Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_smegmatis_str_MC2_155
Gene IDProtein IDProtein DetailsSequence
320154520YP_004191801.1 6-phosphofructokinase- partial [Mycobacterium smegmatis str. MC2 15MRIGVLTGGGDCPGLNAVIRAVVRTCDQRYGSSVVGFLDGWRGLLEDRRI
QLANDDRNDRLLAKGGTILGTARVNPEKLRNGLDQIKQTLEDNGIDVLIP
IGGEGTLTAAHWLSEENVPVVGVPKTIDNDIDCTDVTFGHDTALTVATEA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGIASGAHMTLIPEQPFDVE
EVCRLVKQRFVRGDSHFICVVAEGAKPAEGSMRLREGGIDEFGHERFTGV
AQQLALEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGMNGVAARPGDRPRAAGRRGAPAQAGAAVPLRRRRGILRL
161598319YP_890167.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium smegmatis str. MC2 MTGQEYDVVVVGSGAAGMVAALTAAHQGLSTVVVEKAPHYGGSTARSGGG
VWIPNNEILKRDGVKDTPDEARKYLHAIIGDVVPAEKIDTYLDRGPEMLS
FVLKHSPLKLCWVPGYSDYYPETPGGKPTGRSVEPKPFDANKLGPDLKGL
EPPYGKVPMNMVVMQQDYVRLNQLKRHPRGVLRSLKVGIRATWGKVSGKN
LVGMGRALIAPLRIGLREAGVPVLLNTALTDLYVEDGRVLGIYVRDTTAG
DDAEPRLIRARHGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAVANTGD
GIVAAEKLGAALELMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNMSGK
RFMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLIFDQQYRDRYIFAGL
QPGQRIPSKWLESGVIVKADTLVELAEKTGLPADQFTSTIERFNGFARSG
VDEDFHRGESAYDRYYGDPTNKPNPNLGEIKHGPFYAAKMVPGDLGTKGG
IRTDVRGRALRDDDSVIEGLYAAGNVSSPVMGHTYPGPGGTIGPAMTFGY
LAALDIAATAAASRKG
161598320YP_885251.2 monovalent cation/H+ antiporter subunit A [Mycobacterium smegmatis strMLAVLLAHAVATALAPLMVARWGRMAFFPLSLVPLGSLVWVALNWPSPDN
IPTVHVSWVPELWMDFTLRFDALAAIMSVLVLAIGALVLFYCAHYFHHHD
GRMEKRLPSFAAELVAFSGAMFGLVVSDNMLVLYIFWETTTVLSFLLVGH
YAERATSRRAATQALLVTTFGGLAMLTGIVVLGNMAGTYLLSELIAAPPT
GTAASVGIALILIGALSKSAIVPMHFWLPGAMAAPTPVSAYLHAAAMVKA
GVYLIARMTPGFADTAFWRPMVIGLGLLTMLLAGWRAVREYDLKLILAFG
TVSQLGLITVMVGAGGPDMMLAGLAMLIAHAMFKASLFMVVGVIDHATGT
RDIRRLAGLGRAHRPLLIIALGAVASMAALPPFFGFVAKEADLETVLHSP
ALGTAAPYVLTGIVVGSVFTTIYSLRFLWGAFAGKGLSGPSVRVAEMHRP
PVNFLLAPAILSAAGLVFGLWPKGLDAVLEDYADTVPGGSTYHLALWHGV
GLPLLLSIVVLATGFTVFLVRHRLPKAKSGFLPLGNADRIYDAVIRGLDV
VSLRLTASTQRGSLPATQSVILLTLVLFPTAALVLGAHNRPDLQLWDSPL
QVVVGLLMLAAALGATVMRNRLAAVLLVGVTGYGCGAIFAFHGAPDLALT
QFLVETLVLVIFVLVLRTLPAEADAANINKNRLPRALLALSVGAAVTTLT
VYAMAARTGPGVAVLLPDAAYYRGHGSNTVNVLLVDIRAWDTMGEVMVLL
VAATGVASLVFRHRRFGAAPRVSTAVGQPDIGPVAAYSPAAGDVTWLRGS
ELRDPRHRSLILEVATRLIFPLIMVLSAYFFFAGHNTPGGGFAGGLVAGL
ALVLRYLAGGRYELGETLPLDAGKILGTGLGLSAGTAVASLLLGAPALSS
AVVQLDVPVIGPIKFVTALFFDLGVYLIVVGLVLDVLRSLGARVDVELAE
SGQPQKAAA
118474056YP_886026.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MNSSTHTDVVIVGAGPNGLLLAGELALAGVRPVVLERLPQPSPELKANGI
VGQVHRILDMRGLYQLLTGSSAPPQPLDGYIFAGMRVPFTGVDDNPMYGM
FIKQPQVVRQLADWVRDLGVEIRWGHGLADMAPRPDGVTLNVTSPTGNHR
LHATYLVGADGGRSTVRKAMGVGFPGVTSPVVARVAHVSIPDRLRGSGAL
EVPGFGRIPFGHNRFDHGVFMYMEFEPGRPLVGTLEYGALLPADAPAVTV
DELRDSVTRILGVEVPIGPPSGPGPHALRRINGQNTRQAEQYRVGNVFLI
GDAAHVHSAVGGPGLNLGMQDATNLGWKLAAAVHGWAPSGLLDTYHGERH
PAGERVLMQSMAQTALLAGGPEVGALRTLFGELLATTDGAEHIAHVLAGA
DVRYDVGDGHPLSGRLVPEVVFDDGRRLADLMRAARPVLLDLDGGAYAAA
AIDWRDRVDVITAAAAERPAPALLIRPDGYLAWAATGSGADEHQRMRRAL
GRWFGEAHAGLAHA
118474054YP_889326.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MITGAGALVRLALRRDRVRLAVWIAVLTSTMVYAPNTIRMTYPDEAQRQS
RVELLKTPAGMMLGGPMFGVNETDLGAMMANELMLTLMVAASILSILTVI
RHTRAEEESGAAELVLSSVVGRHARTTAALVLVAGVNVVLAVAMTLAMTV
SGFAPADSAAMCFGVSGVAMVFGALAALTAQMWRQARAATGAAMAALGVA
ALIRGVGDVIDNSGSILSWFSPIAWAQQMRPFVALRCWPFALLVLLAVAL
IALAAVAEARRQYDDGTIPATGDRPDAAPITGVLGLHLRLHRGQTIAWGA
GLFVAGLAFGSMTKSLMDAAQTNELIAQVLAAQGPDGAYTTMTQFLAAAA
AAYTVSGVLRLYDDEQNGRAEAVLAGPVSRWRWLLGATVAAVLGSAVVLL
CAGVGNGLGAGLTLGDLPTVGRLALAALAYLPALAVMAAVATLAVALRTP
WIAWLAVAFVIVALYLGALLRLPRWLLDLSPVGRTTAPMDYPVTALFVMA
VVAVLLACAAGGLYRRRDAV
118474052YP_889617.1 glutamate--ammonia ligase [Mycobacterium smegmatis str. MC2 155]MGSSFIAANGLWTQHQEEAAAKLVAQLDDLNLRQVRISWGDQHGILRGET
LEVDAFRSALKEGKDFQTATLIFDSTNNPVVPPFEADGFGDKRLTGLPDA
VLVPDPTTFRVLPWADRTGWVLSEMYYRSGERVPFDTRGVLKTQLAKLEA
EGFSFTTGAELEFYITRLVDPKLSFVDSGWPPAAPEVTALSHGYQYLTEN
RGDEIDHILSILRDHIVALGMPLATVEDEWGPGQVEMSFDPLVGVETADN
VLLIRSAIKQICRRHGYHATFMSRPAFPNIVSSGWHLHQSLGAAGQANIF
PGEDGKLLSDTAMHYMAGLLEHAKASSVLTTPTINGYKRYIANSFAPDRI
AWAEENRGAMIRISGARGDNSTHLENRIGEPAANPYLYMASQLIGGRDGI
ARKLEPGPSADEAYTADVPLLPATLEEAVGHFESSAVMRRELGDMFVDYL
TTVKKNEISRFNAYVTDWEQREYFEVF
118474050YP_889098.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MLTLKAAGLVDVDTGELIRPGVVRVEGDRIVGIGGPAEGEVIDLGDAILL
PGLMDMEVNLLMGGRGENPGLSQVQDDPPTRVLRAVGNARRTLRAGFTTV
RNLGLFVKTGGYLLDVALGKAIDAGWIDGPRVIPAGHAITPTGGHLDPTM
FAAFMPGVLELTVEEGIANGVDEIRKAVRYQIKHGAQLIKVCCSGGVMSL
TGEAGAQHYSDEELRVIVDEAHRRGLRVAAHTHGAEAVKHAIDCGIDCIE
HGFLMDDEAIEMMVAHDRFLVSTRRLAEYMDVSKAPPELQAKAAEMFPKA
RTSIKAAYEAGVKIAIGTDAPAIPHGRNADELVTLVQWGLPPAAVLKAAT
VTAAELINVTDRGRLAEGLLADIIAVPGNPLEDISVTQNVDFVMKGGKVF
RNDKAN
118474048YP_890769.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTATLDYDGDIAVLDLGDDENRFTPQFLDEVDALLDAVLEKGAHGLVTTA
DSKFYSNGLDLEWLGAHSDQGAWYVGRVQGLLARVLTFPLPTAAAVVGHA
FGAGAMLAMAHDYRVMREDRGFFCFPEVDIHIPFTPGMAALIQAKLTPQA
AIASMTTGRRFGGSEAHEHGIVDATAHEGAVTLAATSLLRPLGSKDQGTL
GAIKQVMFGAAAAALRNP
118474046YP_889622.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
MYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRA
YFVTGFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVE
DVFDDPPPAAVCLTGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGL
GAQEMRDWLPRGWHPDRFSVAETNDALAALNTR
118474044YP_888899.1 hypothetical protein MSMEG_4636 [Mycobacterium smegmatis str. MC2 155]MFSPIDSYDDASVVFTFGGYSVGVWVFFLLSLALFVGFFVRMIQHENRAY
KAIIEHKPVEPGPAAEGEPTPY
118474042YP_886510.1 trans-2-enoyl-CoA reductase [Mycobacterium smegmatis str. MC2 155]MKQLILTKFGDPEDTVRLVDTPEPVAGPGKVLVRLEAAAINPSDLLLLKG
KYLVHPELPAGVGAEGVGIVEAVGPEVDSNLVGKRVIVLPTYTYGTWSEK
VVAAAHDVIEVPDADPQQLAMLSINPPTAHLLLDRFVNLQVGDWVGQTAA
NSAVGRYVTTLARRRGLKTLNIVRREDAVEDVRAAGGDVVVVSGPNLADD
IKQALGGDRLSLVIDPLGGSAASDLIGALEFGGTAVAYASLTGTPMSVSS
ADLFGREVRLTGFWLGNWYASEPRHEIVDTLDYLARLIAEGVLHAPVEAT
YHLDDYLKAFTHARTAKRGGKILFTFE
118474040YP_891139.1 chromosomal replication initiation protein [Mycobacterium smegmatis stMTADPDPPFVAVWNSVVAELNGDVNGDRQGDPSLPVLTPQQRAWLKLVKP
LVIAEGFALLSVPTPFVQNEIERHLREPIVTALSRKLGQRVELGVRIATP
TDEPEDAPDSFADSPAPASVPAGPADADEIDDDRDARVNAQESWPKYFSR
PEPDTSSDDSNAVNLNRRYTFDTFVIGASNRFAHAATLAIAEAPARAYNP
LFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDD
RKASFKRSYRDIDILLVDDIQFIEGKEGIQEEFFHTFNTLHNSNKQIVIS
SDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDV
PDDVLELIASSIERNIRELEGALIRVTAFASLNKTRIDRSLAEVVLRDLI
ADATTMQISTAAIMAVTAEYFETTVEELRGPGKTRALAQSRQIAMYLCRE
LTDLSLPKIGQAFGRDHTTVMYAEKKIRGEMAERREVFDHVKELTTRIRQ
RAKR
118474038YP_885273.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTAPQATPALAGRAVPRVDGRLKVTGQARYAADAEVPDALFAVLVGATVA
RGAVDAVHTDAARRAPEVVDVITDFDGLTLKYDPQQVCAFGQAVAVVVAT
TLEAATHAASLVAVRYSTQPQLTDMDAPDASDQNPTPTRDYSRGDADAAL
RGSAVVTDLRCSMERNNHNPMEINAVVARWEGDRLTVWDKVQSVSGARQQ
YADALGVPAENVRVISPFVGGAFGNAGQVWPHQAIAAHVARRVGRPVKLM
LTRRHLYAVTGYRPRNRQRLAIGADRSGRITAIVHEGAVEVSRYSPYVDN
VTGAASYMYQAPNMRSALRTVELDVHPGNQMRGPGHLSGNFALESAMDDL
AHRLAMDPIELRVRNEPTRDQTDNLPFSSRRLTECLRSGATAFGWSRRNP
VPRSVREGRQLIGLGVSAASFVTLVSPCAASARVRNDGTVEILCGASDIG
PGTYTAMSQVGADALGVALHRVRFQLGDSALPVAPAQTGSRLMASAGSSI
HNVGMMLRDRFVRMAVTDPGSPLHGLAPADVEVADGRMAARGEPARGERY
EELLRRRRLDELSAELEWTPDGPHDRFSMHSFGAVFAEVAVDEALGTVRV
RRMFASYDAGRIVNPMLAHSQAIGGMVMGIGAALLEATHLDHRDGRIVNA
NMSDYLVPVNADVPDLDAEFLPGEDLIADPIGVKGIGELVVVGIPAAVAN
AVFNATGRRVTDLPITLDKLM
118474036YP_889981.1 hypothetical protein MSMEG_5748 [Mycobacterium smegmatis str. MC2 155]MDFSFHPPTRPDAQWRPGLVGGTFADRGLCGCSMNRGLLRFHDADSAPAA
QVAVDAMCGARGLAAEVFAFDWLARQFAVTTRLTVEGASDSSQTLRTVVV
LDPFDGSVTPWVDVESFEGALSVPIAHDFLLPDLFREWMEAAGIDQLAFD
SCAGATVPGFYGGKREVGNLTLDSVEVYLSFAQQLWEHGQKNGPGSPPPH
LVAAKRQSKGDRP
118474034YP_887354.1 hypothetical protein MSMEG_3038 [Mycobacterium smegmatis str. MC2 155]MTEAREQALRVLPLPYSLALRLRDAGVAPDVVSEYLSIDESALEGFYRIA
EQKLAAALPAPGTGPVASDDRTGGRSGQV
118474032YP_889618.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMPMTGQFGRVDRRPLYEQVADRLREFIDTSGMQPGDKLANVRDLAAELQV
GRSSIREAVNALRAQRIVEVRHGDGIYLLQRPEDVIESLATELVETHVDH
PYIWETRQALETQCARLAAVHATDDDLRELDASLDQMRAEVEKGLPGLEG
DRRFHLGVAVAAHNPLLLRLLKGLRVALDRTSETSLTRPGQPARSLEEHR
GVVEAIRAGDAADAANKMLAHLVGTTDELVRR
118474030YP_885083.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium smegmatis str. MC2 1MVLWGALAAVGISAGVGLAPVDINLAAVNQSYRTAIASVEPAPGAVVGIG
HPIVVTFTTPVTDRRMAERAIGIKTHPEVNGSFEWAEDNVVQWVPDDYWP
AHSTVALSVGNIPLQFKTGPAVVAVADISDKTFVVTIDGVPAGPPEQAPE
PPPEQASEPNPEVPVRVNAAQDDPRMPEVMVRVPAKNAAPEPPEPEEPEA
LAIPGMTPTPDIPPGPPLPSPHHRLHWGKPGVLPATMGRPEYPTPVGKYT
VLAKEGSVTMDSSSVGIPVDAPDGYLIDVDHAVRFTRRGLFVHPAPWAEN
SIGYENVSHGCIGLSVTDAEWYFDAVNVGDPIIVQE
118474028YP_889238.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MTELAVDPETPVEQRFRFASRPNAAQVARAAGVPVLDVVVPVFNEQAALA
HSVRRLHGYLQENFALPTRITIADNASTDATPQIAARLAEELPGVRVVRL
EEKGRGRALHAVWSTSDAPVLAYMDVDLSTDLAALAPLVAPLISGHSDLA
IGTRLGRGSRVIRGAKREFISRCYNLILKSTLAAKFSDAQCGFKAIRADV
AKSLLPHVVDTGWFFDTELLVLAERSGLRIHEVPVDWVDDPDSRVDIVAT
AAADLKGIGRLLRGFANGSIPVNTIAAQLGSTRRTAPPGSLLRQVVRFGA
IGVVSTLAYLLLFSLMRAGLGAQAANLIALLLTAIGNTAANRRFTFGIAG
TGNVARHHLEGLTVFGIALTITSGSLYLLHVMTPQPHRAVELGVLVAANL
IATVVRFVLLRGWVFHPARTRRPSQAPSQIED
118474026YP_889137.1 methylmalonyl-CoA mutase- N-terminus of large subunit [Mycobacterium sMSEQAQPRVETPSGIPLAPVYGPQDRSGEPPPPGTYPFTRGNFASGYRGK
TWTFRQYSGFGTAEESNRRYRYLLDQGGTGLSVALDLPTQCGYDSDDDEY
GEEVGRVGVAVDTLADAEILFDGIPLEAISTSFTINGTAAILLAFYVAAA
EKKGVPREKLTGTIQNDILKEYASRGTWIWPPEPSLRLIADTIEFCAAEV
PKFNAISVAGAHFRDAGANAVQEMAFTLADGVTYCDTVIERGRMTIDKFA
PQISFFFYTHGDFFEEIAKYRAGRRRWATIVRERYGATTDKASMFRFGCV
SGGASLYAPQAQNNLVRVAYEALASVLGGVQSMFTAAWDEPFALPSEESA
TLALRTQQILAYETGVAKVADPLGGSYFVEALTDATEAKIVEIMSDLEAH
GGMVACIEDGYLQGLIADEAYKLHQEIESGERPVVGVNRFVVDEPPPEIA
TYELDAEGRDLQLKRLSKVKAERDSAQVKATLAALSAAAEGDDNLMHKLI
DCANAYCTVGEMVSALKAVWGEFQQPVVF
118474024YP_889923.1 hypothetical protein MSMEG_5690 [Mycobacterium smegmatis str. MC2 155]MAAPLLQAQIDIDAPVERVWSLISDLRRMPEWSPQCRLMKTIGPLRPGAL
TVNLNRRNFMFWPTTCHILEVIPQQKLAFRVDLNKTVWAYELEPTETGTR
VTESRHAENGTTAVSNAVITAFFGGVPNFEGELIEGMNQSLARIKAAAER
118474022YP_887604.1 hypothetical protein MSMEG_3293 [Mycobacterium smegmatis str. MC2 155]MENSRNTFAIDARDLCGRSRRPRDVDFRYGFFLVCAPVSPSSADTGDETS
TRQAIFV
118474020YP_888358.1 CoA-binding protein [Mycobacterium smegmatis str. MC2 155]MTTRDLTALFDPKSVAVLGASNDETKYGNWMSVQALRMTGTRPVYLINRR
GDSVLGQPPLRSLAEVDGAVDLVAITVPAHSFEAAVEDALAAGARAIVGV
TAGFAELGPEGRALQDRVVDRVRSAGAVLLGPNCLGVIDSTTNLTFASNP
LPGGRVALLSQSGNMALEVSGFLQSRGHGFSRFASLGNQADLGVADLIDS
CVAHNGTDLIALYCEDFGDGRSFVSAAAAAAAANKPVLLLTVGGSEASVR
GAQSHTGALTSDSAVIDAACHAAGIYRVTSPRQLADVAATLLTYGRRRVH
