386YP_886929.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLTTVETIDGFPIAVDVAGPDKGSNVVLLSAGHHGPGAYEGICHRLHTAS
118473385YP_886556.1 dimethylaniline monooxygenase [Mycobacterium smegmatis str. MC2 155]MTPALPRTAIIGAGISGLTAGKMLKDYRVPYTTFETSDRIGGNWAFGNPN
118473384YP_888386.1 transporter major facilitator family protein [Mycobacterium smegmatis MSAHTEAPTTSPPTTAVSARHRRLLIAVFSISSSMGYIAMIQIIPVILVS
118473383YP_885675.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATVTDAVARILAEQGPLHTDEIERLLQASGEPVPEPVVDELSMPVGMLV
118473382YP_887911.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MNRTPVLVGYGQVSQYDENPATEPVDLMAEAARNAADPRVLQAVDSVRVV
118473381YP_886300.1 ATP-binding protein [Mycobacterium smegmatis str. MC2 155]MEVKIGVTDSPRELTFNSAQSPTEVEQQFTDALSSGTGVLALTDEKGRRF
118473380YP_890696.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MLTVDFDRLGVGPGTSVIDVGCGAGRHTFEAFRRGAHVIGFDQNVADLNS
118473379YP_888151.1 polyprenol-monophosphomannose synthase Ppm1 [Mycobacterium smegmatis sMADDRARRFDRFRVRPEEITEVIPAVTDDDPLEDPLDDDVAPGLDDAEPE
118473378YP_884593.1 polar amino acid ABC transporter inner membrane protein [MycobacteriumMGHAGELDLHRCIVTGAMTATETCETQSPGVARVVRQRHLGRWLSGGVMV
118473377YP_885639.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWWELTLPATNLTYKQVRELNLRGGLSLDAFEHVVANADFVSRTVQAIIE
118473376YP_884484.1 early secretory antigenic target- 6 kDa [Mycobacterium smegmatis str. MTEQVWNFAGIEGGASEIHGAVSTTAGLLDEGKASLTTLASAWGGTGSEA
118473375YP_884731.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNRAVALRIAACGLLGLGAALLIAALLLTTYTKGKIAKIPLDIDTSLVSD
118473374YP_888289.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVSIPQSWVTHGHHDVYWIRTGSLTLGVVPALGGRLLSLRLGERELLWR
118473373YP_890837.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAASARRVGAETSKTRDTLLDHVEQMMLGEGYASVSYRALASAAGVTPSL
118473372YP_886386.1 hydroxymethylglutaryl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MTVREPSPYTPRAELRDVTLRDGLQLTAKTLPTELKIEVVRELLRLGVPA
118473371YP_887496.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSRHVSVWIEAPPDAVYVFASDPGEWPRWAAGLAQGGLRLTAEGWIADS
118473370YP_886685.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSQRASHAVTYNAFFAAAAAPPILIGDPARQHGPIRVEALAGHLQPELVE
118473369YP_886100.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
118473368YP_889316.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSEPTSRQRLDTPRVWRGPRLQVDVEAVGRVSESIARFLGTGRYLAIQTI
118473367YP_890874.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSLGNTVGMVVGTVAVIVMAATGCTEIATGTPVADPAAATESTTAPKTR
118473366YP_886764.1 ftsY gene product [Mycobacterium smegmatis str. MC2 155]MIGLWVAIAVVAVLLVVAIVVGLVRYRRRKIKLSAPEPKKTIDRSGGYTA
118473365YP_885555.1 taurine transporter permease TauC [Mycobacterium smegmatis str. MC2 15MVIPPAEPQAGRGRRFRALTWRLVRPVVVIALFLGVWETAPRIGMVDNVF
118473364YP_889978.1 gas vesicle synthesis protein [Mycobacterium smegmatis str. MC2 155]MTVESIHAPRTDDVALVDLLDRLLAGGVVIAGDLTISLADVDLVHISLRA
118473363YP_884575.1 formate dehydrogenase subunit gamma [Mycobacterium smegmatis str. MC2 MKRTTTGETSVATLVREIAADHRDHRGPLLPILHAVQERLGCVPAEAVPV
118473362YP_887834.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDAVIGVSVTPSTVGMVLVEGDSAADFEAVNLDLELFDVAGLDLSRARAA
118473361YP_890628.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRMDPQRFEELVSDALDQVPPELAAAIDNVVVLVEDRNPDEPEILGLYQG
118473360YP_889214.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEKTTCAVVGGGPAGMVLGLLLARAGIEVTVFEKHADFLRDFRGDTVHP
118473359YP_886707.1 gatC gene product [Mycobacterium smegmatis str. MC2 155]MSQISRDEVAHLARLARLALTEDELDGFAGQLDAILGHVSQIQSVDVTGV
118473358YP_890558.1 6-phosphogluconate dehydrogenase [Mycobacterium smegmatis str. MC2 155MTTTPTVTVLGLGPMGQALSRALLDAGHTVTVWNRTESKAQALRDRGALS
118473357YP_886412.1 nuoM gene product [Mycobacterium smegmatis str. MC2 155]MVSTFPWLTVLWAVPVVGAAVVILLPAAQQVLAKWLALAVSVLTLAVTAV
118473356YP_890200.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGTSGKNHAIGHAVSRSTACSGSRRQKGIIAHQSLALRNTLNSDHLPRCV
118473355YP_887773.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMSRWEPDARGRLERAALELYAERGFELTTVAEIAERAGLTERTFFRHYAD
118473354YP_889354.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVLRALALVVAAVIVLAGCGNPDRDADRQAIEEALRQWPQAFNDRDIDA
118473353YP_886803.1 nicotine dehydrogenase chain A [Mycobacterium smegmatis str. MC2 155]MKPAPFQYLRPATVAEALEQLASYPDAKVMAGGQSLMALMNLRLARPGVI
118473352YP_886043.1 RNA polymerase sigma factor SigJ [Mycobacterium smegmatis str. MC2 155MTTAARTDQFEALRPHLLAVAYRLTGTYADAEDIVQEAWIRWAGQEAPIE
118473351YP_888747.1 acyl-CoA oxidase [Mycobacterium smegmatis str. MC2 155]MTTTAEHLRNALDGRWRDVKNAMRENLSNEVFRPHYTPNTAIARAKVAEQ
118473350YP_889652.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSEPVGQPYDPLRLCVYATVALLAWLLGPWAVAGFAALGLVGYVRARRAG
118473349YP_888815.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MTRFLLARAARMVLTVFAVVLITFGLTRVAYRNPARMLAPENASEETIAA
118473348YP_887564.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGRSPSLARRFFDRLEPVHAVTYFSGESRSALEGLGFRGFWQGYFAARSA
118473347YP_886228.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
118473346YP_885497.1 twin-arginine translocation pathway signal [Mycobacterium smegmatis stMPAADLVFYGTVMTVDPARPTAEALAVSGGQIVAVGDRADVAQWVGPDTD
118473345YP_886494.1 pgm gene product [Mycobacterium smegmatis str. MC2 155]MSANPRAGQPAQPEDLIDVAHVVTAYYTRRPDPEDVAQQVAFGTSGHRGS
118473344YP_890970.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MWVTVIDEDRADALFHALADRTRRDIMRRVLAGEQSVSALASKYDVSFAA
118473343YP_886174.1 ChaB protein [Mycobacterium smegmatis str. MC2 155]MPKTTREGTAKKSELPSTLKKSDAKAQRTFAKAHDAAAEEYGEGERAHRV
118473342YP_890830.1 luciferase [Mycobacterium smegmatis str. MC2 155]MDLGFVSLNTPRDLAPDVLARELESRGFESLWVGEHPQIPVAAAGQFHPG
118473341YP_884981.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPEMTFEVRWPDGSTQRCYSPSLVIHDHLTAGTHYAVDDFVERSSRALAE
118473340YP_891000.1 inner membrane permease YgbN [Mycobacterium smegmatis str. MC2 155]MDEITLAERPAALLVVIALVAIAVLLFLIIKVRLHAFFSLIVVSVLTGLA
118473339YP_887873.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQTGGPAADALRLSTPDPGAVARSLVGALAMTTAALALASPPAAMWTLGA
118473338YP_889427.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
118473337YP_887660.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDGMVATLATDVELVSPISGRMVFRGRDDLRVLLAAIYGSLRELKWADAV
118473336YP_887489.1 lspA gene product [Mycobacterium smegmatis str. MC2 155]MTDETSGPAEPVTDAPGDAESPAQPKRRLRLLLTVAAVVLFLDVVTKVLA
118473335YP_890186.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDELSDEEIDAWHALRASNQALDSPYFHPGFAAAVHATGRPVSVVVVRDA
118473334YP_890066.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAVFATLVLGTVIARIVGLLGVAYVDTWSSAAAVGLAAMFALTGIAHFVD
118473333YP_886893.1 beta-glucosidase [Mycobacterium smegmatis str. MC2 155]MTDPLAHAPTLTLTQQAALGSGASFWTTEAVGHIPSIVLTDGPHGVRRQS
118473332YP_890470.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIEPMRAVTVGLGVAGLVLASVAPAAARPSDPGVVSYAVMPKGSVSNIVG
118473331YP_889060.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAHVFTFSRTKLAIAAAGFAAALPLSAGIASAQPDFSAVVNTTCSYEQVM
118473330YP_887165.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MSITVGPPSDHPDTETRRNKSLSALRAAPWSARISGALLVLVAAWAVAPG
118473329YP_888610.1 diacylglycerol kinase [Mycobacterium smegmatis str. MC2 155]MTGRVTVLTNPMSGHGNAPHAAERAVVRLQQRGVDVTAIVGRDARHAREL
118473328YP_888109.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRAVDVYTVEPWGLYMARPTPGRAQFHYLQSWLLPSLGLRATIFHFNPGH
118473327YP_889725.1 sensor histidine kinase [Mycobacterium smegmatis str. MC2 155]MASATCCGKRLRSEMAFPPNSWRPTGPLPTSSLSLRWRVMMLAMSMVALV
118473326YP_886342.1 groEL gene product [Mycobacterium smegmatis str. MC2 155]MAKELRFNSDARARLEQGVNALADAVKVTLGPKGRNAILEKLTGPPTITN
118473325YP_890633.1 abortive infection protein [Mycobacterium smegmatis str. MC2 155]MTGPLEHREHSEHRQPSRRTIKIEIVVVLAVTFGLSAYTALLRLIEAVLL
118473324YP_890096.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADAVRWEAEGEEPASPNERDDRFEWMDLDVPAASWWEVADHPELIRRGV
118473323YP_890295.1 TrmH family RNA methyltransferase [Mycobacterium smegmatis str. MC2 15MAGNSQRRGAVRKPGTKKGPTVGSGGVRRRGLEGRGATPPAHMRPNHPAA
118473322YP_885951.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMARGADFLQLDPASAPARGLTSWLVDALRSAIADGRLPPGVRLPATRTLA
118473321YP_887884.1 FabG protein [Mycobacterium smegmatis str. MC2 155]MSAHEHVHEDSVAGQVVTITGASSGIGEATARLLAARGASVVLGARRTDR
118473320YP_889470.1 ispH gene product [Mycobacterium smegmatis str. MC2 155]MSGKRVLLAEPRGYCAGVDRAVETVERALEKHGAPVYVRHEIVHNRHVVE
118473319YP_889527.1 LpqV protein [Mycobacterium smegmatis str. MC2 155]MRSYPWARKTAAGFAAAAGLSLLTACGSDTGKNTEEGQPAESSSVSAPAS
118473318YP_885469.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MASESAPGLVWPEGKVAAAAFTFDVDAESAILWGNEAVGARMSVMSHQAY
118473317YP_890359.1 metallopeptidase [Mycobacterium smegmatis str. MC2 155]MTRSKKVAKKAGHPPVIDPYLPGNGNFGYRVSRYELDLEYKVASNRLTGT
118473316YP_889396.1 pimE gene product [Mycobacterium smegmatis str. MC2 155]MLLVVSILARLAWTYLVPNGANFVDLHVYVGGADALDGPGALYDYVYADQ
118473315YP_886483.1 glycerol operon regulatory protein [Mycobacterium smegmatis str. MC2 1MIQAVDRALRILTVLQGGRRMSLGEIASAIELAPSTVHGLVRTLLAHGMV
118473314YP_890085.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGQYGTNFEDKVAIVTGAGGGIGQAYAEALAREGAAVVVADINLEGAQKV
118473313YP_884523.1 cell envelope-related function transcriptional attenuator [MycobacteriMNSPAHALTKPRRRTPRRAVRLARRALVGLTAAAILAGTGMGWVTYHGAL
118473312YP_886211.1 rubredoxin [Mycobacterium smegmatis str. MC2 155]MSHYRLFVCVQCGFEYDEAKGWPEDGIAPGTRWEDIPEDWSCPDCGAAKS
118473311YP_890720.1 glgX gene product [Mycobacterium smegmatis str. MC2 155]MEIWRGKAYPLGATYDGSGTNFALFSEVAERVELCLFDDDGDGGLRETRI
118473310YP_890860.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLAFLDDLGLERGCPWECLNNGGSDLGLTRRVRPSRW
118473309YP_886824.1 mhpA gene product [Mycobacterium smegmatis str. MC2 155]MNTSHASAHQMTTEVVIVGFGPVGKLLAVQLGRRGHSVIVVDRNEASYPL
118473308YP_890820.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRHSRRSRRSTRSGPCADQLLGRTARVRGIDHGAPVELEICQIRQQWRGG
118473307YP_889164.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRKWKRVEAADGPRFRSALEGHEAALLSSLVGSMLGMLDERESSAPADEL
118473306YP_886017.1 ATP/GTP-binding protein [Mycobacterium smegmatis str. MC2 155]MAYEHSEKRSAASTKIVISGGFGAGKTTFVGAVSEIMPLRTEALVTNVSE
118473305YP_887358.1 bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltMGSSSTDRELLSAADVGRTVSRIAHQIIEKTALDDPAERTRVVLLGIPTR
118473304YP_889378.1 typA gene product [Mycobacterium smegmatis str. MC2 155]MSSHPDFRNVAIVAHVDHGKTTLVDAMLRQSGALTHRGDDSTERIMDSGD
118473303YP_890711.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRKTAKRFGVATVAASGLAATLIGLAAPSQAAPSGPSNAQQTISQLQSQG
118473302YP_884956.1 LuxR family transcriptional regulator [Mycobacterium smegmatis str. MCMTEKLSTGTKTLLMARVDRAEELWQTELDQTIAAIPWLRASMAHLIALND
118473301YP_891115.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLIAALLCLSAAVVVAVLGLWLLTRPHYGDPVRGVLRAVAPTQLAAAVML
118473300YP_885150.1 carbon monoxide dehydrogenase [Mycobacterium smegmatis str. MC2 155]MQVPGPFEYERATSVDHAVGLLDRLGEDARIVAGGHSLLPMMKLRIANPE
118473299YP_888161.1 alpha-ketoglutarate-dependent taurine dioxygenase [Mycobacterium smegmMQVTVTKLGAHIGARIDGVRVGGDLSPATVSAINAALLEHKVIFFSGQDH
118473298YP_885292.1 succinate-semialdehyde dehydrogenase [Mycobacterium smegmatis str. MC2MTATPEVDLPNPYTGTGTIHNPATGAVAGEVRWTDPADVPRIAAGLREAQ
118473297YP_888679.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
118473296YP_887521.1 hisB gene product [Mycobacterium smegmatis str. MC2 155]MSALANRRARVERKTKESEIVVDLDLDGTGVVDIDTGVPFFDHMLTSLGS
118473295YP_886223.1 transposase IstA protein [Mycobacterium smegmatis str. MC2 155]MLTWEDDVEVHALRKRGWTISAIARHTGRDRKTIADYLSGKRTPGVRARP
118473294YP_888281.1 N-carbamoyl-L-amino acid amidohydrolase [Mycobacterium smegmatis str. MTVPVNATNLRIPLDTGRDREFLDSWAELEAIGATPAGGVERQAGTAEDG
118473293YP_887478.1 gp55 protein [Mycobacterium smegmatis str. MC2 155]MSIAILIAITLICIAWSLWIRRVTWTCRWEVAATMNVALQGLAVLLMSPF
118473292YP_888896.1 peptidase S9- prolyl oligopeptidase [Mycobacterium smegmatis str. MC2 MNSTPFHDLDAYLDLPRVSGLAVSPDGTRVVTTVSTLNAKRTEFVTALWE
118473291YP_890283.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSRETENALLLLIGVSIAIITVTGSYTRYVKPSLLPYLAATAGLLIALAL
118473290YP_888053.1 3-methyladenine DNA glycosylase [Mycobacterium smegmatis str. MC2 155]MSVDLLTGDPIAAARRLIGAHLVGRDVTATIVEVEAYGGPPDGPWPDAAS
118473289YP_888171.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMAASRGKATTRLTTDALAFLTERHLAMLTTLRSDGSPHVVAVGFTFDPKT
118473288YP_884726.1 eda gene product [Mycobacterium smegmatis str. MC2 155]MSLDSLLDLVPVIPVVVVHDAADAVPIAKALVEGGLPVIELTLRTPAALD
118473287YP_886258.1 transferase [Mycobacterium smegmatis str. MC2 155]MSGEIDGAVIDAIGADFRAAGYTVDGVAELLGEQADAALLRGVWWPALHA
118473286YP_890149.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MAVNAAVLGTGQTKYVAKRTDVSMNGLVREAIDRALADSGSTMADIDAVV
118473285YP_888741.1 extracellular solute-binding protein UspC [Mycobacterium smegmatis strMRRSTLLAGGLAVTMAVLLVIAMLMGRTTEPAGKTVVTVRLWDPQVAAAY
118473284YP_888784.1 polyketide synthase [Mycobacterium smegmatis str. MC2 155]MMTDGTLCDHRVPVVLSAHAEDLIAHDATAILRYLDGRTDTAPSDVAYTL
118473283YP_890603.1 transporter major facilitator family protein [Mycobacterium smegmatis MRRYLAATFSALTIRDYRRYALGQTISVSGTWMQKLTQAWLVLELTDSPL
118473282YP_891032.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MVGRSEELAAVTDVLADISTGGAALVIDGDPGIGKSTLLAAASDWAVANG
118473281YP_887428.1 carbohydrate kinase [Mycobacterium smegmatis str. MC2 155]MPEFTIGVDIGTTGTKTVLVDVDAARIVAQSTGETTLHSDAPGHAEADPW
118473280YP_888021.1 pqqE gene product [Mycobacterium smegmatis str. MC2 155]MDRPYALLAELTYACPLHCPYCSNPVALQNYRDELSTVEWQRVFAEAAEL
118473279YP_884431.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRFVVLAVVAAVAVIVWRSRHGQEVWHQAG
118473278YP_888825.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MTPGRRWTRLCTAGAAAAVMCLLSGCVTVVGGTATRDPAAPPPGAAVTEV
118473277YP_890740.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMLRQERTGRWRKGMQTRERLLGAALAEFKRNGIAAADTAAIVAAAGVAHG
118473276YP_886116.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSRKWTATLDSLTILPRGEQFAALTELRARLRRMDTEAWNTTFGPDSLY
118473275YP_887370.1 coaBC gene product [Mycobacterium smegmatis str. MC2 155]MSARKRIVVGVAGGIAAYKACTVVRQLTEAGHSVRVVPTESALRFVGAAT
118473274YP_890466.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTLSLANYLAADSAAEALRRDVRAGLTAAPKSLPPKWFYDAVGSDLFDQI
118473273YP_890073.1 NikQ protein [Mycobacterium smegmatis str. MC2 155]MRADLTDLDNFADGFPHALFEAHRREAPVYWHEPTEHTPDGEGFWSVATY
118473272YP_885900.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAVYLAAFIVGGVSVLTALLLADVGHGDGMPFLSLTGISAALVGAGTGG
118473271YP_885765.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAPRIGVIGAGIVGLAVARRLQQKLQADVTVLDKENVVAAHQTGHNSNV
118473270YP_888518.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTPTETHKPNPGLAEHVSRLAAFAVSAEARPARLGCLGATVLTIGGLGAG
118473269YP_884545.1 cyclase/dehydrase [Mycobacterium smegmatis str. MC2 155]MSKTVEVAASAETITSIVSDFEAYPQWNPEIKGCWILARYNDGRPSQLRL
118473268YP_889402.1 base excision DNA repair protein- HhH-GPD family protein [MycobacteriuMPTLQLVQDPDADALLESNPFALLVGMLLDQQIPMETAFAGPKKLADRIG
118473267YP_887314.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEWFLFLPQVRLEIGDIVERARIAEAAGFDGIAFIDHLEAPGATHQGIW
118473266YP_886501.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTREFDFEVAFVTEPLDGPDDERIDRAMELIPNLVVSFDGNLTVVTTLV
118473265YP_889079.1 cytochrome p450 [Mycobacterium smegmatis str. MC2 155]MTHMAIDPAGIDWFKDPRLVDDPYPYFNALRDKCPVQSEDHYGVTMVTGW
118473264YP_887840.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTLACRVFGHDPTFRVDGRTMRWECARCGEARGAKDYASEADARRFAAAF
118473263YP_885659.1 Ser/Thr protein phosphatase [Mycobacterium smegmatis str. MC2 155]MNNSVSSGYDVIGDVHGCASQLEVLLHKLGYETGASGEYRHPERQAIFVG
118473262YP_887815.1 ISMsm2- transposase [Mycobacterium smegmatis str. MC2 155]MPTPHAAEIVLSADERAELEGWARRRTSAAGLAMRARIVLAAADGGSNTE
118473261YP_885609.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MSEITVENLDAGYGSVQILHQVSMTARSGEVTCIFGPNGCGKSTLLKAIV
118473260YP_890424.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MISLAEYRRCARREPRDLDDAIEAPVAAVVDEPADAAAAADYEGDEGGII
118473259YP_885005.1 iron-sulfur cluster binding protein [Mycobacterium smegmatis str. MC2 MSTTFLGSPGLGNLRGDESFPHAARGALANSQLRRNIGHATQTIRGKRLR
118473258YP_890321.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGPTRKRDLVGAAVAAALLSYLLIHALYRWFPPITVWTGLSLLGVAAFEA
118473257YP_890529.1 lys1 gene product [Mycobacterium smegmatis str. MC2 155]MRILLVGAGGVGSAFCAIAARRNFFDQIVVCDYDESRARQAAEAVGDARF
118473256YP_887140.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPNVYYSRIIAAPAAGVWKIVGDFGSLPVWFPFVTASELDPPGGRREVGA
118473255YP_889189.1 atpG gene product [Mycobacterium smegmatis str. MC2 155]MAATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYAAEI
118473254YP_884990.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVFDKAIDLQPAGDGHFQGSTVPEWANMVGPFGGITAAALIRAIQLHPQ
118473253YP_888368.1 ssuD gene product [Mycobacterium smegmatis str. MC2 155]MGRDFTELIHIARSAEESGVRALLLDDAGDGGSDPVVVACALARKTRTIE
118473252YP_890680.1 starvation-induced DNA protecting protein [Mycobacterium smegmatis strMTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGV
118473251YP_886087.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MQPVVEMRGISIEFPGVKALDGVDFRLLPGEVHALMGENGAGKSTLIKAL
118473250YP_887202.1 5-exo-alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTLASGTGRIARFDEPGKPFEIQTVPVPQVGPGEILIRVTRANICGSDVH
118473249YP_884803.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MGKVFDPRNNALNALRLLLAVGVILWHSWPLSGHGVTYKPLEQLLEQVWV
118473248YP_889387.1 nitrate/nitrite transporter [Mycobacterium smegmatis str. MC2 155]MSTATTPYTRQGVNLALATWVSAINFWAWNMIGPLSTTYAGDMRLSSTEA
118473247YP_884723.1 dihydrofolate reductase [Mycobacterium smegmatis str. MC2 155]MKTVYYTASSLDGYIVDENQSLDWLTSRDITPDGPFGYEQFIETIGVLVM
118473246YP_890392.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAHDTFPPFGAPDGLQETRSQISCDFRQLHVYSEHYSAYAEVYQPDPPG
118473245YP_888590.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKNLIPAVAVSTAIGFVVGGMEASAPPAEPAANPAPPLPDPGVYLVTETA
118473244YP_886313.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTASSELIMYTTTWCGYCSRLKTALKAEGIPYTEVDIEGDPAAAEFVGS
118473243YP_888604.1 propionyl-CoA carboxylase subunit beta [Mycobacterium smegmatis str. MMTIMAPEAAAESLDPRDPLLRLSTFFDDGSVELLHERDRSGVLAAAGTVN
118473242YP_888267.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPNKSTQAYDVLERMIIFQDIQAGVMVSEAELMEKSGFGRTPLREALQR
118473241YP_887771.1 AMP-binding protein [Mycobacterium smegmatis str. MC2 155]MTPAPLTVPALLQRSVREFGDDTYLVTPTGRATYREIDNLSVRAARWLLG
118473240YP_885851.1 rpsH gene product [Mycobacterium smegmatis str. MC2 155]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYR
118473239YP_885600.1 glycosyltransferase- group I [Mycobacterium smegmatis str. MC2 155]MTDTPSTDAPPQPRFDHLLRMTDNRGTFEHAFLDEPRTENGYCTDDMARV
118473238YP_890926.1 transporter major facilitator family protein [Mycobacterium smegmatis MATAVHIAIRDLIDRNPIGGHQRRTLVLCFFCIVVDGLEVTVVGFLSAAL
118473237YP_888085.1 rpmI gene product [Mycobacterium smegmatis str. MC2 155]MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTV
118473236YP_885371.1 hemL gene product [Mycobacterium smegmatis str. MC2 155]MAMRVDQTCGSEEHSPASTQRSAQLFADACAVIPGGVNSPVRAFNSVGGT
118473235YP_888910.1 carbohydrate kinase PfkB [Mycobacterium smegmatis str. MC2 155]MTVLGNLAIDIINGAPPSPGGCASFAGVALQAAGGVGRIVAMGAERDHSL
118473234YP_888984.1 oligoribonuclease [Mycobacterium smegmatis str. MC2 155]MRILWIFVRDELVWIDCEMTGLDLKSDRLIEIAVLVTDADLNILGDGLDV
118473233YP_885855.1 rpmD gene product [Mycobacterium smegmatis str. MC2 155]MAELKITQVRSTIGARWKQRESLRTLGLKKIRQSVVREDNAQTRGLINTV
118473232YP_885529.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRTTIIATVTAGLAMAGMALAGGAAAAPTGDTSADQTIRQLQSEGYRVIQ
118473231YP_888796.1 salicylate synthase MbtI [Mycobacterium smegmatis str. MC2 155]MTQAGIETASENAEVTGLSLPPGADPVDFVAELARALPERDGEEYVVYER
118473230YP_890619.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium smegmatis str. MC2 1MQSRRPAPSILFTAIAATLIVVPWALSGTGDEHHNPAADAPSLTQQPLDD
118473229YP_890311.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSPAHQSVAPALDLSATKAALWLSVTAFLALAVLYFVGLDQGATSVFGN
118473228YP_886788.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLDDSAHIKPSVGRTTSPFTVRHRTLSGADHCVCVIDRLLTLCK
118473227YP_888627.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTLPLLNGKAADITGPGRTDRFGVTCTDLGASVLAPDGKLVSVFGDTFSG
118473226YP_890936.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQTFLPCPDFADTARVLDPRRLGKQRAETIQVLRALTVPGYGWRHHPAAA
118473225YP_889736.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPSKIRHIACTATGAVGFAGLMLFGFTGAAVAQPPPVPPPCTAAEMARVM
118473224YP_889909.1 citrate synthase 2 [Mycobacterium smegmatis str. MC2 155]MAAVPDDFIAGLEGVVAFTTEIAEPDKDGGALRYRGVDIEELVDKKVTFA
118473223YP_889591.1 transporter major facilitator family protein [Mycobacterium smegmatis MSLDSSRAVLSSGDELHKRATRKAVLRLLPVMCVVYFMAYIDRTNVALAK
118473222YP_884955.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSSAHLRWTVIGAGPAGIATVGRLIDNGIRHDEIAWVDPGFAVGDFGTKW
118473221YP_885726.1 flavohemoprotein [Mycobacterium smegmatis str. MC2 155]MTVTTPEPADVRVDLEPEHAEIVSATLPLIGANIDAITSEFYRRLFTNHP
118473220YP_885975.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MTETPVRRRRADAQRNRDAILRAAREAFETDGIFAPLDSIATAAGVGNAT
118473219YP_891098.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVGDPSDLPSRTGSGALARPHRRSDRRDLRPRAGQPTEVATGPAAPHGF
118473218YP_890746.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQEVRSDIERYAGFLPAGYRQALAPASTWWSWRGHDVHILRAQLPDSRAR