RVAVIADGGGHAGVGSDVVEANGLSVPRFPTALSTALRPLLPPSAGVTNP
VDIAGGGEQDIGCFASVLDAVMSSAEIDSVLLTGYFGGYAEYGEGLARDE
LDVAARIATIAQTHQKPLVVHTMHSASKAARVLIDAGVPVFAAVDDAAGA
LAVIDRGTDPRPLPSLPGTAEKPLSSTDYWDARELFRAAGVTFPEAKLVS
DAAQARAAAESLGYPVVVKAMGLLHKSDVGGVALGLSDPHAVAEAVEGMR
HRLNPPGFCVEAMADLNSGVEIIVGVQRDPRFGPVAMVGLGGVYTEVLAD
VAFALAPVDSGAARALLESLRASALFTGLRGRAPVDLDAAARAIAAITEV
AVTHPEITELEINPLLLTPDHALGLDARIVLDNQPTH
118474018YP_885801.1 RNA polymerase ECF-type sigma factor [Mycobacterium smegmatis str. MC2MSAETDAPRALLRLYDEALPVVYGYFVRRCGDRGTAEDLTSETFLAAMDA
ARKPSPPPMTVPWLIGVARHKLADHYRRRHDRFSVPVAELPEPDDPADNW
DAAVDRIVAEAVLARLPEQHRTVLALRYMDDCSVPECAELIGRTVHATEA
LLVRARKAFRAQYPRDSQSEGGAP
118474016YP_886974.1 oxidoreductase- Gfo/Idh/MocA family protein [Mycobacterium smegmatis sMESAFRSADIANAPTACSAVQVNRPRLPASPADQIRHLSMTTRTLRIAMN
GVTGRMGYRQHLLRSILPLRESGLTADDGSRVAVEPILVGRSADKLADMA
AEHGIEHWTTDVASVIADPSVEVYFDAQVTSRRFEALTAAIKAGKHVYTE
KPTAETLTEAVELARMAQNAGITAGVVHDKLYLPGLVKLRRLVDEGFFGR
ILSMRGEFGYWVFEGDGQPAQRPSWNYRAQDGGGITVDMFCHWNYVMEGI
LGKVETVTAKAVTHIPTRWDEAHQPYPVTADDAVYGIFDISGGIVAQINS
SWAVRVFRDELVEFQVDGTHGSAVAGLRRCRAQHRVHTPKPVWNPDLPAT
EQFRDQWLEVPDNAVLDNGFKLQWEEYLRDVLAARPHRYDLLSAARGVQL
AELGLKSSTEGRRLDVPEIVL
118474014YP_888834.1 hypothetical protein MSMEG_4564 [Mycobacterium smegmatis str. MC2 155]MRIADVLKNKGTAVVTISPQATVTELLAGLAEMNIGAMVVMGKSGLEGIV
SERDVVRQLHKRGSSLLAQPVSSIMTSVVATCTPRDTVDRLNVLMTQNRV
RHIPVLDDGRLAGIVSIGDVVKTRMEELETEQQQLQAYITQGR
118474012YP_887099.1 OB-fold nucleic acid binding domain-containing protein [Mycobacterium MATAERYLRRLTRRLTEDPEQLDVEELSEEAAITGAQKAIDCQRGQEVTM
VGTLRSVECNTKACSGGVKAELFDGTDTVVLVWLGQRRIPGIEQGRTLRV
HGRVGKLENGAKAIYNPHYEIQK
118474010YP_890084.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSGVKLGYIGLGNQGAPMAKRLADWPGGLTVFDVRAEAMAPLVELGAEAA
DSVAAVATADVISVTVLNDAQVRDVVGQLAEHAKPGTVVAIHSTIEPGTA
PELAEQLRPKGIHIVDAPVSGGAGAADKGELAVMVGADDDAYAAVKPVFK
KWASLVVRAGEPGAGTRMKLARNMLTFIGFAASCEAMKLAEAAGIDLQKL
GRVVRHSDAQSGGPGAIIVRDDTKPLTPDHWLYDMFVHTRGLAEKDLTLA
LGLGESVGVELPLAHIALERLADGLGVPHSKEQE
118474008YP_890623.1 Rieske 2Fe-2S family protein [Mycobacterium smegmatis str. MC2 155]MQVTSVGHAGFLIESRAGSILCDPWVNPAYFASWFPFPDNSQLDWDALGD
VDYLYVSHLHKDHFDPEHLRRYVNKDAVVLLPDYPVPDLRRELEKLGFHN
FFETTDSVKHTVSGPKGDLDVMIIALRAPADGPIGDSGLVVSDRVTTVFN
MNDARPVDLDVLHTDFGQIDVHMLQYSGAIWYPMVYDMPARAKEAFGIQK
RQRQMDRCRQYIAQVGATWVVPSAGPPCFLDPELRDLNDDHGDPANIFPD
QMVFLEQLRIHGHDGGLLMIPGSTADFTGSTLNSLTHPVDDPESIFTTGK
AAYIEDYAQRMAPVLAAEKARWAPSAGEPMLEALRALFEPIMTQTDQICD
GIGYPVELRLTGRDHNETVVLDFPKRVVREPIPDEKFRYGFEIPAALVRT
VLRDEEPDWVNTIFLSTRFRAWRVGGYNEYLYTFFKCLTDERIAYADGWF
AEAHDDSSSITLDGFQIQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWNL
ENGRCLTTKGHELRCQKL
118474006YP_889974.1 hypothetical protein MSMEG_5741 [Mycobacterium smegmatis str. MC2 155]MSQLFGGEMGRGDAITRDETGIRRLIGTVAIAMALICGALVQQTPVASAA
PPVAAKDFTKPAIVILGYGLKPDGTMRQILYHRTLTGLVIAQAFPQSPVI
VTGGNPQRGVTEAAAMRNLLLMLGFPANRIIVEDRANSTVQNAQFSVPLA
KKAGTTGIILVTSSSHQGRADQNFADAGGNILATVSFPDSNPTVNISQFV
RDVLSPLTPIG
118474004YP_884875.1 MmpS4 protein [Mycobacterium smegmatis str. MC2 155]MGYAVYRVMKRFWIPLLLVVVVAVGAYAIVRIREAAGAHAPTVAEGTALT
ENFNPKHITYEVTGAGGSANLNYLDENGQPHLVENAPLPWSFTIVTTLPS
MSANIMAQGDRNVSGLRCRVTVDGEIRDDRASDDLVEPFIYCLVKSV
118474002YP_890025.1 hypothetical protein MSMEG_5797 [Mycobacterium smegmatis str. MC2 155]MGRGRAKAKQTKVARELKYSSPQTDFERLQRELSGGSASDGVNDADDDWA
AEDDWRR
118474000YP_886753.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MPKSGTRPTSDRVREAVFNALAARLDFAGLAVLDLYAGSGALGLEAISRG
ASSALFVESDQRAAAVIAKNIAALDVAGATVRRGTAESVLAAGTTRPVDL
VLADPPYDVDARTVDALVVALADGGWVRAGTVVMVERRFNSDLVTWPDGW
TALSARRYGDTRVELAEVG
118473998YP_889090.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMPKDTPEKSGPLAGFTVVALEQAVSAPMCTRVLADFGARVIKVENPKGGD
FARDYDDVVLGPGGLAAHFVWANRGKESITLDLKTPGGMDVLHKLLDTAD
ALVSNLAPGAMARMGLAPADLAERHPQVIPVEIDGYGSGGPLSHKRAYDL
LVQAESGACAVTGHPDMPAKPGPPVADISTGLYAALSIMALLIGRLRRPE
NGAAPAVAVSLFDTMTDIMGYPLTYTQHSGVDQQPLGMSSPAVAPYGAFS
TRDGQTVVLGTTNDREWQRLAREIIDRPDLADDPRFATNSDRCAHRDVLN
EAIGTWCAQHDLAEIQQIADEAGIGNSRFNRPSEVIAHQHLKDRDRWRQV
ATPKGEIAALLPPPVIAGYEMPMGAVPGLGEHTDHILADIGLSAEEIASL
REQGAVGPAMQTRSEQSHA
118473996YP_886138.1 hypothetical protein MSMEG_1766 [Mycobacterium smegmatis str. MC2 155]MMAICATCGNDYDKAFTVSWEGHTEAFDSIECAAAHVAPECAHCGCRILG
HGLEAAGTMFCCAHCARKAGHSELVDREAVG
118473994YP_888045.1 CTP synthetase [Mycobacterium smegmatis str. MC2 155]MPALRKHPQTATKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKL
DPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRNLSGSANVT
TGQVYSSVIAKERRGEYLGDTVQVIPHITDEIKSRILAMAEPDAAGVRPD
VVITEVGGTVGDIESLPFLEAARQVRHEVGRENCFFLHVSLVPYLAPSGE
LKTKPTQHSVAALRSIGITPDALILRCDRDVPEPLKNKIALMCDVDVDGV
ISTPDAPSIYDIPKVLHREELDAYVVRRLNLPFRDVDWTEWDDLLRRVHE
PQETVRIALVGKYIDLSDAYLSVAEALRAGGFKHRAKVEMRWVASDDCET
EHGAAAALSDVHGVLIPGGFGIRGIEGKIGAISYARKRGLPVLGLCLGLQ
CIVIEAARSVGITEANSAEFDPKTPDPVISTMADQRDAVAGEADLGGTMR
LGAYPAVLTPNSVVAQAYQSTEVSERHRHRFEVNNAYRDRIAKSGLRFSG
TSPDGHLVEFVEYDPQIHPFLVGTQAHPELKSRPTRPHPLFAAFIGAAID
YKAAERLPGMDLPEQFVPVEHSDADAPALEEPLEKSDVRG
118473992YP_887747.1 hypothetical protein MSMEG_3443 [Mycobacterium smegmatis str. MC2 155]MAKDSKDDAATGAGDKTDPADNPPPGPTDHGREGGMATREVTPELVESDD
ED
118473990YP_890739.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MAEFDAVTAFADAPAAVLSTLNADGAPHLVPVVFAVHVPHVEGQPARIYT
AVDAKRKTTRNLRRLANIDRDSRVSLLVDHYSDDWTQLWWVRADGVATTH
HSGDEVATGYALLRAKYHQYERVSLDGPVISVEVSRWASWQA
118473988YP_888903.1 salicylate hydroxylase [Mycobacterium smegmatis str. MC2 155]MAASFLVVGAGITGLATAAALQRRGHDVCVAEARADTASGAGISIWPNAL
AALDAIGLGDPVRAAGGRVTAGALRWHDGTWLRHPAAERITRALGEPLVV
IRRRVLTEILSGALAPGTVVHGLEAHTVETCASGIRVTFSDGSVREASAV
VGADGVDSVVARHLNGPLRRRYAGYTAWRGIAAHPLDPELSGETMGAGVE
VGHVPLGADHTYWFATERASQGQRSPDGELTHLRRLFGSWAEPIPQLLAA
TDPADVLRNDLYDREPARCWARGPVVLAGDAAHPMRPHLGQGGCQGLEDA
ATLAALVAREPDLPTAFARFATLRRRRVTRMVRTSRMIGRIVNLRPAVLS
AAASRATVLVPEAVLTRQLASIAARSAFTPVD
118473986YP_887928.1 urease subunit alpha [Mycobacterium smegmatis str. MC2 155]MTALSRSNYAALFGPTTGDRIRLADTDLLIEITEDRSGGPELAGDEAVFG
GGKVLRESMGQGRATRADGAPDTVITGAVILDHWGIIKADIGIRDGRIVA
IGKAGNPDIMSGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHLICPQIM
DEALGGGITTIIGGGTGPAEGTKATTVTPGAWHLARMLESLDSWPMNIVL
LGKGNTVSADSMWEQLRGGAAGFKLHEDWGTTPAAIDACLTVCDAAGVQA
AIHTDTLNEMGFVEDTLAAIGGRSIHAYHTEGAGGGHAPDIITVAGHPNV
LPSSTNPTRPHTVNTLDEHLDMLMVCHHLKPSVPEDLAFAESRIRPSTIA
AEDLLHDIGAISMIGSDAQAMGRIGEVVMRTWQTAHVMKRRRGALEGDGS
GKNGADNLRARRYVAKYTICPAVAHGLDHEIGSVEVGKLADLVLWEPAFF
GVRPHAVIKGGMIAWAAMGDANASIPTPQPVLPRPMFGAAPAAAAATSVH
FVAPQAIEDGLAERIDVRRKLVAVKDVRKVGKAQMPLNDALPRIEVEPDT
FTVRIDGEVWDEQPAAELPMAQRYFLF
118473984YP_884988.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMEMAYLGELRTHWQALTAATAGLSAGLALSAYTNAAMGPQFLAAFGWERS
DFALTGVITLLTFVFLPVYGRLTDLFGVRRIAVVGVAGLPVCWLGYALMS
GPIWQYFAINVAVIALGVTTTPAIYSRVVATRFDRARGLALAIAISGPPL
LGAVSAPVVAAVNRIFGWRAGCVAIAVMIAVIGVVALLLMPADQARPPRE
RRTGDYRMIAGTPVFWILLAGVLLCNLYHSVTTSQLGVMLDDSGAGDRIA
LLVTVFATSVIVGRFVCGVALDRLPPQAVAAVAMALPGLGCLLVASSWDG
FGVLVIAVCCLGAAWGAEGDVIAYLVARRFSLSVYSTVLGILSALIGVSS
ALGALILSRMLAESDSFNGFLLVAGSAAVIGGTLFLLVRPQRKASGAALQ
KPAKMSR
118473982YP_885770.1 PAP2 superfamily protein [Mycobacterium smegmatis str. MC2 155]MTAVEDSATGVGPEPTTGDPADTRDRARTRRGGILRILRYVAIAIWAAVI
VYRTVTDGFAFNRELLLLYICTGLLAASIGQGKRMLYVIRDWLPFALVLV
AYDLSRGAATLIGRPTLWHWQVDVDRWLFFGTVPTVWLQEHLKLPHPPWW
EVVISTVYMSFFILPYVVAGVLWLRDREEWKKFVRLFVGLSFAALAIYAL
VPAAPPWAAARCTPSDVEGGPSGPRCMFRSARGVADGGLLGPMQSSQDGA
NDWIERIVTRGWGKLNLHSATALIDQGQASVNLVAAIPSLHAGLTAGVAA
FLWYRVNRKWRPLLVAYPLIMAFTLVYTAEHYVVDILLGWALAATVIFVF
NRFHAFRRGRSGEVDLAQRLGDGPHGAGAGLESADAAGAQVQRGAAVGEL
DRT
118473980YP_885203.1 hypothetical protein MSMEG_0799 [Mycobacterium smegmatis str. MC2 155]MAKEQRARAESGAGDTGATADKAPVAPSTTGSENTTASPDTAPVRPPTRV
PTDSSILL
118473978YP_889080.1 hypothetical protein MSMEG_4824 [Mycobacterium smegmatis str. MC2 155]MTSDIATPAPTAGEPDLARPWAPHRRKAYVALTAMTGFAFTIAVVGVGTG
LLPPTFTVDVIANLTFGLPVIVLPLVYFWTGRGEQRSRLQRASELTMIYL
PYTAGSQLGYETIFLIGHPMNWWTPTTDPGWKWLWWQYGLADTRYTSGNA
WIFGLELVGVVTGTLLFIVWIRLMRSDLPVESRIKSLWLAFTGCAMLISS
TAVYFLSEVRAGFDDIGQGAFGLWFKFIAENVPFMILPFFALIAMYRQID
DLSRRAGPR
118473976YP_887510.1 hypothetical protein MSMEG_3196 [Mycobacterium smegmatis str. MC2 155]MSVSDAPAPTAPSRPAGGPRISRSRAAVIVVAALAVAGALLGVVWSVLAP
PIHGVIALTRSGDRARAYLGAESDHFFTAAFMFTGLLVVLAAVAAVALWQ
WRAHRGPVLVTALVAGCAAAAGTAAGIGALLVHGRYGSIDVASAPVTPEN
RVFYVVEAPPVFFGHTPLQIATTILFPAAVAALVYALIAVSTSRDDLGAW
PPVETPVYPPVNPHLPPMVTPPPQA
118473974YP_890369.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473972YP_885738.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMTKQPGKLQPHFDEVQAHYDLSDDFFALFLDPSRTYSCAYFERDDMTLEE
AQLAKIDLSLGKLGLQPGMTLLDVGCGWGATMLRALERYDVNVVGLTLSR
NQQAHVERRFSESSSPRTKRVLLAGWEEFDEPVDRIVSIGAFEHFGHERY
DDFFRFAHRVLPDDGVMLLHTITGIHPKHAQELGVPLTFEMARFIRFIVT
EIFPGGRLPTVDMVIDHATRASFTLERRQSLQLHYARTLDMWAAALESHH
DDAVRIQSQEVYDRYMHYLTGCANAFRVGYIDVNQFTLAK
118473970YP_891127.1 thioredoxin-disulfide reductase [Mycobacterium smegmatis str. MC2 155]MSTSQTVHDVIIIGSGPAGYTAAIYAARAQLKPLVFEGTQFGGALMTTTE
VENYPGFREGITGPELMDQMREQALRFGADLRMEDVDAVQLEGPVKTVVV
GDETHQARAVILAMGAAARHLGVPGEEALTGMGVSTCATCDGFFFRDQDI
VVVGGGDSAMEEATFLTRFARSVTLIHRRDEFRASKIMLERARANEKITF
LTNTEITQIEGDPKVTGVRLRDTVTGEESKLDVTGVFVAIGHDPRSELVR
GQVELDDEGYVKVQGRTTYTSLDGVFAAGDLVDHTYRQAITAAGSGCAAS
IDAERWLAEQD
118473968YP_890265.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSLLSAGAGTSEEFAARDMVRSWAAASGAVAAVRESETDPGAWRAAYQGF
AELGIFGVAVPDELGGAGSTVADLAAMIDEAAAALVPGPVVTTALATLLV
TDTGLLEALMSGERTAGVALSADVTVVDGRASGTVEFVLGADAAGVLLLP
AGDDVLLLDAGADGVSVEPLTATDFSIPLARVELDNAPAEVLPVSRQRFS
DLAATLLAAEAAGLARWTLNTATEYAKVREQFGKPIGSFQAIKHMCAEML
LRSEQIAVAAADAAKAVAESDGSDSATQLSIAAAVAVATGIDAAKANAKD
CIQVLGGIGITWEHDAHLYLRRAYGIAHFLGGSRRWVRRVAALTRQGARR
DIDIDLESVADLRPEISAAVAEVAALPEEKRQVALAESGLLAPHWPKPYG
RNASPAEQLLIDQELAAAEVERPDLVIGWWAVPTILEHGSPEQIEQFVPA
TLRGDLFWCQLFSEPGAGSDLAALRTKAVRAEGPNGEPGWKLTGQKVWTS
AAQNAHWGVCLARTDPDAPKHKGITYFLVDMKTPGIVIRPLREITGDELF
NEVFFDDVFVPDTMVVGTVNDGWRLARTTLANERVAMAGGTALGNPMEEV
LRAVEAQPEFDPADQDRLGALIVTAQVGSLLDQRIAQLAVSGQDTGAQAS
ARKLIGVRYRQALAEFHMELTEGGGAVRNREVHTFLNTRCLTIAGGTEQI
LLTLAGERLLGLPR
118473966YP_891094.1 50S ribosomal protein L9 [Mycobacterium smegmatis str. MC2 155]MKLILTAEVEHLGAAGDTVEVKDGYGRNYLLPRGLAIVASRGAERQAEEI
RRARESKVIRDIEHANELKTALEGLGDVTLSVNAAGDTGKLFGSVTAADV
VNAIKKAGGPNLDKRTVQLAKAHIKSVGTHPVTVKLHTGVEAKVSLNVVA
Q
118473964YP_887024.1 DNA translocase FtsK [Mycobacterium smegmatis str. MC2 155]MLIQRSLDGCPAYRENPFPNRFVPLSCYRYQAVTCVADGDSGADATRLAD
MANKTAARSRARSESSSSRSSGRSRGGAKQGAQDGARRKPPTRPAPQQRR
KPARRPQASPVALAGHKLGQGARAGWLMLAKGAGSTARSVGRARDIEPGH
RRDGIALALLGIAVVVAASSWFDAARPVGEWIDTALRTLVGGPVVLVPVL
LAAIAVVLMRSEPDPEARPRLILGTAMIALPALGLWHLWAGSPTDPVGRR
GAAGFVGFAIGGPLSDGLTAWIAAPLLFIGVLFGLLLITGTTIREVPSTV
RAMFSTRGFHDGEYDDEYEYDEDYDDARYDERDGDFSDDFSDGYYDAEVP
DEAAKTWPGSGPMAAIEAPKAPAGTPMDNYPLEDAPTVPEPAVKPRRKKP
EAAKPANKAEEAAKETMVMDRVVEGPYVLPPLDLLIAGDPPKLRTAANDQ
MTDAITSVLEQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALHRNI
AYAVATESVRMLAPIPGKSAVGIEVPNTDREMVRLSDVLTAPSTRRDHHP
LVIGLGKDIEGDFVSANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLARAT
PEEVRMILIDPKMVELTPYEGIPHLITPIITEPKKAAAALGWLVEEMEQR
YQDMQASRVRHIDVFNEKVRSGEISTPLGSERVYKPYPYIVAIVDELADL
MMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSRL
AFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGANKPIRMQGAFITDEE
IHAVVAATKEQAEPEFVEGVTAVKAGERKDVDPDIGDDLDVFLQAVELVV
SSQFGSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVLVKPE
DLAGTLALIRGGADANGAEPEDGEEF
118473962YP_885774.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALV
ERADLDPDVHVILVSGRGEGFCAGFDLSAYAEGSSSAGGGSPYEGTVLSG
KTQALNHLPDEPWDPMVDYQMMSRFVRGFASLMHCDKPTVVKIHGYCVAG
GTDIALHADQVIAAADAKIGYPPMRVWGVPAAGLWAHRLGDQRAKRLLFT
GDCITGAQAAEWGLAVEAPDPADLDARTERLVERIAAMPVNQLIMAKLAC
NTALLNQGVATSQMVSTVFDGIARHTPEGHAFVATAREHGFREAVRRRDE
PMGDHGRRASDV
118473960YP_886119.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MFATCGAGVTITGPDALTERFVRETEPVRDFLIRNAIRLTHQRADAEDLV
QETLLKAYLSFGRYREGNHLKAWLARIMSNAWIDRHRSAQRRPAEQLSAE
MADLRFSTEMPSAGRGWVDSAETQALQSMPGDAGIALAMLPPELRDIVYY
ACVADYRNTEIAVLLGIPVGTVGSRLHRGKALLREALSHSTDNDQAPGER
RMAG
118473958YP_887366.1 integration host factor [Mycobacterium smegmatis str. MC2 155]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLTDAETDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFDQS
118473956YP_888909.1 pyruvate synthase [Mycobacterium smegmatis str. MC2 155]MGDNGNGTGAAPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLA
TQPNYPAEIRAPQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALK
ANVSDLPRGGLIIANSDEFTKRNLAKVGYDANPLETDELSDYVVHSVAMT
TLTLGAVESIGASKKDGQRAKNMFALGLLSWMYGRELEASEAFIREKFAR
KPEIAEANVLALKAGWNYGETTEAFATTYEVSPAKLPAGEYRQISGNTAL
AYGIVAAGHLSDLQVVLGTYPITPASDILHELSKHKNFNVLTFQAEDEIA
GIGAAIGASYGGALGVTSTSGPGVSLKSEAIGLAVMTELPLIVIDVQRGG
PSTGLPTKTEQADLLQALFGRNGESPVAVVAPRSPSDCFDIAVEAARIAI
NYHTPVIILSDGAVANGSEPWRIPDITTYPRIEHTFAKAGEPFQPYARDP
ETLARQFAIPGTPGLEHRIGGLESANGSGNISYEPKNHDLMVRLRQEKIA
GVTVPDLEVDDPTGDAELLMLGWGSSYGPIGEACRRARRKGIKVAQAHLR
HLNPFPANLGEVLARYPKVVVPEMNLGQLALLLRGRFLVDVQSVTKVEGM
AFLADEIEGIIDAALEGTLAEKENDKAKFARLAAATVEGEANEESAVGAN
A
118473954YP_887494.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MPQTEHALDALRRSRYALLRSRRRDGTAVDTPIWFVLQGRTLFFRTKIGP
KTKRLAARPEVTLTPCDHRGRVTDPVRFGGRATVLADDEAQRANRTLHQR
YGWQWNIVPLLKIPGVTNVHRNLPLREKLRRARDRNLWPDSAIVRIDLDA
118473952YP_888078.1 PfkB-family protein carbohydrate kinase [Mycobacterium smegmatis str. MQQTVRARVACLGEPLVLVSEAGDPHPAGAELNVAVGLAGLGVPASLLGR
LGADEYGVLIRAALQQRGIDDSAVETDPARPTGSYSKVTGTDAAGERTTT
SRYARAGSAASAMGPDFLDRDEVSAALGAAAIVHCSGITAALSDTCRALM
CRLLTDRPGIPGLVSFDVNWREQLWPDADPAVVLDLADRADLVLVGADEA
ARVAGTGDPVALRRVLPSPATLVVKDGARRAVAVDRDGVTTEVPALRVDV
VEPVGAGDAFAAGYLSGLVRGDDTATCLRRGHIGAAATLTVATDWAPPPP
AGTLQRLLACSPPEWAATTVTTAGFALPEGM
118473950YP_885694.1 rhizopine catabolism protein [Mycobacterium smegmatis str. MC2 155]MALTLDTYRLLGRSGLRVSPLALGSATFGTDWGWGAERDDARKLFDLYVE
RGGNFIDTANTYTDGSSERLLGEFTQNNRESLVLATKYTTQRRPGDPNSA
GASRKSLVASVDASLRQLRTDYLDLLFLHVWDFATPVEEILRGMDDLVRQ
GKILYVGISNAPAWQVSRMQAIADLRGWSPLVALQIEYSLIERTGERDLI
PMAREMGLGVTPYSPLGGGVLTGKYRRDDLTASHLASEGSTRGSFNAALG
TVTERNIAIADVLKDVAAELGCTSAQAGLAWMLQNPDITAPVIGARTPAQ
LEENLGALDIDLAEDHLARLDEASAIDLGYPHQMLASDHIRNVTGGS
118473948YP_891018.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MNQARIDVHHHVVPPQYRELLAAQTTNAGGRATPDWSVDSALGLMDSIGV
ETAILSITTPGVEPAERAQRPAVARDLNEFCADVVRSAPDRFGFWATLTL
PDVDSAIGEAAYALDELHADGVVLLANSERTYLGDRRFDPLMEELDRRGA
TIFVHPSHLPGGSIPGINAYFADFLLDTTRAAINMVLNGTLDRYPNLRVI
LSHAGGFVPFIAERIATCVPIEHPDVSVESILDGLRKFYFDTALSASESA
LPSLLAFARPDHILFGSDFPYATAEIATRFAKNLDAYLADHQDVDGVAVN
RDNALKLLPRLAVGAAR
118473946YP_887614.1 succinate semialdehyde dehydrogenase [Mycobacterium smegmatis str. MC2MTIHDPRTGELVGRTPIATASECDAAIARARGAAAGWARTPAGERAAVLT
SAAADVRAAADELAELNERETGKLRADARGGVDAAVSTLVQYAELGPLHR
GRSLHGNWSATDLMVPGPRGVVAVLTPWNDPVAVAAGLLGAALVTGNTVV
HKPSERCPATGRRFAELLAQHLPKGVLEILDGDATIGAQLAAAGDVDVVA
HVGSSVTGRAITRACAERGAKALLENGGNDALVVDAGIDPGWAAAQAALG
SFANAGQICVSVERIFVVGAVEAMVEAFIRALVDEAESWAERIGPLVDER
QREQVHRHVTDAVKRGATVAAGGEAPSGPGTFYPPTVLTDCTKDMLVFQE
ETFGPVAAVRVVPDFDAAITEAADDRYGLAASVLTPDMGHAQQAWRDLPV
GTVKINDVFGGAPGGASQPRKASGSGFGFGPELLDEMTTMKVVHWSPPPT
118473944YP_887577.1 maltose/maltodextrin-binding protein [Mycobacterium smegmatis str. MC2MMSRESQPGLHRQLSRRNMLAAMGLAGAAAVSLPVLSACGVGGRTNAPNG
ASEVTGGFDWRKASGSTINILQTPHPYQQSYQPLLKEFTELTGINVNVDL
VPEADYFTKLNTELAGGTGKHDAFMLGAYFIWQYGPPGWIEDLNPWLQNS
SATNAEYDFEDIFEGLRTSTRWDFELGNPLGTGGQWAIPWGFENNVVAYN
KAYFDQRGITKLPDNFDDFIQLAIDLTDRSENRYGIATRGSKSWATIHPG
FMTQYVREGAVDYTFDGTDLVAEMDSDKAVEFTRKWIEMQHKAGPTSWTT
YDYPNATGDLGDGTAMMVYDADSATYPKNKPGASAQAGNLGWYPGPAGPD
GNYKTNLWTWTWAMNANSRNKLPAWLFIQWATGKESMNKAVEGGIYADPV
RQSVFDTTFKRIAADQHGYLETFETVIGSSKIQFTPQKKFFDTTKDWAVA
LQDIYGGDDAASRLRSLAKTNTSKVNL
118473942YP_890520.1 ATP-dependent DNA ligase [Mycobacterium smegmatis str. MC2 155]MDLPVQPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALVFRDGDDVVLQ
SRNGKDLGRYFPELLDALRDELVEKCVLDGEVVVPRDIAGRVRLDWESLS
QRIHPAASRIKMLAEQTPAHFIGFDALALGDRSLLKEPFRVRREALAEAV
DNKRWCHVTRTSEDPALGTEWLKTFEGAGLDGVIAKRLDGPYLPGKREMV
KVKHHRDADCVAMGYRIHKSGDGIGSILLGLYRDDGELQMVGGAASFTAK
DRIKLLAELEPLREGDEMREGDPSRWNSAADKRWTPLRPEKVCEVAYDQM
EGNSVEGRRFRHAVKFLRWRPDREPSSCTFDQLDTPLNYDLYDVLEEQ
118473940YP_889830.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMEGVEWLSAAEYEMWRGYLDSTRLLLRALDRQLEVDAGISFADFEVLALL
SEAPERRLRMSEIADAAMTTRSGVTRAVNRLADAGWLRRVECDEDKRGWY
AELTEAGFAKVRSSAPVHVAAVRRNVFDLLSPRDIRLFTHAYSEIRAHLL
NEADDQP
118473938YP_886898.1 gluconolactonase [Mycobacterium smegmatis str. MC2 155]MTTEAGPERTTELATGFCFGEGPRWFEGLLWFSDMLGEAVHTVTLGGSMT
TLPLPGHAPSGLGFRPDGTLYIVSTEKRQVLCYDGETVELLADLHQVAPA
PLGDMVLDERGRAYVGSQARGGGVIVRIDPDDPVEPIRVVAEGLDFPNGM
AITPDGETLIVAESTARRLTAYTVDEDGDLSDRRIFAEGLDGPPDGIAID
LEGGVWTALTLAHEFQRIVDSGPGTPTVTDRIDAGGRTAIACALGGAEGR
TLFLVTTTDAYPQRLVGTKLSRIEALDVAVPAPGDFAVGDHHHH
118473936YP_889797.1 HPP family protein [Mycobacterium smegmatis str. MC2 155]MTSVELLDAETSGTSGPSRSSWFRSAAPPRQRLSVIVVETIVSLVALAII
ASLTAITHDPWLIPPLAASAALVVGGAHFPLSQPRNVIGGHVMSAIVGVM
VGMTALDALWAGAVAGALALGMMKLLRMSHSPAAATAMIAVVPEIPRWEF
VVLVGTAAVILVVVGLAGNKLNGAKYPHYWW
118473934YP_890571.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMTPRDGNVWVIPAELSSAALVRNAAFEFAQLTLPAPSVGGATLRPVADRQ
DPLLHNMVDRIADLAARDDVLSRLLRDSIAEGLRLHIRDRYGEAPSPDGK
SVQMLDQGQQRRLVEFLHDSLDERIDLRTAANIVGMNVRDFRPAFAQAFH
TTLYQFVLDQRIKRAKALLASTALTMTEISFTVGFSSPSHFATTFKQRVG
VTPSAYRAHL
118473932YP_887790.1 catalase KatA [Mycobacterium smegmatis str. MC2 155]MTEPRATTTDAGAPVPSDTHSLTIGPAGPILLHDHYLIEQMANFNRERIP
ERQPHAKGSGAFGHFEVTGDVSRYTSAAVFQPGVRTDTLIRFSTVAGERG
SPDTWRDPRGFALRFYTSAGNLDIVGNNTPVFFIRDGLKFQHFIRSQKRR
ADTGLRDHDMQWDFFTLTPESAHQVAWLFGDRGIPRTWRHMNGYGSHTYS
WINAEGEIHWVKYHFISDQGVENLTQDEADRLAGVDADFHQRDLHQAIAR
GEYPSWTLAVQIMPFDDAKTYRINPFDLTKVWPHADYPLVTVGRLVLDRN
FTDHHTEIEQAAFAPSNQVPGTGLSPDKMLQARTFAYADAARARIGVNYK
QIPVNAPRCPVHSYSKDGAMRVTNVSDPVYAPNSYGGPHADPNQTNEALW
YADGDMVRTAYTLRAEDDDFTQAGDLVRRVMDDAERDRLVGNVAGHLSNG
VSEPVLQRVFEYWRNIDKLTGDRIEDAVRKRQGVR
118473930YP_890685.1 hypothetical protein MSMEG_6472 [Mycobacterium smegmatis str. MC2 155]MKKFGFAAIAASGLTAAILGLAAPAQAAPAMAPVSTGVDATTITAGVDRL
EWLDKIQPKATAPQVDTTVRHSGR
118473928YP_885543.1 hypothetical protein MSMEG_1149 [Mycobacterium smegmatis str. MC2 155]MKLKTDKRRDVFDEAVDDTEDAEVEALDVAESEDTATEPESDEVTGPSGE
KPSDKPSDEKPAATVTSPNQRRGVVLGVAAGILVAALLGGGGFVGWQLWQ
TKQVIAAGNQARDAAVNYAQVLTSIDSNKVDENFDQVLAGATGEFKDMYS
QSSMQLRQLLIENKATAHGVVVESAVQSATKNKAVVLLFVDQSVQNTAVP
DPRIDRSRIKMTMEKVDGQWKASKVELP
118473926YP_888720.1 hypothetical protein MSMEG_4445 [Mycobacterium smegmatis str. MC2 155]MCGADGGHLASRTRAEHDDVIPHVPDLSVDVSAVEGPGAPVAELGLCREY
DL
118473924YP_884793.1 MmpS4 protein [Mycobacterium smegmatis str. MC2 155]MRRLWIPLLVIAVVAVGGFTVSRLHNVFGAEKRPSYADTKAADSKPFDPK
RLTYEVFGPPGTLADISYFDEDSNPQFVEKVSLPWSLHFDIGKTTAVGSI
MAQGDSDTIGCRIIVDDEVKAEKVSNQTNAFTSCLLKAA
118473922YP_889275.1 T/U mismatch-specific DNA glycosylase [Mycobacterium smegmatis str. MCMSSVLHGLPPIVGEAPRVLILGNMPSVMSLASSEYYGNPRNAFWRIMGSL
YGFAPDAAYSERVSAVTSHGIAVWDVLRSCRRVGSLDSAVERDSMVPNDF
AGFFAAHPSLERVVFNGAAAEANYRRLVGEVPLPYVRMPSTSPAQTMRFE
DKLSAWRVELER
118473920YP_890357.1 membrane protein- TerC family protein [Mycobacterium smegmatis str. MCMHVTQLEWIITLSVTIAVLLFDVVIIGRRPHEPTRRETATYLSIYIGLAI
AFGVWTWLFHGHRYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAINQFSWVFYIFGAFLVYTAVNLVRD
TDHDDDGDNAVVRFARKHLRTTDKWDGLRLWVRENGKRLITPMFLVIVAL
GTTDLLFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILAFIGVKLILHALHENELPFINGGEPVHVPEIPTLASLGV
IVVTLLITTAASLYKTRVRDAQ
118473918YP_886468.1 hypothetical protein MSMEG_2110 [Mycobacterium smegmatis str. MC2 155]MPPSRGFPPPDPATRRLPRPPRPTGPAGPDGPTEQLRAPRPEPPTEQMRA
RRPPLDAAATEKITRPRPPVAQGGPLGASPPAVKRAWLRTWQAAVLIAVI
VVALVVGGLAGAELYARHRAGTLLVAVAECVVEDNATVSFGVNPPFLWQH
ITGHYTNISVQTAGRQVQAAEGMTADVTLKDIRLQGTADSKGTIGSLTAT
LSWTSEGIKDTVAANLPGVGSLVTGVSTDAAAGTLTLEAAGDNRVTARPV
VTDGDLTLEVLDVTGPFSKETVQDALNGLTTKLNENYPLGIHADSVAVTD
TGLVGRFSSQDASIPNDEADPCFARL
118473916YP_886918.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MSVVRDTAAVMRVLDEDPVAGCMVAARVAEFGAEPGAIGGELWTRRRPSE
SLCYAGPNMIPLRGSLDDLKAFSDKAMSMARRCSSLVGRAELVLPMWERL
QSLWGPARDVRAQQPLMALNSMPQCAIDPAVRPVRMEEIDAYLVAAVDMF
IGEVGVDPRIGDGGRGYRRRIASLIATGRAWARFERGEVVFKAEVGSQSP
AVGQIQGVWVHPERRGHGLGTAGTAALAAAVVAGGRTASLYVNDYNTVAR
ATYARIGFEQVGTFATVLLD
118473914YP_885998.1 DNA repair polymerase [Mycobacterium smegmatis str. MC2 155]MPEGSRVLALWCMDWPAVAAAGAAGLPPTAPIAVTLANRVIACSAAARAA
GVRRGLRRREAQARCPDLHVVTADPARDARHFERVTAAVDELVPRAEVLR
PGLLVLSVRGAARYFGSEDAAAERLVDAVAATGVECQVGIADQLSTAVFA
ARAGRIIAPGEDASFLSDLSIRQLATEPALAAPDRDALADLLWRMGIRTL
GQFAALSRTDVASRFGADAVVAHRFARGEPARAPSGRDPAAELDAVLDCD
PPIERVDAAAFAGRSLAVTLHRSLEAAGVGCTRLAIHAVTANGEQLERVW
RCAEPLTEDATADRVRWQLDGWLNRRTDDRPSAPITVLRLRPVEVVSSAA
LQLPLWGGIGEEDRLRARRALVRVQGLLGPEAVQVPVLSGGRGPAERITF
TALGDEPVPQADPRQPWPGQLPEPSPTVLLDDPVELLDAQGNPVRVNSRG
LFSSDPSRLSGAGKRDGVLRWWAGPWPVDERWWDPQNRGTGRTARAQVLL
GDGEDALALLLCYRQRRWYLEGAYE
118473912YP_885640.1 ISMsm7- transposase orfB [Mycobacterium smegmatis str. MC2 155]MMYPLVLDLAADGVPVTVTCRVLGFSTQAFYRWRKAPVSQRDWDDAHLIN
AARNIHADDPAFGYRFIADELPAHGITAGENRVARLCSQERIWSIFAKKR