118473217YP_890175.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTALSLICLLITPAWFLMSHRGIDVLPLLLAGLGWISFLASCLVNDVSVL
118473216YP_890901.1 glutamine synthetase [Mycobacterium smegmatis str. MC2 155]MTITPLDAHRQANATSPDLAAVLETIAERGVEFVYFQAVTITGRVVGKVA
118473215YP_889021.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MMFSRNGIRALRIWTAVVLVFLYIPLLLVLINAFNASRTFAFPPTGFTLA
118473214YP_884744.1 LuxR family transcriptional regulator [Mycobacterium smegmatis str. MCMMTTKERPIGTELLSRSSSAVATTLLSEKAFAAGRATHRDLASPGEQISA
118473213YP_889818.1 HNH endonuclease [Mycobacterium smegmatis str. MC2 155]MCLLVVPVCDTGCMPFEHTFDDLDDAALVAGIEGCERAQNAAAARKLALV
118473212YP_888231.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MEDKPETAVAQRDRVFAFGNLDAQIRETHTGLVALIGDLAYKAKKPVRTD
118473211YP_890567.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDARGTFEAFKNRDGEIPDAELDAFWALLRPAGIDFMLGEWKGGEFYTG
118473210YP_891028.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMGGTAVLLAEDCAHPGTEQHPDRGDPDEHRGDPHGQRWSAGPAVAWHRHG
118473209YP_888460.1 hisE gene product [Mycobacterium smegmatis str. MC2 155]MKQFMLVKTFDALFAELSDKARTRPAGSGTVAALDAGVHGIGKKILEEAG
118473208YP_884843.1 ISMsm4- transposase [Mycobacterium smegmatis str. MC2 155]MSWVFFRHPGQGTRTMVDGSSLLLDLDGVVVESVQRLEDGTRLVQVLTAP
118473207YP_886768.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MGEPMDRDALAEFLRRRREAIRPQDVGLPEGPRRRTAGLRREEVAQLTGM
118473206YP_888555.1 gcvT gene product [Mycobacterium smegmatis str. MC2 155]MSDELLQGPLEDRHRELGAAFAEFGGWLMPVSYAGTVAEHNATRSTVGLF
118473205YP_884629.1 L-sorbosone dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRAWPGISAVVVTASVVLAGCGTEPQTTEPTAQPSRSSSQTTAEHPAGAA
118473204YP_887261.1 glyoxalase/bleomycin resistance protein/dioxygenase superfamily proteiMTVLDSPIPRFHLAMPVDDLDAARHFYGGVLGLPQGRSSERWIDWNLHGH
118473203YP_890246.1 xylose repressor- ROK-family protein transcriptional regulator [MycobaMANGTQQNRAARVGTSNDDVRRRNLSSVLTLVHRRRSLSRADLTRHTGLS
118473202YP_888112.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MHLLAGHRRKRHTRTWQDNLLGECQEFRRKYPVFRPNRCEPKDARVNVVS
118473201YP_888253.1 pyruvate dehydrogenase [Mycobacterium smegmatis str. MC2 155]MITVADHIVSVLRISGVRRVYGLPGDSLNGFTDAIRRSGEISWEHVRHEE
118473200YP_886852.1 xerC gene product [Mycobacterium smegmatis str. MC2 155]MESVLDQFDAYLGLERGHSDHTRRAYRGDLTALFDFVEQRTGERSLARVS
118473199YP_888429.1 acetaldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDKVKVAIIGSGNIGTDLMMKTLRSSSLEMAVLVGVDPRSDGLARAERLG
118473198YP_890785.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDDGVQDAVAALDAALNTLLTLPHSALTDAELLTICAGLQDARNRIPAVE
118473197YP_884730.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPAYALVLSVLVTAPLLAPGYLLLRDAVSTPRSYVTDAALGLTEAAPRAL
118473196YP_885734.1 rplA gene product [Mycobacterium smegmatis str. MC2 155]MSKNSKAYREAAEKVDRTKLYTPLEAAKLAKETSSKKQDATVEVAIRLGV
118473195YP_887821.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTPNPGEARPELVVNDIAAVVATGRFDEALAWYGCIFGREPDLRPVAGVA
118473194YP_888724.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MAQPLSYTRDDVTFMSDGTSCAAWLYRPDGVNNPPIVVLAHGFAAFRELR
118473193YP_887671.1 RhtB family protein transporter [Mycobacterium smegmatis str. MC2 155]MISQMLPTVVTYAVLTASPGPGNMAIGAVAARHGRRPGLTYAAGLLAGGF
118473192YP_884631.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSYAVGVDINGASAIVTGGASGIGAASARLLAAKGAKVVIADLQADKGEA
118473191YP_885908.1 truA gene product [Mycobacterium smegmatis str. MC2 155]MPAIESGGGHVRLRLDIAYDGTDFAGWAVQAGQRTVAGVIDEALTTVFRT
118473190YP_885819.1 rplC gene product [Mycobacterium smegmatis str. MC2 155]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
118473189YP_888708.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRPARIVIVGSGFAGFECARRLSKQLKRHRSEAVVTLISPVDYLLYTPLL
118473188YP_890497.1 metallo-beta-lactamase superfamily protein [Mycobacterium smegmatis stMPDLLKIADSLYRLRIPGDRAHLLNCYLWQEPDGVTLIDTGWPGEAGLIA
118473187YP_887905.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMSPNALLECTDIHKSFGGVPVLKGISLQLEPGTVTALAGENGAGKSTLMK
118473186YP_889057.1 carveol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGSAEGRVAGKVAFITGAARGQGRSHAVRLAEEGADIIAVDLCQDIDSIG
118473185YP_885045.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAVALACAPSAAAVENPWFARSVGTATQVISVVGVGGSKAKMDVYQRTA
118473184YP_888110.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLAGLLIGAQIAPATALADPPVEPAVDPAAPPQVEGQTGPLHNVTYRARI
118473183YP_889304.1 ABC transporter substrate-binding protein [Mycobacterium smegmatis strMRRILVPAVLVVLALIATGCGGQSGTPPIRVGAAPGAESALIGHLYAAAL
118473182YP_889952.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKVLISGASIAGPVLAYWLSRHGFEVTVVERSPVLRKTGGHAVDLFRPAM
118473181YP_887406.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMTTSHNTESTLSDPAVNTPLVPAVRMHDIVKTFPGTKACNGATLEVAPGE
118473180YP_889197.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118473179YP_889209.1 homoserine dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKKPIGVAVLGLGNVGSEVVRIIADSADDLAARIGAPLELRGVGVRRVA
118473178YP_887295.1 hisS gene product [Mycobacterium smegmatis str. MC2 155]MTEGSSPVAFQAPKGVPDYLPPDSAQFVAVRDGLLSAARRAGYGDIELPI
118473177YP_886677.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRISTVVGVLAAGVLIGGVAAPSAAAQSTCAELGGTVDADQICQVHTANA
118473176YP_889314.1 malyl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MENTYRPRRTCLSVPGSSAKMIEKAKTLPADQVFLDLEDAVAADAKAQAR
118473175YP_888034.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSLLIFALVGLGAQLVDGALGMAFGVTASTLLVLSGVAAAQASAAVHLA
118473174YP_884556.1 mce associated membrane protein [Mycobacterium smegmatis str. MC2 155]MEGDAGASQLNPTDQQQEHTEPQIEQTTVEADARRPSRLGRGWMATVCAA
118473173YP_885039.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MMDEIAAVRSIWSDLGLPGLIDVHTHFMPKNVMDKVWQYFDSQGPLIGRE
118473172YP_889454.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADDDSPDAVESTDAEEAEEAAEDGTPDVKEPLSRVALGARVGIAVVVVL
118473171YP_888393.1 alpha-methylacyl-CoA racemase [Mycobacterium smegmatis str. MC2 155]MTGTLPLAGIKVLDLSTLLPGPLATLMLAEAGADVIKLERPGRGDEMRTY
118473170YP_885641.1 ISMsm7- transposase orfA [Mycobacterium smegmatis str. MC2 155]MPTPFPAEFRADVIAVARKGEAPLRQIAKDFGISEACLHRWLKIADREDG
118473169YP_890236.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNLSEAPKEIDGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVISD
118473168YP_891092.1 replicative DNA helicase [Mycobacterium smegmatis str. MC2 155]MDDLGHPDGPADIDGPPPSGDFGRQPPQDMAAEQAVLGGMLLSKDAIADV
118473167YP_887621.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMAGSRGNIIDDIIADHREFESVFVEIESSDDPRTQPELVEHVISGIVRHA
118473166YP_887352.1 efp gene product [Mycobacterium smegmatis str. MC2 155]MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVV
118473165YP_887832.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium smegmatis str. MC2 1MLNSLGRGSRSGRGSVWKLFAAVGLAVAATAVPVNVASAAVSTPVEVAQV
118473164YP_887631.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTLQAAENSQRMQIPSRTPRLRLKPKAPRIGFVDGAWWPRGNDLSAELPD
118473163YP_884854.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDDNTLLTQLQTDVLAIQSYALGEDADLARAVPTCPGWTVADLLGHLWSI
118473162YP_885795.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSAPPTSMAGQMMRRRPVIGAPVAHGASDHLKRSIGTFQLTLFGVGATVG
118473161YP_890494.1 DNA polymerase III subunit epsilon [Mycobacterium smegmatis str. MC2 1MSRAPLSSTPQLWGRPADEPGSGWAVVDVETTGFRPGQARIVSVAALAVG
118473160YP_885825.1 rpsC gene product [Mycobacterium smegmatis str. MC2 155]MGQKINPHGFRLGITTEWKSRWYADKQYKDYVKEDVAIRKLLATGLERAG
118473159YP_891060.1 MmgE/PrpD family protein [Mycobacterium smegmatis str. MC2 155]MGQVNTLTDPSAPEGPTGQLVNWVRTLEWDQVPEHVRVRAAHLLLDGIGC
118473158YP_886446.1 prfB gene product [Mycobacterium smegmatis str. MC2 155]MDPDRQADIAALDTTLTTVERVLDVDGLRNRIEQLEKDASDPNLWDDQTR
118473157YP_885591.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVDGRDIVVTGKLLQPMSRRTNDILRLTLAALFLATVVASSLITRYEWV
118473156YP_884848.1 allophanate hydrolase subunit 2 [Mycobacterium smegmatis str. MC2 155]MGTTLEVLRTGPLALVEDLGRPGLAHMGVTRSGAADRRSHTLANRLVANP
118473155YP_885354.1 glutaredoxin [Mycobacterium smegmatis str. MC2 155]MTLLTRAGCHLCARAAEELTVLRDELGFTLVTTDVDALAAEGDNSLRAQY
118473154YP_889478.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVCVTVSPAVMCAVSANGSPSRRQQRLVCRCSGVKAASRIFVELPRWH
118473153YP_885409.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFTAPAIRTSSASSSSSFASCFAAPLPRGLRAVAQEQTWDAFLARFAAIA
118473152YP_887471.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLAAIQVADAAACALKAPPVVKAFDDLGVPHRIRWIFPPIKAASAVGLIA
118473151YP_886389.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDAELSPTDWVREQTERILEQGTTDGVHVLDRPIVLFTTTGAKSGKKRY
118473150YP_888246.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCETLDDAALIAGIAGESRAESAAAARRFAFIAEFVDRRTADSEDTVVWW
118473149YP_888359.1 butyryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MEFAYTARLAELKNRARTLAEKIMPFEDECERNNGLSAQSHASIKASVLE
118473148YP_887018.1 thyX gene product [Mycobacterium smegmatis str. MC2 155]MAEIAPLRVQLIAKTEFMAPPGVPWETDADGGEALTEFAGRACYQSWSKP
118473147YP_887865.1 pcaC gene product [Mycobacterium smegmatis str. MC2 155]MSRIGDFPDDDVAGWIQRSPDIGTAMANYTHAVYTKGRLPMRVRELARMV
118473146YP_886244.1 S30AE family protein [Mycobacterium smegmatis str. MC2 155]MSSHSMDSSRTMVVEDDRESTAGTTPERPHAEVVVKGRNVEVPDHFRTYV
118473145YP_884861.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPRLNLADFLCFSIYSANLAFGKAYKPLLDQRGITYTQYIAIVALYDQ
118473144YP_885866.1 adk gene product [Mycobacterium smegmatis str. MC2 155]MRVVLLGPPGAGKGTQAEKLSEKLGIPQISTGDLFRKNIGDGTPLGLEAK
118473143YP_888633.1 D-beta-hydroxybutyrate dehydrogenase [Mycobacterium smegmatis str. MC2MTDFHGKTALVTGASAGLGAAVAKLLAARGASVFGIARDADRMAEVFTEV
118473142YP_885982.1 inosine 5-monophosphate dehydrogenase [Mycobacterium smegmatis str. MCMVEIGMGRTARRTYELEDVTIVPSRRTRSSKDVSTAWQLDAYRFEIPVIA
118473141YP_885612.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTGLVQALVGGILIGGLYVAISIGFSLSFGVLDVVDLAVGMWVVIGAFAA
118473140YP_889966.1 universal stress protein family protein [Mycobacterium smegmatis str. MSTSTAPVVVGIDGSDSAVNAARWAGALAEKLGAPLHILHALPTLGRNLT
118473139YP_888719.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQPTMYQICIRGCVTERFGSALEGMRLEAGATESMFVGEIRDQSQLYGLL
118473138YP_889347.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPRKTMSFRPNLLPLSRQARAGLMLKPRQSAASAWGPHRAIILGVSLIPL
118473137YP_889729.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSIWTTAEREALRKTVRAFAEREVLPHAHEWERAGEIPRELHRKAAELGL
118473136YP_885227.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTPPGPPPPPYGAHGYPPPPPLPYTNGTGPIPQPPKKPRRVWVLVAVVV
118473135YP_885483.1 gatA gene product [Mycobacterium smegmatis str. MC2 155]MTDSALERTTDTVAQTIPQVRAQVDCGEITPVGLVRRALARISHVEDKIQ
118473134YP_888256.1 TonB-dependent receptor [Mycobacterium smegmatis str. MC2 155]MYALVDLLRGSRKPLSAARIAEEFGVSKRTIERDIQSLQLAGVPIYADHG
118473133YP_890107.1 carbon monoxide dehydrogenase subunit G [Mycobacterium smegmatis str. MELNNEFRVAVPAAKTWEVLTDVRRVAPCLPGATLLDVDGDEFTGAVKVK
118473132YP_886107.1 flavoprotein disulfide reductase [Mycobacterium smegmatis str. MC2 155MVTRIVILGGGPAGYEAALVAAARGPEVADVTVVDCDGIGGACVLWDCVP
118473131YP_886335.1 sigma factor [Mycobacterium smegmatis str. MC2 155]MVRHADTPTDAQRAREQFLSTGALQPDAVASSVLNSWQRSRELHVHPDRV
118473130YP_891010.1 ribose transporter permease RbsC [Mycobacterium smegmatis str. MC2 155MAETRETVVTATAPATPPPPAAKRINLGTLLREPLVGPLVALVIAIIVFS
118473129YP_888139.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MHERTVRAEISTGIIEGFTRDGVHRWRSIPYARAPIGPLRLRAPQPAEPW
118473128YP_885750.1 rplJ gene product [Mycobacterium smegmatis str. MC2 155]MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSATYT
118473127YP_885810.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MLIVGAGSAGSVLAERLSADPSCQVTVVEAGPAPSDPRVAAQITDGVRLP
118473126YP_884764.1 virulence factor mce family protein [Mycobacterium smegmatis str. MC2 MIHRRTKIQLAIFCVIAVVFGTVMIFGYMRLPAHLFGIGLYTVNLDLDRT
118473125YP_887537.1 TM2 domain-containing protein [Mycobacterium smegmatis str. MC2 155]MYGDPTAPYGRHPVTGEPFSDKSKIVAGLLQLIGLVGFVGFGRIYLGQTG
118473124YP_886369.1 sugar phosphate isomerase/epimerase [Mycobacterium smegmatis str. MC2 MNIENRDLLATCWTWAGNAAPARGTERSPIPMAERLDAVASAGWEGVGIV
118473123YP_886380.1 modA gene product [Mycobacterium smegmatis str. MC2 155]MIRVVSVVVGVFLLAGCTPAPANDDHLTVFAAASLKSVFTELGKRFEDAN
118473122YP_890870.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRTVSVITGGAGGMGVATAKIVGKEHAVVLCDVRQDRLDTAATALAEVGI
118473121YP_889325.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTRSSVAVEIHGLTKSFGRTRALDGLDMTVPYGHIVGFLGPNGAGKSTTI
118473120YP_890273.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARPLPLTAALGALALISTLAGCSGEAERSTAEPIAEPLVATYDGGLYVL
118473119YP_887374.1 lipoprotein- nlpa family protein [Mycobacterium smegmatis str. MC2 155MSTPENIDGPPRSKTPLYAGIAAVVVVVLVVAGFLWLRGSGEKKLTVAAT
118473118YP_888519.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSSIPAADDVLDPDEAVYDLPTVADILGIPVTKVHQQLRDGHLVAVRRNG
118473117YP_887241.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTKFLDGYLESPLSGIAPWVVMAVLSTPGHFEEAVCAALGLTLLTMWINR
118473116YP_891005.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MTDPRIDPTETTAMRRARGEAIVTQLSGGTRPASLDALDHEHPFLSHAVN
118473115YP_890192.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMPEHRFQVAVVTGGGGGIGRAVARGLASAGYCVAILGRCMEDLAEAARDH
118473114YP_891085.1 NADP oxidoreductase- coenzyme f420-dependent:6-phosphogluconate dehydrMKIVTIGRGMIGGGLARLWRDSGHDVDELGRDGGDASDADVLLVAVPGNE
118473113YP_887002.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDGARSLRIQLLIGFMCVALIVYFVMLGRAAFVFITSGEAAAVALGIAL
118473112YP_885078.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MDHEWECVVVGGGAAGLSAALVLARARRRTLLIDAGEPSNGVAPAIGGLL
118473111YP_886684.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118473110YP_887719.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMLTDTVDHVRHEWAKTYPHLDTSPIEVLGRVQRIASICNHRLDLDLARHG
118473109YP_884676.1 p40 protein [Mycobacterium smegmatis str. MC2 155]MTAHGRRSGGPYFDDLAVGQVFDTAPSMTLTEGAAAAHQAVIGDRLRLSL
118473108YP_890266.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTNVAVLSESELGSEAQRERRKRILDATLAIASKGGYEAVQMRAVAERAD
118473107YP_889295.1 D-2-hydroxyacid dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAEALTERLAHIVGAGHVSTDPDVLAARSVDHTGRYRGRACALVRPGTGD
118473106YP_890326.1 cell division protein [Mycobacterium smegmatis str. MC2 155]MNRKNVIRTLTVIGVVLLLGWSFFYFSDDTRGYKPVDTTVALAQIRGDNV
118473105YP_884732.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MTTEQSAQAEHEVGGTRGFLPAVEGMRACAAMGVVLTHVAFQTGHTGGIS
118473104YP_885298.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMTAADRWEPVQRLRTYEQVMAQIEQRIAAGQLQPGDHLPSERELAALLGV
118473103YP_888694.1 glucose-1-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MIYERIRAVGGEFEGKKVVVVGGSAGMGRQAALDIVDRGGSAVVIGRSKR
118473102YP_887418.1 tkt gene product [Mycobacterium smegmatis str. MC2 155]MTTAEEITALTQPNHPDDWTDLDTLSVDTARVLAADAVQKVGNGHPGTAM
118473101YP_886505.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRFEIDTDDEHSWPPANSETLWVLPEPEARTYRVLSIPVLADGIAVNDTV
118473100YP_888062.1 macrolide ABC transporter ATP-binding protein [Mycobacterium smegmatisMAHLLGGEALHLEYPTGVVLDSVTVGVSEGDRIGIVGRNGDGKSTLMGLL
118473099YP_885331.1 murB gene product [Mycobacterium smegmatis str. MC2 155]MASSHVAGVEIAEAVPLAPLTTLRIGPVARRMLTCTSTEQLIGVLRALTA
118473098YP_889990.1 cupin [Mycobacterium smegmatis str. MC2 155]MNSGNVKVSDLLITTPPPIAQGAHAMTQLVEIPPADDGVDPHRHSGPVFG
118473097YP_887602.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCLFEVGLDAVHSPGAAAGALPECRTALRPVTLFSFGHRGCDVNHAPPAR
118473096YP_887746.1 cyclohexadienyl dehydratase [Mycobacterium smegmatis str. MC2 155]MRLRQATIFCAALLSLSTLAAGCTSGPTPDPSPLRHITESKTLRVCSTGD
118473095YP_885532.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MPAPDTIRPHSTSIRAAVFDGTISVEPVDLADPRPGEVRVKIAAAGVCHS
118473094YP_888508.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacterMIDMTIARIAEIVGGELADITPEQAAATHVTGTVEFDSRAVGPGGLFLAL
118473093YP_889392.1 binding protein dependent transporter [Mycobacterium smegmatis str. MCMTSATTGFRRQQGHPRSVRDVRVGYLAVPALVFFVAFAVIPLVGVLLLSF
118473092YP_890622.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MEPVYGTVIQLARLAWRLQGLKFTVTGVENLPVTGGAVVAINHTSYFDFT
118473091YP_887858.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MTVIRAAITQVEWTGDEESMVARHEALARRAAEAGAQIICFQELFHGPYF
118473090YP_884655.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAPDVRDMRDARRKDMSPIQPPSNRSPGQRNQGPRPAAVRPRDPQAPARG
118473089YP_889613.1 ehuD gene product [Mycobacterium smegmatis str. MC2 155]MNTERSLWNWDYAHEVLPGLVAAFFKFTLGITAASSLVAIVLGLVLVLGR
118473088YP_887893.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVEGTTHTRISVTRRTARWDPDESVTVADAMDFWAFAAGAANVIMQLAR
118473087YP_886752.1 pyc gene product [Mycobacterium smegmatis str. MC2 155]MISKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQ
118473086YP_889264.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNGQWLPDPEGRYEYRWWDGQSWTDQVSHQGQLHRAPLGPPPGPGPAQAQ
118473085YP_889364.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MGMIRQVSTREVYRNNWLTLREDAIERPDGSDGIYAVVDKPTYALVIPHD
118473084YP_889705.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMASNMRTGAHFTPIGGAPGIERLQAGLRGEGFTPHRHDTYAIGMTLSGVQ
118473083YP_890016.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSSSITDTARPRLDQVDVRGPRFAAWVTTAVLIVALLVSGVSSAAAAVVL
118473082YP_890112.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MPYLLMRWFDMTGSDGDGGQARQIEYETLDEGRIARIWLNRPQAQNAQSR
118473081YP_889034.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSTQKALAPEISTWPDENPQLIGSRCDTCGSYVFPVQDHCPRCSSADTSE
118473080YP_884634.1 RNA polymerase factor sigma-70 [Mycobacterium smegmatis str. MC2 155]MSVILRKLTTVTVLAHKLDDDSPADAFLAEAQTYRRELLAHCYRMTGSLH
118473079YP_884864.1 oxidoreductase- FAD-linked [Mycobacterium smegmatis str. MC2 155]MSDNSAVARIDEVAPGDVVTLGTGEPTCKVVHKEDTESGLLVTFEGDDGE
118473078YP_888750.1 hydrolase- alpha/beta hydrolase fold family protein [Mycobacterium smeMAETSYASCGDLSLAYQLFGDGPIPLVFVGPFVGHVELFWTVPEFKSFFD
118473077YP_888869.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGSVGHRVAKFARVERFAMTGCRAMVSPGGCGGERW
118473076YP_888908.1 orB gene product [Mycobacterium smegmatis str. MC2 155]MSLVPTADQPQKAKDFTSDQEVRWCPGCGDYVILNTIRNFLPELGLRREN
118473075YP_887561.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTEPPQVAEEVIEDLAGVHREINAAEGEILLQTHDLTVKFGGLVALDSVN
118473074YP_887169.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MKSVGIPKGTECCPDAFQWDRREDCEVRQILDRIADKWSLLIIALLDDGS
118473073YP_884504.1 ptsI gene product [Mycobacterium smegmatis str. MC2 155]MVPGVRYAPVIRPGRLPVIELPDTEVAEPDRAAEAGRFRAAATAVTERLR
118473072YP_890994.1 tpiA gene product [Mycobacterium smegmatis str. MC2 155]MPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFI
118473071YP_891052.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MGTFVISGGTDGIGKAIAANRLKLGHEVVVIGRDTAKGQAFLDSAADIGA
118473070YP_889282.1 uracil-DNA glycosylase [Mycobacterium smegmatis str. MC2 155]MGPIFGHSGRVSPQLLPHPRTGQLFPSPVPPGTGWPGDPATPSTPVAKTP
118473069YP_888986.1 mycocerosic acid synthase [Mycobacterium smegmatis str. MC2 155]MTQNCVAPVAIIGMACRLPGAINSPQQLWEALLRGDDFVTEIPTGRWDAE
118473068YP_887127.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAPQSRGAYREAPGFGSIGEVSIDISLDPDTAFDTAPRPFHLAWCAQPPR
118473067YP_885560.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MSQRSYAGQSAEERRRLRRARLLDAAMDAMCANAWRAVTVDKLCASAGLN
118473066YP_888589.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium smeMVDSSSAAPSFPTLNHVAVTVRDLAVSGPWYRALIGADPVLDERTDAGFH
118473065YP_885594.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRFSSGHWPGRGITAAPVAAHSFLNVLTRRETHRKAFPGKGVDMNPIVRR
118473064YP_886641.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAQGSDFAGKRCFVTGAASGIGRATALALAAAGAELYLTDRDADGLVQTV
118473063YP_889143.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTASATQNVYFDPYDVAINADPYPTFARLREEAPLYYNEQFDFYALSRFS
118473062YP_887345.1 aroE gene product [Mycobacterium smegmatis str. MC2 155]MPGRRPAAPGEPRKAAVLGSPIAHSRSPQLHLAAYRALGLTDWTYERIEC
118473061YP_885804.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPYICDLDHNCRDHTRRKGVHMEPNQHVEAETELVTETLVEEVSIDGMCG
118473060YP_890782.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTTTPDDRPRTESPPTSPPTARAAARQLLMRLHFYAGVFVGPFILIAAVT
118473059YP_885885.1 antibiotic ABC transporter transmembrane protein [Mycobacterium smegmaMTRLWAALRLELTVQTRQKFLHAAVFSGLIWLAVLLPLPHSVRPVVEPYV
118473058YP_890978.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTNTATVLRDLFAAAEQSGFGEAFLDRLSDDVVFTATGTSPVAGKYHGK
118473057YP_889670.1 50S ribosomal protein L25 [Mycobacterium smegmatis str. MC2 155]MAKTANIPNKLTANVRTRTGKGASRQARRDGKVPAVLYGHGTDPQHLELN
118473056YP_890204.1 GlcNAc-PI de-N-acetylase [Mycobacterium smegmatis str. MC2 155]MNELFTGDLREIAVVGAHCDDIAIGMGGTLLTLANTVPGLRVTALVLSGG
118473055YP_890791.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKFTGITTRRGLAGICASGLLGGMAAAVIAAPTASAAPDCSASGVANTVS
118473054YP_885585.1 TROVE domain-containing protein [Mycobacterium smegmatis str. MC2 155]MDILKTIRLRQTPQAPAATPGQVRNAAGGYTFPVDDWARVHRFLTLGTDG
118473053YP_885357.1 hemD gene product [Mycobacterium smegmatis str. MC2 155]MGGADSLTKVGGADAAVAVVGAAEGSVGAAESPASDPQPRESSSRSRSRK
118473052YP_888097.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDQPDPGPAPQPEETGYTEGGVPTFDAVREKIETRYGTAIGSSELAGET
118473051YP_888865.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTPKPEPEPNAIHAGQLGRILGLGAGSGDVSISTVLGVEYLGKTAEFFG
118473050YP_887755.1 short-chain dehydrogenase/reductase [Mycobacterium smegmatis str. MC2 MTARSDQAVRHWFITGASGGLGHHLAECALRQGDRVTATVRRATALADLC