GLNRRSGPPVHDDLVQRQFSTHAPNQVWLADITEHRTDEGKLYLCALKDV
YSNRIVGYSIDSRMKSSLAVAALEHAVALRSPVATIVHSDRGSQFRSRKF
VHALSHNGLHGSMGRVGACGDNAAMESFFALLQRNVLDRRRWTTRAELRL
AIVTWIERTYHRRRRQRALGRLTPIEFELLHTPVATAA
118473910YP_887742.1 hypothetical protein MSMEG_3438 [Mycobacterium smegmatis str. MC2 155]MLRSEPDFSSAHGATDGAEDPQDDAHDDQDAADGVQDRKAREVADQEKDD
AEDNHC
118473908YP_890498.1 recombination protein RecR [Mycobacterium smegmatis str. MC2 155]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLGRIR
DGVTFCSVCGNVSDEERCRICSDPRRDASLVCVVEEPKDVQAVERTREFR
GRYHVLGGALDPLSGIGPEQLRIRELLNRIGERVEGVDVAEVIIATDPNT
EGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRR
AMV
118473906YP_889810.1 repressor [Mycobacterium smegmatis str. MC2 155]MPEPTPEDLRLALRAATLYYLDGLTQAEIASRLGVSRPTAGRLVAKAKAN
GLVRIEVVVPPDIQDDLHAEEERELERRFGLTEAVVATNAGRAGAALLMR
RIAADDVLGFTWGPEQVGVATNLVPGIASCRAVVQLDGAMSTAAYQTGME
TILTRCADTLRAETFRLPAPLYADPATVVSMREDSVISRTLDAGRRAQAM
LFGVGAVSTSTTLFEGSFLDIRMLDELMSMGAVGEIGGRFFNAHGEPVHD
ELQQRAMSVPLEDIRMCEKTILISGGAGKYQAILGALRGKLARLLVCDID
CARWLLNQ
118473904YP_885733.1 50S ribosomal protein L11 [Mycobacterium smegmatis str. MC2 155]MAPKKKVAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATES
QRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVQKGSGEPHKTKVA
KVTWDQVREIAETKKADLNANDIDAAAKIIAGTARSMGITVE
118473902YP_889317.1 hypothetical protein MSMEG_5067 [Mycobacterium smegmatis str. MC2 155]MRIGGGAAIQAARHRAGRFMRTPMVGAAALAPLILAGAVGASAPPHHGSS
DAAVTPLAAVQPQIDHDGPAVVAAAKAPTKFHIATTTAVSAPPPAVVVNS
PGALGIPGMALNAYRNAERMMAAAYPGCGVSWNLLAGIGRIESMHANGGQ
TDARGTAVRPIYGPALDGTLPGNEIIVQSAQAGRVTYARAMGPMQFLPGT
WARYASDGDGDGKADVQNLFDASLAAARYLCSGGLNLRDQSQVMTAILRY
NNSIAYARNVLGWAAAYATGVVPVDLPPITGEIPALGDSHLERKEGLGPG
LPVNALGLPPDDPLALIPVLDSNVTATRVPAANLGFAPNQVLGPLPGPAE
AVPTAPAAPPEPPRWIPPWEQPPRQPECVVFCLGEQAPPAPAPGPPPAAP
TPGPAPGPAPGPAPAPAPAPVLGPAPGPAPESP
118473900YP_888528.1 cyclase/dehydrase [Mycobacterium smegmatis str. MC2 155]MADKTAQTIYIEADPKTVIDVIADIGSYPEWVAEYKETEVLEVDDNGNPK
KARLVLDAAVLKDTMVLEYVWPPDRTSVTWSLVSSSLLRSLNGAYRLSPK
GSGTEVTYELSVDLVVPMIGLLKRKAERRLTDTALKDLKKRAEVR
118473898YP_888898.1 ammonium transporter [Mycobacterium smegmatis str. MC2 155]MPPDVQDALDTMATINNEFYYWVSIALMFLIHAGFLAYEVGASRSKNVLA
TAMKNLLALATIIASFYFVGWFLYNAMPSGFIEFNEAAKAALPWGDNMGP
NVQDSASGIFWGAFALFAATTGSIMSGAVLERIRTSGFLILTVLVGSVTW
IIGAAWGWHGAGWMLTKLGFHDVGAAGCVHMIAGFATLGVLINLGPRIGR
FLPDGTPVTIRPHNLPLTMLGLMLIFTGFFGFLMGCIIYAGDGLTTIYAS
PTTMSAFAFNTLMGLGGGIIGAYLTSKGEPFWTISGGLCGVIGVAAGMDL
YHPTLAFVIAFGAGAVAPFIGRLLEKFKIDDVVGAVSVHGGIGLYSLLMS
GIFLHGYPNTGGNPSISLWGQAIGAAVFAALGFIPTYVVSLGLKKVGLLR
IPKEVEEQGLDLTEVPATPYPEGIPVTAMPVNGNGHAKTNGKLVTTAEV
118473896YP_889735.1 hypothetical protein MSMEG_5497 [Mycobacterium smegmatis str. MC2 155]MITIPDRHADGKIAESWAIWDTLGMLQQLGLVPSSSGAQQPA
118473894YP_889453.1 hypothetical protein MSMEG_5207 [Mycobacterium smegmatis str. MC2 155]MSGRHSFRAFTQAEKERPEEETAEQTVEAAEEPELTEPAEEATSSDDVTP
EAEETPEESPEPDPEPARTIAWSRVLVFAVIPAVALLLAAGSAFLKWQIA
WNAESDTARTESVQAAKDITVEMLSYEPDTVEAHLNEALNRLTGNFRDSY
TTLVNTRVVPVATTQRVTANADVPAIGVESASPDRVELVLFVNQLVAVGD
QAPQKTTSTVRATMVREDGQWLMSEFEPVKP
118473892YP_889293.1 LprE protein [Mycobacterium smegmatis str. MC2 155]MKKVAGVVLATLALAGCGGGDSTVSKTPGPTASQPATAAPETTVAAPAPT
SAEPDPCTVNLAAPEIARAVSELPRDPRSNQAWSPEPIAGNYNECAQLSA
VIVRANTNAENPNTRAVLFHLGKFIPTGVPDTYGFNDIDKTQSTGDTVAL
QYSGGFHGLPSTVRFRWNGSGVELMGNVG
118473890YP_890784.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MVGARAALGGFRLRRPTVVGVYDQYDVIADDYAQHFPDDFASRPFDRALV
HVFAGLVQQSGGGNVLDVGCGPGQATAELGAAGLRTHAIDGSPAMVSIAR
RRYPHARYQVADMASLPYQDAAFGGLCAWYSIIHTPADRLAGLFAEFSRV
LADPGWLLLGFQTDAPPLVFDEAFGHKVDMTFLRHNVTAVHEALLAAGFT
VYATSKRERLQHLSETAAQAFVIAHRGPLH
118473888YP_884712.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MTQTVLRAARWVDVAAGVVRAPAVVVIEGNRITEVNPAAPLPDTAAVIDL
GDVTLLPGLMDMELNLLIGGPEGLPSPMHGVQDDPAYRTLRGAVNARTTV
QAGFTTVRNLGLMVKTGGYLLDVALQRAIDQGWHQGPRIHPAGHAVTPYG
GHLDPTVFQRLAPGIMPLSVAEGIANGVPDVIACVRYQIRHGARLIKVSA
SGGVMSHSTAPGAQQYGDAELAAIADEAHRAGVKVAAHAVGDTAIQACIR
AGIDCIEHGFLATDETIQMMVDHGTFLVSTTYLTDAMAIDRIAPELRKKA
LDVFPRAKAMLPKAIAAGVRIACGTDAPAIPHGQNAKELCALVERGMTPM
QALQAATVVAAELVDASDELGRLAPGYLADVVAVPGDPSTDISAILDVSF
VMKDGAVVKHREPSDAAVR
118473886YP_889377.1 hypothetical protein MSMEG_5131 [Mycobacterium smegmatis str. MC2 155]MKKSVTAGTAVLAAGAIALGPVVSQAPEAQRAMRAADLALSAAANPIEAA
AFIVEGFGTSGVRLVQGALTAPLGLIPLVEALGAQDSEALYSVLREYNDA
PLWVADPTIDGFAEALPRWLGGGTDGDRYVNSSEDGAIIDFRDNVLWVAT
DNARTQINNALHVDAGPPANLFEGAVTLSVGAGGTAVRLVEGAALAPFGL
IPVAQGLATSATTGDNTALYVAVRQYIDAPLWVADPAIDSVAKVLPRSLG
GGTDGNHNVSSDLDGAVVKFRDNALWGATNAVRTAVADVLNVNPNAGNVP
AAPLAASPKKANVAGSVNLGKFLPGASAPEGATKTRPGRAALGALRNQVR
ASVAKVNADINAAVKKVTSGLPAKKAAAKEKKAATSEKAAEGSED
118473884YP_884654.1 O-acetylhomoserine/O-acetylserine sulfhydrylase [Mycobacterium smegmatMTDRTFGLATRAIHAGQRPDAATGARVTPIYANASFVFNDTDDAANLFAL
QKYGNIYSRIGNPTVAAFEECIASLENGLGAVAMASGLSAQFAVFAALAG
AGDHIVSAASLYGGTVTQLDVSLRRFGIDTTFVGGTDPADYAAAVTDRTR
LIYAEVISNPSGEIADLAGLAEVARDAGVPLIVDSTVATPALCRPIEHGA
DIVVHSATKFIGGHGTTLGGVAVDAGRFDWGAGKFPQMTEPVASYGGLSW
WGNFGEFGFLTKLRSEQLRDLGATLAPQSAFQLLQGVQTLPQRMAAHIAN
ARAVAEWLEADPRVTYVRWAGLPSHPHHDRARHYLPDGPGAVFAFGVKGG
RAAGEKFINSVQLASHLANIGDVRTLVVHPASTTHRQLTDEQLTAGGVGP
ELIRISVGIEDVEDIIWDLDQALTQAEKADD
118473882YP_887144.1 sensor kinase [Mycobacterium smegmatis str. MC2 155]MATGELSGARRSLARQSVVIALLAAAVDVGIFASSGIFRVAFAAACAMTV
LLVLADLALALPAHATAAVAIVQVVIRLAVCWLLSRHGLAAGIGDVGILV
AGYRVGAWLPTRVALLVVPLLAAGVSGAAVINGAGRTWREVVLIAVSNAV
VPWLVGRYTAAGRAYVDQLERHQQQQQAALERALADEREAIARDLHDVIS
HHVSAVGIHAGAARLALGTDPDAVARSLAAVESASRSAMMDLRRQLDLLH
GADSAGERQPGLANVSHLVDTVRQAGLSVELELPDAMPALSQSLDVTVYR
IVQELLTNALRHGDGTARLQVRRTINEVIIDTSNPIADGRFSGESPGRGR
AGVRRRAELFGGIMRDGSDDGLRWRTVVSIPVPPS
118473880YP_885025.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MRTDNDQWDITISVGQTALFVAASRALEARKPHPLAVDHYAEVFCRAAGG
DWVAAVEGTDPEHPLQTEFGVDFVNFQGARTKYFDDYFRRVADAGVRQVV
LLAAGLDSRAYRLPWADGTVVYELDVPKVLEFKREVLRRHGATPTAERRE
VPVDLRDDWPAALRANGFDASQPSAWIAEGLLIYLPADAQELLFAGIDAL
SAPGSFVAIEESAPMPMDVFEVKRAEALASGDPNSFFALVFNEQCAPGEQ
WFSERGWTASTTTLNECLHEVGRPAPAPDSEAAQMTGSISLMWARKG
118473878YP_890778.1 hypothetical protein MSMEG_6566 [Mycobacterium smegmatis str. MC2 155]MLIPAPHKPTVLARWLEKHRVDGHDHGRHHEYPTKWTYFESALMSREMSR
L
118473876YP_885728.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadA [Mycobacterium smegmatisMALSSKIVGMHYRYPDFYEVGREKIREHALAIKNDETYFYDEDAAAELGH
DALPAPLTFICIFGYQAQSAFFDHADIGVREAKIVQVDQELKFFKPIKAG
DRLYCDVYVHAVRRAHGTDIIVTKNIITNDAGEIVQEAYTTLAGRAGDGE
EGFSDGSA
118473874YP_887534.1 tryptophan synthase subunit beta [Mycobacterium smegmatis str. MC2 155MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVT
AAYEKCRGDQTFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKRE
DLNHTGSHKINNVLGQALLARQMGKTRVIAETGAGQHGVATATACALLGL
ECVIYMGAVDTARQALNVARMRLLGATVVSVEAGSKTLKDAINEAFRDWV
TNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQVQDQAGRLPDAVT
ACVGGGSNAIGIFHAFIDDPGVRLIGFEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPIT
DTEAMDAFRLLCRTEGIIPAIESAHAVAGALKLGPELGAGSVIVVNLSGR
GDKDVETAAKWFGLLDEGQGEGEAR
118473872YP_889677.1 dimethyladenosine transferase [Mycobacterium smegmatis str. MC2 155]MAKEIDFRPRKAFGQNFVHDANTVRRIVSASGVHRHDHVLEVGPGLGSLT
LALLDRGARVTAVEIDPLLARQLPTTIADHSHSEINRLTVLNRDILTLMP
GDLEEQPTALVANLPYNVAVPALLHLLAEFPSIRTVMVMVQAEVAERLAA
EPGGKDYGVPSAKVRFYGNVRRHGMVSPTVFWPIPRVYSGLVRIDRYETS
PWPMDEAFRDEVFNLIDIGFAQRRKTSRNAFAEWAGGGNESAERLLAARI
DPARRGETLSINDFVRLLQRTKEALGEDYTKQVARPSASAPSVSAEA
118473870YP_886921.1 penicillin-binding protein [Mycobacterium smegmatis str. MC2 155]MATRTSPVTRTAGLLAVIGVLAASALSGCTPRPNGPEPAAEMFFAALATG
DIAAAAELSDRPDEAKTALNEAWNGLQALRLDAQILGSKYSEDTGSVAYR
YTWHLPKNRTWTYDGQLNMVRDEGRWEVRWSATGLHPRLGEHQTFALRAD
APRRASVNERGGTDVLVPGQIYHYALDAKAAGAGLMTAARAVADALRPFD
PGLDPQRLAEQASSSAQPLSLITLKQADHDRVAPAIAGLAGVVVTPQAEL
LPTDETFAPAIVNEVKKAVIDDLDGQPGWRVVTVNQNGVDVDVLNEVPGQ
PAPSVTISLDRAVQNAAQNAVNTTGKQAMIVAIKPSTGEILAVAQNAAAD
TGGPLATMGLYPPGSTFKIVTAGAAIERDMATPNTLLGCPGKLDIGHRTV
PNYGGFDLGVVPMSRAFASSCNTTFAELASRMPPRGLTQAAAQYGLGLDY
QVEGLPTVSGSVPPTVNLAERTEDGFGQGKVLASPFGMAMVAATVAAGRT
PVPHLIEGRETVVDGDAGQISQKVIDGLRPMMQLVVTNGTAKDLKGVGDV
RGKTGEAEFAGGSHSWFAGYRGDLAFAALIVGGGSSEYAVRMCKAMFDSM
PADYLV
118473868YP_886022.1 NADH:flavin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MNTQPNVFTDVFSEAKLGPITLRNRIIKAATFEASTPDALVTEDLINYHR
LPAAGGVGMTTVAYCAVAPGGRTDGWQIWMRPEAVPGLQKLTEAVHAEGA
AISAQIGHAGPVANARTNKAKALAPVRFFNPLSMRFAKKATIDDIREVTA
AHANAARLAIDSGFDAVEIHLGHNYLASSFLSPLINRRIDEFGGSLENRA
KVARGVVRAVRDAVDKAGGTIAVTAKLNMSDGIRGGISLEESLQTAKWLE
EDGGLDAIELTAGSSLVNPMYLFRGDAPVKEFAGAFKPPISWGMRTVGKG
FLREYPYREAYLLREAKQFRAELKLPLILLGGITNRDTMDQAMAEGFEFV
AMGRALLAEPDLINRIKADGDAHSVRSLCTHCNKCMPTIYTHTHCVLTGA
PDALVR
118473866YP_888938.1 hypothetical protein MSMEG_4678 [Mycobacterium smegmatis str. MC2 155]MNQPHPGNQWQHVPSQVQYGQPYPPGYYPPPPPPPKKRKTWLWVLVALVV
MVAGGVVAYSVLGDATNTSDEPAAADSTVMPVTLTMEVTGTGSSALVAYS
DGLAPPGDYAEVALPWTYEGTGVPETAFYLMVKPTAAGDTVTCKVTFQGT
ILADQSTTDDRRLTCSGLVPGAR
118473864YP_888532.1 hypothetical protein MSMEG_4255 [Mycobacterium smegmatis str. MC2 155]MLLVELGLAVALLGTASNPPSAGQQPHPPVSATSAPADAAPVQTFTLPDG
RTARLLTLGGPQTDVLLDRIRDELLGAADAVTAFWGPDWPREIDIAVAGT
PEQFRVLGGVGADIAAITTADRIVFAPGAATMSPAALRIVLRHELFHYAA
RSVTAYDAPRWLTEGVADYVARPDAPRPGPQAAQMLARLPTDADLDTPGS
TRSTAYDRAWWFTRYVADAYGPAKLRDLYVRACGFDHPDIATAVRTSLGA
ELDAVVDGWRRWMSG
118473862YP_890999.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 1MRKINTVTVVGAGYMGGGIAQVLALNGFKVQIADVNAEATQEALKRLDRE
AREFEQQGLFGPGSADTIMSNLTASDSLDDAVSDVDYVMEAVFEDVDVKK
EVLARVCASARPDTIIGTNTSTIPVKVLVDAVTHPERFLTVHFSNPAPFI
PGVELVAGEATTQEVIDSVKDLLARAGREGAQVADTPGMALNRLQYALLK
EATLIVEEGVATKEDVDTIVRTTFGFRLGFFGPFAIADQAGLDVYVKGYH
TLENAFGERMATPKLLTDNVDAGRYGTKNGKGWTGDFDDETKAAVIAYRN
KAYSRMGELLRELGPAPKGA
118473860YP_888632.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTDLKTNAPVLSVRDLTVGIGRREIVHGVSFDVHREQTVGIVGESGSGKS
LTVLAATGLLDAPGAVVRGTSTLADGSQLVGASARLLRSVHGGRIGFVFQ
DPGTSLNPLLTLERQITESLETHRKMSRRQARTRAGELLEAVGLPPQRLD
AYPHQLSGGQRQRVMIAIALACDPELLIADEPTTALDVTTQAQIVDLVAD
LQRDFGAAVVWISHDLGVIGQVADEVTVLRDGDAVEQAPVMDVFDRPRHE
YTRELLAARPRVDDAGPPAPPDDAGILLDVADLEVRYADVAAVKGVSFTI
RRGTTLGLVGESGSGKSTVAAALTGLSEPSAGTATLDGADVFGGGSELRR
RISLVFQDPFSSLNPRARVGTTIGEPLQVHGLAKGRRARAERVAELLELV
GLPGDFASRYPHELSGGQRQRVSIARALATEPELLILDESTASLDVSVQS
RVLDLLADLQRELGLAYLFIAHDLAVVHRMSHDVLVLRDGEVVEYRPAAE
LFAAPQHEYTRTLLAAVPPLRPHEKV
118473858YP_886853.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MIRSEVDLSGGRVSYLTWSPERPSGTVVLLHGGGVDNAELSWGGIAPGLA
AAGYRVVCPDHPGYGHSPLPALPVTQERLVAYVGDFVDAVVDGRYAIGGL
SLGGGMTIGHVLDRPDRVTGAMLLGSYGIMARLSDGPFSAIRQALTWAMV
RTGVMGSVMRWTARNRTAMNQSVAAIIRNRVYRTDDLLQAVYAAAAQPGG