118473049YP_889298.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVFGRSKSKNLPATVEGANGLSDDPGTAAKVLSHIIESSTRVQAPAVRAY
118473048YP_887095.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDTRATTQTTRYRERLWVPWWWIPIAAGFAALIAFEVVMGVSSIPAWVP
118473047YP_889308.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MAEIVLDRVTKSYPDGAGGVRAAVKEFSMTIADGEFIILVGPSGCGKSTT
118473046YP_888302.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARQRDGFAAGPPGHRVDDEVDGLIQAVSATVVGSMRRARSDRQASSPCS
118473045YP_890450.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MAAAPGPDPTDGADQGGLEQVSRADRIASLTGVRAVAALTVMGTHAAYGT
118473044YP_887368.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRGAHEEVSWRLLVTNAVNAFVNSVTGGSQPECARVRRSAR
118473043YP_889104.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGVMPVTGMVSPTDPFPPPAQFRQRMLPFFSVVQSLSIAEHVL
118473042YP_884469.1 transcription factor WhiB family protein [Mycobacterium smegmatis str.MTALMTNGIPLGVCTSDPERWTSAPDAQAKVICRECPRRWLCAREACELP
118473041YP_889831.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSKTLLGKVALATGGSRGLGAATAEALADRGADVAISYVASDAKAQAVVE
118473040YP_888451.1 ribose transporter permease RbsC [Mycobacterium smegmatis str. MC2 155MTTTSAPLKPPESGPTNTSRPRGRVLGGPSLRQLAQLGPVVALVLLAAVF
118473039YP_884694.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRPCAGEQIPVGIGQRRGAQTAAHDRIGEPLTKLPDRHAERDPDVVLAWT
118473038YP_889862.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMDKLLNLDGRIVVVSGAGGGGIGTTVTRMAAEAGATVVAVSRSQDNLDTH
118473037YP_888066.1 argF gene product [Mycobacterium smegmatis str. MC2 155]MIRHFLRDDDLSPEEQAEVLTLAADLKKTPFSRRPLEGPRGVAVIFEKNS
118473036YP_885519.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMDTDTSLPPRGRRDAILQVLRASPQPRAIAGIADELGVHPNTVRFHLEAL
118473035YP_889684.1 pabB gene product [Mycobacterium smegmatis str. MC2 155]MRIERFCTPDGQADAPSVLRSVAAAASAAGLAPPAALIGDWFGSRAVIAP
118473034YP_888966.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MSYVPERDAAGLPEELSAVDQLLHRGEANPRTRSGIMGVELLDTTPDWER
118473033YP_890873.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSTSQAIYKPLSMAISVAGGLLAGKVFSEIWQRVSRSDQEPPEPEDLSRS
118473032YP_887585.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGRVSIGDFAVMTHLSRKALRHYHEMGVLVPAHIDAHTGYRFYDTCQVD
118473031YP_887105.1 diguanylate cyclase [Mycobacterium smegmatis str. MC2 155]MSPFDHYYARTAMLSAQGQRSRMRRIIGVTITALAFVPVLMLASPAGPAG
118473030YP_890282.1 permease [Mycobacterium smegmatis str. MC2 155]MAMNLAVARWRPNSMQVLVFGIVGLALAGTTLRAFVADTPDVATAATVFC
118473029YP_888248.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPFEPVQRPAGLSDLAYEQLRSRILDGDFPAEGRMSVVSIAEQLKMSRSP
118473028YP_888559.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGWFDRFRRGGSVRAGDPAADLQYMQRWVAEHTGVEAYVEPRTTVTDVTV
118473027YP_890475.1 asd gene product [Mycobacterium smegmatis str. MC2 155]MVNIGVVGATGQVGQVMRNLLEQRNFPATSVRFFASPRSEGKKLTFRGQE
118473026YP_888002.1 peroxidase [Mycobacterium smegmatis str. MC2 155]MLDLDDIQHILLTRTPAITGRYEFLTFDTPAGGRAWLTALLDKVQSAADV
118473025YP_886534.1 RemK protein [Mycobacterium smegmatis str. MC2 155]MTEQRRLWWRHLLSVLLAPAMMTVFIPSAIAAVTDARAPDLSTAGGWLAA
118473024YP_884681.1 uracil DNA glycosylase superfamily protein [Mycobacterium smegmatis stMAGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMI
118473023YP_886964.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRQPHATDDRGLHVLVFGPLRALRLATALGCAAGTSECTCGTAALAGTAT
118473022YP_886490.1 acyl carrier protein [Mycobacterium smegmatis str. MC2 155]MQSTSPDAISAALTEILREDMNVDIRRVTRDSRLVDDVGLDSVAFAVGMV
118473021YP_889029.1 long-chain-fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 15MTHPSWQTIPEMVLSAADRFGDAEAVVDHGDNPAGAAGPLRLTFVELADR
118473020YP_889406.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MVRTRIEVQEQTQVGDALVRGLMRAQLGLALRLAAVVVSIVAAVVLFTTA
118473019YP_889726.1 DNA-binding response regulator [Mycobacterium smegmatis str. MC2 155]MAVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDAL
118473018YP_887547.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLPHLWKATLVSGVLAVVLGVLVLAWPGITLLVAAICFGAYLLITGVAQV
118473017YP_889922.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGAPEPNPDRTPVPPQLPRALLDPRPVIIAIALGWLVATIAAFTLPDLH
118473016YP_885834.1 sulfatase-modifying factor 1 [Mycobacterium smegmatis str. MC2 155]MLTELVEVPGGSFRMGSTSFYPEEAPVHTATVGDFAIERHPVTNAQFAEF
118473015YP_889253.1 O-methyltransferase- family protein 3 [Mycobacterium smegmatis str. MCMTTTLTSDPVSTVLHGLLRAEQDGDAAAFAEVGEFPLDAAPAERAEVLKN
118473014YP_890436.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTTIDIDRDAAHDAAQNELNKPIYPRSSLTQQFLDWIDELLYRLAYEGST
118473013YP_889494.1 acyl-[ACP] desaturase [Mycobacterium smegmatis str. MC2 155]MAQKPVPNALTLELEPVVAGEMRRHLDSEDLWYAHDYVPFDQGENFAFLG
118473012YP_889463.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDSEGSTHTPDERDDQATGADQRRDAELKRREYFADERDQVADERERLAD
118473011YP_889431.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTSTDASAETVTRDYPSIDDVSVSLTDGVLAVTLNRPDSLNSLNRDMLDA
118473010YP_885959.1 gcp gene product [Mycobacterium smegmatis str. MC2 155]MIILAIESSCDETGVGIADLRDDGTVTLLADEVASSVDEHARFGGVVPEI
118473009YP_890090.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTTLHDVPRVSGGEEEHGHLEEFRTDPIGLMKRVRSECGDVGWFQLADKQ
118473008YP_884927.1 sugar transporter sugar binding lipoprotein [Mycobacterium smegmatis sMIRRWLCLAVVTAVACLLTACGGGSSSSGPVEIAVWHGYQDTEGEAFKGL
118473007YP_889813.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCLIEPARITISAFLNALMLRRSMTSRQLRERSGKSDSLRFFSGSFRCAR
118473006YP_888959.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSFTTPVHVRWSDIDMYQHINHATMVTILEEARIPFLREPFGPTIDTIGL
118473005YP_890954.1 oxidoreductase- aldo/keto reductase [Mycobacterium smegmatis str. MC2 MADDLVISGVPFTHDPWMASQNRYDAMPYRRVGTSGLLLPAISLGLWYNF
118473004YP_888318.1 zinc-binding alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 1MGRCVGLFKGVKAVGVYEFGGPDALEVIDLPEPQAGPGEVRIRVYAAAVS
118473003YP_889543.1 oxalyl-CoA decarboxylase [Mycobacterium smegmatis str. MC2 155]MNTAPLMTESVPGTSPVTDGAHVLVDALKLNGVETLYGVVGIPITDVARV
118473002YP_891128.1 trx gene product [Mycobacterium smegmatis str. MC2 155]MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAA
118473001YP_887514.1 nadB gene product [Mycobacterium smegmatis str. MC2 155]MTGAGTFACGTSAYWQQRTDVVVIGTGVAGLVAALAAHRAGRRVTVLSKV
118473000YP_887782.1 tena/thi-4 family protein [Mycobacterium smegmatis str. MC2 155]MIGQTPTTRAPFDCQDEHMHPNPLTFSARLWQQIETVYEEILAHPFLTGL
118472999YP_888890.1 ribonuclease- Rne/Rng family protein [Mycobacterium smegmatis str. MC2MAEDAHTEDLSTQTPQQEGLPERLRVHSLARVLGTTSRRVLDALAEFDGR
118472998YP_890278.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVTRCLLGGLTCATRRREHGVILMLQPCTADRRPIGPAKWIGPVATESDL
118472997YP_885319.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAQQTPPATVKTDGRKRRWHQHKVERRNELVDGTLEAIRRRGSNVSMDEI
118472996YP_889336.1 long-chain-acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTDQKATRNSVGLLDLATRLPGFLMDAPVILRGVATGFTARPSAKTSIGK
118472995YP_887484.1 ileS gene product [Mycobacterium smegmatis str. MC2 155]MTAYPKPAAPNFPERELEVLDYWAKDDTFRASVERREGAEEYVFYDGPPF
118472994YP_890725.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFQLTEEQTLLADTTRDLLSSYDTETRNKVIASDPGHKPEVWNQLAEIG
118472993YP_889386.1 nitrate reductase subunit alpha [Mycobacterium smegmatis str. MC2 155]MEELLQRSGRFFTPGTFSSDLRTVSRQGGREGDVFYRDRWSHDKVVRSTH
118472992YP_885274.1 aldehyde or xanthine dehydrogenase- molybdopterin binding subunit protMHPFAFTKAADERSALNAAASGGRYVAGGTTLVDLMRETVERPESLVDIN
118472991YP_889586.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAELPLPNYDEMALGDIQHKVRSLTKDQVEAILTYEAGHAARVPVLEIV
118472990YP_885474.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MVVMVKAVLFDFSGTLFRLEEDESWFEGMTVDEREVDGHVQAELMRRLTA
118472989YP_887451.1 heme peroxidase superfamily protein [Mycobacterium smegmatis str. MC2 MQRITEPDLETETETDAARLRAACERDLGDPARWFPPPGYPDSLALCIVD
118472988YP_887003.1 multimeric flavodoxin WrbA [Mycobacterium smegmatis str. MC2 155]MSRTLLVVHQTPSPATRELLEAVLAGARDPDITGVDVVTRPALAATIPDM
118472987YP_885926.1 PduO protein [Mycobacterium smegmatis str. MC2 155]MGALSLSTAQKVVDAAIEKANEIGQPMNIAVVDDGGHLVAFARMDGAIKA
118472986YP_887236.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATTRRMAGVTSAVILTAALGLSTGTAAAAEEFTYQPLWPFASQTDADTW
118472985YP_889807.1 sugar ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MMTTDTATKTTAPAPTPGPRTKVKRRKFDPWGVVAWIVGLGFFFPVFWMV
118472984YP_887825.1 dopamine receptor D4 [Mycobacterium smegmatis str. MC2 155]MRHKLIERTVVCLAAGGGVGLSVLLGAPAALADPEPSPPTPVVAEEGTPH
118472983YP_884686.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVAPETERIRTQIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGEHALIV
118472982YP_885541.1 mce related protein [Mycobacterium smegmatis str. MC2 155]MMAASPKRLRKVRLVAAFAMTVIVSGCATNGLADLPLPAPGVGSGGYRIT
118472981YP_889249.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKPISGKTTSILRRLAAAACVGAVTMAMTSCTSDERDIPSAGGTAEVGAT
118472980YP_889665.1 glmU gene product [Mycobacterium smegmatis str. MC2 155]MTASTEAAVVVLAAGAGTRMRSDTPKVLHTLAGRGMLAHVLHTVSEIDAR
118472979YP_887272.1 ethyl tert-butyl ether degradation EthD [Mycobacterium smegmatis str. MTMMLVHYVGNADSRFDRDYYMTEHVPLVERTWGPHGLRSAEVYFAAEAG
118472978YP_886238.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGQSLEVVTSELRSASAALADAGQRLQDGLSAVDLSVDQLLGSGWKGGAG
118472977YP_885430.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIAAVATMMAVGCRGIGNAEKPDRTGRQQRNADVVRDAFARGVGDQNSFY
118472976YP_888392.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTIPDHVGVFGGGRMGTGIAHAFLVAGASVTVIEADAGAAEAAELRIIAS
118472975YP_884627.1 lyase [Mycobacterium smegmatis str. MC2 155]MSNDLTIHNTFVPHEDPEESLAFYRDALGFEVRLDVGHGTMRWITVGPPN
118472974YP_888883.1 NAD-dependent deacetylase 1 [Mycobacterium smegmatis str. MC2 155]MDAPELVALLQGRRIVALTGAGMSTDSGIPDYRGPDSPPSNPMTIQQFTS
118472973YP_886868.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMQESATASTTSTAPPARLRLVNGLRDAISHGVLKQGERLNERELCETYNV
118472972YP_884628.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPGEEQRLRDLKLLRRVRDRIDREYAQPLNVEALARGVNMSAGHLSRQFK
118472971YP_886650.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDRQRRRWHQPPTPARWRDDALPAQERCCGRRGGRTVRPCGHPWPFVVDA
118472970YP_885451.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFRRYLALMVAALLTGLLAGCENTDSWVQASPASGWAAQYADAANSSYKS
118472969YP_886339.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MYEKDGQQYFIVDSHVHLWDGRASNLKNVHGKQFIDCFYDYHKNLSPEEA
118472968YP_889486.1 fumC gene product [Mycobacterium smegmatis str. MC2 155]MADTDVEYRIEHDTMGEVRVPKDALWRAQTQRAVENFPISFRGLERTQIR
118472967YP_886241.1 sensor histidine kinase MtrB [Mycobacterium smegmatis str. MC2 155]MGRALSLVWRRSLQLRVVTLTLGLSLAVILVLGFVLTSQITDRILEVKVK
118472966YP_886349.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMADVGDLEFFVTLAAAGTMTEAARHWGVSVSVVSRRLKALEERLGTPLVH
118472965YP_890554.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MTSLEGLDLDALDRHLRAEGIARAGDLRAELIAGGRSNLTFLVFDDASKW
118472964YP_886498.1 gp35 protein [Mycobacterium smegmatis str. MC2 155]MCQLAVRGPLRLLWEGPDGEFNPDFGPAKDIPDELQRQYRIAEAQGIPVE
118472963YP_887923.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTIRLALQIPNFSYGTGVEELFPTVIAQAKEAEDAGFDTVFVMDHFYQLP
118472962YP_889129.1 enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis str. MC2 155]MPDEIEVRAEGDIRVITLNRPEALNAVNDSLHEGLAHLWTRLSEDYDARA
118472961YP_889281.1 alkanal monooxygenase subunit alpha [Mycobacterium smegmatis str. MC2 MRLSVLDLVPVRTDQTTADALAATTHLAQTADRLGYHRFWVAEHHNMPAV
118472960YP_888873.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MASRAGCSRPSCCGCRPWIRTTGSRDRRPHAGSGNRSCGADLLQHGVGIT
118472959YP_889516.1 cystathionine beta-synthase [Mycobacterium smegmatis str. MC2 155]MRIARHISELIGNTPLVQLNSVVPEGAGLVAAKIEYLNPGGSSKDRIALK
118472958YP_885800.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MNADHDPLTVLHQHDEPPVAPDPEFVARLRARLEAALTLPNRTEGVVMTG
118472957YP_884559.1 mce associated membrane protein [Mycobacterium smegmatis str. MC2 155]MEDQPADSGDLTTPARRRRWGFPLRRRQAEPAEQSDATGEGTEPSTEAGN
118472956YP_888902.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRPALELTSVPPWTITATVPDADTSGRAWTIIAIGHAEDVITRWEGQLGD
118472955YP_887265.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MTVAGLVFAALAAVLHVYIFVMESLTWTSARTRATFGTTAEEAEATKELA
118472954YP_887909.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MGPDELFQRAVIARRYYLEGRTRVQIAEEFGISRFKVARMLDEALGSGMV
118472953YP_888688.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLENLDRVRLARAVAGGAVLAGVAAAIAGCGGTGSNEPSTTTTTTTITTT
118472952YP_884809.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
118472951YP_884716.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MDPALAELAADLPAHALLTDPDQIEGYRRDAAADPLAGRPRAVVRATCTA
118472950YP_889619.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRAPRQVAEFNKRFTNPAARAITPWLPYLGTLEHVGRKSGKCYRTPLLVF
118472949YP_890949.1 ANTAR domain-containing protein [Mycobacterium smegmatis str. MC2 155]MGESRNHELAMRMADLARAVASPRSLADVLTGVTTAAKELIPGVDTAGVL
118472948YP_886266.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium smegmatis str. MC2 MGLGAGLFGGLVTASAVLTGALTAPAPSPQIALVDNTEALTSSDGSLADG
118472947YP_885833.1 arylsulfatase [Mycobacterium smegmatis str. MC2 155]MAAEFNGKIELDIRDSEPDWGPFAAPTAAEGAPNVLYVVWDDIGIATWDC
118472946YP_884998.1 rhaU gene product [Mycobacterium smegmatis str. MC2 155]MQRVCFVLQLRPERMDEYLTAHEQVWPEMLEALSEAGWHNYSLFVRESDG
118472945YP_888443.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTRTVLIAGSSRGIGAAAARREAANGSRVILHGRSDSPALKELSVELGAP
118472944YP_889932.1 ThiS family protein [Mycobacterium smegmatis str. MC2 155]MTVRYFAAAAAAAGIETESLEIATGTSVAELVERLGARNPELARVLKRCS
118472943YP_884443.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPARADVRLAPRQRLTRGLKYTAVGPVDITRGVLGIGADTAQATAAELRR
118472942YP_890487.1 ScnB protein [Mycobacterium smegmatis str. MC2 155]MPEEPTTLKRIVERNQIWPVMAAKYGVENPVPPWKSSLDGLCDALDHSEC
118472941YP_890853.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MAKTFIGPRLRRLREEHGLTQVALARALGLSTSYINQLENDQRPVTVPVL
118472940YP_888581.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MDAPGAEHDVDALVRQRLRELRTERGLTLEDVASRAQIDVSTLSRLESGK
118472939YP_887694.1 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogeMHSDPSHIDLLGPATFTSRDRRPIGFPPLRCSRHKISWKEPSEMKTKAAV
118472938YP_886821.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MANLLYTYVDIADRKDIDAAVGLLGNARVRFPDNGFETIDDARPFFTRLW
118472937YP_890749.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MLPPLPAEDWDDAARDALASVVPPERRDADGVGNALGVLVRHPELARHFL
118472936YP_885815.1 acetylcholinesterase [Mycobacterium smegmatis str. MC2 155]MRRARQVSALLFGLVIVLNAAVVGCRAAEAPVATDPVVVHTASGTVRGLV
118472935YP_890921.1 hydroxyquinol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MSVAGLHEENSAEVVVDSFRDTPDERLKTVLNSLVEHLHAFIKDVEPTHA
118472934YP_890879.1 sulfate/thiosulfate import ATP-binding protein CysA [Mycobacterium smeMPSAVQIESATKVYGSTKALDNVSLHIDPGQMVALLGPSGCGKTSLLRAI
118472933YP_886896.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVEVNLARCTGHGICETIAEDVFEVQDDGTVLIHGNERPEHDRDRMRQA
118472932YP_885537.1 mce related protein [Mycobacterium smegmatis str. MC2 155]MGNSIELDGRGPSERQLLACGLAVLVVAGLISTVLLVKATGRLDPYVRVV
118472931YP_886558.1 carveol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAERLTGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPSVPYD
118472930YP_884682.1 esterase [Mycobacterium smegmatis str. MC2 155]MTSSVSTIDARPDLSVGKQIMHRRRSAESFALAAGCRAFVRNAVRVWAMQ
118472929YP_890913.1 shikimate 5-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTDPTGRTRLLGVVGDPVAQVRAPELWGTVFRELGVDAVCVPFHVRPTDL
118472928YP_884765.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAVDVDTARHELTQPGQADDQETDEKSGVDTDSREPTSAQVRGVRGALVI
118472927YP_888067.1 argD gene product [Mycobacterium smegmatis str. MC2 155]MTLQSRWEAVMMNNYGTPPLSLVSGEGAVVTDADGREYLDLLGGIAVNLL
118472926YP_886615.1 hybC gene product [Mycobacterium smegmatis str. MC2 155]MTELDLFVSPLGRVEGDLDVRVTINDGVVTSAWTEAAMFRGFEIILRGKD
118472925YP_886867.1 pcaC gene product [Mycobacterium smegmatis str. MC2 155]MPDTDNAPGESEALEYVNQMARARGYVLPYHKLMARADLDVLKAANGLVS
118472924YP_885247.1 monovalent cation/H+ antiporter subunit F [Mycobacterium smegmatis strMNWVWGIAAVMLTAAAAITMFRLLAGPSTLDRLVALDTLVAVTLCSIGTW
118472923YP_885148.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MTPAQLRAFSAVVRLGSVRAAAEELGVSDAGVSMHVAQLRKELDDPLFTR
118472922YP_885050.1 oligopeptide transport ATP-binding protein OppD [Mycobacterium smegmatMSALLQVNDLRVSFTTDGGVVRAVDGVSFDLKRGEILAVVGESGSGKSVT
118472921YP_886714.1 ilvB gene product [Mycobacterium smegmatis str. MC2 155]MSAPTTRPPHTAAAPANGAPASTSDQPQPKRVAPEQLTGAQAVVRSLEEI
118472920YP_889940.1 cupin [Mycobacterium smegmatis str. MC2 155]MLVMEKMSLTALARQQLAAARTASAGRSAHTVYGGHEHNLRQTLIALVDG
118472919YP_890405.1 NTP pyrophosphohydrolase [Mycobacterium smegmatis str. MC2 155]MSSTPEGLVPDAAPPWLRPLLDNVGHVPNAYRRRVPPEVLASIVEANHQA
118472918YP_884450.1 pknA gene product [Mycobacterium smegmatis str. MC2 155]MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKAEFST
118472917YP_889424.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLQRIATTAIAAPRRILVVAALVMIAAGIFGIPVANKLSAGGFQDPTAES
118472916YP_887311.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTANPEQMLFTSTAQAFLEKEAPLSRVRQLHDEDTSFDAQWWGRAAELGW
118472915YP_885297.1 dihydrodipicolinate reductase [Mycobacterium smegmatis str. MC2 155]MNLYSLLQQRTEASGPVRVGVIGAGKFASMFLTQAVNSPSLHVVGVADIN
118472914YP_888978.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMSSVTRRSQAKSDRRSQLIAAAERLVAERGYLAVRLEDIGAAVGVSGPAI
118472913YP_886316.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTQHSKSDQARKSFIDSVKGTAKEVVGAVTGNDSLTAEGQLEKTQAKERR
118472912YP_889400.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAKTHLNCPCGEAIVGTDEDDLVEKAQAHLAESHPGREYDREMILFMAY
118472911YP_885597.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMKETPQKSNIAVKVGAPPGERHGSTADEVRSHYDLSNEFFRLWQDPTQTY
118472910YP_885709.1 Asp/Glu racemase [Mycobacterium smegmatis str. MC2 155]MTRIGMIVPSSNTALEPATTRLLTDRPDVTVHYTRIPVRAITLDGGGAAF
118472909YP_884680.1 arginine decarboxylase [Mycobacterium smegmatis str. MC2 155]MDQTETPLLDALNEYHASNRYGYSPPGHRQGRGVDDRVLRVLGREPFLSD
118472908YP_886951.1 ElaA protein [Mycobacterium smegmatis str. MC2 155]MTVSLRRSWAKDLDAPTLYELLKLRVEVFVVEQATPYPELDGRDLLAETR
118472907YP_884569.1 panE gene product [Mycobacterium smegmatis str. MC2 155]MRIAVVGAGAIGAYWGAAMHRGGAEVHLIARNAHLHAMREHGVRVLSDRG
118472906YP_886622.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQTDEQVGFHWATPHGRPTTLRHLVAADDEPARLAATHLSALDDTLIDTA
118472905YP_885955.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MAGLAAVGTVAGVSIARSLTLRVSKEDPYAGEDFELLDADRSSVITTDDG
118472904YP_890776.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTTAEAPRRRSEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTI
118472903YP_888104.1 universal stress protein family protein [Mycobacterium smegmatis str. MSAYQTVVVGTDGSDSSLRAVDRAGQIAAASNAKLIIATAYFPQSEDSRA
118472902YP_888767.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGLLPLIGVITLVVFGGLFAAIDAALSTVSIARIDELVRDERPGAARLA
118472901YP_888563.1 lipA gene product [Mycobacterium smegmatis str. MC2 155]MTVVPEGRKLLRLEVRNAQTPIERKPPWIKTRAKMGPEYTELKGLVRREG
118472900YP_885849.1 rplE gene product [Mycobacterium smegmatis str. MC2 155]MTTTEKALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDA
118472899YP_890338.1 glucarate dehydratase [Mycobacterium smegmatis str. MC2 155]MTAHGTTPVVTEMTVIQVAGHDSMLLNLSGAHGPYFTRNLVKLTDSDGNT
118472898YP_887526.1 hisI gene product [Mycobacterium smegmatis str. MC2 155]MSLDPAIAARLKRNADGLFAAVTQERGTGKVLMVAWMDDDALARTLQTRE
118472897YP_888514.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPLSDHEQRMLDQIESALYAEDPKFASSVRGGTLRAPSARRRIYGAGLFV
118472896YP_885966.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGVVACLAPALAVPAAATLDPIPGEGFFLVGTDIAPGLYTTGGSESPFA
118472895YP_886056.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTFSLIAHDTSTEAFGIVICSSSPAVASRCAYARAGVGVVATQNVTNPAL
118472894YP_885182.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium smegmaMVAELKLGYKASAEQFAPRELVELAVLAESAGMDSATVSDHFQPWRHEGG
118472893YP_888656.1 amidase [Mycobacterium smegmatis str. MC2 155]MDHITFVPTVDQMNYTFGGADPVMRIKPGTVLTLWTEDAYGGRITSVDSV
118472892YP_886147.1 cytochrome P450 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSDGGHQLRGAQALATLVDLGFPAIASGVIARRPPVLGLLERMQADERAG
118472891YP_888538.1 ubiquinol-cytochrome C reductase cytochrome C subunit [Mycobacterium sMTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALL
118472890YP_886723.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLTGVSLICAPVCALVLAPTAAWAAEPEWSNLDARRYDAPIPRAGTLIAA
118472889YP_890589.1 LacI family transcriptional regulator [Mycobacterium smegmatis str. MCMSAEVPSRRQRSTRVSAADVARAVGVSPATVSYVMNGRAGVSEQTRARIL
118472888YP_885716.1 recD gene product [Mycobacterium smegmatis str. MC2 155]MSLLEAFAEILEPADVHVAQRLTVLADEPDASVELAVALAVRALRGGSVC
118472887YP_886948.1 mycothione reductase [Mycobacterium smegmatis str. MC2 155]MEHYDLAIIGTGSGNSIVDDRYAGKKVAICEQGTFGGTCLNVGCIPTKMF
118472886YP_885464.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MPDRDDVAPTLRDLLNSHLGVVAAQNLTDDLSAELDRTITWAHTTELRDP
118472885YP_884866.1 aroK gene product [Mycobacterium smegmatis str. MC2 155]MATPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIEKMSAGHA
118472884YP_884438.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MISDEPVTPPVLPVATARRSGAWLIADLRGRRTALAAVVTVGLAAAAASV
118472883YP_884952.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MYCSAACRQKAHRARTARRVDALRSLRSGRNEVRRPVGIRSDIAQSIARA