FIAFEQWQRDQVRWNRQRTDYTDRLRTFPRPALIVHGGRDTGVPVAHARA
AARLIPDATLKVVAEAGHWVQRDAPDVVLDAMTTFLARISATA
118473856YP_891043.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMRRVAVLAVPDVVAFDLSIPIEVFGRVRLADGMNGYRVQVCGTEPTVSAG
PLRIATDHGLEALADADTIIVPGRENLPTQTPAPVVTALRDAYASGATIA
SICTGAFVLADTGLLDGRRATTHWAAADLFRANFPAVDLDPDVLYVDAGR
ILTSAGASAGVDLCLHMVQRDHGAAAAANAAKMAVAPLHRSGGQAQFIIR
NQPPASVIGEKTHLSEVLVWIEQNAHRELTLSDIADHAATSIRTLNRRFQ
AETGQTPMQWVTGVRIRHAQELLERTSLSVERIGRDVGFTSAANFREQFR
RLSGVAPQVYRNTFRERTQDIPHTTSTALASA
118473854YP_889988.1 PE family protein [Mycobacterium smegmatis str. MC2 155]MTVGSAVRQLIAVGSVIAAGAIAVAPAVVADTVLTVGGTGSALVGDQGPW
RLPYTHGAPEVNIVYPSSPVFMDWSVAHGAGSLHAAIVSTPEGKTAVGIS
QGGLVLAEVKRRLMALPESDRPASGELVFIGVGDPSNPQGGLLRHFPEGF
RLPGFGVTVVETPETPWNTIYVTREYDGFADFPDRVHNLVAVANALVGIV
YVHAQPGYASVDLEAVPDRDVTVTTNTLGGVTTSYLVRTERLPLLQPARD
LGVPEKIVKHLEAALKPVVDAGYVRNDPPRTPALTAASAPEPVAASVEPE
PEPERKRHLRVASPGRIAVGGPAKGRHARVVEAELRDPRDDERPDVRTQA
STPESAAHAGAKSDPPGDSPSDNSGADAERGDE
118473852YP_887657.1 TRAP transporter DctM-like membrane protein [Mycobacterium smegmatis sMTAATGVVLVVVLVLFFALLAIRLHIGLSLMASAFVGVLLLRGTGAGLST
VANQPFSTAADYSLTIIPLFIVMGIFAVRAGLAQAGFDLASSVLRRLPGG
PALASLAGSGMFAAVTGSSVATVATMARVSTDAIVRAGYSIRLAAGVVCA
GGTLGVLIPPSIVLVLYGVVTEESIGQLLIAGIGPGLLTIAGYAVTSVLL
VMWQRRRAGVVGAERRIEEPGPGADGAQAGEPGRLDIAGFLYLVVIFAVS
IGTIYLGLATPTEAASFGALAALVVLLLRTRPPSWIREIGESLREAIGLT
AMTFLLMVGAGVFTYVLALSGASSSLVSAVTAAQLPPYLVLVLCLAILLP
LGMFLDGISMILIAAPLLHPILVGYGFDGIWIGVLIVKVAEMALITPPVG
MNAFVYSGAVREAGLGRVFRGIIPFIVADLVVVGVLIAFPGIVTFLPSMS
GAQ
118473850YP_888035.1 hypothetical protein MSMEG_3736 [Mycobacterium smegmatis str. MC2 155]MAEREFRTAPSDLAALEPFWPSRRLMAFDEWCCARI
118473848YP_887262.1 Holliday junction resolvase [Mycobacterium smegmatis str. MC2 155]MRVMGVDPGLTRCGLSMIESGKGRQVIALDVDVVRTPADTPLQKRLLTIS
DAAEHWMDTHRPDVIAIERVFANQNANTAMGTAQAGGVIALAAAKRDIEV
HFHTPSEVKAAVTGSGRADKSQVTEMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAAAEAMAEEQRRKFQAKIKAARG
118473846YP_889996.1 hypothetical protein MSMEG_5767 [Mycobacterium smegmatis str. MC2 155]MTQDTSETCPVTSGSARPAAGCPAALGGYEAPPEVLGPDSLTWKIFGDWR
GLLQGPWAGSMQNMHPQLGAAVEEHSIFFRERIPRLLRSLYPIGGVVFDG
DRAPQTGAQVRDYHIGIKGVDSQGRRYSALNPDVFYWAHSTFFMGTILTA
ERFGGGLTEDQKRQLFDEHIVWYRQYGMSMRPVPKTWEEFQEYWDHICRN
VLENNYAAREVLDLSTMPKHPSLEWIPDWLWKLNLKILGPFAVWVTVGLY
DPPVRELMGYTWSDRDEKLHRLFGKAVHYTFKMLPERRRRHPRARAGWDR
AQGRIPADAPLVETPARNLPPLDARDSPWHYCPAVTK
118473844YP_886979.1 hypothetical protein MSMEG_2642 [Mycobacterium smegmatis str. MC2 155]MGSMCRNITELRGLEPAATAEEIEAAARQYVRKVSGITRPTGDNVDVFES
AVAEVTATTTRLLAGLAPRRQPPKTVPPLRRPEVRARMAAR
118473842YP_888033.1 hypothetical protein MSMEG_3733 [Mycobacterium smegmatis str. MC2 155]MSQDQNTDVPPNHLSIDPRSDFYSEEALQRGVGIRFNGVEKNNVHEYDVA
EGWVRVEVPTAKDRRGNPMVVKVTGTVEPYFRDAE
118473840YP_888196.1 tRNA (adenine-N(1)-)-methyltransferase [Mycobacterium smegmatis str. MMAGNRPTGPFAEGDRVQLTDAKGRHYTMVLNHGGEFHTHRGIIAFDDVIG
LPEGSVVKSTNGDQFLVLRPLLVDYVMSMPRGAQVIYPKDAAQIVHEGDI
FPGARVLEAGAGSGALTCSLLRAVGPEGSVTSYEVRDDHAVHAERNVVTF
FGERPANWNLVIGDVSDYDGPEMDRVVLDMLAPWEVLPAVSRALVAGGVL
MIYVATVTQLSRAVEALREQQCWTEPRAWESMQRGWHVVGLAVRPQHTMR
GHTAFLISARKLAPGAVAPMPLRRKRQIGGGI
118473838YP_888189.1 L-ectoine synthase [Mycobacterium smegmatis str. MC2 155]MIVRTTDEITGTDRDVSVGTWRSKRIILADDKVGFSFHETTIESNSVNEY
RYEHHVEAVWVIEGTGTLTDLETGVEYPLAPGTMYLLNGHERHRVTCDQQ
LRMLCVFNPPVTGQEVHDETGAYPAPQSVA
118473836YP_889859.1 cyclododecanone monooxygenase [Mycobacterium smegmatis str. MC2 155]MSQTTCGPTDTPTDIDIDALREKYRVEREKRLRAEGSKQYVETRDQFAQF
GEVDPHTPYVERDSLDIDIDVAVLGGGFAGLLVGASLKKAGVEDVHIIEM
GGDFGGVWYWNRYPGIQCDNESYCYIPLLEELGFMPSKKFADGAEIFQHC
RNIGKHFGLYDGAIFSTQVRDMRWEDDLKRWRISTNRGDDIRARFVVMAS
GSFNRPKLPGIPGIKDFGGHIFHSSRWDYSYTGGDTTGNLHKLHDKKVAL
IGTGATGVQLVPYLGRDAQHLYVFQRTPSTVDERNNTPTDPEWVKTLQPG
WQKERQRNFHAWTFEGMALGQPDLVCDFWTELGRNTAARVMALEDPASMT
PEQFMAIREEEDYKVMERLRRRVDQLVKDPQTAEALKPYYRFLCKRPCSN
DEYLSTFNRPNVTLVDVSETKGVERITQTGIVANGNEYEVDCIIFASGFE
ITTEIRRRFSIDSIKGRDGVSLYDHWADGYKTLHGMASRGFPNQFFTGFT
QVGISANISANYELQGEHIAYVIAEALNRGVTTVEPSQQAQDAWCRTIKE
NFVDNSAFDAECTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFGDLLKQW
RDKGDLDGLEIS
118473834YP_887486.1 DNA polymerase IV [Mycobacterium smegmatis str. MC2 155]MEGTVARTASRRWVLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVV
AGASYEARRYGARSAMPMHQARRLVGAPAVVLPPRGAVYGVASRRALDTV
RSVVPVLEQLSFDEAFGEPSELAGAEAADVEAFCERLRAKVLEHTGLVAS
VGAGSGKQIAKIASGLAKPDGIRVVRREEEAVLLHGLPVRKLWGIGPVAE
DRLHRIGIETIGAFAALTEAEAANVLGSTIGPALHRLARGIDDRPVAERA
EAKQISAESTFPEDLTTLAQLQDAIVPIGEHAHRRLEKDGRGARTVTVKL
KKSDMSTLTRSATLAYATTEASTLIGTARRLLLDPVEIGPIRLVGVGFSG
LSDIRQESLFPDLEQPEEFPDAAPQVESVQTGPSSPTTQWRVGDDVAHTE
LGHGWVQGAGHGVMTVRFETRASGPGPARTFPEDSPEISRADPVDSLDWA
EYLSSLADYQSTP
118473832YP_888930.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMASDVMLQHLDYLLALASERHFGRAAARCHVSQPTLSVAIRRLERDLGIT
IVQRGQRFEGFTEEGRRVVTWAQRIVAERDEMLADIERMQGRLTATARIG
AIPTAVPASPFVTDEFLRRNPAASVRIEALSSREIARRLADFEIDGGLTY
LDEETPPGTRSVELYREQYVLVAPGDDPLMGESPVSWSDAAGRPLCMLTT
AMRNRRILDANMAAEGAQYRPVVEADSVDALYAHLISSKRATIASTAWLP
QLGIPEGFAARPMVQHGPSPAIGLVVLDRAPASIVAAALAEVAEGIDLST
RIDRMWADMRPS
118473830YP_885956.1 hypothetical protein MSMEG_1577 [Mycobacterium smegmatis str. MC2 155]MGERVDGTARPATAEDTIALGAQLGAHLKAGDVVVLSGPLGAGKTVLAKG
IAQAMDVEGPVVSPTFVLARVHRARQADRPAMVHVDMYRLLDEPGADLLG
ELDALDLDTDLEDAVVVVEWGEGLAERLSDSHLDIHIDRRSDTETRTVTW
HWSRT
118473828YP_888729.1 hypothetical protein MSMEG_4456 [Mycobacterium smegmatis str. MC2 155]MSHELHLLAALSALSPPKLADVNADIREVCAAVTGLSPLPAESRGGAVDP
MVSEFAEQFSVDVTGINPAQRLAFSDLLGVETFRVATLIFIADFVPRVLA
GLSSLGVGVGVAVDGDIWDHDTDPGDFVLDVFGPAVGRMRALDPVTTEIV
RLRGARVHNCRLCKSLREATALEAGACETLYDQIDRYETSEMSDRHKAAL
RYVDAMIWTPSQAPGDELLRHFSHEEAVELTLDVMRNASNKVAVALGVDA
PRVSEGTEQYRLGADGQPIYT
118473826YP_886470.1 hypothetical protein MSMEG_2112 [Mycobacterium smegmatis str. MC2 155]MPTWSWIAIGVVVAVLVILAAICLVSMNRHKRSERLRSHFGPEYDRTVDT
AGDRKAAEKELLGRQRAHKKLDIVELTPEARARYFQAWTATQAEFVDDPA
GAVRDADRLVTDVMRERGYPIDDFEQRAADISVDHPKVVEHYRAAHVLHL
AQEHGEIGTEAQREAIVHYRALFEQLLGVHPTSNMPNTPEETRS
118473824YP_885664.1 gluconolactonase [Mycobacterium smegmatis str. MC2 155]MYTTRRNLLFGTAATIAAMTTGACSSSAAQQPQAQPSAPPTPSFQPNQRY
PDPAIEILDPSFAKYRLFSSSLEKVATGLRWAEGPVYFPDGGYLLCSDTP
NNRLMKFDEKDGSFTVFRHPSNYSNGNTRDRQGRLVTCEHSETRRITRTE
ENGDITVLADSFEGKRLNAPNDIVVKSDDTIWFTDPLFGINGEWEGSRAE
PEQATTNVYRLTPDGELTAVITDLVNPNGIGFSPDEKKLYVIEWRGTPNR
SLWSFDVNDDGTVANKTKLIDAADQGALDGFTVDRDGNLWCGWGSNGLVA
DQPTDVGGRKVYELRGKPEDLDGVMVFNPQGKPIGFIRLPERCANLTFGG
PENNRLYMAASHSLYALYVEAFGAT
118473822YP_888515.1 hypothetical protein MSMEG_4238 [Mycobacterium smegmatis str. MC2 155]MAAMATYLIDLSPEDMQRRLPDALRVYVDAMRYPRGTEEQRAALWLEHTR
RQGWKAVAAVEFGTDDGSHPETPSRDDLVAAPLLGIAYGYCGAPDQWWQQ
QVVSGLHRIGATREQIAELMSSYFELTELHIEPRAQGRGLGEALVRRLLA
DRGESHVLLSTPEINGEANRAWRLYRRLGFTDVIRGYHFAGDPRAFAILG
RPLPL
118473820YP_886949.1 hypothetical protein MSMEG_2612 [Mycobacterium smegmatis str. MC2 155]MTSREPSWEPDVLPGFWQRTIDLGPDPDGEGDLFATLVRRGDPESTGRAE
HAVLALHGYTDYFFNTELADRFAAHGFAFYALDLDKCGRSRRDGQTPHFT
TDLTRYDAELEQALSIIGYDTAGARVCLYGHSAGGLIVTLFADRMRRRNR
QATHNITGLVLNSPFFDLHGPGILRTAPTSLTLRALARWRKHTVIRKPTV
GGYGTTLHRDYHGEFEYNLDWKPVGGFPITLGWINAIRRGQAQLHRGLDV
GVPNLILRSDHSVRETDDPEAIQRGDAVLDVRQIARWAGCVGGRSTIVAI
PDAKHDVFLSLAEPRAQAYRELDRWLDEYLSLQNPTQRLVRDR
118473818YP_887724.1 gluconate 5-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTGLFDLTGRLAVVTGSSRGIGLAIAAGLAEAGARVVLNGVDGPRLEHTC
DGLREKFGTDAVYAARFDVTDPDEVSSAIDDIEQRIGPIEVLVNNAGLQH
REPLLEVSLANWQRVIDVDLTSAFLVGREVARHQLARGSGKIINICSVQT
DLARPSIAAYTAAKGGLRNLTRAMTAEWAGGGLQINGLAPGYIHTEMTQA
LVDDTSFNNWILGRTPAGRWGTVDDLVGPAIFLASPASAYVNGQVLFVDG
GMTAVV
118473816YP_885550.1 dihydrodipicolinate synthetase [Mycobacterium smegmatis str. MC2 155]MNGLMQPGVWGVLATPFSGSTLEVDDNGVAVLAEHAQAVGATGLTVLGVF
GEAAKLSWEERRRVLETVLDTTKLPLVVGCTSLATAPVIDEARMAVELVG
DRLAGVMVQANSADRTTLATHLRAVNEATGAHVVVQDYPVISGVHVPAGV
LGDVVAQAPFVTAVKAEAPPTPVAVAELTRRVDVPVFGGLGGINLLDELA
CGSAGAMTGFSYPEALVATVRAWRDGDRMKARAALLDHLPLITFEQQVGI
ALAVRKECLRRRGLIAESGVRPPGRSLPDCLAPVLATHIDTVEGR
118473814YP_888103.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MTPSETPSSITVDDTYTGHVEPGTAARRTLADATIVKASVGPMDNNCYLV
TCRSTGETLLIDAANDAEVIIGLVEQHAPKVSLIVTTHQHQDHWLALQAV
TEATGAPTAAHALDAGALPVKPDRILSDGDKITVGNLTFDAIHLQGHTPG
SVALALAGADGADGPTHLFTGDCLFPGGVGKTWKPGDFETLLGDVTTKVF
DVYDDRTVVYPGHGDDTTLGAERPSLAEWRERGW
118473812YP_890024.1 glycine cleavage T-protein (aminomethyl transferase) [Mycobacterium smMSAVPTPEGSPDAGAVWHYGDPLGEQRSAATDAVVIDRSHRAVLALTGKD
RQGWLHNISSQHVSAQPDGTVTENLSLDMQGRVEDHWVQTELDGTTYLDT
ESWRGEPLAAYLRKMVFWSDVQIEPADLGVLSLLGPALAGDAVLSALGLS
ALPEEATAQPLPGGGFVRRVPSEGLELDVLVARETLDDWKQRLVSAGVRP
AGMWAYEAHRVAAQRPRLGVDTDERTIPHEVGWIGGPGVGAVHLDKGCYR
GQETVARVHNLGRPPRMLVLLHLDGSSDRPATGDPVLAGGRTVGRLGTVV
DHVDDGPIALALVKRGLPAETELMTGGSVEVPASIDPDSLPPPDSVGAGR
LAIERLRHG
118473810YP_887754.1 haloacid dehalogenase [Mycobacterium smegmatis str. MC2 155]MALRALVFDVFGTLVDWRSGVADAFRSAGVVGDPDDLADAWRARYRPILD
EVNDGLRPWGNFDELHLATLQDVLSERDIALSPDQLTSLVHAWHRLDPWP
DVRDGLELLRSNFLIAPLSNGHVRLVVDLARHGDLRFDCILSAELAHAYK
PAPETYLTAAHLLDVDPSEVMLVAAHPSDLAGARAAGLRTAFIDRPLEHG
PATPKRSDRKADVSAADLHELARLLGDEGKA
118473808YP_889329.1 glucose-1-phosphate adenylyltransferase [Mycobacterium smegmatis str. MRELPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVN
ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSLNLIYDEDPDYIIIFGADHVYRMDPEQMMQFHIESGAGATV
AGIRVPRSEASAFGCIDADESGRIREFIEKPADPPGTPDDPEQTFVSMGN
YIFTTKVLIDAIRADADDDHSDHDMGGDIIPRLVADGMAAVYDFKNNEVP
GATERDHGYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGESENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVLMP
GVRIGRGAVVRHAILDKNVVVGPGEMVGVDLDKDRERFAISAGGVVAVGK
GVWI
118473806YP_890495.1 mur ligase [Mycobacterium smegmatis str. MC2 155]MLTVRGRAALAAGAAARWASRVTGRGAGAMIGGLVAMTLDRSVLRQLGQG
RRTAIVTGTNGKSTTTRMIAAALAPLGPVASNTEGANMDAGLVSALAANR
DAGLAALEVDEMHVPHVSDAVSPSVIVLLNLSRDQLDRVGEINHIERTLR
AGLARHPDAVIVANCDDVLMTSAAYDNPDVVWVAAGGTWANDSVSCPRSG
EVIVRDGRDWYSTGTDFKRPSPQWWFDETHIHGPDGLSVPMELALPGTVN
RGNATQAVAAAVALGADPVAAVAAVSTVDEVAGRYRTVQVGPRHTARVLL
AKNPAGWQEALSMVDRTGAGVVIAVNGQVPDGEDLSWLWDVRFEDFSGVQ
VVAAGERGTDLAVRLGYADVEHTLVHDTISAIKSCPPGHVEVIANYTAFL
QLNRRLS
118473804YP_886057.1 endoribonuclease L-PSP superfamily protein [Mycobacterium smegmatis stMTMTDIATPTHTRIRPFNTKDTYPEQNLDNDLCQAVVAGGVVYLRGQIGQ
DLETRESVGIGDVAAQTEKAMSNIAMLLEEAGSSLRDIVKVTVYLTDIRY
RETVYRIMGRWLKGVFPVSTGLVVEALARPEWLVEIDATAVVSEARG
118473802YP_890060.1 phosphoribosylformylglycinamidine synthase subunit PurS [MycobacteriumMNAVAKVVVHVMPKAEILDPQGQAIVGALGRLGHKGISDVRQGKRFELEV
DDSVTDETLNEIAESLLANTVIEDFTVSREDA
118473800YP_887069.1 GTP-binding protein [Mycobacterium smegmatis str. MC2 155]MTYPENSVAPSTGELALEDRASLRRVAGLSTELADVSEVEYRQLRLERVV
LVGVWTEGSAADAEASLAELAALAETAGSEVLEGLIQRRDKPDPSTYIGS
GKAAELREVVLATGADTVICDGELSPAQLNALEKAVKVKVIDRTALILDI
FAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQAGGRAGGAGGGVGT
RGPGETKIETDRRRIRERMAKLRREIRDMKKIRDTQRGSRRRSEIPSVAI
VGYTNAGKSSLLNALTGAGVLVENALFATLEPTTRRGEFEDGRPFVLTDT
VGFVRHLPTQLVEAFRSTLEEVVDADLLIHVVDGSDVNPLAQINAVRTVI
NEVVAEYDIAPPPELLVVNKIDAATGVGLAQLRRALPDAVFVSARTGDGL
DKLRSRMGELVESTDATVDVTIPYDRGDLVARVHTDGHVDATEHTDAGTR
IKARVPAPLAATLREYATFA
118473798YP_886027.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MTPSDPLKQQRSLSFGSEAAAYERGRPSYPPEAIDWLLPDGAHDVLDLGA
GTGKLTTRLVERGLNVIAVDPLAEMLELLSNSLPDTPALLGTAEEIPLPD
NSVDAVLVAQAWHWFDPELAVKEVSRVLRPGGRLGLVWNVRDERLGWVKD
LGNIIGHEDPFAHEVTLPAPFTDLERHHVEWTSYLTPQALIDLVASRSYC
ITSPEQVRTRTLGQVRELLSTHPALANSNGLALPYVTVCMRATLA
118473796YP_885010.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTAKAKEYAERGVAELHYARKMFEAGALRLEPPQHMLALVADIRTWGEIG
MIPALNARRHPNRVAVIDDEGEFTFGELDAAAHALANELLARGVRGGDGV
GILARNHRWFLVSLYGAARVGARIIMLNTEFSGPQIKEVAAREGARVIIY
DDEYTAAVAQAETELGKLRALGTNPDKEEPSGSTDETLAEVIARSGKRPA
PKASRHASIIILTSGTTGTPKGANRAAPPSLAPIGGVLSHVPFKAGEVTA
LPAPMFHALGFLHATIAMMLGSTLVLRRRFKPATVLEDIEKHKVTAAVVV
PVMLSRMLDHLEKMPQKPDLSSLRIMFVSGSQLGAELATRALKELGPVIY
NLYGSTEIAFATIARPQDLSRNPATVGPVVKGITVKILDDNGKELPQGEV
GRIFVRNTFPFKGYTGGGGKQIIDGMMSSGDVGYFDEHGLLYISGRDDEM
IVSGGENVFPAEVEDLISGHPEVIEATAIGVDDKEWGARLRAFVVKAAGS
SLTEDDVKAYVRDHLARYKVPREVIFLDELPRNPTGKILKRELRNIDA
118473794YP_885170.1 Na+/H+ antiporter [Mycobacterium smegmatis str. MC2 155]MGASLLAALVVAVLVAAVARRFDVSAPLVLVVAGLAGSTLPGFGDVALDP
DLVLFVILPPLLWSAGMESSYVALRRNMRSIGLLAVGLPLVTTFVVGIVA
YHTVPELTLAAALTLGAIVAPPDAVSATAVGRRLGLPRRTMTLLGGESLL
NDATALTAYKVALAAAIGAATSWGTALGTFALAAVGGLVVGLVLGMLVHY
VRTRLDDPLVESAIGLVAPFSIYLIAEEAHGSGVIAVVVAALLLGQRETQ
ASYATRLQDKAVWKALQLVLESFAFLLIGLQLPAVVGELAGISAATLAIS
SAAVLAAVIGVRIVWVYGCTYLGRLFTKNHEPPPSHAQVFILSWAGMRGV
VSLAAAFGIPLITLSGEQFPGRAQLCFLTFVVVVGTLLLHGLTLPWFIRV
LGAEGDEAHSDAIATAAAQDKAARAAAERLDALLAEQPASAEVSHRAADV
LRAWNTRRRNAAWERLGRDEEDIGESPTSAFRRLRLEMLAAERETFIAER
DAGHIDDEVLRTVLHGLDLEEATLNRD
118473792YP_888099.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMPSLATESDHSVIFVGFEGEIMKLHGATALVTGANRGLGHHLAVELIRRG
AKVYATARRPELVDVPGAHVLRLDITDQWSVEAAAAAADDVDVLINNAAF
TDGGNLVTGDLAKIRATMDSNYYGTLAMIRAFAPILARNGGGAILNVLSV
AAWRTVDGNTSYAAAKSAEWGLTNGVRVELARQGTHVAALVPGLIRTDTL
LEFARGNGIELPEEHMNEPADLARMALDGLEAGEVEIIDRMSVDAKAALA
GPPVTLSL
118473790YP_887449.1 hypothetical protein MSMEG_3133 [Mycobacterium smegmatis str. MC2 155]MTRRPPGTRHLLAERVCGGELSPDTSSSTGPIGVGQQLRLPSGPPEHLEY
QQHQVDGRRDGVAPCSGQGVPHRDDDRHGEQEDDQGPPHPGVVGGSTHPG
GVVLRARAKPRVADAPPGAGRAHHDRAVGAVEAGPGRPVPRHAQRGPRPA
RERQDDEHREAREPPSRVDPGQRTEEPTGTDPGDQCAKDESASPDEGRDP
DHSLIVDAMSCG
118473788YP_886564.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MIDRTGLAEFLRHRRESLQPEDVGLPRGRRRRTNGLRREEVAALCHMSTD
YYSRLERGHGPKPSEQMIASMAQGLHLSLDERDHLFRLAGCSPPARGTDS
EHISPGMLRIFDRLDDTPAEIVTELGETLRQTPLSVALTGDLTVHTGPAR
SIGYRWFTDEATRRLYAPEEHDFLTRMFVSNLRALVALRGAGSRAAHYAD
LLLSESDEFRRVWDDHEIGLRPREVKHFVHPELGTLELHCQTLLDPEQSH
LLLVYTAVPGSESREKLQLLSVIGAQALR
118473786YP_887251.1 HIT family protein hydrolase [Mycobacterium smegmatis str. MC2 155]MTDPDERQIVDRGVGDPDHLQRLWTPHRMSYIAEAPMKKRGEGGSAGSAE
PFTDIPEMPDEEGLMVARGKRVYAVLNLYPYNPGHLMVVPYRRVSELEDL
TEDESSELMAFTQKAIRVIKAVSRPHGFNVGLNLGSSAGGSLAEHLHMHV
VPRWGGDANFITIIGGSKVIPQLLKETRQLLATEWVRQDQLAAGTDGKDG
KAPTS
118473784YP_890410.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MSDLQHPAYGLLRPVTGSASVLLCNNPGLMTLEGTNTWVLRAPRSDEIVV
VDPGPDDDEHIARVAELGTISLVLISHKHEDHTGGIDKIVERTGAVVRSV
GSGFLRGLGGPLTDGEVIDAAGLRITVMATPGHTADSLSFVLDDGDGPGA
VLTADTVLGRGTTVIDTEDGSLRDYLDSLHRLKGLGERVVLPGHGPELGD
LSGVAQMYLAHREERLEQVREALRELGDDATARQVVEHVYTDVDEKLWDA
AEKSVQAQLDYLRH
118473782YP_888316.1 hypothetical protein MSMEG_4030 [Mycobacterium smegmatis str. MC2 155]MSASKVIERALPLSASDKIGAILGRYGLVIVIGWIGALKFADFEAHQIQP
LVANSPFMGWLYNFLPVYTFSALLGVFEVTAAVLLAIKPIAPRLSIYGSL
MAIVLFVFTVSFLFSTPGVSEPAGGGFPAISLTAEFLLKDIPLLGLSFWT
LSDALRASQQRRG
118473780YP_886794.1 translation initiation inhibitor [Mycobacterium smegmatis str. MC2 155MSVRERLSALGIEIPPPAEPKGAYFPSRLVGDQLWISGTTSRRPTEPGAF
GTVGEDVTPEQAQKHAGYAALNLIAAVDAAVGLEAVRGLVHLRGYVRASP
HFDSHPAVIDGASRMLMDVFGEQRGAHARTAVGVASLPGGACVELELVAS
VRP
118473778YP_890418.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MTDPARTLPLSAMISGAAGMLIPLAGARDPGDDPLVSDVALHEPGEPADY
RGTIVLVNSRIDDRFVLGSLLDEVGTAGAVVLPPGATTDLSLVRGHTARL
FRRSPWVGWSELFRVLVRLLGAGHTVDPAPQVDNLQALARWISTRTGAPV
TIEDLDSRVLAYAVVGHDVDPIRNQTILGGAVPAWRVERLMSTGFLPAVW
RSDDVVVRNAENGDPARMVVSVKTGGETLGTIWAALDDATDRDALRQLLL
QVRQTAAAMMLREVHLEQYERRLREAALVDLISRGVDPGVPAALLGLQPD
TRHVVVALGADAPESRSLMFHMQALRAGARPARVGTDLLVVVPLQDDEVT
DADVAGNLSVHLARVSRARCGTVAVGSVVDSILDLQRSAVVARQVLDAAA
LDIGCRRTREATPPVITAADVADPLTLVRAADLLDPLGDAIAEPLRALRR
HDIDHGTAFVDTVAAVLDHPGNLSGAARELGIHANSLRYRLDRITAVAGL
DLQSAAARLRAALALLVWERRGESVRATVHFDEKRGSR
118473776YP_886845.1 carboxyvinyl-carboxyphosphonate phosphorylmutase [Mycobacterium smegmaMEARRKLNAQIESGTLTVAPGVYDGLTAALVKRREFNAAYMSGAAVAASL
GLPDLGLTSQSEMAARVALLTGVLGDVPLIADADTGFGDIINAVRTVQLY
ERAGVAAIQLEDQMFPKKCGHLDSKEVVAPEDFQRKIEAVVEARTDDRML
VIARTDALASRGFDDAVARARSYVEAGADVIFIEAPQTAEQIAAIPGLIS
KPTLFNVVPRGKTPPVSLEMLQTAGYSIVIAPGLAFGAAADAVDHALATL
RDGDTDTGSQWSPNELFRAVGLDYWDEVGKRFATPTVGV
118473774YP_889805.1 ATP-dependent DNA ligase [Mycobacterium smegmatis str. MC2 155]MERYERVRLTNPDKVLYPATGTTKAEVFDYYLSIAQVMVPHIAGRPVTRK
RWPNGVAEEAFFEKQLASSAPSWLERGSITHKSGTTTYPIINTREGLAWV
AQQASLEVHVPQWRFEDGDQGPATRIVFDLDPGEGVTMTQLCEIAHEVRA
LMTDLDLETYPLTSGSKGLHLYVPLAEPISSRGASVLARRVAQQLEQAMP
KLVTATMTKSLRAGKVFLDWSQNNAAKTTIAPYSLRGRDHPTVAAPRTWD
EIADPELRHLRFDEVLDRLDEYGDLLAPLDADAPIADKLTTYRSMRDASK
TPEPVPKEIPKTGNNDKFVIQEHHARRLHYDLRLERDGVLVSFAVPKNLP
ETTAENRLAVHTEDHPIEYLAFHGSIPKGEYGAGDMVIWDSGSYETEKFR
VPEELDNPDDSHGEIIVTLHGEKVDGRYALIQTKGKNWLAHRMKDQKNAR
PEDFAPMLATEGSVAKYKAKQWAFEGKWDGYRVIIDADHGQLQIRSRTGR
EVTGEYPQFKALAADLAEHHVVLDGEAVALDESGVPSFGQMQNRARSTRV
EFWAFDILWLDGRSLLRAKYSDRRKILEALADGGGLIVPDQLPGDGPEAM
EHVRKKRFEGVVAKKWDSTYQPGRRSSSWIKDKIWNTQEVVIGGWRQGEG
GRSSGIGALVLGIPGPEGLQFVGRVGTGFTEKELSKLKDMLKPLHTDESP
FNAPLPKVDARGVTFVRPELVGEVRYSERTSDGRLRQPSWRGLRPDKTPD
EVVWE
118473772YP_887087.1 hypothetical protein MSMEG_2756 [Mycobacterium smegmatis str. MC2 155]MNATLTSPELTRADRCDRCGAAARVRAKLPSGAELLFCQHHANEHEAKLI
ELSAVIEVSPVEA
118473770YP_885095.1 hypothetical protein MSMEG_0687 [Mycobacterium smegmatis str. MC2 155]MAHSHSHSHSLSGPSPLGPLAARIVVGLLVAIGVVVIVGAALLWPSRQKV
DIPLPYQNAAGGAVTTETGHVLSSTLTACGSPSVGAVLTSDPVSSPGDAG
QCVQNLVAIDSGPNKGARTLLEFSGGPGQPNLVAGDDVRLSRQVDASGAT
SYAFYDYERTWPLIALAAVFAVVVVAVARWRGLRALIGIVVAFGVLVVFL
LPALRDGASAVPVSLVASAVILYAVIYLAHGVSLRTSAALLGTLTALFLA
ALLSWAAIELAHLTGLAEDQNNDVAAYMGNVSITGLLLAGFIIGSLGVLN
DVTVTQASAVFELAEAGGTRRSIFVGAMRVGRDHIASTVYTLVLAYAGSA
LPLLLLFSVANRSLGDVLTSENVAVEVARSAVGGIALALSVPLTTGIAAV
LATPSVASPAR
118473768YP_890456.1 two-component system- regulatory protein [Mycobacterium smegmatis str.MTVTTREIRLALVDDHAILRQGLRSLLEREDDLVVVGEASSEAEAEAMVA
AVEPDVVLLDLKLSAGSDFEGLSLCAKLSAAHPDLGLLVLTTFLDEDLVV
RAVHAGARGYVVKDVDTTELVRAIRAISSGDSAFDSRSAAAVVRSLSGRT
EPREQLTDREIEVLRLLAAGLSNNKIGEKLFISATTAKFHVSNIMRKLDV
SRRAEAVYAASKRGLI
118473766YP_886790.1 hypothetical protein MSMEG_2450 [Mycobacterium smegmatis str. MC2 155]MTAIQESTLLPNGLTVDTAKAEAARAYELDRAHVFHSWSAQEEISPMTVT
AAQGSYLWDGDGNRLLDFSSQLVNTNIGHQHPKVVAAIAEQAAKLCTVAP
QHANAARSEAARLIAERTPGELNKIFFTNGGADAVEHAVRMARLHTGRYK
VLSRYRAYHGGTDTAINLTGDPRRWPNDRGNSGIVHFNGPFLYRSSFYAE
TEEQESQRALEYLEKLIQMEGPSTIAAIILESIPGTAGIMVPPPGYLAGV
RELCTRYGIVFIADEVMAGFGRSGKWFSINHFDVVPDLMTFAKGVNSGYV
PLGGVAISPEIYETFAHRAYPGGLTYSGHPLACAAAVATINAMEDEGMVE
NAAKVGAEVIGPGLAELAAKHRSVGEVRGLGVFWAVELVKDQKTREPLAP
YGSSSPAMNAVIAACKSGGLLPFANFNRIHVVPPCNVSADEAREGLAILD
SALDVADEHTV
118473764YP_888031.1 dipeptidase 2 [Mycobacterium smegmatis str. MC2 155]MLIDGHNDLAWAMRQEYDADLDAVDLTAMAPRLHTDLKRLEAGGVTGQFW
SVYVPPQQFTGPSAVSATLEQIDLVRRLVARYPDRLVLATTADEVERSGD
RIASLLGMEGGHCIDGSLAVLRMMRALGVRYLTLTHNKNVSWADSATDDP
VLYGLSEFGEDVVREMNRLGMLVDLSHVSADVMRHALRVTAAPAIFSHSS
ARAICDHPRNVPDDVLAMLAKNDGVCMVTFLPAFVSPAVARWHAEAKAEA
RRRGVQKGELAYDALMMELTEQSPPPVATLSDVVAHVEHVRAVAGIDHVG
IGGDYMGAEAMPEGLEDVSGYPRLFAALADRGWSRADLAKLAGENIIRVL
RAAEDVADPAG
118473762YP_886294.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALK
TLSAGFAAAPDRDGLLEAVQQANLRVFELLGDEPTVSGTTLTAVAVFEPG
QGGPLVVNIGDSPLYRIRDGHMEQLTDDHSVAGELVRMGEITRHEARWHP
QRHLLTRALGIGPHIGPDVFGIDCGPGDRLLISSDGLFAAADEALIVDAA
TSPDPQVAVRRLVEVANDAGGSDNTTVVVIDLG
118473760YP_889548.1 aerobic C4-dicarboxylate transporter [Mycobacterium smegmatis str. MC2MSTTLDRQPEPAPPRRRDRTHWLYIAVIVAVVAGVAVGLLAPEVGKSVGV
LGTMFVNLIKMMIGPVIFCTIVLGIGSVRKAATVGKVGGLAFTYFLVMST
FALAIGLVVGNVLHPGTGMHLTESAAGKGAELAETAHEAGGLMDFVQGII
PETLFSALTAGSVLQALFVALLVGFALQAMGSAGEPVLRGIVHLQKLVFK
VLAMILWLAPIGAFGAIANVVGQTGWTAVTQLLALMFGFYVTCFVFVFGV
LGVLMRAVAGVSIFKLVRYLAREYLLIVSTSSSESALPRLIAKMEHLGVD
RSTVGVVVPTGYSFNLDGTAIYLTMASLFIAGALGDPLSVTEQIGLLVFM
IVASKGAAGVTGAGLATLAGGLQAHRPDLLDGVGLIVGIDRFMSEARAVT
NFSGNAVATILVGSWTHTIDKDKVDAVLGGDDPFDELTMVDDHQTAAPEK
EPAATPA
118473758YP_886447.1 transporter small conductance mechanosensitive ion channel (MscS) famiMTISSSAATVLAFSVADRWHDFWHGEIGVWILTKGLRIALLLIGGLLAAR
FISWAAQRVVRRIDAEYQESDQLVRSESAKHRQAVASVISWVSVALLFVI
VLVEVTDVLAVPVASLVAPAAVLGAALGFGAQRIVQDLLAGFFIITEKQY
GFGDLVRLTIGASNEAEGTVEDVTLRVTKLRSTEGEMYTVPNGQIVKSLN
LSKDWARAVVDIPVSVSVDLNVVNDVLNEVAERATEDAELSKLVLDKPQL
MGVESIGVDTVNLRMVARTLPGKQFEVGRRLRVRVVRALRRAGVVTSSDA
SVAAAGDIIHPAAAAEVQIAPQEPKK
118473756YP_889595.1 hypothetical protein MSMEG_5351 [Mycobacterium smegmatis str. MC2 155]MTRKRLAIAGLAFGLLALIAGVLQVSVYLINDGPRHLVVGIFAVSVGVSV
LVAAGQSLRR
118473754YP_884935.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTVWFITGASRGLGAQIARTALDHGADVAVGVRNPDLLPSDIAERAFAVR
LDVTHDADISAAVAAVVERFGRIDVLVNNAGRGLLGALEEVTDAEARSLF
DLNVFGLINVTRAVLPHMRASGGGKLVHIGSRSGFEGEPGVGLYSASKFA
VAGISEALSAELAPFGIQSMVVEPGVFRTDFLDGSSLSMPANRIDAYDGT
PAHDTLDWVDDANHTQLGDPVKGAALIYEVANEDKLPRHLLLGRDAVERW
RVKAAQMADDVTAWEMKSLATAHLA
118473752YP_890079.1 phosphoribosylamine--glycine ligase [Mycobacterium smegmatis str. MC2 MAPGNAGTSSIADQYDVDVTSGEAVVKLAQRIGADLVVIGPEVPLVLGVA
DAVREAGIACFGPTKDAARIEGSKAFAKDVMSAAGVRTATSEVVDNPGHL
DAALDRFGPPAGQAAWVVKDDGLAAGKGVVVTADRDAARAHAASLLDSGH
PVLLESFLDGPEVSLFCVVDGETVVPLLPAQDFKRVGDNDSGPNTGGMGA
YAPLPWLPDSVTTQIVDEIVKPVAAELVRRGSSFSGLLYAGLAITSNGPA
VVEFNCRFGDPETQAVLALLESPLGQLLRAAATGELASFGELQWHDGYAV
TIVVAAENYPGRPRVGDPIHGADADGVLHAGTARRDDGAVVSSGGRVLSV
VGTGADLSAAREAAYGLAKSIRLPGSHFRSDIGLAAAEGRISV