118472882YP_887654.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMTLTAAVAQFAPSEDKAANLDTIVDLLRQAADQNADLVVLPEYAVFTVPT
118472881YP_885380.1 class V aminotransferase [Mycobacterium smegmatis str. MC2 155]MMRAAFGAEFVGAEGFLNSATYGLPPQFLVDALDTHIRQWQSGTLDAASF
118472880YP_890781.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRNSAVVFAVAALTLAGCTPQHEEHTMAQTVTFADPWASAADTGMTAVFG
118472879YP_889468.1 ychF gene product [Mycobacterium smegmatis str. MC2 155]MSLNLGIVGLPNVGKSTLFNALTRNDVLAANYPFATIEPNEGVVPLPDPR
118472878YP_885169.1 antibiotic transporter [Mycobacterium smegmatis str. MC2 155]MSWLAVLVVIISGGLMGVLSGGDSASQSPVAVPSDAESARADALRADFPG
118472877YP_891066.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPRWEHGSEDRLKQAATELFEERGFQNTTAVEIAKRARVTTRTFFRYFAD
118472876YP_886083.1 phosphatase YfbT [Mycobacterium smegmatis str. MC2 155]MTSHKTFPIAGILFDSDGVLVDSHEAAATAWNHWARTWAPGFDFHRDAQH
118472875YP_888105.1 acyl-CoA thioesterase [Mycobacterium smegmatis str. MC2 155]MPLPQLADVLATLDITDCGHDMFVATQIDNEAHHIIGGHISAQALMAASR
118472874YP_885698.1 peptidase S15 [Mycobacterium smegmatis str. MC2 155]MIIERDVAVPCDDGLILRADVFRPDDGEPAPVIMTLGPYGKGVEYSDGYA
118472873YP_884475.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAPFTAETGDAHIDDVVGVEVTIDGMLVIADKLGLTDFPPSMGIRLNIP
118472872YP_885201.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSALAALDAERIKLSTTRSPLWSVVGAAVLSFAIAALQGWSAYGYTPLPP
118472871YP_890557.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MESNPPSAVVEAAHREHLTTLPFGDRRDFDDADRGFIAALEPCVITADDG
118472870YP_890813.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKIGLSINYAGGFKDIAAEVADLERAGLDIVFVPEAYSFDAVSGLGYLAA
118472869YP_890941.1 carbon-nitrogen hydrolase [Mycobacterium smegmatis str. MC2 155]MRTVDVAVVQEPAVAGDVAANVRRAVAALAKHPGADLVVFPELFLCGYRL
118472868YP_889760.1 peptidase [Mycobacterium smegmatis str. MC2 155]MPLPQPISVEDFFRPPVRAAAKISPDGTRIAYLAPWQNRLNIWVENVDGS
118472867YP_884872.1 two-component system response regulator [Mycobacterium smegmatis str. MKVVVADDSVLLREGLIRLLTEGGHEVAAAVGDGPALVQAVDTHRPDVSV
118472866YP_885140.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium smegmatis strMGGTATMAKPPLSMKPTGWFQVAWSDEVGVGDVRAMKYFGQEMVAWRSES
118472865YP_886657.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MRRGSRSHSGGPGVKVDARSERWREHRKKVRSEIVDAAFRAIDRLGPELS
118472864YP_886647.1 glutaredoxin [Mycobacterium smegmatis str. MC2 155]MTVTVYTKPACVQCNATYKALDKLGIAYETVDITVDSEARDYVMALGYLQ
118472863YP_890562.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MELLRHVVVYLHLIGFAVMVGAWVAEAAARRFEITRVMDYGILLSLLTGL
118472862YP_887148.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGFQNRAGPALGDAPMTLPPPPNTPPPNGASPPPPFGGSGPYPQSLHQPW
118472861YP_886858.1 amidase [Mycobacterium smegmatis str. MC2 155]MVHAFSNDALGDHDAVGLVGELAAGRVSSADLIEAAIARVEAVNPTLKGL
118472860YP_889507.1 mycothiol conjugate amidase Mca [Mycobacterium smegmatis str. MC2 155]MSELRLMAVHAHPDDESSKGAATTARYAAEGARVMVVTLTGGERGDILNP
118472859YP_888138.1 tynA gene product [Mycobacterium smegmatis str. MC2 155]MWLRDRVDYPLDPLSADEFTAVAAILRREHGVGEGWRIASVELAEPSKAE
118472858YP_888817.1 methyltransferase small subunit [Mycobacterium smegmatis str. MC2 155]MSEHDRARWDAAYTDRPLGAGLPDGPAGPPRAFAGHVDEFPTAGSALDVA
118472857YP_885011.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNIDLTGKTALVTGSTQGIGLAIAETLARSGARVAINGRTASRVDETVAQ
118472856YP_885803.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSEGSRAGRRRSTTQDHIAGVAIDLFAARGFDAVSVDDVAAAAGISRRTL
118472855YP_889701.1 rarD gene product [Mycobacterium smegmatis str. MC2 155]MSGHQPGHPVRGVAASLGASALFGLIFYISGVVDAPSEMVFGCRILVTFG
118472854YP_888121.1 esterase [Mycobacterium smegmatis str. MC2 155]MPIDPIAQKMLDDAKASGRPNAHLLPVPTARENFENTFAALQKPDVHRVT
118472853YP_884814.1 non-ribosomal peptide synthase [Mycobacterium smegmatis str. MC2 155]MESLPLTVNGKLNTRALPAPEYQDADQYRAPANAVEELLTGIYAQVLGVE
118472852YP_887977.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKKLVVLGGGLVVAGSVALLGAGIATSQPTSASINVVGEPYMKALQILKS
118472851YP_889880.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQHNTFLRHARSAVKRPIAWIHTRASLTPQERHNLRMSNTPVAVLTASLG
118472850YP_889896.1 sensor-type histidine kinase PrrB [Mycobacterium smegmatis str. MC2 15MSMLTRIFRRTPSLRTRVAFATAIGAAIVVVIVGTIVWIGITNDRKERLD
118472849YP_887896.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIRIGTSGWSYDHWRDVLYPPGTPSSARLSRYTQVFDTVELNASYYRWPR
118472848YP_890892.1 agarase [Mycobacterium smegmatis str. MC2 155]MRFTLDHSAGRWRFRGPDGDPFLSIGVVHADDTNLRYPHNMGIFTARYGA
118472847YP_889163.1 endo-type 6-aminohexanoate oligomer hydrolase [Mycobacterium smegmatisMGSITDVAGILVGHHHRLDPDAVLGSGWASGTTVVLTPPGTVGAVDGRGG
118472846YP_887990.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MSVSFDLSTVFSTVAAAVPDQTFVVWRDRRLTYAQFDAHVDGFAHFLVSA
118472845YP_884533.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MNIHHRYATIDGQRIFYRAAGPADAPPIVLLHGFPTSSFMFRDLIPLLAR
118472844YP_891077.1 endoribonuclease L-PSP family protein [Mycobacterium smegmatis str. MCMSNKQTGTQSVEALLDARVVVTDGLVFVSGLSAADPGVGIPPQAAVSPEF
118472843YP_886454.1 serine esterase- cutinase [Mycobacterium smegmatis str. MC2 155]MLSRRIGAWALMAAGIALVVPARLPVASAAECPDAEVVFARGTDEPAGLG
118472842YP_884837.1 Hsp20/alpha crystallin family protein [Mycobacterium smegmatis str. MCMSTLMKTPAVWTRPAWQLDNWVRDFFGPADDWFKGFTPAAEVTRDGEDAV
118472841YP_885945.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MMRTGIFLSYAGGFKEAADQVVELEKVGVDIALVAEAYSFDAISQLGYLA
118472840YP_888854.1 rbsK gene product [Mycobacterium smegmatis str. MC2 155]MGAARVCVVGSINADLTFTVANLPRPGQTVLASSLASAPGGKGGNQAVAA
118472839YP_890521.1 ligC gene product [Mycobacterium smegmatis str. MC2 155]MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRK
118472838YP_890897.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MITARGLAQVESLGLSLLAGAQGADREIAWAHANELRDPTPYLAGGELVM
118472837YP_884828.1 NADH-FMN oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSATDLSPTSLREAFGHFPSGVIAIAAEVDGTRVGLAASTFVPVSLEPPL
118472836YP_887874.1 thioesterase [Mycobacterium smegmatis str. MC2 155]MAGFTHVEGLSSADVQRLRATYEPLAQSVRELVDATIRSEVDADDVAAAK
118472835YP_887287.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDVMELMNTTTVVAAGTGRAVVLDKGDRVRVIDVEGAQVGDVFAFAAGDP
118472834YP_885838.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAPPIDSGRMTVRGLLDESLMAGSRIVAGEDLLDEELTWVLPLNEVLSQ
118472833YP_888732.1 speB gene product [Mycobacterium smegmatis str. MC2 155]MTATSTPIGPVDASKVPRFAGPATFARLPRLDQVTKADVVIAGVPFDTGV
118472832YP_885136.1 oleandomycin glycosyltransferase [Mycobacterium smegmatis str. MC2 155MFPRAGLHICVVAASAPSHMYPHLPVVRELVERGHRVSYVVGAHRAELVR
118472831YP_885156.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAPLLLRGVDLAALAVALVDRLRAAGVAVSAVGPSTLVAAMHVVAPVRR
118472830YP_887077.1 thymidylate synthase [Mycobacterium smegmatis str. MC2 155]MAIDVTVLRVFTDSDGKFGNPLGVVDNSTVDPADRQRIAKELGYSETIFI
118472829YP_886955.1 cobA gene product [Mycobacterium smegmatis str. MC2 155]MTEDAYLVGLRLSGKKVVVVGGGTVAQRRLPLLLANGADVHVITRAATPV
118472828YP_885780.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MHWIAVGRIAVSCVIALPMALAVGLPTAGAKNGDTHITGQGVERTLDCNN
118472827YP_890215.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGIMPDSSPFGSQTVMGPAWPNVDEEQLTAAAASYEKLATTISGNIVPQQ
118472826YP_887048.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MEAVGWAAVVVVAAVVVAGVVVGVRSIPDAQRYLKMRRM
118472825YP_889962.1 hydantoin racemase [Mycobacterium smegmatis str. MC2 155]MIRIWVVNPNTTASMTEGIGRCANAVAGPGTEITAVTSRSGPPSIESHYD
118472824YP_890114.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSALALVPAPAASAACHNGEEEDTYTMVCTPFMVPNSPGAFSGIPGNPDL
118472823YP_885830.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMTVPGTDQDLLQIGEVAARTELSVKTIRHYDEVGLVVPSARSAGGFRLYT
118472822YP_886133.1 short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis str. MDIDGTTAVVTGGGSGIGAALAEAFAAAGARVVVADLDEPGAAATAARIE
118472821YP_889683.1 RNA polymerase sigma-70 factor protein [Mycobacterium smegmatis str. MMNNPSAGNSTEHAERFTALRPLLFTIAYEILGTATESDDVLQESYLRWAE
118472820YP_889014.1 acpS gene product [Mycobacterium smegmatis str. MC2 155]MAIVGVGIDLVSIPDFAEQVDRPGTVFAETFTPGERRDAADKSSSAARHL
118472819YP_885405.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118472818YP_885576.1 serine esterase- cutinase [Mycobacterium smegmatis str. MC2 155]MRLAGLVAVAAAATSGMQIAAMPSAMAAPCPDAEVIFARGTTELPGLGPT
118472817YP_885341.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTRVHPGEVELDFAREWVEFYDPDDADHLIAADMTWLLSRWTCVFGTPAC
118472816YP_886305.1 6-O-methylguanine DNA methyltransferase [Mycobacterium smegmatis str. MARVTEEQVEAVRALVAAIPPGTVSTYGDIAEVAGLSSPRIVGWIMRTDS
118472815YP_890484.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MSDDVPLLRNRSGTARERDPQAPVEELEFEAAIGRNVRQLRQQHGLTVAE
118472814YP_889875.1 glycoside hydrolase family protein [Mycobacterium smegmatis str. MC2 1MSGNDILAPADVDDPLRIVLVAPPYFDIPPKGYGGTEAVVADLADTLTAR
118472813YP_888124.1 rpsA gene product [Mycobacterium smegmatis str. MC2 155]MPSPSVTSPQVAVNDIGSAEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
118472812YP_887474.1 methylmalonyl-CoA mutase [Mycobacterium smegmatis str. MC2 155]MTATTGSEIRSFADVPLEGETPAAAATPEARDAQVSAAASAHGYAPDQLT
118472811YP_888463.1 dTDP-glucose-46-dehydratase [Mycobacterium smegmatis str. MC2 155]MTILVTGATGNIGRRIVDRLVELVANDIRALTKIPAKANLPAGVSVFTGY
118472810YP_887161.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MDATGTGPSVGVMTRPRLILNAFTMNTATHVAYGAWRNPETRSVEFDQLD
118472809YP_886922.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGTNEQSVDMRVSDADRNGTLRRLHNAVALGLIDIDEFEERSALVSQAR
118472808YP_887902.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MHVAGQVGSLQRGVDREQRDALGLGRGDLRAERIRLHRNDDDGVHALVDQ
118472807YP_887642.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMNTPGDSAGAPNPGTSTSIRSMNSVLSTLRIFEEVATRQPIGVSDLSRVT
118472806YP_885406.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MGVVTVDRELEAKHRALWALGNYGAIAAHIVAPLGPVLVEACGIGPGDRV
118472805YP_890012.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MDLLLLTVDPHPESVLPSLSLLAHTVRTAPTEVSSLLETGSADVAIVDAR
118472804YP_889050.1 virulence factor [Mycobacterium smegmatis str. MC2 155]MTRNVGPGPAHRSETDSSAAPVAARPGRSFGARGHARPLAGLATVVVVGL
118472803YP_890610.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRPRPPDRVELTAAILSDRRSIISGTVSGTGDIGDVVHYNASSVSGGTFR
118472802YP_884911.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSEVVDDRPGSDAPPGSEKLRGNLGIPAIVLMVVAAAAPLSTIGGNVPIG
118472801YP_887900.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDQTQSGRQPAAGRASGDGRGAELRAVEPHHRLHAQHARAVVAGPQVRPG
118472800YP_887277.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDYETRGGRLTMPRSRGAASGLLLVVLGIYGALIPFVGPYLDFAFTPDQ
118472799YP_889790.1 ANTAR domain-containing protein [Mycobacterium smegmatis str. MC2 155]MSVSQNEAISQQISNLIRDVHTRRATDVDAVLGELTESAVEYVAGAQYAG
118472798YP_890002.1 cytospin-A [Mycobacterium smegmatis str. MC2 155]MFSGSTVYSCSDRGDSSGANVVMCMVTGWRSTSARAVTISHTYRPLTVPA
118472797YP_886658.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MTAADQQPIRTRALVIGTGFSGLGMAIELQRRGVDFLILEKADEIGGTWR
118472796YP_887607.1 ECF-family protein sigma factor H [Mycobacterium smegmatis str. MC2 15MIREEFPGERRPDFQDEVKPLLGDLHRRAYAYVRDTSDAEDLVQETLLRA
118472795YP_890473.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSETPSDHPTTPVGTPAETPTATSGPVAPPPVAPPPAAVPVAPAEAPRRH
118472794YP_884516.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNDNATWTLSASDGELLLHTGVTGTAARVGHRLTIAMRSWEATVFWEGDG
118472793YP_889721.1 porin [Mycobacterium smegmatis str. MC2 155]MKAISRVLIAMISALAAAVAGLFVSAGTSHAGLDNELSLVDGQDRTLTVQ
118472792YP_890144.1 P450 heme-thiolate protein [Mycobacterium smegmatis str. MC2 155]MTQMLTRPDVDLVNGMFYADGGAREAYRWMRANEPVFRDRNGLAAATTYQ
118472791YP_886593.1 coniferyl aldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155MSTIDQRAEKHSRQGGAADVLAAQRRSFLDDGPPDIALRRNRIDRLLAMV
118472790YP_884691.1 aldehyde-alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSEVIQDRRSAVDTARAGHMLERARWAAAAYGEYDAATVEGIVAAVAEAA
118472789YP_886196.1 rfbD gene product [Mycobacterium smegmatis str. MC2 155]MDLINGMGTSPGYWRTPREPGNDHRRARLDVMAQRIVITGAGGMVGRVLA
118472788YP_890017.1 thiosulfate sulfurtransferase [Mycobacterium smegmatis str. MC2 155]MARSDVLVSTDWAESNLKAPKTVFVEVDEDTSAYDTGHIEGAVKLDWKTD
118472787YP_885658.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MDNAEYQDSSGRTLGDYPRPSVAVDAAVLTVGPDAGLSVLQVRRAQGRGW
118472786YP_890227.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTITSTTVEPGIVSVTVNYPPVNAVPSRGWFELADAITAAGRDPQTHVVI
118472785YP_884505.1 chromosome condensation protein [Mycobacterium smegmatis str. MC2 155]MPAITADTLTLPRIAAPSAADTERPVRSITTGPRGYEGEGFPVVRAFAGV
118472784YP_887181.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMRVSRVSIVMATAAATCFGVATSAPAAAENDWGLNGTYVATSNGEWARK
118472783YP_890570.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGLATAAGLMLGTAGVAAADDVIVYDGATGIPWSWPTEGACISDGPNMHL
118472782YP_890808.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSRFVPLNTIALELVPPNIERGASYAVEEAHKVLAIAAETGIEGRIRHV
118472781YP_891132.1 Soj family protein [Mycobacterium smegmatis str. MC2 155]MGSGQNKGQGVVQKPNVSRETWDSATSTWVTDAAMDTPIAAEAEQATRVL
118472780YP_884777.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSPLKVAPGQLRSAAAEEVALGAAVAALGVGDLLSAAVAALPRLQSGKA
118472779YP_890614.1 phosphoribose diphosphate:decaprenyl-phosphate phosphoribosyltransferaMDATHMSEEAQPTAGPPKNLVSGLIKAVRPRQWIKNLLVLAAPLAAVGSG
118472778YP_885471.1 menB gene product [Mycobacterium smegmatis str. MC2 155]MSSQAASDNPFDPAMWERVPGFDDLTDITYHRHVLDGARQPTVRVAFDRP
118472777YP_886103.1 transposase IS116/IS110/IS902 [Mycobacterium smegmatis str. MC2 155]MAAHCEDSEQVVVGIETDNGLWVQALHAVGYRVYGINPLSASRYRDRHCV
118472776YP_884526.1 pntA gene product [Mycobacterium smegmatis str. MC2 155]MIIGIPRESQPGETRVAATPQTVGQILKLGYSVVVESGAGAAASFSDAAY
118472775YP_890100.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNLGKTLVQVATAPVRIGIAIADAGLGIAGETLTAVQRTVTDSNPLTSRS
118472774YP_886171.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MELRHLRYFLVVVEEGSLGRAAARLHVAQPSLGRQMTDLEHQLGQRLFER
118472773YP_885989.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMKYTPGWQPTPVDWASTRGRILLAASQLFAARGYFGTSTRDIADAVSIRQ
118472772YP_887083.1 RNA polymerase sigma factor SigB [Mycobacterium smegmatis str. MC2 155MANATTSRVDTDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
118472771YP_888963.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MASDVRAVWPVLVGVGLLAGAVAAGIGALALADALTATGLPNPGPVTTYG
118472770YP_887491.1 rarD gene product [Mycobacterium smegmatis str. MC2 155]MSGSNRTGVLYGAGAYIWWGLCPGFFLLLLPAGPLEVVAHRIVWSTVFLM
118472769YP_887930.1 ureA gene product [Mycobacterium smegmatis str. MC2 155]MRLTPHEQDRLLISYAAELARRRRARGLRLNHPEAVAVITDHLLEGARDG
118472768YP_887738.1 peptidyl-prolyl cis-trans isomerase domain-containing protein [MycobacMSSSVAIAACAASLAMTLAACGSDSDTASSSTSPAGSSTVAELVTSSSTE
118472767YP_888480.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAQIAPLVFDAEGHPDPMTLTDLEQRLPGLTDLVIFSHGWNNDEAAATL
118472766YP_886691.1 phytoene dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSRAIPGPTDHVVVVGAGLSGLSAALHLAGRGRRVTVVEREPWPGGRAGR
118472765YP_888680.1 ECF sigma factor RpoE1 [Mycobacterium smegmatis str. MC2 155]MTSQHTAGTEPAPAANDTELSARFVNETLPYMSQLRSRARRLTRNPVDAE
118472764YP_890478.1 amt gene product [Mycobacterium smegmatis str. MC2 155]MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAVV
118472763YP_890425.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MGSAERFQRLLGDRYELRGVLGRGGMAEVRDGWDTRLARPVAIKLLYPAL
118472762YP_888492.1 phosphoribosyltransferase [Mycobacterium smegmatis str. MC2 155]MSAWSVRHDAIRTFQDRREAGRVLAQRLSSYRDDPDVLVLGLARGGVPVA
118472761YP_885413.1 alkaline phosphatase [Mycobacterium smegmatis str. MC2 155]MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGG
118472760YP_890335.1 ppa gene product [Mycobacterium smegmatis str. MC2 155]MEFDVVIEIPKGSRNKYEVDHETGRVKLDRYLYTPMGYPTDYGFFENTLG
118472759YP_885688.1 guanine deaminase [Mycobacterium smegmatis str. MC2 155]MTTYRGHLIHIGGAPRLADAAQCLVSEPDGAIVVDDTGRITYSGPFDRRP
118472758YP_884921.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSIKRTDRMREVLSLLRERGEVTSQVLCTELRISAATLRRDLSELEEQGL
118472757YP_888541.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSPFAELNTTDRILAGACAVAWLAALGAGVAALVALVDLGRGHTQAVES
118472756YP_886897.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDSYYELLDAADTLGERFAATDMVRGTWSAAIQHAAPASALLVRALEHC
118472755YP_890982.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MSTSLVHTDVADGVFTLTLDAPDTGNALDVAMTNAVANALERANAMPDVH
118472754YP_885217.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSYRAVYLGIAGAIVLAIGLYLMSMTVYLDDFDRYGMQIPCGTAFSEHLV
118472753YP_889409.1 glycine/betaine ABC transporter periplasmic protein [Mycobacterium smeMTRPIRVGHIALSFHDAAAEQVELVLRSAGHEIERRSAPHELMFDAIGRG
118472752YP_886213.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MERMMPDWESIFVPAAPPAESVVRGTVTFLVLLVLIRAVGQRESGGLGLT
118472751YP_889780.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAMAEPAPPPCVNADGTPCSDIGTAGPGGATGQIPGGPGGTAGPGGASGA
118472750YP_887725.1 inner membrane metabolite transporter YdfJ [Mycobacterium smegmatis stMADQHPSAEAARGSDDPEYARNLKRATLAASVGSALEYYDFALYSLASAL
118472749YP_885135.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGIWSSVLTELIPLAMVVALSPLSIIPAVLVLQTPRPRPTGLAFLGGWL
118472748YP_890042.1 pcaC gene product [Mycobacterium smegmatis str. MC2 155]MTTPDTERLERGKRAFADVMTFPAPDDFSPAMTHLLDFVFAEVWQRPALT
118472747YP_888221.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTKLPERSRARSLFPEMSDFFAGLPSWASIRPVFGDHIIRIEDEMKDGGY
118472746YP_885565.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMSNQIAATDLAACCPPGALLREPLSAAEAADMSVKLKALADPVRLQLFSA
118472745YP_888669.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMELRHLTYFLAVAEELNFARAAENLRIAPSPLSRAIRELEKELRAPLFDR
118472744YP_891039.1 Fatty acid desaturase [Mycobacterium smegmatis str. MC2 155]MVITAPSPLHRLSEQDLEKLAKEFDAIHDEVFAELGERDRHYIKTVISVQ
118472743YP_884529.1 taurine transporter permease TauC [Mycobacterium smegmatis str. MC2 15MSVFVDIVPGSETDSPRPAAPSNRGRAILTKALLPLLSVAVFFAVWQAVA
118472742YP_885246.1 monovalent cation/H+ antiporter subunit G [Mycobacterium smegmatis strMNIPDIITGVLILGGSTLALTAAIGIVRFPDTLSRMHAATKPQVLGLLLV
118472741YP_885582.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MALSQGAKIAGYTVERMLGSGGMGEVYLAQHPRLPRHDALKVLRANISAD
118472740YP_890527.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNPDPNAHNARRSRPHHLRTLVARAVGIETARSTGPV
118472739YP_887203.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MLASTRSHALGDIPRRSARRCPDKVAIIDGDVTLTFAEFEHHVDRAAAAL
118472738YP_887152.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118472737YP_888789.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMPFSGYPVAMSTTRPAIAPKSAHQAVSLPPAQRLLNTASELFAGQGIRAV
118472736YP_885276.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLFSPGAPREAYFVGFEHLADLTGEERARWFIAHDNFFIWGTSESRCITT
118472735YP_886542.1 atzF gene product [Mycobacterium smegmatis str. MC2 155]MTGKIDEIYRRIEQSGRSEVFIHLRPRDQVEADHASATSGPLAGLVLAVK
118472734YP_884613.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MPSDHDASDLIRRQALTLLAVAQNGLTFAHDPFDRQRYTQVRRAAEELMT
118472733YP_887422.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFHPRVVLASCPALPEGDGDDDGLVAALRHRGLHARWLSWDDPETLDADV
118472732YP_886698.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLVMSMRAASVLIAADEATSRPDRGAKRYTLLLTTDPDLIDAAQRLRHDV
118472731YP_888545.1 cytochrome C oxidase subunit 2 [Mycobacterium smegmatis str. MC2 155]MTPRGFRVVALSIVLGGSALLLSGCSWSDALALGWPTGITPEAKLNRELW
118472730YP_886466.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDLIVRKMRFAFADHHVPFLWNEANPAFSSMANAVSFLAIAFEKMIGHM
118472729YP_889379.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVNVGHNGDVAKIWVRTHSVILAGSRADHENERAPSR
118472728YP_884820.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRRIAVWGTGNMGSTAIRSAVAFPGLELAAVITSSQDKVGRDAAMFAGLA
118472727YP_888315.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAPAPRVDEPAPLALANTLWIDRHGVHDALADKDYVQAWIRAVGKRLDV
118472726YP_887715.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMARPRDDSITEAVVDATRQLCGEIGYRNLTMEALAARAGTTKPAIRRRWP
118472725YP_885165.1 purA gene product [Mycobacterium smegmatis str. MC2 155]MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
118472724YP_889356.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTIGSPTRYRILQIALVAVGVAMILLYPLAVVWPSGWAWHSGPPHESNY
118472723YP_885189.1 ackA gene product [Mycobacterium smegmatis str. MC2 155]MTVLVVNSGSSSLKYAVVRPASGEFLADGIIEEIGSGAVPDHDAALRAAF
118472722YP_887271.1 transporter [Mycobacterium smegmatis str. MC2 155]MSIPNDHLVDVAIRQEHRAQHRFRTLLGAGVGNTLEWYDWSVYAIFAPFF
118472721YP_886204.1 manB gene product [Mycobacterium smegmatis str. MC2 155]MSRPAAAVHGVIKAYDVRGLVGSELDESFVADVGGAFARLVRGEGARQVV
118472720YP_889737.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSTQRYLITGFALALAPFGTVVVDPPPARADCTSSGYATVCAQGEVRGT
118472719YP_888979.1 peptidase S9- prolyl oligopeptidase [Mycobacterium smegmatis str. MC2 MNYGASLSPDATAFAHLVDDGGFPRAVQRFLRGWRASSSRDVELPVVGPV
118472718YP_890158.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MYSQPLVDAIAEAERLVAAAPFIESEADLTEGLQYLAGCVSGCLHLAFDY
118472717YP_885632.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVAHLGKAVEELCTSAVHELLLVAPFIKEPVLSHLLSRVGSDEVEVTCV
118472716YP_889930.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVLLNIIWLIFGGLWLALGYLLAALICFILIVTIPFGFASLRIASYALW
118472715YP_890252.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMADAPASRRPSADDLLVLLAVGRTGRYTTAADELGINHTTISRRIAALEE
118472714YP_886472.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAGETGHVRQGSRACPAQPHQHRDRRSGVPGDLRLRRTATESRSGGVVVR
118472713YP_887780.1 peptidase- M48 family protein [Mycobacterium smegmatis str. MC2 155]MTRPPATQPPQRTTFPGISSRAWEHPADRTALTALRRLKGFDQVLKVLSG
118472712YP_885773.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAHDLSLLASSGTHAVTNQVPPLEDYNPATSPVLTEALIREGGEWGLDEV
118472711YP_890115.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATFPYSLRRLILAGGFVVAAAAAPAITVFAVPDSAMPTAACPGGEEEDL
118472710YP_886688.1 methylesterase [Mycobacterium smegmatis str. MC2 155]MKIGDRWPKDWPLQLISSPRWSEQRPTYGEAKPAIIEAALRRSQRRPTGN
118472709YP_889628.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIALTIVLAVFVGIALGMLGGGGSILTVPLLAYVAGMDAKQAVTTSLLVV
118472708YP_884454.1 FHA domain-containing protein [Mycobacterium smegmatis str. MC2 155]MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGLALRGS
118472707YP_886403.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MANEPAVEDVSHLQLSSRDVSTVPVALADWLSTVLPAGAEPRVTVEDGVD
118472706YP_886495.1 permease of the major facilitator superfamily protein [Mycobacterium sMSSCPAEGDCSAPEKPKLPGEVWVLIVANAVIALGYGVVAPVLPQYARHF
118472705YP_886298.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVKVSRSWPSSSAGCRRPTSAACRNSAWPDRSYCVQVAIIVLLAWFTRTL
118472704YP_884769.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MPDAHHYELTVDGEHAGVLAYVDIGDQRVFHHTEVDDKFSGQGLAGELVS
118472703YP_886094.1 IS1137- transposase orfA [Mycobacterium smegmatis str. MC2 155]MQMVADLRSETVSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGSRAGQ
118472702YP_887531.1 trpE gene product [Mycobacterium smegmatis str. MC2 155]MQTTANHSSRSTQTGTRAHGAALAETTSREDFRALATEHRVVPVIRKVLA
118472701YP_886630.1 membrane-bound oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSERVRRTPPLAGLAAAAVALGVAGIVAVPFGPAADSRTAVGSAVIDLTP
118472700YP_885253.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGEVVIGGEALAKGLVTRNDLRHHYRRLFPGVYVRGEPTLRDRTVGAWLW
118472699YP_889040.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVIAAAATVLAGLLTAPPAAAGPQTCNDAFCVPGINPHAVLGAPCSNTT
118472698YP_890221.1 P450 heme-thiolate protein [Mycobacterium smegmatis str. MC2 155]MPTPNIPSDFDFLDATLNLERLPVEELAELRKSEPIHWVDVPGGTGGFGD
118472697YP_886442.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGLQKHKRTATDIGLALITPIVGQEWLDRYGLRDPLNRGLKYGVKQVFST
118472696YP_888893.1 valS gene product [Mycobacterium smegmatis str. MC2 155]MTASPENRADALPKSWDPGAVEAELYQGWVDAGYFTADPASDKPPYSIVL
118472695YP_884554.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRLLKGFPKMRNWTRVGRRTAVLAAVALVLTSCGQWRGIANVPLPGGPGT
118472694YP_884606.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MRVLDLVVIVVYLVAIAWFGLRASGRQKTSKDYFVGEGKLPWWTVSFSVV
118472693YP_888096.1 lipoprotein LpqH [Mycobacterium smegmatis str. MC2 155]MNRVIAGTMGLLAAGTILVGCSDDKPQATPSPAAADVKTGGNTQVKVDGK
118472692YP_885973.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLCATWAGRMHEGAPMNRLPVPLLQSGVLQRLSCTSTVGTLFCARGALSP
118472691YP_886068.1 ECF-family protein RNA polymerase sigma factor [Mycobacterium smegmatiMDPAPSSASDPAWTELSEAEAVFTRVRPRLFGVAYRMTGTVAEAEDAVQE
118472690YP_886217.1 selB gene product [Mycobacterium smegmatis str. MC2 155]MFVVATAGHVDHGKSTLVHRLTGMWPDRLAEEQRRGLTIDLGFAWTTLEG
118472689YP_889867.1 feruloyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MNLFGLLDQTAARHGDRGAVFCGERELYTWTQLRDRAARLGSTLTEPGTR
118472688YP_888117.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTVAAQTGQAPTKSLAYTFTGGDAVVTGAASGIGAATAAMLMSAGIRTIR
118472687YP_888072.1 pheS gene product [Mycobacterium smegmatis str. MC2 155]MVRTQGGETAGEQPSDLSEEALTKAVSAARHAFDAAGDLDALARAKTEHL
118472686YP_890534.1 lipoprotein LpqH [Mycobacterium smegmatis str. MC2 155]MKRGFLVAVGSAALVVAGLSGCSSDDKSAEASEASPTANATVDSTASPGT
118472685YP_888917.1 aldo/keto reductase [Mycobacterium smegmatis str. MC2 155]MTLDQYVTLGRSGLRVSPFALGAMTFGEDFGAVGTSVENSERILSAYLDR
118472684YP_887638.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVGKKIAHKAESAKGTVKKLFGRAIGNTRLRTEGRADQFKGNTKQAGAK
118472683YP_886994.1 peptidase- M16 family protein [Mycobacterium smegmatis str. MC2 155]MTETRLETSQVRRTTLPGGLRVVTEYLPYVRSASVGVWVGVGSRDEGRSV
118472682YP_885172.1 purT gene product [Mycobacterium smegmatis str. MC2 155]MSESIEGALTDDAAADESAGAGPDDTDVTDDSVADTAPEDTAPDPDDTEP
118472681YP_890925.1 oxidoreductase- Gfo/Idh/MocA family protein [Mycobacterium smegmatis sMVGHALRIGIIGAGVMGTKHAEYVAREQDATVVAVADPFSRTLAGKLGVP
118472680YP_886522.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDTRTMCMRALAVACALTGLLVISSTACSGGRAVVADSVGAESVLRDVD
118472679YP_885580.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDVVLGVAVTGRVARLAMIGAPANGGQLLDQYALDLSDDGLAELAETIIG
118472678YP_890661.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSSVVLCIPVREHLRFRPEDCIGCWQPEISFEEAMSSCWVMSEQAHDLGD
118472677YP_887912.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVPGGHGAEPRPQRTDPVAVLIGCLPRRDPQRLLEHRIHERRAVQLDPV
118472676YP_889469.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPWWGAVLAAVTATAIGFAFDAGAGSRELSGVFGFCYVVGCLAAVLAVRQ
118472675YP_888911.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MAHRYKVREIAQQCGLSEATVDRVLNNRPGVRENTRAEVRQAIADLDKQR
118472674YP_890732.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MAVRDHGDPGDAPSVPPPLTPVADVVRPSAAEEARTIAASTNVGTLATLT
118472673YP_889745.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAVRPLVTTGAALISAGALVAATPALFVPKDEIAIAAPSMATAPKQLTVD
118472672YP_888186.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAQEQTKRGGGGGEDDDLPGASAAGQERREKLTEETDDLLDEIDDVLEEN
118472671YP_884687.1 propanediol utilization protein PduA [Mycobacterium smegmatis str. MC2MSSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGE
118472670YP_888292.1 CdaR family transcriptional regulator [Mycobacterium smegmatis str. MCMQHTGAPEHGVGSVGPTLAEIGAAIGAQIAAPPYDPTVAVQSVMDAERAS
118472669YP_890364.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNWVARTAAALIALQLVVRAVLAFGGYFYWDDLILVGRAGTQSLLSPSFL
118472668YP_888181.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MSLRSAPVDGFRLAFDRHGIRGGPPVVLLHGWPGTRRDHRHVVPLLTDVA
118472667YP_887803.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MFALATLMALVQQVSGTPYVSGGDSPSGTDCSGLASWVSNVATGRPAFGD
118472666YP_885682.1 FAD binding domain-containing protein [Mycobacterium smegmatis str. MCMPRFMVHGAFTLVTVAGMDLNTVEVVDRPTRREEVWPLGAGDAVLAGGTW
118472665YP_889462.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MKFVSTRIITADVKRLVDFYETVTGLSAVWANELFAEIPTPAGTLAIGSE
118472664YP_889658.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLSLQSPRQPAANELATPNSLKPASSRSPWSHGTESAVSMDGGAANTCRT
118472663YP_884900.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTTVLPQRAATVPQSPRRRTSTPSPGRRRVILHALQGGIVLSALAAWELG
118472662YP_886035.1 ribonuclease [Mycobacterium smegmatis str. MC2 155]MTEPADESAKPGLLDRLKARWPWFDHVMRAQERYNDSKGDFYAAGITYFT
118472661YP_889070.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSQIPGRPLPTVTALNEYFWTAGRDGVLRIQECRSCDALIHPPQPICRYC
118472660YP_889604.1 formate/nitrate transporter [Mycobacterium smegmatis str. MC2 155]MSYVSPSDFVGKMIDAGEAKAHMSTRDTLIRAYMAGAILAIAAAFAVTIT
118472659YP_884902.1 racemase [Mycobacterium smegmatis str. MC2 155]MSLLEGVRVVSFTHFLQGPSATALLADLGATVIKVEPPSGAFERSWSAPD
118472658YP_887764.1 ferric uptake regulation protein [Mycobacterium smegmatis str. MC2 155MPSRAEFEAQLRMTDLRVTRPRIAVMEAVHANPHADTETIYSVVRGSLPT
118472657YP_886375.1 LacI family transcriptional regulator [Mycobacterium smegmatis str. MCMARRSVTSFDVAKKAGVSQPTVSRALRNLPGTSPETRERVRTAALELDYI
118472656YP_885123.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMTTIDNEVGQKVGAVSPARVATASFVGTAIEWYDFFIFGTAAGLVFGVAF
118472655YP_890179.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNSTRWLDLGAITLAAAIALGIAGISRPEVVTTPYSTSSSVREDHAPPDT
118472654YP_888210.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDRHAEKPPLLRRVWEAIIGEFTPPSTPRPTPSEAEFTEGYLAVGMIND
118472653YP_887581.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein [MycobacteMTSTVAAPAQTGTAQSLTLSKLVKTYSSRGRESFTAVKGIDLDIRPGELV
118472652YP_888191.1 ectA gene product [Mycobacterium smegmatis str. MC2 155]MHVLESAPGRNSRTLNLRPPQGDDAIGIRDIAEATEVLDLNSTYAYLLLA
118472651YP_886140.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAPTLTALALVCSLKRSPAESSSDLMARHVCDDLGAAGVGTEILRCADY
118472650YP_885450.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPSPRNSLILHGCRAKSSHEAHHFLWRFRQFPVKLPASCR
118472649YP_884896.1 shikimate transporter [Mycobacterium smegmatis str. MC2 155]MSRAGNDAAEKPPNQARKAGIAALVGTTLEWYDFLIYGTAAALVLNSQFF
118472648YP_885020.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSERLGEFLRARRAQLNPEDVGLRDFGGRRRVAGLRREELAQLAGVSVS
118472647YP_890259.1 nitrilotriacetate monooxygenase component B [Mycobacterium smegmatis sMTATQPIDPRTFRNVLGQFCTGVTVITTVHENVPVGFACQSFAALSLDPP
118472646YP_887394.1 uvrC gene product [Mycobacterium smegmatis str. MC2 155]MPDPATYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADI
118472645YP_888914.1 AP endonuclease- family protein 2 [Mycobacterium smegmatis str. MC2 15MTDLKIAGAPISWGVCEVPGWGHQLDRQRVLSEMRTAGLTATELGPDGFL
118472644YP_890807.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPSTLRTRLSSRHRPGVLLAALLLTAGAAVACSAEDAAAGDAQAPGTASA
118472643YP_887244.1 permease membrane component [Mycobacterium smegmatis str. MC2 155]MTTTAPDTERVALPAEPSSRLGLGRWLIQPLVCVAAVAGSLLYVEVADVS
118472642YP_887101.1 TrkB protein [Mycobacterium smegmatis str. MC2 155]MKVAIAGAGAVGRSIARELLESNHEVTLLERNLDHIDVDAIPAAHWRLGD
118472641YP_886159.1 STAS domain-containing protein [Mycobacterium smegmatis str. MC2 155]MPTISVAKRSSPHSGSHAPQRAHFTTEQINTATAVVTVHGDLDASNAGLL
118472640YP_887783.1 tpx gene product [Mycobacterium smegmatis str. MC2 155]MAQITLRGNPINTVGELPAVGSSAPGFTLTGTDLGEVTNDQFSGKSVLLN
118472639YP_888278.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MSPSVPDAPTDTSARGSGRRRTVIASMVGTTIEWYDFNIYGSVAALVFGK
118472638YP_886450.1 cell division protein FtsX [Mycobacterium smegmatis str. MC2 155]MRFGFLINEVLTGLRRNVTMTVAMVLTTAISIGLFGGGLLVVRLADQSRD
118472637YP_889637.1 KDP operon transcriptional regulatory protein KdpE [Mycobacterium smegMTAPIKTRVLVIDDEPQILRALRINLSVRGYEVRTAASGAEALHSAADHR
118472636YP_884502.1 1-phosphofructokinase [Mycobacterium smegmatis str. MC2 155]MIVTVTLNPSLDRTVTLTAPLTRGAVQRVDSVTVEAGGKGINVAKALTSA
118472635YP_885160.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGDLLGPDPVYLPGDPAAEEELAAGEKAAVVAAAHPSASVAWATLAEQAL
118472634YP_890459.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTPSKILDLVAAAFGELLRRAGVATSPAEVIEVRRVLGLLGARDQEALRA
118472633YP_886737.1 AsnC family transcriptional regulator [Mycobacterium smegmatis str. MCMVEAYVLIQTEVGRAEVVAKQLASLAGVVSAEYVTGPYDVVLRVSADTLE
118472632YP_886822.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMADIGRSTLVLDALAEASKPLTLSELATRTGLPRSTVHRIVQSLERSLYL
118472631YP_890162.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGPSCRVTPTRNHSRIRARACNQVAARGKAATWLPQSELFERVGHRRRRH
118472630YP_890890.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MDAESREWLRLLDAGACPADRRTAIERLHERLLRVARREVHRRHTAITGS
118472629YP_886878.1 frr gene product [Mycobacterium smegmatis str. MC2 155]MIDETLFDAEEKMEKAVSVARDELGSIRTGRANPGMFNRINIDYYGSMTP
118472628YP_886944.1 cbiM gene product [Mycobacterium smegmatis str. MC2 155]MHMSDGIVNVQTSLVFGALAVAALGVCALRARDELDERTVPLAGLVAAFI
118472627YP_887222.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MGENLVVAAVQPRVLDGDVEANVASHVEAIVSADARLVVFPELSLSGYRA
118472626YP_890038.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSKRPLYFSAFVMNTASHVLHGLWRAPEAQNHRFNELKHWTSVATSVENA
118472625YP_885363.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MKVRAVLQIVIAVVAAVGCVVSWVASRATVEVAPVLPGEPVTYSVTYSAP
118472624YP_886049.1 cdd gene product [Mycobacterium smegmatis str. MC2 155]MNWNALRSKAIEVSRHAYAPYSGFPVGAAALVDDGRTVTGCNVENVSYGL
118472623YP_886430.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MTETRDPASLTGGLVDVLAPVVGAGVSVENLRELTGGASRTTWSFEAVTA
118472622YP_886935.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDLTQRLAGKVAVITGGASGIGLATGRRLRAEGATVVVGDIDPTTGKAAA
118472621YP_885614.1 ISMsm6- transposase [Mycobacterium smegmatis str. MC2 155]MAYVRKVRTASGAVAVQVARKDAGKVVILAHLGSAHTDAELGILLEQAKA
118472620YP_885747.1 alpha-mannosidase [Mycobacterium smegmatis str. MC2 155]MHVTSAESTERYTGPAEEPRQLVAVTYRGCTQPSIITVEGDGISGSARID
118472619YP_886702.1 methionine synthase- vitamin-B12 independent [Mycobacterium smegmatis MSIFATATGVGSWPGTTARQAAEIVVGELHTLSHLVELPARGIGADLIGR
118472618YP_884918.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MKPYLYVAPAFVVFAVFLGAPVLQTVQYSFYNWDGLGVATVAGLKNYVAV
118472617YP_884923.1 sugar isomerase [Mycobacterium smegmatis str. MC2 155]MTSPQAHHAEIPAQSAGGATILEIGQQPDVWREIAGRSDAETSEFLRPIV
118472616YP_888991.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MAAIPNYNMGHNLNRLLPEVLAQGYDAVYVLDDASTDDSADVVRQFGSDV
118472615YP_886322.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTARFTLTPDRPVLLRPDGAVQIGWDPRTAVRVRPPDGMTPTQLTDLLHA
118472614YP_888735.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNAAQRQFTAYGPSYWSAIAVFVIVAVVLVWLGRRQTERQARVLGRVLGG
118472613YP_888695.1 cupin [Mycobacterium smegmatis str. MC2 155]MRVLRAFTALTAVLAVAHAAHADPMPPNANQAPVVRKVFDQPSNVRGKVV
118472612YP_887947.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMDLTTGAEPPVRPSSEPVQAGLFPDDSVPDELVGYRGPSACQIAGITYRQ
118472611YP_888082.1 inner membrane permease YgbN [Mycobacterium smegmatis str. MC2 155]MTTFVDWLRHDTAGLLTLAAVSIAVLLLLIIKMKVEPFIALIVVSVAVAL
118472610YP_886730.1 NUDIX family hydrolase [Mycobacterium smegmatis str. MC2 155]MMPVDDLQEIPLSKDTTEKSKHTVRAAGAVLWRDASEHGGTTGHPATVEV
118472609YP_885706.1 prfC gene product [Mycobacterium smegmatis str. MC2 155]MTDTPALAPSANTSLSRRIAAEATRRRTFAVISHPDAGKSTLTEALALHA
118472608YP_885520.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAASQPVLEALGDHDYLLRFTQDYDAPVVVRVYADPTVVAQIAADETRVV
118472607YP_887953.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MIGIVALVVGIVLGLVFRPDVPEVVEPYLPIAVVAALDAVFGGLRAYLEK
118472606YP_886415.1 NADH dehydrogenase subunit J [Mycobacterium smegmatis str. MC2 155]MNSDLMLLAAEGARTSTSEAVVFWVVGTVALVGAIGVVAARKAVYSAVFL
118472605YP_886016.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDELERTDEPNLVRPYTLTAGRTAPPVNLPLEAPVETLDTPNAPTWPGRD
118472604YP_887632.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVQVTRNDGLTDEFARFGDRYIKHADGSLEVVRAGTMQPVAYPAGGWTE
118472603YP_887149.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
118472602YP_890838.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MSDHEVKMVVLSTENLDESIKFYETLGFSLKFRDGAHFAALDGGAVTLAL
118472601YP_887359.1 pyrB gene product [Mycobacterium smegmatis str. MC2 155]MTKRHLLSAGDLTRDDATAILDDADRFREALLGREVKKLPTLRGRTIITM
118472600YP_887218.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMPRVSREQMQSNRAAVVQAASELIRERGMADVTVDAISARAGLTHGSFHK
118472599YP_886582.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MTTDPERLPYLAVDVDNHYYEPLDAFTRHLPKEFRSRGVQMLTDGKRTYA
118472598YP_885695.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAWDTARTKQKLLDAAVHEFSEHGPLGARVDRVASRAGVNKERIYQYFGS
118472597YP_890946.1 transcriptional regulator YdhC [Mycobacterium smegmatis str. MC2 155]MPVPIERGKHRRSLLRDQAYVSIRDAIVNGTLAPGEKLRDPELEEWLGIS
118472596YP_885306.1 lpdA gene product [Mycobacterium smegmatis str. MC2 155]MTHFDVVVLGAGPGGYVAAIRAAQLGLNTAIVEPKYWGGVCLNVGCIPSK
118472595YP_885504.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPVADRVRAAARVVLPHLYGEPGETRRQRIIRRVRIGIVIAACLVTLQSV
118472594YP_888108.1 uvrB gene product [Mycobacterium smegmatis str. MC2 155]MGEHHRNLSVRSSTLVNMAFATEHPVLAHSEYRAVDEIVRTGKPFEVVSP
118472593YP_889118.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium smegmatis str. MC2MAALDALVRYDGRHVVVTGCSSGIGAKVTDQLRCLGARVTGLDLRAPDSG
118472592YP_885619.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMLRGKILDGVYGGLAAARPMLPPENELAAEFGVSRNAIREALELLRGEGL
118472591YP_890655.1 dinP gene product [Mycobacterium smegmatis str. MC2 155]MFVSAAESASILHADLDSFYASVEQRDDPALRGRPVIVGGGVVLAASYEA
118472590YP_888462.1 phosphoglycolate phosphatase [Mycobacterium smegmatis str. MC2 155]MLAVLWDMDGTLVDSEKLWDISMHALYARMGAVLTPEVRESTVGGSSETV
118472589YP_884562.1 mosc domain-containing protein [Mycobacterium smegmatis str. MC2 155]MADELLRVDSLHRYPIKSMLGESVTSLEVYLGGVDRDRHLAFIDQETGRV
118472588YP_889165.1 clpS gene product [Mycobacterium smegmatis str. MC2 155]MVTPAKARPGTREEVDVASVESTEAPWVTIVWDDPVNLMSYVTYVFQKLF
118472587YP_887258.1 glutamine amidotransferase subunit PdxT [Mycobacterium smegmatis str. MTAHVGVLALQGDTREHLAALREAGAEASTVRRLSELAAVDALVIPGGES
118472586YP_887946.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MISLWARGSAAGVEAQTYVLVVLLSLSLCRRPDRAPERFGPRPCEPFPMG
118472585YP_885938.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKRMTVGAALGGALFLSAGMGIANAQPRDGQVDLALGTAGVLEDVPIGAA
118472584YP_889401.1 nitroreductase [Mycobacterium smegmatis str. MC2 155]MEFTDVVRTTAAIRQFTGDPLPDDVLRRILDNARFAPSGGNRQGTRVVVI
118472583YP_888712.1 ctaD gene product [Mycobacterium smegmatis str. MC2 155]MTTHAPSAGELLARRPFPQRLGPRWTLLYKLVTTTDHKLIGMMYVVACFI
118472582YP_886251.1 2Fe-2S iron-sulfur cluster binding domain-containing protein [MycobactMAKNHIKISANVADTVRPTVAGADERPGWHALRRLAARITTPLLPDDYLQ
118472581YP_887500.1 glgX gene product [Mycobacterium smegmatis str. MC2 155]MSDPTASPPAPMNMVWPGEAYPLGATYDGAGTNFSLFSEVAERVELCLIA
118472580YP_889397.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSNTSNSIRSSPDVQSIDWENDEIHLESHFHRHDRGSGRSPGRGGPERRG
118472579YP_888857.1 nitrate/sulfonate/bicarbonate ABC transporter inner membrane protein [MTDTVTVVRAGPPETDDTTTPDSPTVVERDFRPSASESRRGRTRRLSVGI
118472578YP_890362.1 N-acyl-D-glutamate amidohydrolase [Mycobacterium smegmatis str. MC2 15MSYDVIVRNGLWFDGTGRPPQVRTLGIRDGVVATVSAKPLDETGCPEVID
118472577YP_886810.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MHAASSALLDALRAHGDRTALITAERHVTYRELADQVADASARLGTGRRL
118472576YP_891116.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAQSEDPEDFIAPAAHRVRPGTLLLANTDLLEPTFRRTVIYIVEHNSGGT
118472575YP_887986.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADHDYITYEEFGRRFFEVAVSEDRVGDAIGAIAGDEFEIGPIAQGPGKI
118472574YP_886913.1 deoxyribodipyrimidine photo-lyase [Mycobacterium smegmatis str. MC2 15MPTLLWFRRDLRCADHPAVLDAAQGDADVLACYVLDPRLTGSSGDRRLAY
118472573YP_888468.1 cysS gene product [Mycobacterium smegmatis str. MC2 155]MQSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGPTATMYVCGITPYDA
118472572YP_887453.1 trx gene product [Mycobacterium smegmatis str. MC2 155]MSTLDITAEQFNDTVNDNEIVLVDFWASWCGPCKAFAPTFAASAEKHPDV
118472571YP_889998.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKIELGTVLGVSTAGCALAFCGAGMAAAAPDVVGQPYSDAVTAIEDGGGT
118472570YP_884636.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLMSLLVLAGCGENHQAAEPGWTDTDVSFDSDGLTIHGTYRHDGKPGPAA
118472569YP_888009.1 catalase [Mycobacterium smegmatis str. MC2 155]MPDNPKPVLNRRRVLLGAAAIGGFLAVDLGALLFATNTLGTQRLTPRAIL
118472568YP_887872.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MEKVIVTMRSARADDAWCARMVQDVSAELLEIGLPGLVLNIRDAPVRDSL
118472567YP_888983.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTESTATPAQQIAAGYAVEGQALELGTVVVDGAVDPTAQVRIPLATVNR
118472566YP_889276.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGAGILERMFDGTSDAGLIDAIAEAKRQENAATARRLFAIGELDTRRAID
118472565YP_886290.1 N-acetyltransferase Ats1 [Mycobacterium smegmatis str. MC2 155]MTELIRRARPGDEVEITAMIRELAEFEHASDECTVTEEQLHTALFGDKPV
118472564YP_886394.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGSDTTAYSTARTVEDFTRNLQAVNTRIGAALQRAGREPGEVRLLPVSK
118472563YP_887014.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATLTVAQARRIAVAAQGFHEPRPRGSVTRAHVRRLINRIQVLQLDSVSV
118472562YP_886041.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGFPGGLHRGTIDPTARDFYCHTHGPTLTDRSPVRLRNPYAIPQSRCLQT
118472561YP_888280.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDLGLKGKRALISGASDGIGLAAAELLAEEGVDVALVARRANVLKEGCDS
118472560YP_890834.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MSVSHVGLRVRDIETSKKFYEAIGFTEAKRLTLPDKIAGGLLGLDPPIGF
118472559YP_887907.1 sorbitol utilization protein SOU2 [Mycobacterium smegmatis str. MC2 15MDVRSAFDLSGRTALVTGGNQGLGKAFAIALAQAGARVSFSGRNAERNEK
118472558YP_886754.1 coaD gene product [Mycobacterium smegmatis str. MC2 155]MSGAVCPGSFDPVTLGHIDVFERASAQFDEVVVAVLVNPNKKGMFDLDER
118472557YP_890539.1 glycerol dehydratase large subunit [Mycobacterium smegmatis str. MC2 1MVAVTESGDPGQSPELGRMRILDAKPVNLDGFSVPDPDLGLAAMSSPHDP
118472556YP_887227.1 2-keto-3-deoxygluconate kinase [Mycobacterium smegmatis str. MC2 155]MSTFDVVALGEPLIEVSTRGKITHGVDCGFAVSGDVVNTATAAVAAGARV
118472555YP_887070.1 PPE family protein [Mycobacterium smegmatis str. MC2 155]MGTHARSVSRTLLITLVVVIGTVALAFASTISSAARLVATYALIVPGTGT
118472554YP_886127.1 anti-sigm factor- ChrR [Mycobacterium smegmatis str. MC2 155]MTTSKGTPKGDISQFGPNAPGYTWVSAADVPPREPFPGITIKLLWEGDNG
118472553YP_890296.1 cysS gene product [Mycobacterium smegmatis str. MC2 155]MTDRAQAVGSGPELGLRLYDTMAGAVRDFVPLRPGHASIYLCGATVQGLP
118472552YP_889492.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDTRLDVATLANAVQLAARAPSLHNTQPWRLIAEDGELKLFLDPSRVVR
118472551YP_888379.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSTQPTELDEALVRIRAVFDALAEGAAERDQANEHPYALVSDLAGAGFG
118472550YP_885352.1 HAD-superfamily hydrolase [Mycobacterium smegmatis str. MC2 155]MTDEAGEARGAQELGGEASAEVAVTDLQAEQTPPPSAPPPDLTAAAFFDV
118472549YP_885901.1 infA gene product [Mycobacterium smegmatis str. MC2 155]MAKKDGAIEVEGRVIEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
118472548YP_890467.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCRHVAWLGAPRSLADLVLDPPQGLLVQSYAPRRQKHGLMNADGWGAGFF
118472547YP_885093.1 oxidoreductase- molybdopterin-binding subunit [Mycobacterium smegmatisMKAFGYHVATSPADAVATLAGHPGAAYLAGGTNLVDHMKLGVAEPDLLVD
118472546YP_889503.1 hemolysin III family channel protein [Mycobacterium smegmatis str. MC2MTAPIDGSHDRRTAPYRSAAADAAGSQRQAEDLPAAVADGVAQFFGKPRA