118473750YP_885837.1 multidrug resistance protein [Mycobacterium smegmatis str. MC2 155]MTDVRQTPTPDAAPPTGADTGTPLGLAALLAGTLVGTVSNNVVNVPLDAI
IGEFDASLGNGVFVVVGFLVCFAATIPLAGWFGDRFGRRRVYCAALLATA
VCAVGAATAPSLPLLIAWRSVGGVAAAAFAPAVMGLLAWMFSGARRGRAM
GAWASVNGIGQAVGPSLGGLVADHWGWRWIFVPLVPVALAGFVGTLRYVP
KFPGARMRFDLAGAAALTFGSALLMLGLAIVPQPNVSGWAAAGSVALGVV
ALVWFCFHCARVPNPFVNVRLVTESRFARSALAAFAQMFCLGATLLAVPL
YLVAHAVSISTAGLVLFTVPVAMAVLGPVVGRRQDRLGPRLVLRVGLVVL
LAVQIALAVTVAQDRLLLGVLIAALVTAGVGIALVQTPAATGATRSPAGA
EGTGLGLFNLVRFAGSACGAAWVAVALSGPASFPGVFIASAVIVALGLAG
TFFGPDPA
118473748YP_886989.1 iron repressor protein [Mycobacterium smegmatis str. MC2 155]MSPDGDHRDLSSVAQDYLKVIWTAQEWSREKVSTKLLAERIGVSASTASE
SIRKLADQGLVHHEKYGAVTLTDAGRRAALAMVRRHRLMETFLVQELGYG
WDEVHDEAEILEHAVSDRMLDRIDAKLGHPTRDPHGDPIPAADGQVPTPP
ARQLSVCQDGDAGTVARISDADPEMLRYFDSVGISLDSRLRVVARRDFAG
TISVAIEDPAVPEGDPEATVDLGSPAAEAIWVVGAS
118473746YP_888931.1 oxidoreductase alpha (molybdopterin) subunit [Mycobacterium smegmatis MTRASDVRDYDADYDDHDVITSGPKHEAAGVKAVMVSMQRGLTQMGPVRT
TAALTRLNQRHGFDCPGCAWPEEHGGRKIAEFCENGAKAVAEEATKRRVT
PEFFARHSVAELQNKPEYWLSQQGRLTHPMVLHEGDTHYRPIAWDDAYRL
IADELNALDSPDEACFYTSGRTSNEAAFLYQLLVRSYGTNNLPDCSNMCH
ESSGTALTESIGIGKGSVTVDDLIHADVIVIAGQNPGTNHPRMLSILEKA
KANGAKVIAINPLPEAGLIRFKDPQKVHGVVGHGVPIADEFVQIRIGGDM
ALFAGLGKLLLEAEDKAPGTVVDHEFVAAHCAGFDEYAAQTRAVDLDTVV
EASGIDRTQLQRVADMLIGSERTVLCWAMGLTQQHHAVATIGEATNLLLM
RGMIGKPGAGVCPVRGHSNVQGDRTMGIWEKAPDAFLDALDAHFGITSPR
KHGYDAVDSIRAMRDGKAKVFMAMGGNFVSASPDTEVTEAALRSCNLTVQ
VSTKLNRSHFVPGRKALILPTLGRTDRDIVDGRKQLVSVEDSMSMVHLSR
GSLKPPSAELRSEVAIVCQLARTLLGPDHPVPWETFASDYDTIRDAIAAV
VPGCTDYNTRVRRSDGFQLPHPPRDSREFPTHTGKANFSVYPLEWVPVPE
GRLVLQTLRSHDQYNTTIYGLDDRYRGVKGGRRVVFVNPTDIARLGLKPD
DRVDLISEFEGQERWAKDFLVVPYSTPEGNAAAYYPETNPLVPLDHTAKK
SNTPVSKAVVVRLQRREGSAS
118473744YP_886717.1 NAD(P)H:quinone oxidoreductase- type IV [Mycobacterium smegmatis str. MTSSATKVAVIYYSATGHGTTMAQRVAASAEAAGAEVRLRHIAETQDPQT
FTQNPAWTANYEATKDLPAATGEDIVWADAVVFGSPTRFGSPAAQFRAFI
DSLGGLWAQGRLADKVYAAFTSSQTAHGGQESTLLNLYVTLMHFGGIIVP
PGYTDEVKFADGNPYGVGLIANRTNITEIDEITNNALDHLARRVVTVAGR
LAG
118473742YP_886075.1 pentachlorophenol 4-monooxygenase [Mycobacterium smegmatis str. MC2 15MTIATDVLIVGAGPVGLAAAMVLTQQGRDVTVVDGQAEGANTSRAAVVHA
RTLELLEPYGVVDDLVNRGVHTPAFTIRDRDELLVEVPFGRLPTAYPYTL
MISQADTEAFLLKRLEALGGKVIRPATVTSVTQHGTHAMVTFEDGQRIRA
RYVVGADGMHSTVREAARIPFSGSTYAESFVLADVRLSGGIPTKEVILYF
SPAGLVVVAPLPDGIHRIVATVDAQQAQAHPDAAFVQGLLDERGPHASPA
AVRDVVWSSRFRVHHRVADTFRANRILLAGDAAHVHSPAGGQGMNLGIED
AVMLAGALSEVLDGAPDTALDDYAADRRRTAQKIVAATGRLTDLATASAR
KRPLRNRIMRAAGSLPAVRRALAWRLSGLDRR
118473740YP_889814.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMTDSLPGLDKDENRTWAHFLESTTLILDELNRQLMSCHDMTLPDVQLLDL
LAKSGNGSARVGDIADELTAPPSTATGQIARLEEAGLVRRGVSSKDRRGV
TVTLTPAGCRRLKPALATYARFVRLNYLNPLTRRQMLAVGDNGRRISEGL
RGPRRS
118473738YP_887609.1 response regulator receiver domain-containing protein [Mycobacterium sMALPAVSDDWLVALATGGFGHQSSLVTMGLTNSEQEDMMTTATTPLVPPF
ASATAIAKVRAAENLWNTREPERVARGYSTDSVWRNRSAFIHGRPAIVEF
LKAKWATELDYRLIKEVWAYGDDRIAVRFAYEYHDAAGQWFRAYGNENWE
FDPDGLMRHRHASINDLAIAESDRLFHWDSSGPRPDRHPGLSELGL
118473736YP_888586.1 low molecular weight protein-tyrosine-phosphatase [Mycobacterium smegmMSELHVTFVCSGNICRSPMAEKMFAHQIAERGLRDVVRVTSAGTGSWHAG
DGADERACLVLADRGYPTAHRAAVVDDDHLSADLVVAMGRNHARILADLG
VEPDRLRMLRSFDPRAGAHTPDVEDPYYGTRDDFEAVFEVIEAALPGLHD
WVDEALAARGIVA
118473734YP_886283.1 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [MycobaMKMAEDVRAEIVASVLEVVVHEGDQIGEGDTLVLLESMKMEIPVLAEVAG
TVTKVNVAEGDVIQAGHLIAVID
118473732YP_888673.1 hypothetical protein MSMEG_4398 [Mycobacterium smegmatis str. MC2 155]MKLGLRLPQRLNVDLRHDVVWAARAAEAAGFASLWTYERLLFPADPVESY
AGTDAPWPTHSRQAADPLAVLTAAAVVTETARLGTSVLVAGLHTPIQLAK
ALATVDQISGGRMIAGLGTGWSTDEFRAAGARRADRGPLLDETRDVLDAV
WARDPVTFRSPHVIIDDAAVLPKPVAQMPVLLAGGGSLPDRSASKAMRRI
AARADGWLPLLTEPGQAGATRLRTDWDRIRELAAERGRTPDAMEMIVVGN
VTFTERSAGPDRPAFVGTFDQIVEDVHTAAEAGADELIVDLNLQDWFTST
PQMLETAVQIHERFVAA
118473730YP_887459.1 hypothetical protein MSMEG_3144 [Mycobacterium smegmatis str. MC2 155]MTGPHVIPFLPAYIPVEICDIAGIDPAVPDAVAQCMAAVQADVREDGVSA
PPEAVEGLRQVVADAREAGIDLKIVAIPRNPAIDTPLRDIATEVGQENPG
ATVLAVSPSFAGTYSTSFDRVTLEAGQDVAKTGDPVLSANNFLAEIQKPD
FPWMTLTIVLVLGVAAAAALTRVLQVRSKALASSGERDGQSVGDATPIEH
118473727YP_887264.1 Holliday junction DNA helicase RuvB [Mycobacterium smegmatis str. MC2 MGRFEDDAEVEDREVSPALTVGEGDIDASLRPRSLGEFIGQPRVREQLQL
VLEGAKKRGGTPDHILLSGPPGLGKTSLAMIIAAELGSSLRVTSGPALER
AGDLAAMLSNLVEHDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGP
GATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPVELERVL
ARSAGILGIELGAEAGAEIARRSRGTPRIANRLLRRVRDFAEVRADGIIT
RDIAKSALEVYDVDELGLDRLDRAVLSALTRSFNGGPVGVSTLAVAVGEE
ATTVEEVCEPFLVRAGMIARTPRGRVATPLAWTHLGLQPPVTGIGQAGLF
D
118473725YP_887423.1 ABC transporter ATPase [Mycobacterium smegmatis str. MC2 155]MASVTFSKVEKSYGAVTVVKDLDLELADGSLTVLVGPSGCGKTTSLRMLA
GLEPVTSGTIHIGDRDVTRLEPRDRDIAMVFQNYALYPHLTVRENIAFPL
RATKTPRAEALKRADDIAASLGLGALVSRKPKDLSGGQQQRVAIGRAIIR
EPAVFLFDEPLSNLDAKLRVETRTELLRLQRRLGITSLYVTHDQEEAMTL
SDRIVVMRDGQIAQAGPPEEVYRRPADTFVATFVGSPKMNLVDGAVSGGE
LRTESGLRIRVGGPDAAAVTVGVRPDDLTLRPVQTTATTASAAPTVELVE
LLGPRAIVTVRSGELRLTSVVDAPSLSEIPTGTAVELSARDVHRFDIATG
TRLPD
118473723YP_887511.1 lipase [Mycobacterium smegmatis str. MC2 155]MDLSSAAKAADAEWIGRAPHEELDRDARPGLPGEDPFYLPPAGYHHAEPG
TVLRSRDVELAFLGLVPQALHATQLLYRTTDRNGAPEAAVTTVIMPPDAR
AGCPIVSYQCAIDAISATCFPSYALRRHAKVTGGLAQFELLLITAALAEG
WAVSVPDHEGLDGMWGAPYEPGYHVLDGLRAALNSERLPLTDASPIGLWG
YSGGGLASGWAAEMSGSYAPELNIVGAVLGSPVGDLGHTFRRLNGTVFSG
LPALVVAALADIYPGLNRVIAEHATTEGRKLLQRLHKMSTIEAVLRLARK
DMDDLVDLPLEQILDSPEVTEVFDDIKLGVATPNPPVLLIQAVHDELISV
SSIDELAEKYLTGGASVTYHRDLFSEHLLLHPMSAPMALRWLTDRFAARP
LTANLVRSKWPTLLNPVTYVGMARLAGIAAKVVTGRALRRSPL
118473721YP_885416.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAVVAATDRSVRLEVTDRAPQERGDAARNRAAILDAARRLIAERGPDAVS
TDDIAVEAGVGKGTLFRRFGTRAGLMMVLLDEDEKAHQDAFIFGPPPLGP
GAPPLDRLLAYGRERMKFVREHHALLSDAARDPQARFGGPDTLHRSHVRM
LLQAAGTTGDLDAQADALVALLDADYVAYQLERGRSCEVQAAAWADTARK
LCGH
118473719YP_888797.1 coproporphyrinogen III oxidase [Mycobacterium smegmatis str. MC2 155]MTTRTAPLGQPDLAPTPGRPFGIYIHVPFCATRCGYCDFNTYTPSELGGA
NPEGWLEALRVELRLAAERVGALAVQTVFVGGGTPSLLGGDGLSAVLDAV
RDNFVLATGAEVTTEANPESTSPELFAALRNAGYTRISLGMQSVAPHVLA
VLNRTHSPGRAPAAVAEAKAAGFEHVNLDLIYGTPGESDDDLLRSVDAAV
HAGVDHVSGYALVVEDGTALARRVRRGEIAAPDDDVLAHRYELLDAQLSA
AGFAWYEVSNWSRPGGECLHNLGYWDGGEWWGAGPGAHGFLNATRWWNAK
HPNAYAQTLAEGALPIADFEVLDAADRHTEDVMLRLRLRRGLALDDLAAD
ERARVPEIVAEGLLDTAGERVVLTDRGRLLADGVVRALLA
118473717YP_885461.1 hypothetical protein MSMEG_1065 [Mycobacterium smegmatis str. MC2 155]MTYLESILKVLVVGLILGAGLPALFATGLLAFAGTDADADGTAAARNPVM
KFLGLALFVFVGAVILVAILWITRGTIIHHTGVDLFPFLPRK
118473715YP_885296.1 hypothetical protein MSMEG_0893 [Mycobacterium smegmatis str. MC2 155]MAGTPNGNQEGGLAAIYLVAGAVVLIVGVVALFVAKDARLERRLYWATAA
VGGLLVSLAALHRGWGTVVAAYLAILVVTALYAFLRTDYLKIRSRVYSAW
DLIGKSK
118473713YP_886942.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTDGSTTSNRRATDDIFTKVTPGRASEMILDQIRSLIRDGHLKPGDRLP
SERELGDRFGVSRVTVREALRGLEANAMVTIKVGAHGGAFVTAPTSSRVS
EGIVDLLSMSGLTDIEITEARQVFELGIIPLVCERATEADIEELLQICDR
GDAAAGQGSSSMELSAQFHTRVAEASHNAALAMLAEAFYGPTLVSLRHVQ
EGHPEIGVRSSREHRQFVMAVKKGDVEKATAVMRTHLGRTARHVKG
118473711YP_886328.1 hypothetical protein MSMEG_1962 [Mycobacterium smegmatis str. MC2 155]MRFWLAVLSALVLAVGLVACDTDDDGWNPEAQFAPVKRPAFGARETDGKL
VIWVPPGCVGVWSVKLMFGLSGPDLVLTPTVGTVSFDRFTVGGPYPPGMA
VTKAPPPDFDWRTVDTLHLDVGTTPGGFPSTSVVADIVESSGDHPDNTFF
FDGVGWLDPEGVAARIGNDFEGVCTPQETRG
118473709YP_886439.1 antigen 85-C [Mycobacterium smegmatis str. MC2 155]MTFIDKIRGHWARRMTVAAVAALLLPGLVGVVGGSATAGAFSRPGLPVEY
LMVPSPSMGRDIKVQFQSGGPGSHAVYLLDGLRAQDDFNGWDINTNAFEM
FLDSGLSVVMPVGGQSSFYSDWYQPACGNNGCVTYKWETFLTSELPEWLA
ANRDVAATGNAAIGLSMAGSAALILAAYHPDRFIYAGSMSGFLNPSEGWW
PFLINISMGDAGGYKANDMWGPTEDPNSAWKRNDPMVQIPRLVANNTRIW
VYCGNGQPNELGGGDLPATFLEGLTIRTNETFRDNYIAAGGNNGVFNFPN
NGTHNWAYWGRELQAMVPDLQRVLG
118473707YP_886992.1 LppU protein [Mycobacterium smegmatis str. MC2 155]MQAGDCLELGGTFDQPEATRAECGSKKSNYKVVQTVADSARCPADVDSYY
TLSSRFGGETHTVCMDIDWVVGGCMNVDPENNTDPYRVDCSDAGAPHRQR
VTEVLEGISNPDQCATGLGYAYDERQFTVCVENVR
118473705YP_890379.1 hypothetical protein MSMEG_6159 [Mycobacterium smegmatis str. MC2 155]MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRTI
118473703YP_889730.1 acetyl-CoA carboxylase carboxyltransferase [Mycobacterium smegmatis stMTALHSTIDATSPGFNEAAAVMTAKLSELDAEHAKALGGGGPKYVDRHHA
RGKLTARERVELLLDPDSPFLELSPLAAWGTDFAVGASVVTGIGAVEGVE
CLIVANDPTVKGGTSNPWTLKKILRANQIALQNRLPVISLVESGGADLPT
QKEIFIPGGQMFRDLTRLSAAGIPTIALVFGNSTAGGAYVPGMSDHVVMI
RERSKVFLAGPPLVKMATGEESDDESLGGAEMHARTSGLADYFALDEPDA
IRIGRRIVARLNWRKQGPAPAEVVEPRYNAEELIGIVPADLRVPFDPRDV
IARIVDDSDFDEFKPLYGSSLVTGWARLWGYPVGILANARGVLFSEESQK
ATQFIQLANRADTPLLFLHNTTGYMVGKQYEEGGMVKHGSMMINAVSNST
VPHISLLIGASYGAGHYGMCGRAYDPRFLFAWPSAKSAVMGGTQLAGVLS
IVSRAAAEARGQTVDEDADAALRAAVEAQIEAESLPMFLSGRLYDDGVID
PRDTRTVLGMCLSAIANAPVEGTSNFGVFRM
118473701YP_889243.1 hypothetical protein MSMEG_4991 [Mycobacterium smegmatis str. MC2 155]MKIKYTLAGLGAAAAVSMGAFGVLGGSGLSGSAQFDEALGPTMGETSTQT
GAPTELETSIATPPIEVELPDGYGAAG
118473699YP_886489.1 long-chain-fatty-acid--ACP ligase [Mycobacterium smegmatis str. MC2 15MNVLSAALTEAMTTSSADLVVFEPETRTWHRHPWGQVHLRAQNVAERIGQ
DGSSAVGIVGEPTVEGVAAILGALLAGSAVSILPGLVRGADPDQWADSTL
NRFANIGVTTVFSHGSYLEQLRTRDSSLVIHDDAEVAHAQRSTTLELGAP
LGEFAVLQGTAGSTGTPRTAQLRPDAVLANLRGLAERVGLAGSDIGCSWL
PLYHDMGLTFLLSAAVGGTETWQAPTTAFASAPFSWVHWLTESRATLTAA
PNMAYGLIGKYSRRLTDVDLSAMRFALNGGEPVDIDGTARFGTELSRFGF
DPGALSPSYGLAESSCAVTVPVPGVGLKVDEITVTTEAGSSTQKLAVLGH
AIAGMEVRLQPGDEDAGVVDREVGEVEIRGTSMMSGYRGEAPLDPGEWFP
TGDLGYLTDDGLVICGRKKELITVAGRNIFPTEIERIAARVKGVREGAVV
AVGTNERAVRPGLVIAAEFRGPDEAGARSEVVQRVASECGVVPADVVFLA
PGSLPRTSSGKLRRLEVKRQLEESKG
118473697YP_885397.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MAPRSATVTVVLPCLDEEQSLPAVLAAIPHGYQALVVDNNSTDRTAEVAR
AHGAVVVHEPRPGYGSAVHAGVLAAQTPVVAVLDGDGSLDPAALPALVSA
LDDGADMVIGRRRPVAGLRWPWHARLGTAAVCWRLRRRYGLPVHDIAPMR
VARREALLDLGVTDRRSGYPLELLVRAAQAGWRVVEHDVTYGARTGGRSK
VSGSLRGSVIAAVDFWRAI
118473695YP_890666.1 [NADP+] succinate-semialdehyde dehydrogenase [Mycobacterium smegmatis MNMTQYAVTDPATAEVVATYPTATDAEVQAAIEAAHKTGRTWAKSTTVAE
RAALIRKVAELHEQRREQLADVIVREMGKPRDQSLGEVDFCAAIYQYYAD
NAEKFLADEPIELLDGEGSAVIKRSPIGVLLGIMPWNYPYYQVARFAGPN
LVVGNTILLKHAPQCPESAELLQLLFLEAGFPQGAYVDIRATNEQVANII
ADPRVAAVSLTGSERAGAAVAEIAGRNLKKCVLELGGSDPFIVLSTDDLD
ATVQAAVDGRMENTGQACNAAKRFIVNESIYDDFLAKFTEKLLAAGEGIA
PLSSEQAAVRLEDQVKSAVEAGAKLTAAGERKGAFFPPAVLTGVTEDNPV
YRQELFGPVAVVYKAGSEEEAVQIANDTPFGLGSYVFTTDSEQAARVADK
IEAGMVFVNAVGAEGAELPFGGVKRSGFGRELGRYGIDEFVNKKLIRVVD