118472545YP_890845.1 [Mn] superoxide dismutase [Mycobacterium smegmatis str. MC2 155]MAEYTLPELDYDYAALEPHISGQINEIHHSKHHATYVKGVNDAIAKLEEA
118472544YP_890971.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MPVIELPSGPIAYEDTGGDGPVLVFGHGLLMDGRQWRKVIPLLPGCRCIT
118472543YP_891053.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMELRQLEHFVAVAEELSFTRAAQRVHVVQSALSSSVAKLERELGVELLDR
118472542YP_887814.1 hydroxylase [Mycobacterium smegmatis str. MC2 155]MAGQAVVLGASMSGLLAARVLADHFDTVAVVERDVLPDGTDQRRGVPQGR
118472541YP_888159.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKRFVVAGFALVVFVELAALAVPGRSMIGWATGAALAVLLVSVRLALRED
118472540YP_886259.1 UbiE/COQ5 methyltransferase [Mycobacterium smegmatis str. MC2 155]MPQPKPTNWAAGRYQAVAERIAPIAEEVVVAAGRVGPQRGPLTGGDIVDL
118472539YP_887053.1 hydrogen:quinone oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTTTAPKPSDTEREPGQLVEMSWDPITRIVGSLGIYTKIDFENREVVECH
118472538YP_887936.1 inosine 5-monophosphate dehydrogenase [Mycobacterium smegmatis str. MCMRFLDGHTPAYDLTYNDVFVVPGRSDVASRFDVDLSTVDGSGTTIPVVVA
118472537YP_886155.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIENVSGIRSAMERQDVPDEVPVADAVEQQQGAVRPPIDDDTPGSDPGSP
118472536YP_888924.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MYSFECMSVHQLHCGRDGRAHVVVGRVQEASARDETAYRRQRQGFLPGRE
118472535YP_886902.1 4-hydroxy-2-oxovalerate aldolase [Mycobacterium smegmatis str. MC2 155MTASRLQQALADRQTVWGGWVVGPTILGPEEFAAAGYDYVGFDVQHGYLD
118472534YP_886550.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWDDELDVVCCGSGSGAFAAAIAAADADLDVEVACRPVTPQGTSGSPWLG
118472533YP_886916.1 zinc metalloprotease [Mycobacterium smegmatis str. MC2 155]MMFGIGIVLFALAILVSVALHECGHMWVARATGMKVRRYFVGFGPTLWST
118472532YP_888615.1 NAD/mycothiol-dependent formaldehyde dehydrogenase [Mycobacterium smegMPQTVRGVISRSKQQPVELVDIVIPDPGPGEVVVDIIACGVCHTDLTYRE
118472531YP_890216.1 lipid-transfer protein [Mycobacterium smegmatis str. MC2 155]MTGLSGKAAIAGIGATDFSKNSGRSELRLAAECVLDALDDAGLEPSDVDG
118472530YP_890549.1 amino acid ABC transporter permease [Mycobacterium smegmatis str. MC2 MQYLLTHLDDLWELTVIHLRLSLVPIVLGLLIAVPLGALVQRTTTLRRLT
118472529YP_888568.1 dtd gene product [Mycobacterium smegmatis str. MC2 155]MRVLVQRVSRAQVTVDGEVVGAIDPQPQGLLALVGVTHDDDAAKAQRLAE
118472528YP_888402.1 CAIB/BAIF family protein [Mycobacterium smegmatis str. MC2 155]MTNTTDNGPLHDLTVVDMTTSYAGPTAAMYLADLGARVIKIERPGSGDDT
118472527YP_888800.1 phosphoadenosine phosphosulfate reductase [Mycobacterium smegmatis strMTDVTTSTENELRELAERGAAELADASAEELLRWTDEHFGGNYVVASNMQ
118472526YP_888259.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDDNTNTLDINAAVADAALAVWLRMWNSDSRIARRICSDDFRIHFLISDS
118472525YP_889708.1 molybdopterin biosynthesis protein MoeA 1 [Mycobacterium smegmatis strMRSVEEQQARVAAAAVAPRPVRVAIAESQGLMCAEEVVTERPMPGFDQAA
118472524YP_888832.1 iron ABC transporter substrate-binding protein [Mycobacterium smegmatiMRAITALLTLLPLAICALSGCSARGTEPSPHEETTNYPLTFENCGVTVTI
118472523YP_884787.1 glycolate oxidase subunit [Mycobacterium smegmatis str. MC2 155]MSALTAPNVTVDKTLIHRFTEAVAGHAEVITDGAVLDARGHDFWGVGGTA
118472522YP_891046.1 2-2-dialkylglycine decarboxylase [Mycobacterium smegmatis str. MC2 155MDPVSQLEADARHLVRYSGRGGFTPTVIGSARGSLMFTEDGRELIDFTSG
118472521YP_890712.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAVNMGDLFAANLESLRYQPTAKRIRACLGGEPVVDTCAAVLVWEPRRVV
118472520YP_885813.1 cytochrome P450-terp [Mycobacterium smegmatis str. MC2 155]MSTPTMDDAAKALADPTAYADDARLHEALARLRAENPVAWVDQAPYRPFW
118472519YP_889091.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MRTYFDLTGRSALVTGAGCGIGAAVSEALAAAGAAVLVTDIDGEAARTVA
118472518YP_891047.1 NAD-dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MMTQTVLITGANGGLGRLMRPRLAREGRTLRLLDLVTPEPPADGEDVEVL
118472517YP_886193.1 biotin-[acetyl-CoA-carboxylase] ligase [Mycobacterium smegmatis str. MMNSDTERPALDADAIRSAVVRPRGSWRSFDVVAETGSTNADLLARARSGT
118472516YP_886274.1 benzoate 1-2-dioxygenase subunit alpha [Mycobacterium smegmatis str. MMTTHLSPDHLENVLADAVIEDPAAGVYRANRRIFTDDEIFELEMKHIFEG
118472515YP_888913.1 oxidoreductase YisS [Mycobacterium smegmatis str. MC2 155]MTTLGVIGLGRIGAFHVDTLSSLDGVDGLVVADERPDAVAAVAAKHGAKP
118472514YP_889094.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSLTSIFSLVTRTREQLPLTIGRKDGNLLVVNENLILMDES
118472513YP_890059.1 purQ gene product [Mycobacterium smegmatis str. MC2 155]MTTRVGVITFPGTLDDIDAARAVRLAGAEAVSLWHADADLHGVDAVVVPG
118472512YP_887630.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWPVQTETVHSYTMRLAHANHLPLKVLHTYLSGTAVSNQPRPEWLAAAGG
118472511YP_889114.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTRFTGLVTTASRTASRTAARTARADRATSTQEAILKAAERLYAEHGVFA
118472510YP_886295.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVKPERRTRGDIVAAAVIVVVVAVAAGLIWWTSDARATLSRPAAAPVPYL
118472509YP_890312.1 negative regulator of genetic competence ClpC/mecB [Mycobacterium smegMFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
118472508YP_885656.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGHVFIINGDLTKIACDAVLVPTDDHFTIEAPWRGLFEGRRHEIPETWG
118472507YP_890102.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MILCTMDSHDNGRPIPADARQTTEQQEELQDEFDRRGADPEAPGLHESRE
118472506YP_890822.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGRHLDAAKAHFGRDAGGLLEGGRYSLVHTRSLEFDELRPYVRGDDVRDI
118472505YP_884471.1 ISMsm2- transposase [Mycobacterium smegmatis str. MC2 155]MPTPHAAEIVLSADERAELEGWARRRTSAAGLAMRARIVLAAADGGSNTE
118472504YP_887437.1 sufB gene product [Mycobacterium smegmatis str. MC2 155]MTTTPETAPLTQEETIASLGKYGYGWADSDVAGASAQRGLNEAVVRDISA
118472503YP_886478.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGWPFVGRDDELREAAEALRDSSRGVVLAGPSGVGKTALARALAGQLET
118472502YP_888183.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTTTLARPATRTAVLYRPGSAVFWVFVIALAAGAFALLNQEGSAIHETL
118472501YP_884609.1 murQ gene product [Mycobacterium smegmatis str. MC2 155]MDLSALETEGRNTRTTELDRLTVPELLAVMNDEDRTVASAVRDVLDQIGA
118472500YP_889440.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSTDIGRTAGQKAQRIHWAWVVAAVSFVAILGAAGFRSIPGVMMNPLHHE
118472499YP_890322.1 folK gene product [Mycobacterium smegmatis str. MC2 155]MTSTVLSIGSNLGDRLTRLQSVLDGLGPAVRAVSAVYETAAWGFEEQGPF
118472498YP_888088.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDQNVTPDAAEAQVRDLAEIPAVEVITRAAIMLMSAAAEKIGLSHENPD
118472497YP_890987.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRLRTAERDRVFDAVAHERRGIADLIDGLTPEQLATPSLCGGWDVKTVAA
118472496YP_888554.1 ilvE gene product [Mycobacterium smegmatis str. MC2 155]MNSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGW
118472495YP_887133.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAAPRGRSPGQAARRSRSPACRPCIDHMFEWVGAGHCPSIVILTWCARGR
118472494YP_885481.1 dipeptide transporter permease DppB [Mycobacterium smegmatis str. MC2 MTATIRNRLLSTLLVLFGVSLIVFLLLQLVPGDPAVTILGSGATAEAVAA
118472493YP_885725.1 BadM/Rrf2 family transcriptional regulator [Mycobacterium smegmatis stMHLTRFTDLGLRTLMLLSAGESQDQRVTTRTIAKSANASEHHVAKAVSKL
118472492YP_887967.1 transporter monovalent cation:proton antiporter-2 (CPA2) family proteiMEVSGALLLELGVILVALTVLGTAARRFALSPIPLYLVAGLALGEGGLAP
118472491YP_887566.1 DoxX subfamily protein [Mycobacterium smegmatis str. MC2 155]MLSATFIARGVDALRNPKPAADAARPTLGMMSSLPDPVGSKVPSDAETVA
118472490YP_885647.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPPTEPTEPPTGGVAPNPNDILVLGENRWLTIQGQVISDQFGDPVRLRPA
118472489YP_885087.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDIVLGVSMTPTTVRMVLVEGENADGITVDHDVFDVTAVEDAATMSAADQ
118472488YP_885839.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MHRIHRITLDDALPLLAAGRAKAEEIGVKQTLCIVDDGGNVIALHRLPGA
118472487YP_888699.1 endoribonuclease L-PSP [Mycobacterium smegmatis str. MC2 155]MTTTSTRIHTGVGAHIATGYADAIAVPSAGTTIYVSGTPGLREDGTTPED
118472486YP_886001.1 universal stress protein family protein [Mycobacterium smegmatis str. MKLVVGYLATPGGADALALGIRFARTLGAELEICIVLPPDTRAPGMPKGG
118472485YP_889374.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGRRLAGGAARQHPDLTSRAGIVLTLLAIDGVISAVVGALFLPIYIGTIP
118472484YP_890169.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MRGTAGASGAGFLDGWDEHPDHPALITDGHTVTYAELSARVSAESQLCDM
118472483YP_885197.1 thiS gene product [Mycobacterium smegmatis str. MC2 155]MITITVNGESVEVDDTITIERLLETRGFPEKGIAVALDWSVLHRSEWDQT
118472482YP_885997.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTAAADLDVRRLTRAEQVEHLRRKMASVSAKVGSAHRGVSGSDDLISPAG
118472481YP_889603.1 cynS gene product [Mycobacterium smegmatis str. MC2 155]MTPIMSKADAAGLVVAARIRNGLSWADIAKHLDAPLVWCVAALLGQHPLS
118472480YP_890884.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MADDPELTTFALRMPRWPALVRLRGRDPLVRAVDRVEALIFCLVVVVAVL
118472479YP_886742.1 dihydroxyacetone kinase [Mycobacterium smegmatis str. MC2 155]MSARRLDASALRDWAHTAVGDLITHTDEINRLNVFPVADADTGTNMLFTM
118472478YP_889742.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPRSVLVTGATGTLGHHVVPEATQAGHAVRALSRRPRVGYTGVHWQQGDL
118472477YP_888201.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MQPLLARHAGDINRRRPDEVIDALTQAGLFRMLTPRRFGGYAVAPRTVVE
118472476YP_886802.1 carbon-monoxide dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSNANGRGLIGSSVRRREDDRMLGGRGHFVADLSAGAHHVVFLRSTEPH
118472475YP_888703.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGISEFDDVSSHLLEPEESLDSEQTGIDLDEGYSPPESPRELGAWGLTER
118472474YP_890783.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSTLTDHAAHLRGGLVGLCSALTAAVAHTAAGGVPPSGSPLVILLIACAT
118472473YP_884665.1 membrane protein- MmpL family protein [Mycobacterium smegmatis str. MCMFAWWGRTVYQFRYIVIGVMVALCLGGGVYGISLGNHVTQSGFYDEGSQS
118472472YP_885573.1 hutF gene product [Mycobacterium smegmatis str. MC2 155]MTSYFADHTWLGDEQVADNVLITVDGDTITAVQRDAARPADATHLKGVTL
118472471YP_890586.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNQSMNDKVIITCAVTGGMTVPAQSKAIPITVDEIVRAGVEAAEAGAAVL
118472470YP_888566.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MGSWLSGPGPFDAGDGSDGNDRRGKYPGERLGLPEDGPGSIARTGRRLGA
118472469YP_886231.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
118472468YP_891102.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATRQTSMTRAKDSDRNDTCKVLDSAMAEGQLSMEEHRDRLSAAMKATTL
118472467YP_889980.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSFDGVRTVLTPDHQARLAVMRAIDLEAAQVAVPGPVVTGPAWAGRGLRL
118472466YP_888327.1 hydroxyquinol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MDITPDESAAVVAASFDNTPDPRLKEVMQSAVRHLHDFVREVRPTNAEWE
118472465YP_884576.1 formate dehydrogenase subunit beta [Mycobacterium smegmatis str. MC2 1MSEPVTVYVPCDSAAKSVGADEVAHALTAAAERVGRPIRLVRNGSRGMLW
118472464YP_887529.1 molybdenum ABC transporter ATPase [Mycobacterium smegmatis str. MC2 15MTEVLKIDDVTFRRNGKQIIDGISLTVRSGEHWALLGPNGAGKSTLLGFC
118472463YP_886708.1 gatA gene product [Mycobacterium smegmatis str. MC2 155]MSTELIRSDAATLGAKIAAKEVSSTEVTQAHLDQIAATDDRFHAFLHVAA
118472462YP_886102.1 ISMsm1- transposase orfB [Mycobacterium smegmatis str. MC2 155]MIVDYIDAYRHRFGVDPICAVLSEHDMPIAPSTYYAAKARGPVSDAAWAE
118472461YP_890965.1 glycerol operon regulatory protein [Mycobacterium smegmatis str. MC2 1MPGTVQSVERAAAILQLLGIEDESLGLVQIAGALGLAKGTAHGLLRTLHG
118472460YP_887659.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSSRDASEGAGDRAPVSGIALLTLLALLFLGMVVLGIATGDVPIDNKALA
118472459YP_886700.1 cysteine desulfurase [Mycobacterium smegmatis str. MC2 155]MTSTAGRQVYLDHAATTPMHPAAIEAMTAVLAGVGNASSLHGSGRAARRR
118472458YP_889124.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPANAAQSAARTRVEGAPSAAPGSQTLARGLSALQAIADAPGGLTVQQVA
118472457YP_886181.1 thiosulfate sulfurtransferase [Mycobacterium smegmatis str. MC2 155]MSLPADPSPTLAEYAHPERLVTADWLASNLGRPGLAIVESDEDVLLYDTG
118472456YP_890342.1 dipeptide transport ATP-binding protein DppD [Mycobacterium smegmatis MTTSANRSATAVLADPALKVDGLCVDIRSMSGTVRAVDHVSFEAHRGETL
118472455YP_886020.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGREEIADRIRTVLRPVATVSAGAALVLLVWAALLGLWSRLVSPRSMAEQ
118472454YP_886012.1 nitroreductase [Mycobacterium smegmatis str. MC2 155]MTLNLSVDELLTTTRSVRKRLDFEKPVSREVILECLDLALQAPTGSNAQG
118472453YP_884511.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRKFGVATGMAVAGGLVAAVVGLPNPASADPGDQPWVNTLGPNVTVLKVS
118472452YP_885623.1 inner membrane protein YidH [Mycobacterium smegmatis str. MC2 155]MNDSETDTVETLIEPDYRFTLANERTFLAWQRTSLGLLAAAVAVVQFLPE
118472451YP_885779.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRAHTTRILGTTAAAVAVLGLAACGSESSDTNTPSATAGSSGVNVEIGNT
118472450YP_884530.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKLKSLLVATAASALALAGCAVDNSEQDAEKPTIRVGYQTFPSGDLIVKN
118472449YP_884986.1 MmpS1 protein [Mycobacterium smegmatis str. MC2 155]MLKQAWIPLVLAVVLPVSGLVVWRLHEKFGSEDLNANAGAGIEIVQFNPK
118472448YP_885489.1 ureC gene product [Mycobacterium smegmatis str. MC2 155]MTTIDRRAYARMFGPTRGDRIRLADSDLFVEVEHDHTVAGYELLSGAGKS
118472447YP_885674.1 twitching motility protein PilT [Mycobacterium smegmatis str. MC2 155]MVIDTSALVAILTDEPDAELLEGAVADDPVRTMSTASYLETAIVIESRFG
118472446YP_888376.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSAVRTSPDITMALTVDGIRAAIQPALERLSATARFREDTRDYAYDDVYE
118472445YP_884587.1 histone deacetylase superfamily protein [Mycobacterium smegmatis str. MTTMLIHHEIFAAHRTAAGHPERPDRYRAVEMALAQSRFDDLLRVEAELA
118472444YP_890968.1 glycerol-3-phosphate dehydrogenase [Mycobacterium smegmatis str. MC2 1MTVGAYPLSPAHRAAALDRLASDEFDVLVVGGGVVGAGAALDAATRGLRV
118472443YP_886999.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVACASAAAAVGTVLGSAGIASAAPEGPSSPSQTVSELRAQGYHVVVNTV
118472442YP_887132.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRLPLGGDKRWPGMAIPGTVAAPRIFAVPSTSVGVRDGQ
118472441YP_888846.1 DegV family protein [Mycobacterium smegmatis str. MC2 155]MAVVVVTDSSSRLSRQLCERWGIRQVPLHILDGDNDLRDGVDAVPSDIHD
118472440YP_885758.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTALLEARGISRSFGHVRALDGADFDIDAGEVVGLIGDNGAGKSTLIKAL
118472439YP_891061.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MATTALRGLHVLETLAGMRQPATLRDVAARAGLSESNAFRILQALENEGY
118472438YP_890072.1 C4-dicarboxylate transporter [Mycobacterium smegmatis str. MC2 155]MDTQQPPYRDPPPGGRVRRVKPNVFAVVMATGIVSIAAADHHLGVISAPL
118472437YP_889471.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGTAPYGVRLLVGAAVTTLEEARKLPQTILTYPMTMASQAANLVMHVQQN
118472436YP_889651.1 radical SAM domain-containing protein [Mycobacterium smegmatis str. MCMTTGMGLRGDRLHRYVTAFCPHCHAEAPERPLADVQRLAAMLIERDGRIW
118472435YP_891110.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MAETEPQVTELAGELQRVLSKVFSVLRRGDTHRGTAGDLTLAQLSILLTL
118472434YP_888810.1 cysteine desulfurase [Mycobacterium smegmatis str. MC2 155]MSTSEYRSLNAESDLPISADELSALATQLFAAGIRPGPDTPPQTAPVAPR
118472433YP_890503.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMTTFKERETSTADRKLTLAEILEIFAAGKEPLKFTAYDGSSAGPEDATMG
118472432YP_891045.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARVGFELRDGVHASHARTRRCLRPATIIQFPVRWIRTTINRC
118472431YP_889315.1 Mg/Co/Ni transporter MgtE [Mycobacterium smegmatis str. MC2 155]MAAVNRVYAARLAGLVVLGPDGESIGRVRDVVISISIVRQQPRVIGLVVE
118472430YP_886453.1 56kDa selenium binding protein [Mycobacterium smegmatis str. MC2 155]MPTDPTFYRSPGHAVAADSEQLAYVVAFDPTGRKLDALAAVDCEPGSPDF
118472429YP_888665.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSTATEPITYGSQRLAELIEKIGEGSLERERTGERPFAVIDLIKQSGLG
118472428YP_887774.1 NAD-dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MRVFVTGASGFIGSAVADELIAAGHTVIGLARSDASAEALTRAGHEVHRG
118472427YP_887357.1 thiopurine S-methyltransferase (tpmt) superfamily protein [MycobacteriMTGPTGSEFDFDALYRGESPAEGVPPITSVPWDTKAPKENVVAWEQAGLV
118472426YP_885949.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGLLLTSGRKLAQKSTFAANTRNQEVEPEFEACVELFADSRHEFTRGERR
118472425YP_887676.1 transporter [Mycobacterium smegmatis str. MC2 155]MLLHTARSTRDAASETRSYPAVIALCMVITVIEGFNLIVYGSVVPMLLAD
118472424YP_890578.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTINPDDDNIEILTGAAGGADTEGEGEGEGKSLTDLVEQPAKVMRIGTMI
118472423YP_885116.1 dnaK gene product [Mycobacterium smegmatis str. MC2 155]MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARNGEVLV
118472422YP_886544.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFNLTKEQELLRDGLTKFLSSRYDLQTSRAAAKLGEGWQPDIWRGFAEE
118472421YP_888730.1 AsnC family transcriptional regulator [Mycobacterium smegmatis str. MCMEAMDRMDEVDEAIVSLLEDDGRLTHRDIAHRVGLSRSAAAARVQRLIAS
118472420YP_890423.1 cysteine synthase/cystathionine beta-synthase [Mycobacterium smegmatisMTVSTVSRSGPREWVDNAVRLIEADATRSADTHLLRYPLPAAWCDDVDVA
118472419YP_888057.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSVRRPGSRAYLATTTRILRQLAGDHRSVAMILLVPSLIITLIYFMFDDV
118472418YP_885545.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MGKAKPNDNKALVDAMLGDLGSRIRMLRKERQLTTERLAETAGVSAGLIS
118472417YP_886894.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGTDAGTDAGTEASSTRERILAATAKVLGSNGTTKLSLSDVASQAGVSR
118472416YP_886763.1 smc gene product [Mycobacterium smegmatis str. MC2 155]MHLKSLTLKGFKSFASPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
118472415YP_889821.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLPFVWHCVVLGETLVHCGAAALMGAARRAMHIAAAAAATHRTELVMTYS
118472414YP_890634.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MAQRNRPQGHRPGPPAGARRRPRRPRPRRADRVTRARVLRRGPHPGPECR
118472413YP_889572.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLSTVFGVHEDSAGLDAENADDIELDDYEAELDDEEANGQVISIRRANGE
118472412YP_888609.1 flavoprotein [Mycobacterium smegmatis str. MC2 155]MKWNAWGDPQAAKPLSDGIRALLQQALGVTDSPAQISPEDITLRPSALTA
118472411YP_886516.1 MmcJ protein [Mycobacterium smegmatis str. MC2 155]MPVRLGIGIPTTIGPPRAPELSRWCREAEERGASSLSCVDRLNYPNLDSF
118472410YP_889177.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARRRRDKWRQTPPPLPPSLTSRRVETGPDGYDYEVRQVTASRATKTYRC
118472409YP_887685.1 beta-lactamase [Mycobacterium smegmatis str. MC2 155]MRAARTSATILLAILALVVPPPVTAQPLELAARLDRAIEARLAQMGAPGA
118472408YP_884573.1 oxalyl-CoA decarboxylase [Mycobacterium smegmatis str. MC2 155]MTVAPTRDTEAASTDEPGALTDGIHLVVDALKLNDVQTIYGVVGIPITDL
118472407YP_885286.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MSHAFDLVIRGGTVVDGLGGEPVVGDVAVRDGVIVQVGEVAGTGAREIDA
118472406YP_889215.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMIAVAVPEELVDAALRAAAELGRGVADVPAEVIARHAGMSRSTLLRRLGG
118472405YP_885768.1 MmpL5 protein [Mycobacterium smegmatis str. MC2 155]MSAPTDDTPTDAIAAPRHSAPPRPRLPWFLRTFAVPIILAWVAVVAILNT
118472404YP_886101.1 ISMsm1- transposase orfA [Mycobacterium smegmatis str. MC2 155]MAAPRKFDQETRERAVRMYEDRIAEFGGSKREARRHVGELLGINEATLRN
118472403YP_886128.1 endonuclease VIII [Mycobacterium smegmatis str. MC2 155]MPEGDTVFHTAAALRAALEGKTLTRCDVRVPRYATVDLSGAVVDEVLSRG
118472402YP_884572.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMLLRQLEYFVAVARERHFARAAEVCYVSQPALSTAIAKLERELDVTLIHR
118472401YP_887833.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNLRTRLRLGIRICIVAAVVAALVVVEYSTRSGVLWRLITFTYQANLMAA
118472400YP_884873.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MRHADEVSPLFQRQRPTPSDPPEGTPEWFTAALEHRPQHSTIDFEGCRIH
118472399YP_885954.1 alr gene product [Mycobacterium smegmatis str. MC2 155]MQTTEPMTPPAPLASAQTVIDLGAIDHNVRVLRELAGSADVMAVVKADAY
118472398YP_890402.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSIGDRRNGVPATVTSIPLVDPHAPKPDPSIGDLVKDATAQVSTLVRAEV
118472397YP_886286.1 diacylglycerol kinase catalytic subunit [Mycobacterium smegmatis str. MRAVLIVNPNATSTTAAGRDLLAHALESRVSLTVAHTDHRGHAIEIAREA
118472396YP_890517.1 glyoxylate reductase [Mycobacterium smegmatis str. MC2 155]MKVVVTRALPPATLSPLADVGEVWVSPHDRPLTDDELRHAVRGAHGIVSM
118472395YP_888172.1 proline dipeptidase [Mycobacterium smegmatis str. MC2 155]MTISRFSTDVYAQRLQTAAQAAGDAGLAGLVITPGYDLRYLVGSRAQTFE
118472394YP_890324.1 folP gene product [Mycobacterium smegmatis str. MC2 155]MNPPSLTAQPGTPVQVMGVVNVTQDSFSDGGKFIDTDRAVEHGLALVAAG
118472393YP_890854.1 2-methylcitrate dehydratase [Mycobacterium smegmatis str. MC2 155]MRIMRIHDVRTRRSAEDFPRSEHLAWKIAQVAADPVAVDADVEEMVLNRI
118472392YP_885214.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MIDLLVAGGGPAGLATAIYAARAGLVTVVVEPRPGPIDKACGEGLMPHAV
118472391YP_888921.1 sugar ABC transporter substrate-binding protein [Mycobacterium smegmatMRLSRLVAAAGVGVLMLGASACSSTGGKPDSSGGGDMGAGTADTPRFTVA
118472390YP_889393.1 sugar ABC transporter transmembrane protein [Mycobacterium smegmatis sMAATLTTGPDRIATPPARPKRQPLRVRRGERPNWVGALISCVWLAIIMVP
118472389YP_890754.1 anti-sigma factor antagonist [Mycobacterium smegmatis str. MC2 155]MNLSLNTAAENGSRSATVTVAGELDFMTTNKLVDYVSELLSTNQTLDDLR
118472388YP_888348.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MDDSYEALLQHFMPDRDSSERLGGRRLTHMDRVGIDVQVVSHGANNPGSL
118472387YP_886084.1 ribose operon repressor [Mycobacterium smegmatis str. MC2 155]MTRKPVMADVARLAGVSHQTVSRVINGSPSIRPATRRRVEDAIAQLGYRP
118472386YP_888288.1 oxidoreductase- zinc-binding dehydrogenase [Mycobacterium smegmatis stMSHTTIPSTMDGVYLPGDSTAVLKQFDVRPPGPGQVLLEMGASGICGSDI
118472385YP_886184.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGANDSTTVSGEVQADVTDEAKADHEAHIKVLRGEPTPEEMAALMAVLA
118472384YP_885670.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSNERAVATAIIRLMQGVVYRDADEDTWLTLERAGAGVRDHFATIGIDVV
118472383YP_885990.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKTALNVLAVGFAAVSLAGMVAGCSSSEGATPEPTGPAKVSPPAVLTADT
118472382YP_887538.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MEPSERIDHLRTRRAALGAGALFAGALAYLGFADPHRPGFLFPPCPFKML
118472381YP_886577.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAKQPAAEKRQRRERGSINPEDIIKGAFELAEKVSIDNLSMPLLGKHLGV
118472380YP_885554.1 nitrate/sulfonate/bicarbonate ABC transporter ATPase [Mycobacterium smMSTQPKLRLRNVTKQFEIRGEKDKFTAVEDISIDVAAGEFLVLVGPSGCG
118472379YP_889484.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTQPTPAPKPEKSRLLQDGRDMFWSMAPLVVACIVLAGMLGMCSFQGSG
118472378YP_886666.1 periplasmic binding protein [Mycobacterium smegmatis str. MC2 155]MLTFRPLVGTALIAAAASLISGCGTSGEQPVTQPSMTTSVTKIADAGVLG
118472377YP_885312.1 acyl-ACP thioesterase [Mycobacterium smegmatis str. MC2 155]MTGTEKGSKDSSENSLVSTGLAKTMMPVPDPHPDVFDTGWPLRVADIDRN
118472376YP_889687.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSTGHLSRHAPRPDDVGAAPDDARMYPFIGTEAIAAGELTRGQLRWNYTA
118472375YP_885348.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK
118472374YP_888200.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADLLNGIPRVDPTRKPTLMRRAAGWILSTELGSALHRHLMAPADKRLMH
118472373YP_888929.1 myo-inositol 2-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSDLRVAVLGVGVMGADHVERLSTRIAGVKVAVVNDFIETRAEEIAAGVP
118472372YP_889335.1 folP gene product [Mycobacterium smegmatis str. MC2 155]MFSTFCGRPVAHDRALIMAIVNRTPDSFYDRGATFTDEAAKAAAHRVIDE
118472371YP_890771.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGSVFVAGAAAAIAAGPTAALLADAPSTLTDLTGTNQVILATPSGHGDAG
118472370YP_887920.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKALIGLAVGALAAGGIALATASPASAGCQGGWTPWGGGTTCDGPIAQDG
118472369YP_890591.1 senescence marker protein-30 [Mycobacterium smegmatis str. MC2 155]MGTAINRDYSITVVADLKTTLGEGPLWDTEQQLLYWLDSADGRIFRATAD
118472368YP_887456.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKDSSYSNRDELLTELRRAYEEGASIRSLVARTGRSYGSIHSLLRESGTT
118472367YP_885931.1 PduH protein [Mycobacterium smegmatis str. MC2 155]MIQVFTALTGTSGELAAVTRDVLAGIEEEGVPYAVTTVAEDVPVADLARR
118472366YP_889123.1 2-hydroxy-6-ketonona-2-4-dienedioic acid hydrolase [Mycobacterium smegMTSTAAAGTASAVEFESIWSDLQGVAFSQGYLDVPVGDRKIRTRYLHAGN
118472365YP_888629.1 dipeptide-binding protein of ABC transporter [Mycobacterium smegmatis MAGMATAWLAALVLVFTACSTGERVDLGDEASGNLIAAIAGEPDQLDPQK
118472364YP_886966.1 rbfA gene product [Mycobacterium smegmatis str. MC2 155]MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVSGDLHDATL
118472363YP_888777.1 hrcA gene product [Mycobacterium smegmatis str. MC2 155]MGSADDRRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAV
118472362YP_885929.1 glycerol dehydratase large subunit [Mycobacterium smegmatis str. MC2 1MTTARNLGTEAKRQSERTKLLEERPVNLDGFVQEWPEVGMVAMDSAFDPE
118472361YP_885661.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSERKPSTLWSGGRSTTWGAYWDALFPPAMVTGWDDWKRGSTGVNVARRL
118472360YP_887082.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRSSRRLDATTKATSGCARRDAAGTFVFAPASQHARRWQRAGQTARWGL
118472359YP_887580.1 sugar ABC transporter ATP-binding protein [Mycobacterium smegmatis strMATVSIAGVHKSFGKTKAVDDLSVDIADGEFFVILGPSGAGKTTTLKSVA
118472358YP_885401.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPVDRADTSGSAADQMAFAHRGGAMTRIVLAALGVVVGGYGAVLLWDNPP
118472357YP_886905.1 LipW protein [Mycobacterium smegmatis str. MC2 155]MAHRSGWTERLDPALREFAGARTDLSPETLAVVRASIDRRRRESAQTLDT
118472356YP_888691.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSVRDQRMLVAAYLPVLAFTAVLVAAKMSNPRRPRSLELLR
118472355YP_887424.1 binding-protein-dependent transporters inner membrane component [MycobMSRPRWLETLRITVLTVAFLFVLFPIVWVTLASFKSPAQMSEPFLFVFRP
118472354YP_886846.1 IclR-family protein transcriptional regulator [Mycobacterium smegmatisMLDRFVSVLSCFSVHAPVATAADVRERTGLPPTTTNRLIRSLVERGILSQ
118472353YP_886885.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTALHTFPPERTAVVTGAGSARGIGRATVQRLARAGWHVAALDVDEAAVV
118472352YP_885088.1 UDP-glucose 6-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MFGTGYLGATHAAGMAELGHEVIGVDIDPGKVAKLASGDIPFYEPGLRKV
118472351YP_887118.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSDDTAPARFTELTAGGRTVGSGDDELTTRFYAYPDDLRKCRVRANMIVS
118472350YP_887578.1 transporter [Mycobacterium smegmatis str. MC2 155]MTLQTSQPAPAAESVDRGTSGRPPEVPSWRRKLRPYILSVPAVLIVIGIL
118472349YP_885665.1 HNH nuclease [Mycobacterium smegmatis str. MC2 155]MTGASDPLLLGQRVVAILETGLRTATYKLATLMALIEHCVENLPTDPAAT
118472348YP_889328.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MELLTGFGLATAAGLNAYIPLLALGLLSRFTDLVALPAGWAWLENGWVMA
118472347YP_890585.1 membrane protein [Mycobacterium smegmatis str. MC2 155]MAETTAPRLSLGTQAFRFIVTGGLSAIVDFGLYVLLLAAGLHVNVAKTLS
118472346YP_884437.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MADTTRTDLSWTGVRVLRRTVSRNLKWLTSGTTLIALHQLCEVSVPVLIG
118472345YP_889531.1 phospholipase [Mycobacterium smegmatis str. MC2 155]MDSKRALVLAGGGIAGIAWETGILRGIADESPETAQALLGSDVLVGTSAG
118472344YP_885351.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSIAANIIGTHYRYPDYFEVGREKVREFSAAVKDDHPAHFDEAAAKECGH
118472343YP_889957.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMPSAEEPQWLSPAEKEAWTGLVSLILLMPGRLEAPLRDVDLNLFEYLALS
118472342YP_884485.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSADYDRLFHSSEPGKPVDDATITVDRDAILKATAATPRVPAGEKPPADA
118472341YP_886784.1 dienelactone hydrolase [Mycobacterium smegmatis str. MC2 155]MTITISTPDGPIDALLSTPTGSGPWPGVVIIHDAIGYGPDNELVSERVAQ
118472340YP_885486.1 ureE gene product [Mycobacterium smegmatis str. MC2 155]MALGTGLRILDTIVGWSTDQPIAGRLHELRHRHAVEYVHLDAHDLDRKRL
118472339YP_887159.1 transcriptional accessory protein [Mycobacterium smegmatis str. MC2 15MPTSGPVPGVRSITARLAEELSVGEHQVAAAIHLLDEGSTVPFIARYRKE
118472338YP_890389.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSATGRGSNQASAAAPTRSPGNIRRRRRRGDTFRGTRRRRGREGQINNAA
118472337YP_887994.1 galK gene product [Mycobacterium smegmatis str. MC2 155]MGDTVTYAAPGRINLIGEHTDYNLGLALPIALPQRVVVRYQPDDSEAITV
118472336YP_886947.1 cobalt transporter ATP-binding subunit [Mycobacterium smegmatis str. MMTDTAISIAALCHVYPDGHIGLDGVDLEVAEGERVAVLGPNGAGKTTLML
118472335YP_886787.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MIPTVRDVIGLPVVQAGDPEVVSAENLDCPVRWVHVSDMPDLAGLLHGGE
118472334YP_889141.1 major facilitator family protein transporter [Mycobacterium smegmatis MATSTGVRVSPLRVAVASFIGTTVEFYDFLIYGTAAALVFPKLFFPQASP
118472333YP_887751.1 two-component system response regulator [Mycobacterium smegmatis str. MRVVVAEDEIILREGLCSLLAQEGFDVVAQADTADGLLAAVRDKNPDLAL
118472332YP_885896.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGIPREGGGVEADMTDTTPAAGPKPDLGRYGSFGRGVTPAQAKEIEALG
118472331YP_885163.1 peptidase- M50B family protein [Mycobacterium smegmatis str. MC2 155]MNIRPLRQSVRPSPIFLLVIAVTAAGGALAWIAADTIRPLSYVGVFILVI
118472330YP_889442.1 fasciclin domain-containing protein [Mycobacterium smegmatis str. MC2 MHTRTKTLGAAAAIAAIATSLPLAVTAYAEPETTTEAEPTVEIPDPQGPG
118472329YP_889732.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSGFVETEEQQALRRAVAAMAANYGQDYYLEKARAGQHTTELWNEAGKLG
118472328YP_889332.1 tag gene product [Mycobacterium smegmatis str. MC2 155]MTDGRVRCGWATPGSDGSTLYLDYHDTEWGRPLRDGDALFERVSLEAFQS
118472327YP_890339.1 IclR-family protein transcriptional regulator [Mycobacterium smegmatisMSTDDAVSVRKVKSAVRTVELLEYLAARPDRPTRIREICAALDMPRSSAH
118472326YP_888179.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSQVSTRLVRLLNMVPYFQANPKVTRAEAAAALGVTGKQLDADLDQLWMC
118472325YP_889580.1 formamidase [Mycobacterium smegmatis str. MC2 155]MPEVVFSVDHSKSMRDQAVPGHNRWHPDIPAAATVKPGSEFRIECKEWTD
118472324YP_886793.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPRTASKSSSPARTAKAAATRADFVRPKTAQQAVAEVLRRDITSGKLAP
118472322YP_885777.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTMFSADNLRYFLEVARTGRLNDAARNLGVDHTTVGRRITALEKSIGER
118472321YP_889161.1 ThiS family protein [Mycobacterium smegmatis str. MC2 155]MTVNVSIPTILRPHTGGQKRVTASGSTLKEVITDLENNYSGISERIVDAA
118472320YP_887960.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNEIPDVVNAVDVEAWRDEAADEVDVVVIGFGIAGGCAAVSAAAAGARVL
118472319YP_888345.1 haloacid dehalogenase [Mycobacterium smegmatis str. MC2 155]MVFILDPKPDLLTFDCYGTLIDWDSALRVYMADLLRRKNLSVEPDQFYHR
118472318YP_890417.1 diaminopimelate decarboxylase [Mycobacterium smegmatis str. MC2 155]MTDAPPRAGAPLPSPEELLYRREQIVADVVRQGFIDDLHPLCGVIDLDTL
118472317YP_886977.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLAVLFAALLHAIWNSLAHAVSDRVVGFALIGVVDAIGGAALIALGGLPP
118472316YP_890433.1 GatB/Yqey domain-containing protein [Mycobacterium smegmatis str. MC2 MAELKDRLRADLTAAMKSQDKLRTATLRMLLAAIQKEEVSGKQARELSDE
118472315YP_888330.1 GAF domain-containing protein [Mycobacterium smegmatis str. MC2 155]MSVRSDPLRAWMSAVTAISRTVNAAEPLETVLDDIAQMGCDLVGFDYCGV
118472314YP_887205.1 short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis str. MTNLLSGRTALVTGSSRGIGRAVAQRLAAEGAVVAVTARSYEPSPSVRAG
118472313YP_884845.1 bifunctional uroporphyrinogen-III synthetase/response regulator domainMREPDWAPLTGFRVAVTSARRADELCALLRRRGATVTSAPAITMVPLPDD
118472312YP_884479.1 ftsk/SpoIIIE family protein [Mycobacterium smegmatis str. MC2 155]MTTKKFTPTIKRGPRLTPGEINVAPPDDLGIDIPPSGMQKALPWVMGGCM
118472311YP_889448.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGFLKQTAPQVDFEEWSKGTRAEKIRPMARHWAEVGFGTPVALHLFYVVK
118472310YP_888444.1 3-hydroxybutyryl-CoA dehydratase [Mycobacterium smegmatis str. MC2 155MIRLEIAGAVARIVLDRPQKRNALSSQLLTELRTRLEDVAASDVRVVQLI
118472309YP_890014.1 thiredoxin [Mycobacterium smegmatis str. MC2 155]MSSSMAAAVAVLIAALVLAYVIGRVLTRRSGRVRQTGPGSAVGAETDAVA
118472308YP_887199.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAIPRLVPALDTEPADATALRAEVRAFLDEQRAAGTFTPAVDAWLCGWDE
118472307YP_885473.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRTERIRPPWWLKYVNKVMIGLSKVGVGGDKGPVVLTVPGRKTGKPRTTP
118472306YP_890876.1 ABC transporter periplasmic protein [Mycobacterium smegmatis str. MC2 MRQQKWSRWLIPAMLTAISLPLAACGGSAGSAAVDASSPPDINAAKEQAE
118472305YP_884550.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MTEPPAPTAPLNKPKTPPYKLAGLILGLVGVLVLALTWMQFRGQFEDKVQ
118472304YP_884874.1 CinZ protein [Mycobacterium smegmatis str. MC2 155]MAYTLEPAARPYAEAVIKNSRFIARLCRADSEAAAREFIGTARDVERGAG
118472303YP_886151.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNGPSSRGASRGETILDARLHLLDRQLIDDDGAPVGIVDDLELDGIEIDK
118472302YP_890193.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MCPKWVFSTGMVQSMSTDQMTDELDVIVVGAGLAGSVAALTVARAGYSVG
118472301YP_886308.1 ATP-dependent DNA helicase [Mycobacterium smegmatis str. MC2 155]MQARYSPVELSAALGLFPPTDEQAAVIAAPPGPLVVIAGAGAGKTETMAA
118472300YP_888742.1 cobalt transporter [Mycobacterium smegmatis str. MC2 155]MSAPGGQRKPVVLLRPVPGDSVIHQLWAGTKLLSVAVIGIMLTFYPGWVP
118472299YP_886474.1 PTS system- glucose-specific IIBC component [Mycobacterium smegmatis sMSNAAKPEATQRKSGLRIPGFAQLQRLGKSLMLPIAVLPAAGILLRIGQP
118472298YP_889955.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MATYRVLNPKGDVVDTKDIESADDAHAWFVDQRADNTELGWRMEVEQGGE
118472297YP_889700.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MASDLRVDSGGLRAGAVSSELIAAELTVGHVGVGADSPTHAGVSAMDAAI
118472296YP_887186.1 thioesterase [Mycobacterium smegmatis str. MC2 155]MSDPISVADPEHARALYEPLTQSVRRLVDLTIRSEADDDAVRRAHRLVDE
118472295YP_885391.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNEQLSKTEIGKDALQESVEALATTVGEVATIVTTAVKDVASAIGGLATE
118472294YP_887796.1 phosphodiesterase [Mycobacterium smegmatis str. MC2 155]MDVPKPESALPHLADVVPSVLAAMGVAAFETVAGIDLPSPIRGACVLLVD
118472293YP_888509.1 murE gene product [Mycobacterium smegmatis str. MC2 155]MAMKLRPSRPVGHHLAPLAAAVGAVASENPAGSSSDLAAVHVTGVTLRGQ
118472292YP_889933.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSGRHRKPTSSSSAKNVAKIAFTGAVLGGGGLGMAGQAMAATDGEWDQVA
118472291YP_887730.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MKTFFITGVSSGLGQAFANGALAAGHRVVGTVRKDSDAAAFESTAPDRAH
118472290YP_888675.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MEENATTFTELSHTRAAIWRGGGDVVIESVPLPVLQTGEVLVRVRLATVC
118472289YP_886799.1 transporter ATPase [Mycobacterium smegmatis str. MC2 155]MDRDGIRIEDVSVVFDVPAGKVTAVAGIDQHVPHASFVSIVGPSGCGKST
118472288YP_886569.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MAHPLSQRIADVLDLDPDAGAIQFDGQWSCWGQIAALAGHIEKITGPARV
118472287YP_889131.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDVRLTAEQQQLREAAAKLADDLGPGSVHELEDRGRIARLENTVAATEWR
118472286YP_888209.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDEYAEFWASRAKTPETRARIRRWALLKRVFFGLAGLSSTASVTIIVVA
118472285YP_887805.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVARPTGEETMSHLALLAGSVMVGIVIAAGAVYDYQRRAARARNVSIRSH
118472284YP_886834.1 decarboxylase [Mycobacterium smegmatis str. MC2 155]MEQTGIGVVVPYDFALDRELWRWVPEHISLHLTRTPHVPLSVTMEMAIYV
118472283YP_885147.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEGQCARIDFPSRIGVWWASDTWSMRDAQEVAREIEALGFGSLFLPETV
118472282YP_890076.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MTNPEMVEEQPQLRRVMGPGLLLLFVVGDILGTGVYALTGQVAKEVGGAA
118472281YP_887973.1 transporter small multidrug resistance (SMR) family protein [MycobacteMRKWALLLGAVVVEVTATLSLRASQDHALWLVPVVAGYVAAFVLLTLVLR
118472280YP_889508.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIERPAARYGSREQPRLSRRWILIAVAALVLVAGVIVAVVAYQRFGSGEV
118472279YP_889346.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLRPWSFSVTHADHFVNSIKPGRHAPIHESMDRKSVLDLMSPEGTFVRAA
118472278YP_890037.1 lipoprotein YaeC [Mycobacterium smegmatis str. MC2 155]MTDQITPTSALDIEIEKKRRWPWIAGAATAVAAIVGGVVYANLANQDKAF
118472277YP_888003.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTGGPARTYNQAHIPRMRNGRRRISIYWTWSYPWESQRDPAAMENRFSTM
118472276YP_885867.1 map gene product [Mycobacterium smegmatis str. MC2 155]MINLRGRRKPKVVTQRTSAELDAMAVAGALVASALRAVKAAAAPGVSTLE
118472275YP_884713.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPDKVPNKLPPEFADLEPFSGWCLGSEPERYAKRLASTMTEIQAFYDAIT
118472274YP_889130.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFRDSPEEAAFRDRLRSWLADNAASFKASGDDYWARQGEWHQALYGAGF
118472273YP_885383.1 two-component system regulator [Mycobacterium smegmatis str. MC2 155]MRCLIVDDSASFRTAAATMLDSGGVEVVGVASNSAEAMVFCRELQPDVVL
118472272YP_889041.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSTTKMIAGAAILASATALGLLGAPTASAGEGWGINGTFAMSSNGEWAKI
118472271YP_889183.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium smegMRRALKCRTVDSPVGPLTLAGRDGHLVHLRMEDQTYEPSRDGWEVDDSAF
118472270YP_886958.1 proS gene product [Mycobacterium smegmatis str. MC2 155]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYVRAVGPGIYSWLPLGLR
118472269YP_885327.1 carbon-nitrogen hydrolase [Mycobacterium smegmatis str. MC2 155]MMRIALAQITTGTDPSSNLELVESCTRRAADDGARLVLFPEATMCRFGVP
118472268YP_889256.1 phosphohistidine phosphatase [Mycobacterium smegmatis str. MC2 155]MATLLLMRHAKSDYPDGVVDHERPLAPRGVREAALAGDWIRANAPGIDAV
118472267YP_887584.1 glutamyl aminopeptidase- M42 family protein [Mycobacterium smegmatis sMADDGFPRALLQELLSAYGPCGQEAAVRVVCRRELEPYVDGLWTDAAGNL
118472266YP_884670.1 phosphoenolpyruvate carboxykinase [Mycobacterium smegmatis str. MC2 15MTSATIPGLDTAPTKHQGLLAWVQEVAELTQPDRVVFADGSDEEYERLCA
118472265YP_884958.1 chromosome replication initiation inhibitor protein [Mycobacterium smeMQIDGQQLAAFAAVIELGSFDAAAARLHVTPSAVSQRIKALEQRVGQVLV
118472264YP_886216.1 4Fe-4S ferredoxin [Mycobacterium smegmatis str. MC2 155]MSENRRNSFYGPLEDPATDAGYDDEHPPRVGFFTDTSVCIGCKACEVACK
118472263YP_885822.1 rplB gene product [Mycobacterium smegmatis str. MC2 155]MGIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRIT
118472262YP_886456.1 acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase [MycobacteriMRVLRLAGTAHERGVAYGEHTRDEIRECIQVYQRWFESFANISWPAAREL
118472261YP_885892.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MVEGDKRLGLTADEVLTTTRAVRKRLDYSRPVPRELVTECVRIATQAPSG
118472260YP_887935.1 gnd gene product [Mycobacterium smegmatis str. MC2 155]MTASSTPSSTTGTAQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTD
118472259YP_887721.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSNDIMTAERIVDAPAATVFGVLADPTAHHAIDGTGWVRESLDSAKLTTV
118472258YP_889852.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MMTDFTTDFSAIHDELRSVAADLLAKDSVDWPLLVQAGWVGLDAPESLGG
118472257YP_890210.1 UDP-phosphate galactosephosphotransferase [Mycobacterium smegmatis strMMTAQISNFDSGFGTRQLVSMPKPNSVVAGTNMSIKLPPSSVFQRSKWQR
118472256YP_891122.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRVLLVTAIVALLTMIVGPPDLLPRAAAHTDEARFLQIHIDRISPDLVTT
118472255YP_889848.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTELPDWAAPLDLAPHPEGGWYRETWRSELTVNQTSLPAGYSGPRSAGTA
118472254YP_890729.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAALRVLLHRCSTYPLPGRQTPGDRNVLAATRFTATTRFAQKSAVE
118472253YP_890928.1 epoxide hydrolase [Mycobacterium smegmatis str. MC2 155]MTSDVTLVHDSAYFDDLKMHYVRAGAGEPVVLLHGWPQTWYAWRKVIPLL
118472252YP_889734.1 MscS mechanosensitive ion channel [Mycobacterium smegmatis str. MC2 15MGTQVLMSETIKLESATNFAVTAAWAAGAVALAYGVGLGSNWLVQRVGGR
118472251YP_890437.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDAGPMKIRNLRWIVPTAVVIVVLAVLTVYLTAPRPGGRMDPDSTSPEGA
118472250YP_886597.1 bile-acid 7-alpha dehydratase [Mycobacterium smegmatis str. MC2 155]MSDDLEAIKRLKARYCRLLDTKDIEAWRTLFADDVVVTLDMAVSTGGADP
118472249YP_884561.1 HNH endonuclease [Mycobacterium smegmatis str. MC2 155]MSWGYPQTRVHPQIAVLRCRGGFTVGRFERMYEGLLVQIAEFSALSDLEL
118472248YP_888093.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDTVLFTVLCIACFGVATALRAAVARRGSDDVPPRDPKDTEASERLVTL
118472247YP_889433.1 tetracycline-resistance determinant TetV [Mycobacterium smegmatis str.MRSPRPVAGWRVLAPFRIREYRLLIAAVTLSIFAEGMWSVVMALQVIAID
118472246YP_889717.1 type I antifreeze protein [Mycobacterium smegmatis str. MC2 155]MPTYSYACTECDNRFDAVQAFSDDALTTCPKCSGRLRKLFGSVGVVFKGS
118472245YP_886149.1 UsfY protein [Mycobacterium smegmatis str. MC2 155]MGDTAKDPVDHARTTRPHAGETLKDTANIPALILLFLGGVSFVSCLFAFS
118472244YP_890383.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTHDWLLVETLGSEPAVVARGSQTKNLIPISVFLRRNPNLMAIQSAIGET
118472243YP_885345.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSASTLFTDAMALTPAGDGIYDGALDEHWTIGPKVHGGAMLALCANAAQT
118472242YP_885723.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKNIALCFDQSGEQSASGADTNIKALLALLDDSAALTWYHCARKLPVYRR
118472241YP_888957.1 alpha-amylase [Mycobacterium smegmatis str. MC2 155]MAQWWSHAVFYQAYPRSFRDSNGDGVGDLDGVTTGLDHLADLGVDALWLN
118472240YP_884635.1 monoglyceride lipase [Mycobacterium smegmatis str. MC2 155]MVSSTRSEHSFAGVGGVRIVYDVWTPDTDPRGVVVLAHGYAEHAGRYHHV
118472239YP_888415.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
118472238YP_886817.1 fumarylacetoacetate hydrolase [Mycobacterium smegmatis str. MC2 155]MRVVGIRRTGSDRVEVAALTDTGDAVRVLAGLDEFWCDPTAHLAEEPAGA
118472237YP_890934.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTDVSRSDSGPFVPQDRPRTYRWRVVDIVVASVLAVAAGLVFVMWNIASN
118472236YP_885869.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTQSEPHRIGPVDPDRYSTWDAAYVLGSLSSEERREYEAHLTTCPQCRAG
118472235YP_884490.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
118472234YP_887408.1 sugar kinase [Mycobacterium smegmatis str. MC2 155]MGILLTIDLGTEGARVGAFTEDGTALGSTHRPYLTHHPRPGWAEQDPRDW
118472233YP_885477.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVHRDLLLTPVSSARHPSADITDWTGTWVCVGLAEQLTEVGAILPATIG
118472232YP_890469.1 glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]MALPARSDSGCAVPVEFTSAEQAAAHIGANSLQDGPIGRVGLEIEAHCFD
118472231YP_884980.1 potassium transport flavoprotein [Mycobacterium smegmatis str. MC2 155MTTHVPVAVIGGGQAGLSVSWYLVRAGIEHIVIESKTPMHAWADTRWDNF
118472230YP_889024.1 ltrA gene product [Mycobacterium smegmatis str. MC2 155]MFAGTRAMRADAEGGRIQDVDEGARELPVQAHRLFRMSGRDPHEQHRVAS
118472229YP_884651.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MRNRLRVLAFDVAAPLAAIAALVYLGAALGWPTWWVSVCSILCLLIVQGV
118472228YP_886479.1 multiphosphoryl transfer protein (MTP) [Mycobacterium smegmatis str. MMTVGIVVVSHSRPLARAAVGLAQEMLHGKAVRISIAAGLDDTTLGTDASA
118472227YP_888012.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVVIPSAPTGYTLSRREFLSDEELVTSPLTDVCQIGFV
118472226YP_887166.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MLRYAAARIGQSLLVLLLAFTVIFWGVSILPTDPVSIFVAKGDGYFNPEI
118472225YP_888971.1 pyruvate dehydrogenase E1 component subunit beta [Mycobacterium smegmaMTQIIDRPAAQGDAPEPWGSILTPAAAQAPVPAVTELTMVQAINRALRDA
118472224YP_888542.1 MmpS3 protein [Mycobacterium smegmatis str. MC2 155]MSGPNPTEPDANGSDLPDQTPGKHAVPEEPTQVSGTDPETGETEFYSQAY
118472223YP_884736.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MLEQDMTDEEFEPYFAKAQEVSQFFREIGPKYDQENTFAYPSIEAFKKSG
118472222YP_884674.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMSENKIILVTGVTSGIGEAVAIRLAAEGHLVVGGARRADRLAALKRENLH
118472221YP_890206.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MTCRLCGSQRLLSVLDLGATPPCEKFLAAGELDLPEPTYPLHLRLCEDCL
118472220YP_885346.1 proC gene product [Mycobacterium smegmatis str. MC2 155]MSRIAIIGGGSMGEALLSGLLRAGRQVKDMVVAEKFPERAKYLADKYSVR
118472219YP_890140.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MALNIADLAEHAIDAVPDRVALISGGDQLTYGQLEEKANRFAHYLIDQGV
118472218YP_886724.1 5-carboxymethyl-2-hydroxymuconate delta-isomerase [Mycobacterium smegmMRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVR
118472217YP_886186.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MDGCARPAFRVPLSDDEMHFTHLFGYAPGDFGYLLLPLDGGGWRTPATIL
118472216YP_886751.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTVAASDTDRSVAEGPGGLVVGKPSAVWVLIAGVLGLAASLTLTVEKIEL
118472215YP_890150.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSPTTVPRLRLLLTTGLAAAVVATAAGCQDAQLTADPATGKAPAASSSAA
118472214YP_889816.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAAEQEFSAYGPSHLVVLAIFVVGAALLVWAGRRQTEQQAKLLSRVLAV
118472213YP_884740.1 aldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSEHYSMYIDGKWIDTDEVYEIRSPATEELVATVAKGNTASVDAAVEAAK
118472212YP_889951.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMDTRQRIQEVARELFAEKGVVRTSLQDIADRLGITKPALYYHFRSREELI
118472211YP_888845.1 SpfH domain-containing protein [Mycobacterium smegmatis str. MC2 155]MDMLYSLGISAAAAVTLAWLAIRNIRVVRQYERGVVFRFGRVTKSIRQPG
118472210YP_889236.1 carbonic anhydrase [Mycobacterium smegmatis str. MC2 155]MSVTDQYLANNEEYAKTFSGPLPLPPSKHVAVVACMDARLDVYRILGLGD
118472209YP_888144.1 aliphatic sulfonates transport ATP-binding protein SsuB [MycobacteriumMTVTSERSVTTAAELRGVNKWYGRHHVLRDVSLRIGRGEIVALIGRSGSG
118472208YP_886634.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118472207YP_889126.1 LAO/AO transporter ATPase [Mycobacterium smegmatis str. MC2 155]MPHGVVDVPELITVARGGSMRAVGRLLTLVESDRRGEVLAALGPATPRVI
118472206YP_889006.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MQQIFLGFAADIMPLPAVELTPAFAGAASPRPDGASLSTGREVLWHM
118472205YP_887616.1 zinc-binding alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 1MVIGGGRFRLKQRADPVAGPHEVLVEVRAAGLNAADLQQARGDYPAPAGW
118472204YP_884626.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MHPADSHDRIRVTGARENNLKDIDIELPKRRLTVFTGVSGSGKSSLVFDT
118472203YP_885797.1 amidinotransferase [Mycobacterium smegmatis str. MC2 155]MTISDDVIWNDRVRPDQHGPSADVAAPPARRSTVRHYAMTAPDHFTVEYA
118472202YP_889600.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIVAGLIAALSTIPWDGQGCDDVLPAWHEYIAFLLAVQAIFTGLATLVWL
118472201YP_887807.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPIGIGLAATAVISSLLTAFVVFTTLTTKLSKRDSVYAVGVRMLPDDPRS
118472200YP_889646.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMGHGVEGRSTPAASLDAASAVKVAETLQALASPNRLLILTRLRESPCSVT
118472199YP_890394.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMSVPPGTQTLARGLAVIRAVADGARDLRGLVEHTGLGRSTTHRLVQLLVH
118472198YP_887910.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTQAQELSVDFDFRLDGKVALVTGAASGIGAAIASAYATKGARIAAVDLN
118472197YP_886953.1 cobO gene product [Mycobacterium smegmatis str. MC2 155]MVPDDGLTTRARRNAPVLAVHTGPGKGKSTAAFGMALRAWNQGFRVAVFQ
118472196YP_886871.1 carboxylesterase [Mycobacterium smegmatis str. MC2 155]MTGYEPIVGRYLTADIDGVPNRMYIEESGDGVPVVCLHTAGSDSRQYRHM
118472195YP_888165.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMVRPSTPVRSPTDRRQPQRSDLRRTAILEALNEHLQKTGFDALNIAEVAR
118472194YP_884753.1 enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis str. MC2 155]MLEITDQNRVRTIALARHDALNAFDEALYDATAIALQDAAEDGDVAVVIL
118472193YP_889108.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MAERPTPEEIILYDKDPETKIATITFNRPEFLNAPTSMARLRYADVLRAA
118472192YP_889280.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPWWERYIGLPLLLLHDKVYKATDGRIGHRIPGGPATLILHTVGAKTGQH
118472191YP_887488.1 L-asparaginase [Mycobacterium smegmatis str. MC2 155]MNPSAQVVLITTGGTISTSTDNAGVRRPTRRGAQLTAALTAPTAPTVSVV
118472190YP_888733.1 acetolactate synthase [Mycobacterium smegmatis str. MC2 155]MSARNGGDVVVETLTALGVSHVFGIPGQNALGLFDAVRRSKLTFISSRVE
118472189YP_889899.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAKDQDILAEVHRLVAEEQELRDKLQRKEISEDEEHQRLQHLEVALDQCW
118472188YP_887588.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNDLMFVRAVNGVASRLTRVPILGSLVRRGMIVIRYTGRRSGQTFETPVG
118472187YP_886269.1 caib/baif family protein [Mycobacterium smegmatis str. MC2 155]MTSTDTYDPPLSGVKVLDLSSGPITAVGRLLADLGAQVTPVNLAGVTEAG
118472186YP_887334.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MGIKVALEHRTSYTFDRLVEIHPHVVRLRPAPHCRTPIDAYSLTVEPADH
118472185YP_885879.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MYLSDLDDDERVIVETAAAFAEKRITPYALEWDDKHHFPTDVLREAAELG
118472184YP_884683.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMPVQSEELRRRLVADINAGTPGAKLGSERDLAEKYGTSRSSLRQVLAALE
118472183YP_890181.1 protein-tyrosine kinase [Mycobacterium smegmatis str. MC2 155]MNLKSFVAAAQRFWSTYLLVAGLVLIVGAAAIMMLPVTYVSSARLMVSIE
118472182YP_886716.1 ilvC gene product [Mycobacterium smegmatis str. MC2 155]MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDSGVQVKVGLKE
118472181YP_885200.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MIELAGLTKLYGTHRAVDDLSFTVEPGVVTGFLGPNGAGKTTTMRLILGL
118472180YP_885367.1 porin [Mycobacterium smegmatis str. MC2 155]MKAISRVLIAMVAAIAALFTSTGTSHAGLDNELSLVDGQDRTLTVQQWDT
118472179YP_888520.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MEQQSDPLVGSLLDGRYRVDMPIATGGMSTVYRGLDTRLDRPVALKVMDS
118472178YP_890814.1 NADH:flavin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MHPFRQAVEARDTDAMTALLADDVVFTSPVAYKPYPGKAITAAILRGVLR
118472177YP_890976.1 halogenase [Mycobacterium smegmatis str. MC2 155]MRAQISHLDPTTREALATRIRNQLSRADATSTDHDVAIVGGGAAALTLAL
118472176YP_886687.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MKKAYTALVAITVGAHFGYLLYLPSGGFLALRWPRTLAFHVPTVIWGAFV
118472175YP_887554.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTEPQRAVIARVTADLTAVSAYLNRMAGDLATLDRLVAQQSAAPRPEAVA
118472174YP_889286.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MTNAALAELVTELPEGTVVTDPDILASYRQDRAADPNAGMPLAVVRPHRT
118472173YP_887848.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MMIVKTTTTRFVAAALTVGALGFGATAFGTPVASAGPAAPVPLKPGDGGC
118472172YP_887826.1 linalool 8-monooxygenase [Mycobacterium smegmatis str. MC2 155]MVMSDSALHLPAGFDFTDPDIYAERLPVDELAELRRVAPIWWNAQPIGAG
118472171YP_887226.1 oxidoreductase YeiQ [Mycobacterium smegmatis str. MC2 155]MNLLKLGSYGTAVPPRPDPNALTVGQVHLGLGAFHRAHQAIYTEDAMRHT
118472170YP_885680.1 ilvD gene product [Mycobacterium smegmatis str. MC2 155]MASSSIPLRSRTVTHGRNMAGARALLRAAGVAREDFGKPIVAVANSFTEF
118472169YP_889146.1 ahpD gene product [Mycobacterium smegmatis str. MC2 155]MSIDNIKSALPEYAKDLKLNLGSIANTTELTEQQLWGALVATAAATKNAR
118472168YP_887533.1 trpC gene product [Mycobacterium smegmatis str. MC2 155]MSSATVLDSIIEGVRADVAAREAVISLDEIKERAKAAPPPLNVMAALREP
118472167YP_887688.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMVSTDSFAVLAEPARRDILDQLRLGESSVTELVARLRLSQPSVSKHLKVL
118472166YP_889490.1 DevR family transcriptional regulator [Mycobacterium smegmatis str. MCMIRVFLVDDHEVVRRGLIDLLSADPELDVIGEADSVSQALARIPAAQPDV
118472165YP_889081.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMVASPRNTEADRGQRRATFQRANSHTTKQMLVHAAMALWRTNGYANTTVA
118472164YP_888467.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGSRTASLGGKVVFITGGGAGVGAEVSRRLYRKGAKLMLVDVDADALKAH
118472163YP_886591.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMASPATGGGRPRRERGSITVDEILSGAFEVAREVSVDNLSMPQLAKHLDV
118472162YP_888148.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTPTAAATRRRNRPQPCRWCGREVPDAQMGRRRQYCRQSCRQRAYEQRA
118472161YP_891135.1 inner membrane protein translocase component YidC [Mycobacterium smegmMFNFFSLDIIYYPVSAIMWVWYKAFSFLLGPTNFFAWALSVMFLVFTLRA
118472160YP_887879.1 alpha-amylase [Mycobacterium smegmatis str. MC2 155]MTMPDWVTHAIWWQIYPLGFVGAHPADPPPGPEEHRLRRIVEWLDHAVEL
118472159YP_887769.1 fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 155]MDSGSRTQYEAPTGLLRIEDCLDADGGIVLPPGTTLISLIERNIANVGDS
118472158YP_889535.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRLVVVPGPTHQNRRCQQPFLLVRPNVSRRRAHMSSKLVDRHAARQTASP
118472157YP_890004.1 LytR/CpsA/Psr family protein [Mycobacterium smegmatis str. MC2 155]MNDPVDDDAEPTGNHADGVTVADLIAKVAGSDGATPRRSRRRRAAEPDPE
118472156YP_891031.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MLLPESPDRSSEGSMGGEWLPEAAVNHTGLLDVGDAVEKRCGTYPK
118472155YP_890866.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MNAAIRPVISAIAMLTVAAGVAVVALLGDDARSVAAPAPGAKPTIVLVHG
118472154YP_886554.1 purU gene product [Mycobacterium smegmatis str. MC2 155]MMAQEYPKANALPAQDVGRLLLRCADRPGLVAAISGFLTAAGANIVSLDQ
118472153YP_889291.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MTLSGSVQDPAQGGLESVGAPERVGSLTGIRALAALLVVLTHAAYTTGKY
118472152YP_888351.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MEIDFRDDRIGGFNYEFFRTISSPVAEMGETLGVAYRIKDGDIESWLTNF
118472151YP_887057.1 recA gene product [Mycobacterium smegmatis str. MC2 155]MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLD
118472150YP_888417.1 dTDP-glucose 4-6-dehydratase [Mycobacterium smegmatis str. MC2 155]MRIFFAGASGLIGRHVLPLLIDAGHTVGAMTRTADKAGHLEASGALPIVC
118472149YP_886709.1 gatB gene product [Mycobacterium smegmatis str. MC2 155]MTAATTAELVDFDDVVARYEPVMGMEVHVELSTATKMFCGCANRFGAEPN
118472148YP_890082.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTSRFARLTRDELATLVPELLLMGQMIDRSGMAWCISNFGREEMVQIAIE
118472147YP_886097.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIASVDTIVTIALFVALIPAVGAAFMIGIHLMMLGDNISADRPRRIWGIY
118472146YP_884571.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MTETPTAISASWLAQAVVDASSEAIVVTDKAGDIVLWNDGAARMFGFTAA
118472145YP_884947.1 intracellular protease PfpI family protein [Mycobacterium smegmatis stMTHALDGKKVAILATDGVERRELVEPREALEQAGARTELLSLQTGSIDAR
118472144YP_885650.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
118472143YP_888178.1 tatA gene product [Mycobacterium smegmatis str. MC2 155]MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQAES
118472142YP_887291.1 permease- cytosine/purines- uracil- thiamine- allantoin family proteinMSTRPIEPVAAGDDSPPEQSAAVPFDAHGIEPIAPTDRDCSPAELFWIWC
118472141YP_889222.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MMGDFDLRGLTRPVIVAPMAGGPSTPALAAAGSNAGGLGFIAAGYLTADA
118472140YP_889868.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTV
118472139YP_886201.1 transcription factor WhiB [Mycobacterium smegmatis str. MC2 155]MSYESGDFDRVVRFDNRLLGSVSHAPHIDTGSTPTGAAGRPQLSLVPDSF
118472138YP_889694.1 PE family protein [Mycobacterium smegmatis str. MC2 155]MGRLLHSLSTAFLVFVAVVVLCVSTSMPTAAHLLLNHPHALVIGGTGTPV
118472137YP_887239.1 aldo/keto reductase [Mycobacterium smegmatis str. MC2 155]MTVAPLRTDRRRLGSGGPEVSAIGLGFMSFRAGSGPDDEKQAKDIVDAAI
118472136YP_887625.1 dapB gene product [Mycobacterium smegmatis str. MC2 155]MKVTYMSDIRAVVYGVGAMNSIVAGMLLDKGVQIVGAIARSPQKVGQDLG
118472135YP_887741.1 esterase [Mycobacterium smegmatis str. MC2 155]MVRTHTVAAGETLSGLALRFYGEADLYPLIATASGIPDPGVIAVGQRLIF
118472134YP_890391.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPSSRKAWLSAAAVLLDASAARRCADRGLPRRDRVLVIGCDEPGPADWQA
118472133YP_889066.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTATGSTVGGPTLKRGEKTIEINGGNVVYEMLGKEGDVIALTPGGRFSKD
118472132YP_890249.1 acetoacetyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTAPQWEPTQSDIDSARVTDFARYVESRTGVSAPDYQALWRWSVEDPGAF
118472131YP_890547.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MESVRVQLQGKRIKAYGRIVAAATESHPAFSASYDLVTDETGATKRLSLT
118472130YP_889614.1 ehuA gene product [Mycobacterium smegmatis str. MC2 155]MVRFENVVKRFGDKTVLDGMNFSVAPGERVTLIGPSGSGKTTILRLLMTL
118472129YP_889839.1 cytochrome bd ubiquinol oxidase subunit I [Mycobacterium smegmatis strMVFTETLLLLAADGEPPGLLPARQQMAFSLGWHIVLACFGVAFPTMIFVV
118472128YP_890356.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADADSWSELTDGAQDAAPTVRISASDLAQARRKRTRIKAEDDTVAVILD
118472127YP_884901.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MEVVGIDKEYPAATGPIQILRGLSLRADRGEFVSIVGPSGCGKSTLFNII
118472126YP_888423.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAYVISDIEIVDPAAFEEYKTLSPPSVAKYGGRFLARGGDLEILEGDWV
118472125YP_886560.1 fabG gene product [Mycobacterium smegmatis str. MC2 155]MLTGQTAVVTGGAQGLGLAIAKRFISEGARVVLGDLNSEATEAAVEELGG
118472124YP_884710.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MAAMETSTAPLDEPAGLTDADGFTPLRVKDVIRETTDAVSLILDVPELIE
118472123YP_884514.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MDTALRRAMDLLIDPPAEPDFSKGYLDLLGRGDSTAPKNTGLIQKAWASP
118472122YP_890261.1 2-hydroxy-6-ketonona-2-4-dienedioic acid hydrolase [Mycobacterium smegMVTATQEITFESTSRFADVQAGELAMRLHYHEAGDPSAQTIVLLHGGGPG
118472121YP_886855.1 peptidase M23B [Mycobacterium smegmatis str. MC2 155]MKWKVMRIMAAVVCAGLFWAVPADAETVRFRWPLDPRPAVTRAFDAPSPN
118472120YP_885498.1 O-succinylbenzoate synthase [Mycobacterium smegmatis str. MC2 155]MTNGVPALDDILERLHVVALPMRVRFRGITVRELALIDGPAGWGEFGAFV
118472119YP_889738.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MCQQCLRGCRTDTGGERGGGCDDGSGDRGSLCLLETVRGWLCHEALRLCV
118472118YP_888284.1 MmsAB operon regulatory protein [Mycobacterium smegmatis str. MC2 155]MDESTAAWIADGFVGQRMLAVPRPVVDHALGAPVTRRLLVTDAGFFPRAT
118472117YP_886469.1 chorismate mutase [Mycobacterium smegmatis str. MC2 155]MLASVALAALAGVGTPHATADDASPLVPLVDAAAQRLQTADPVAASKFRS
118472116YP_889011.1 antioxidant- AhpC/TSA family protein [Mycobacterium smegmatis str. MC2MPPTPRLQAGDTAPAFSLPDADGNTVSLSDYRGRKVIVYFYPAASTPGCT
118472115YP_888051.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MILFSAGPFSVSNSVRNPVRKMAEKACDYGWSGTGQYPFGDSAGRKAHVV
118472114YP_886798.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSWFPKVLAVAGTAAALVLGSTACADESAGPTSDTSTLSISATGVDSLPF
118472113YP_888952.1 HNH nuclease [Mycobacterium smegmatis str. MC2 155]MAVSRTRSARYARRRKRRLDAVVNDLTPAQWEAIKQAWGGCAYCGATGGP
118472112YP_890340.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTVAGYAVVAAAILLASCMQASIGFGMGMLAAPVVAIVDPALIPGTLIML
118472111YP_885084.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTPPEGLGLALFRPECIQDPYPLYRRMLDTAPVHPIADSGFYAVCGWDAV
118472110YP_887593.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIDGGGGVWPGQRGPPQVQPEWLWVNLRGFSRRSQAIPQRFNIFTMDSFV
118472109YP_886901.1 oxidoreductase- zinc-binding dehydrogenase [Mycobacterium smegmatis stMWSYRLVAPYVFERSDLRAPSPDALTDGQVLLSFSAAGICGSDIPGFRGT
118472108YP_886931.1 asnB gene product [Mycobacterium smegmatis str. MC2 155]MCGATGEVRLDGRTPDIGAVSAMAETMSSRGPDAAGVWSQGRVALGHRRL
118472107YP_885522.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MADKSGKTLRKPSLSLKERRAIKRAKAEESTPIIRKRKG
118472106YP_888794.1 binding-protein-dependent transporters inner membrane component [MycobMTIAGTRNGPTTAGEVSWQRRCAPPITAILIAIALWWSATSVLSGPESVL
118472105YP_888471.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDKRVISVVLEKQQVAVL
118472104YP_889273.1 flavin-containing monooxygenase FMO [Mycobacterium smegmatis str. MC2 MTQTTAAPLATLSPQERVDAWLADFESALAARDIERVVSKFAVDSFWRDL
118472103YP_889835.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNAVSADPVLNFEVYVLMTMRNRMTNKKDQLRATLSSHGFSVKDAERVHR
118472102YP_886502.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MWCRYPDQIESDLKIHCHGTDIRWWHRGDRDERGCLKLSSRLLLNLIRGL
118472101YP_886882.1 ribosomal RNA large subunit methyltransferase N [Mycobacterium smegmatMKQQLVFEAPRRAMPPQHLADLDETARAAAVTELGLPAFRAKQLANQYYG
118472100YP_887062.1 glutamate transport ATP-binding protein GluA [Mycobacterium smegmatis MGSPGEQPQVDGAAQSDVPMISLQGVNKHFGQLHVLKDINLDVGKGQVVV
118472099YP_885291.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTRWWPPVGLAAMVLLGGAVRHGTTPIDAWFGHLGRELGRPLRRAFLYFT
118472098YP_888651.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MSTLTDKPVVVITGAGSGIGAAIAALLRERGWAVASISREPAPDNDLWLI
118472097YP_887683.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPKHRMPATSGAQKPVKKILAGVLVMTGIGGAGLLSTPTNREAAVAVEQQ
118472096YP_887989.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIRELLVATAVAGAALATASAAAADDDSNMYFDEPGRYSTDVPGMSYEAH
118472095YP_891042.1 haloalkane dehalogenase [Mycobacterium smegmatis str. MC2 155]MPGSEPYGRLQYREINGKRMAYIDEARGDAIVFQHGNPSSSYLWRNVLPH
118472094YP_886659.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MIAAVATMMAVGCRGIGNAEKPDRTGRQQRNADVVRDAFARGVGDQNSFY
118472093YP_889921.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMKHLDARVASDLALAVIRFARQLRSQRSDSKVTLTQLSALSTLAKEGSMT
118472092YP_885408.1 transporter [Mycobacterium smegmatis str. MC2 155]MTVWDVVLLVFAGIAGGLTGSIAGLASVATYPALLVVGLPPVAANVTNTV
118472091YP_884773.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MNRFVVPSAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPASSVLNR
118472090YP_890540.1 bifunctional wax ester synthase/acyl-CoA diacylglycerol acyltransferasMNRMQLMSPTDSMFLIAESREHPMHVGGLALYDPPDDAGPEFVRELYEEM
118472089YP_884633.1 3-demethylubiquinone-9 3-methyltransferase [Mycobacterium smegmatis stMPVKINASIVPNLWFDREAEEAAEHYIAAFGGNGRILNKIAAHPDAPSPQ
118472088YP_889897.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTKPEIEFPDGPAPTELVITDLVVGDGPEAVAGANVEVHYVGVEYDTGE
118472087YP_890552.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVLHGRDVRLATADTELPADVKAVGLQRLGVDLGDDLRLREIGRADPDGL
118472086YP_885928.1 coenzyme B12-dependent glycerol dehydrogenase small subunit [MycobacteMSEPVLDPAVDYPLSLNRKDLLTTPNGKPIDAITMDAVMSGEVSASDLRI
118472085YP_884536.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MTSAANNGTSRREELLNVAAKLFAARGYHGTRMDDVAEAVGLNKATVYHY
118472084YP_885891.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMARHKEFDPDVALDTAMRVFWRSGYAHTSTEDLVTELGIARASLYGTYGS
118472083YP_884834.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MVATSRSERDAHHVSEGRGARCAFPVPFRQGGVEASRQAVSRIGKQLR
118472082YP_889054.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMSGPLEGIRILEVAMYGFVPSAGAVLGEWGADVIKVEHAVTGDPQRGLRQ
118472081YP_885007.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMRAHELVLERIERDLVAGAITVGDRLPPERALAESLSVSRASVREAIRVL
118472080YP_888450.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMSPSASAVAPARTGLVQASGISKHYAGVAALDDVSVTLEPGKIHALVGEN
118472079YP_887793.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSRLTTFLVAVALLVGVFVNVPTQRYVTSGLDPKIFHIAVIGDSYTTGAA
118472078YP_888499.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MPKHHRRGSSSRAEYEHSRFQYPDHSNAVAGRRLSAA
118472077YP_885232.1 immunogenic protein MPT63 [Mycobacterium smegmatis str. MC2 155]MKISQLTIAAAAALAISGAAGTAGMATAFAEAAQAAQVSANPLGSQARLE
118472076YP_890757.1 phosphoglycerate mutase [Mycobacterium smegmatis str. MC2 155]MTTHTRRTAAVAALVVALVAGMLTAPNAVAQRIITLTLVRHAQSEGNASG
118472075YP_890900.1 glutamine-binding periplasmic protein [Mycobacterium smegmatis str. MCMTETTTRAPLRLACLDAEAPPLFSLWTPENGRTGYEPGVAEALGAELGRP
118472074YP_885233.1 xth gene product [Mycobacterium smegmatis str. MC2 155]MRVATWNVNSIRARVDRVTDWLARADVDVLAMQETKCSDDKFPAMPFVEL
118472073YP_891137.1 rnpA gene product [Mycobacterium smegmatis str. MC2 155]MRRSAEFSVTVSRGVRAAQPDVVVHALRLESNAGNAGDDGDDGDANGPRI
118472072YP_889653.1 immunogenic protein MPT63 [Mycobacterium smegmatis str. MC2 155]MNALKITNLSTAVAAAAVAAAAILGTAPAAFGDASAVTTSTLGSAAKLNN
118472071YP_888746.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSDPSPRTSPSGLPHDIDHTHSDVSGGWLRAATFGAMDGLVSNTALIAGV
118472070YP_886039.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTTADITQTAPTDLGAKANRHLWGHFARHGDGITPPIITRGEGVKIFDDS
118472069YP_890345.1 peptide ABC transporter substrate-binding protein [Mycobacterium smegmMRRAPHPLALIAGLAIITSGAAAGCTVANTAHGGYDPDTLRIVLPQEPPT
118472068YP_886407.1 GlcNAc-PI de-N-acetylase [Mycobacterium smegmatis str. MC2 155]MDEEPFPTDWQTALVLVPHPDDPEYGIGAAVAKWTATGRTVHYALASRGE
118472067YP_889632.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MISPSRSGGRKRRQHVRVGLPGADGGDLRAARPGAEAGRSPVIENVVGLI
118472066YP_885977.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSAIDDVTATLAEAAFGDDPGRWPLPSASTPHERWLRAVAAGGQGRYNCA
118472065YP_888522.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MRYFYDTEFIDDGRTIDLISIGVAAEDGREYYAISTEFNPDRAGRWVRKH
118472064YP_885226.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MVETASPPLTELPLAPRNTLPCREQIRCLRSFIDGMQRLRDVGGPVTRIV
118472063YP_890569.1 serine esterase- cutinase [Mycobacterium smegmatis str. MC2 155]MFKSTLSRFIPAVSAALLTAGLVPGTAGTANAEPPIEGAAPPCPDVEVVF
118472062YP_885826.1 rplP gene product [Mycobacterium smegmatis str. MC2 155]MLIPRKVKHRKQHHPEQRGIASGGTSVSFGDYGIQALEHAYITNRQIESA
118472061YP_886986.1 truB gene product [Mycobacterium smegmatis str. MC2 155]MSGQARSGAEPGLVIVDKPAGMTSHDVVGRCRRLFGTRKVGHAGTLDPMA
118472060YP_889020.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MAAGQGLTDRARLAFLLTPPLAWLVVAYLGSLAVLLVSAFWQTNEFTGAV
118472059YP_887975.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MVTEQRDPVTTRRARVAVAALFLTNGAIFANLLPRYPEIKTDLQLSNATY
118472058YP_885538.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MKIRGALIGLSLFMVVALTLTWMVYVTLRRDVAGRTVPYTAVFTDVFGLR
118472057YP_885581.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MTDPRYDASETVAVATTAAPSVARSPRVGYVPTRTNRVRDGVAVVLLVLA
118472056YP_885589.1 LuxR family transcriptional regulator [Mycobacterium smegmatis str. MCMTAMPVDRPLPRPELAPREKEVLLAWIRTDSKDGVARQLHIAPTTVRTHL
118472055YP_889299.1 kgd gene product [Mycobacterium smegmatis str. MC2 155]MSSSPSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTTDSAS
118472054YP_887405.1 ribose transporter permease RbsC [Mycobacterium smegmatis str. MC2 155MTDLIEETPSTSTATGSGRTRRQNIIVRFNLLFIFIALFAVASVTAPQFL
118472053YP_885785.1 rpsG gene product [Mycobacterium smegmatis str. MC2 155]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQA
118472052YP_888135.1 lipid-transfer protein [Mycobacterium smegmatis str. MC2 155]MSAPEPVYILGAGMHPWGKWGRDFTEYGVVAARAALAEAGLDWRQIQLVA
118472051YP_886071.1 phosphoglucomutase/phosphomannomutase [Mycobacterium smegmatis str. MCMTSTATTAQEWIAHDPDPETAAELSACSPEELEHRFSHPLTFGTAGLRGP
118472050YP_889739.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MAHKRTMEAEVALTASVPGLPNIPGLEDLDLSGIPKLGGAYAVGPVFWAA
118472049YP_889621.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
118472048YP_888245.1 alkylhydroperoxidase [Mycobacterium smegmatis str. MC2 155]MRSLTAWRCYRRVEMAALHITEYVTNISTAILPDAIRTEINYALSPRQIA
118472047YP_890584.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMTSRANSGARDLELHTVITPGSRTAREDLVTALRDGIRSGRLGTGTVLPP
118472046YP_885426.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MSLAENVQFGIFTPPHQVDYADLLRVWTEADEIPEIAHAWLFDHLIPIAG
118472045YP_890718.1 NfnB protein [Mycobacterium smegmatis str. MC2 155]MSVPTLPTGPTVDLAQAAERLIKGRRAVRAFRPDEVPEETMRAVFELAGH
118472044YP_884707.1 hypothetical protein [Mycobacterium smegmatis str. MC2 155]MARLPSAFAELEPYAETWCLATETARWERRVSSSMPQLHDFYDAFFPRLE
118472043YP_890213.1 two-component regulator [Mycobacterium smegmatis str. MC2 155]MEELSGISVDAESGRMGTVADGDQQFGGPAADVAESVCQYMPGSGRRPAN
118472042YP_887734.1 SAM-dependent methyltransferase [Mycobacterium smegmatis str. MC2 155]MVEQSLWMQKVAADPGHSQWYIERFRSLARAGEDLFGEARLVDAMAPRNA