118473693YP_884642.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAKSVAPRGFARERVLEAALNLFAEHGVNGTSLQMIADRLGVSKAAVYYQ
FHSKDDIVFAVVEPIFGDMRRVLRIAEAMSSPDARREAAVSGMVELAVRH
RRVSAVFHGDPAIDNLVHSRKDLHEVIERLTAILLGPEPGTACRVMMSML
ASGIFSSAMDPELADIDDEELHRVLLDCTQRLLNAPVSS
118473691YP_885019.1 methyltransferase- - family protein [Mycobacterium smegmatis str. MC2 MGDTPNPDAGRAVADTGLLVAAIRAAESRREDRLFEDPFAEKLAGETGRR
MLEEALATTGDKSTLQIVVRTKFWDEALLRATTHVDQVVLLAAGMDARAF
RLAWPAGTVVYELDQPEVIAAKSGLLADASPRCRWTALGVDLTRDWTTAL
RSTTFDPARPAVWLAEGLLQYLDETAVHTLFDRVDAMSAPGSVLLYDVVG
KTLLDAAMLAAVRESMARSGAPWRFGTDAPGELSTRLGWSANVTDIAEPG
NAYGRWFTPAVPLDVPGVPRGYFVEATKPG
118473689YP_888413.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MAVYIGLNVEYFLLDHPSTSIWQGTADLRPDALNHGWREYGARVGIWRTI
ESLDRHGVRPSVLLNSVVVDEYPQIVAAGVQRDWVWLAHGQTNSILHTGL
SVDDERRVLAEITDTITEATGRRPRGWMGPGLTETHHTPELLAELGFQYV
LDWTNDDQPYPLSVPGILSVPYTVELNDLLIFSKGITGPEFVQMVRDQYE
QLHADSATSGRVLALALHPFVIGQPFRHKYLDQALSFLTAQPDVWLTTSD
DIATHYQTQTAIDQSPAGRPSMSAPRTEKPFPV
118473687YP_890864.1 hypothetical protein MSMEG_6656 [Mycobacterium smegmatis str. MC2 155]MAGESAAGWSLHFYDFQRRFVSVDDVVPGLGDIADWAKRNGARDGTPFFL
DPWGRADAVVNAYWRDPVLRRRATATVRRYALSLKVWLDFLHAVDVRWDH
ASRSEFAAFKEWRLSARENPQCVSAASFCVDRSAIRGFYLWAAEHQGVEN
PVRARAIATSWAGGQRVTLESTPSGMRRSDVKWLTPQAFRLWRNLGLRGF
TGAGMPHPDWRGSTEDRDTAFVDGLFGTGLRIGEWSSVLTSEVPTPGSEG
LTRSRVASACAKGGSGRTFWMRHRVSQQVDFYLHEGSRTAAVARAQAAGR
YEQVVDSWIVERVRSDRRLDVVDEEGSRRVVSLDALDPLLRMKMFRRVCG
GLEPMWLWLNHDGTPRPKHAWYKTFDRANARVAGALTHEHGAPLWCRPHM
LRHSFALRWYCIATFVAWRRTGMLTAQEQRDFRNQLGDVWFLLATLLGHR
SAEVTRNVYLEPFQALQVEELVALMDADDRQSLERLVATVGVGEPRVLTG
HR
118473685YP_885046.1 hypothetical protein MSMEG_0636 [Mycobacterium smegmatis str. MC2 155]MGDNLRVNDDIDIKDIERVKYRYLRALDTKNWDEFADTLTEDVRGDYGQS
LGEALHFTDRAALVDYMRQSLGPSIITEHRVAHPEITVDGDEATGTWYLQ
DRVIAPDFNFMLIGAAFYRDTYRRTTDGWKISATGYDRTYDATMSLENLN
FHLKPGAALHI
118473683YP_887824.1 molybdopterin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTSGTATNATGTEWHHTACILCECNCGIVVQVENRTLAKVRGDKDHPASR
GYTCNKALRLDHYQNSAGRLTTPMRRRPDGEFEPVDWDTAIAEVAEGFQR
IAKTYGGERIFYYGGGGQGNHLGGAYSGAFLRALGSRYRSNALAQEKTGE
AWVDAHLYGGHTRGEFEHAEVSVFVGKNPWMSQSFPRARVVLNEIARDPA
RSMIVIDPVLTETAALADHHLRVRPGTDAWCLAALAAVLVQENLCDEEFL
TQHVHGADAVREVLRDVDIAENARRCGVAEEQIRAAARRIGRATSVSVFE
DLGVQQAPNSTLCSYLDKLLWILTGNFAKPGGQHLHSTFAPLFGKSGVGR
TPVTGAPVIAGLVPSNVVPEEILTDHPDRFRAMIVESSNPAHSVAASARV
RAALQELELLVVIDVAMTETARLADYVLPAATQFEKAEATFFNLEFPHNT
FHLRHRLFEPLQGTLPEPEIWARLVRALGVVDEAELQPLRRAAEAGLAEF
TAAFFTAVASNPTLSKVLPFVLYETLGPALPDGMAGAAALWGLAQKTAMT
YPDAVRRAGHADGNALFEAILANPAGVTFTVHEYAEDFTLIDHPDHKIAL
EIPEMLDEIRALRNQQAPLTSSEFPIVLSAGERRAYTANDIIRDPAWRRR
DPEGALRVSPHDAEELGLADGGRARITTAAGTAVARVEISDAMLPGHASL
PNGLGLDYRDGDRVVVPGVAPNALTSTEWRDPYAGTPWHKHVPARLEAV
118473681YP_890878.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTRMSRWALLGLWSVFLVLPVLATLLYSLATVWRGRAFPDGYTLAWWVQA
FSEPRVVSALMRSVWLAVLTVVVVAAVVLPALYWGHIRNGRIRTVMQLCA
LLPFALPFVVLAYGIKRLAGASELTQPWESSPVLVVLGHVALSFPFFLWP
VDGAMSAAGVRQLSEAAETSGATPLATLFRVVIPNIRTGILTGAILTFAT
SFGEYSIARVITGSSFETLPVWQVAALQDTRGNPNGVAVMAIFTFLLMFI
VSVLIARTGKGQPLRLLPGIGNTR
118473679YP_888920.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSTQADLDLESHKVVHDERVKEQNKLQRLIIRPEMGAAVGAIAIFILFLI
VAPPFRSPESMATVLYASSTIGIMAVGVGLLMIGGEFDLSAGVAVTTSSL
AASMLAYNLHLNLWVGAALALVLSLAVGFFNGFLVMRTKIPSFLITLGTF
FMLAGINLAVTKLLSGQVATPSVSDMQGFDSGRTVFASVIKVGPIDVRIT
VLWWILFTLIATYVLFKTRIGNWIFAVGGNQDSARAVGVPVTKVKIGLFM
VVGFCAWFVGMHLLFSFNTIQSGQGVGNEFFYIIAAVIGGCLLTGGYGTA
IGTLIGALIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVVANNVVRNYAA
KR
118473677YP_885002.1 rhamnulokinase [Mycobacterium smegmatis str. MC2 155]MSAIQVAAVDLGATSGRVMVADIDGDRLDMRTVARFPNDPVTLWNGTGDE
LRWNVPTLYGHVIDGLTRAGRDCDSLVGVGVDSWAVDYGLLREGRLLSLP
MHYRDARTARGVELVHDVLDAPELYRRNGIQFLPFNTVYQLAAERASGLL
DLADTVLLVPDLLTYWLTGQRVAERTNASTTGLLALDGTWDRDLMTRLDL
PHTLFPPIVEAGSRRGPLLPSVARQIGLTGKAGAEVVSVASHDTASAVAA
IPMDPDHAAYISCGTWGLVGVELGRQVATDAAREANFTNEVGADQRIRFL
HNVMGLWLLSETLRQYERDGHDVDLADLLAGAAQAPAPPVVFDTDDPRFL
PPGDLPARISAWYVERGHTPPADPVQMVRAILESLAAAFASAVCTAAELS
GVDVRTVHMVGGGSQNELLCQLTADRIGMPLLAGPVEATALGNVLLTARA
RHVISGDLASLRARVAQWFPPRRYLPRTSRTTAMV
118473675YP_885379.1 hypothetical protein MSMEG_0977 [Mycobacterium smegmatis str. MC2 155]MVADVLAYVAARLVLVAVLAAVIYVVGRMVVGDFPIVVALLFSFVIALPL
GIWVFKPLRLRATASIAEFDERRRKDRADLQARLRGDDPK
118473673YP_889961.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MSYPRDMVGYGRTPPDPQWPGGAAIAVQFVLNYEEGAENCVLDGDPASET
FLSEMTPAEAFPNRHMSMESLYEYGSRAGLWRVLRVFEQRGIPLTIFAVA
RAMQRNPEAVAAFTELGHEIACHGLRWKSYQLTDRDTEREHMAEAVRILK
ELTGSAPLGWYTGRDSPYTRELVVEHGGFVYDSDSYADDLPYWVQVDGSD
HLVVPYTLDTNDMRFASPAGFANGEEFFAHLRDAFDVLYAEGLAGAPKML
SVGLHCRLVGRPARTAALQRFLDHVQSHDKVWLARRIEIAEHWRTVHPA
118473671YP_889931.1 molybdenum cofactor biosynthesis protein A [Mycobacterium smegmatis stMTVTALGLPTVARSTGDGSAGASPAPADGPLVDTYGRAATDLRVSLTDRC
NLRCTYCMPAEGLNWLPGDALLSPTELARLLRIAVARLGITSVRFTGGEP
LVVRHLEEVVAAAAALEPRPEITLTTNGLGLARRAEGLKKAGLNRINVSL
DSVDAAHFARITRRDRLPDVLAGLAAAKAAGLEPVKVNAVLDPVSGLDDA
VELLRYCLQHGYQLRIIEQMPLDASHSWQRDNVIDADRILQTLQQHFELT
PDSRPRGSAPAELWQVAEGPTHAAGTVGVIASVSHAFCSACDRTRLTADG
QIRSCLFSREETDLRHLLRGGADDAEIEAAWRAAMWSKPAGHGINDPDFV
QPVRPMSAIGG
118473669YP_888837.1 hypothetical protein MSMEG_4567 [Mycobacterium smegmatis str. MC2 155]MWRLRVVHSTGYAYKSPVTASFNEVRLTPRSDSRQNVILNRVETVPATRS
YRYVDYWGTAVTAFDLHAPHAELEVTSSSVVETEVGEKPEEPVSWDDLRT
EAVIDRFDEVLAPTHYTPCSKRIERVGRSIAKEHDPYEAVIAAAQWVRSE
LDYVPGTTGVHSSGLDALREGKGVCQDFAHLSLIMLRGMGIPARYVSGYL
HPTRGAAVGDTIDGQSHAWVQAWTGGWWDYDPTNDSEINEQYVSVGVGRN
YSDVAPLKGIYSGEGSTDLDVVVEITRLA
118473667YP_886581.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MSVAETGTSDAVRYEVNDAGVAVITLNRPERLNSWGADISAGVYASFDRA
EADPAVRAIVLTGTGRGFCAGAYMGEMASLGESISGDTDVSKIVGERHPH
FLTTLRKPVIAAINGACVGIGLTHALMCDIRFAAAGAKFATAFPRRGLIG
EYGITWILPRLAGWGAAADLLLSGRTFLAEEALQLGLVKEVVEPENLLTR
ALEYAEDLARNCSPASMAVIKRQLYGDATDVVTDVSDRAVTLMHESMVRP
DLIEGITAFFEKRPPNFPPLAAE
118473665YP_886115.1 Fatty acid desaturase [Mycobacterium smegmatis str. MC2 155]MSTPTYTLTPDQAEEFGRELDAIRERVIADLGERDATYIRNVIKAQRTLE
VGGRALLFGGIFPPFWLAGTAMLAVSKILDNMEIGHNVMHGQYDWMGDPA
LSSKTFEWDTACPADQWRHSHNYMHHTYTNIVDMDRDIGYGILRMSPDQK
WSPYYLGNPVYAFLLMVLFQYGVALHELETERIRAGEISIADKREVLREI
WHKTKGQTVKDYVAFPLLAGPFAPLVFAGNLTANLTRNVWAFMIIFCGHF
PEGTQEFSREQAENESRGMWYFRQLLGSANLTGGKWFHILSGNLSFQIEH
HLFPDIPAHRHAEISAEVREICERYGLPYNSGPLVKQFGTVVRKIVRLAL
PWGSKPKSPEPADTRAEPVSDTEPEAELALAH
118473663YP_890125.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MHRDRTMLKVGIFTMVMLLVAAGLVVVFGEFRFAAGQSYHATFSEASRLK
AGQDVRIAGVPVGTVKSVKLNPDNTVDVGFDVNKRYQLYTSSRAVVRYEN
LVGDRYLEITSGPGELRKLAPGGTLGLQNTQPALDLDALLGGLRPVLKGL
DGAKINEVSNAVIEMLQGQGGALANMLTSTSAFTQNLAARDQLISDVIAN
LNTVLGTVDEKGAQFDASVDQLQQLITGLAENKDPIAGAIEPLASAESDL
TEMLEKSRRPVQGVIENVRPMAGRMDERKDDINKVIEPLAENYLRLNALG
AYGSFFNIFYCSVRLKVNGPAGSDILIPFGGPPDPSKGRCSENG
118473661YP_887972.1 hypothetical protein MSMEG_3669 [Mycobacterium smegmatis str. MC2 155]MSYQNKFYLTGSINQPTVADAFRFVGSRLQPAVTRVPDGEPGERANWVLT
QTPHFLDNPALDIVEVNGRRLARLRPGTTAADVSFPAFDYADHAISSYAL
FRQARDRGELAPQSKFLVSIPTPFNAVNFFVEFGSQVEVARAYEKPLKDS
VDAIQAAIPHEDLVIQWDLPIEDATIEGWFPNPYNDFEEIYAATARPASW
VADDVELTFHLCYGDSKFGASPFMGDPPDAEAAARGGRHIHPRDASVIVA
VANGLSRHVPRRIDAFQAATVTTWNRLAHWQPLANLAIEPETEFYLGLVH
AEDGAAGARYRAALAGKFLDRFGVSTECGLGRHSPEQLEAVVNAVTELFA
GTPANRPAAALA
118473659YP_888761.1 hypothetical protein MSMEG_4489 [Mycobacterium smegmatis str. MC2 155]MNAMPDLLQRLSTVLAEVMSVAEEADGALTITSGGSVALVRVVAIAEDLE
MVSLTQPLAWDLPLNNKIRERVVGHANRTMLGSVVLVEKVADGPAAPVNG
TGPKSATRKGSTKKVADVMLRYNFPAAGLTDDALRTLILMVLETGADVRR
DLTS
118473657YP_890955.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MPRTVQFAEYGDTDVLTVVDTPAPEPGPGQVRLKVRAAGLNPIDWKIVAG
FMRELMPVDLPAGVGSDVAGIVDAVGPGVTEWAVGNEVLGRSATGAYAEY
ALAEAAELIGKPGEITWEVAGSLAGAGGTAHAVLDRLDLKSGETLLVHAA
AGGVGTFAVQLAGARGVSVIGTAGEGNHDYLRSIGATPVTYGDGLLERVR
AAAPQGVDAVLDASGRGEIPLSIELTGDPQRVLTLVAFDQAGTGIQVHAG
GAGDSLSKALSDVVALITDGRLTVPISATYPLDEAAAALDASRTGHATGK
IVVVP
118473655YP_889477.1 hypothetical protein MSMEG_5231 [Mycobacterium smegmatis str. MC2 155]MDTRVIVYPGTDNELHGVVVEDFADLAGTAVEIAGERIVGPARRYAVNVD
DGGLVFVDDDSIVAEAQPA
118473653YP_886614.1 hydrogenase-2- small subunit [Mycobacterium smegmatis str. MC2 155]MASVLWFQGGACSGNTMSFLNADEPNVVDLIVDFGLDLLWHPSLGLELGN
NAQKVFWDCAKGERPLDIFVFEGTVIEAPNGTGQMDMFAGRPMKDWVTDL
AGAAQIVVAIGDCACFGGIPAMEPNPSGSTGLQFHKREKGGFLGPDFRSK
MGLPVINVPGCPAHPDWITQILVALATGRAGDITLDDLHRPETFFKTFTQ
TGCTRVQFFEYKQSTLSFGEGTRTGCLFYEFGCRGPMTHSPCNRILWNRQ
SSKTRAGMPCLGCTEPEFPHFDLAPGTVFKTQKVSGMIPKEVPEGTDHLT
YMGLAAAARIAAPQWSKEDMFVV
118473651YP_884560.1 hypothetical protein MSMEG_0145 [Mycobacterium smegmatis str. MC2 155]MAIASPVSERLTVTALLLLTVATGLVDAISVLVLGHVFVANMTGNVIFLG
FWFVPHSGVDLTAAVVAFPAFVVGTIIGGRLARHLDGQVRTWLTTALGVE
VVLLTVLSILAGTGVLDYQDNTKLFLIAGLAITFGIQNATARQFGIQELS
TTVLTSTIVGLGFDSRLAGGTGEREKLRYAVVATMCLGAVIGATLSRFTV
APVIALAAVVIATSACIFRFGR
118473649YP_887706.1 LamB/YcsF family protein [Mycobacterium smegmatis str. MC2 155]MTVIDLNADLGESFGVYTYGADAEMMPLITSANIACGGHGGDPAVMRTSV
ALAHAHDVAVGAHVGLPDRLGFGRREIPTTAQEAYDLCLYQVGALDGFLR
AQGTAMQHLKLHGSLYMMANRDRDLAEAVCAAVTALDPALLIYVLPGSAL
HTTAVETGLTPVIEIFADRPYRDGVVQMYDRTAELIGGPDQVVTRTLSQL
AAISETTGTDVHLTVCVHSDTPGAPALLAAVRSALTAEGHTFRSPTTPAS
ATTRKPILTAALGGE
118473647YP_890852.1 malyl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MTNLLRRSELALPACNDHMFDKGVTCGADLVFLDLEDATPVGLKVESRAK
AIHALTQLDWGRTARAVRINGLDTEWCHDDIIEILTHAGDHLDTIVIPKA
KTARDVWWVDVLLTQLEAKLGLDKTIRLEVLIEEVEGLANAEDIVRASPR
LDAVIFGVGDFSLSQGARVDTNFDPLGEYPGDFWVYARNKIMVAARIAGI
DAIDSPYPDYRNLEGYERDARRSSLMGYTGKWAIHPDQVPIANEVYAPTT
DEIARAERNVAAYREAEAKGRGAVGVEGVLVDAAHVKMAEETLARAALIS
GGR
118473645YP_885502.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MRHVVPRELRHRASSSSVSHVNLAYDERGKGEAVLFIAGRGGAGRTWHLN
QVPEFQRAGYRVITFDNRGVGATENAEGFGTEQMVADTAALIEKLDAAPA
RLVGVSMGSFIAQELMVARPELVHSAALMATRGRHDHAREFFRKAELDLS
QSGVDLPPTFDAKVRMLESFSPKTLNDDAFVRDWSEMFTMWPTKQTPGSR
TQLDVGPVTNRLPAYRSISHPVLVIGFADDVVLPAHLGREVADAIPNGRY
LQIPDTGHLGFIEKPQEVNAAILNFFAEHGGKKFTNLLANKL
118473643YP_887335.1 hypothetical protein MSMEG_3017 [Mycobacterium smegmatis str. MC2 155]MVLRANGSQPTSTAGAAGDLGAGSDVSGAPGIRDVDGVLEKYRRTRLQRA
LFDVRGSQAGTAYDEFVDTAGEVRPAWRELAECVSERGRSGLDRLREQVN
ALVDADGITYIQVDRHGEIVIDREGAAMPGPWHLDALPMVISAEEWDVLE
AGLVQRSRLLDAVLADLYGERRSITSGVLPAQLLFSHPGYLRAAHGITVP
GRHQLFLHGCDISRGDDGAFVVNADWTQAPSGAGYALADRRVIAHAVSEL
YERIAPRPVSPWAQALRLALIDVAPESAEEPVVVVLSPGIHSETAFDQAY
LAGVLGFPLVESADLVVRDGKLWMRSLGTLKRVDVVLRRVDADYVDPLDL
RPDSRLGVVGLVEVLRRGAVTVVNSLGSGVLESPGVTRFLPQLAQLLLDE
TPQLDTAPLYWGGIDIERSHLLTRLDSLLIRPVCGGKPIVGPELSTAQRE
ELAARIEATPWQWVGQELPQYSTAPVDFRSSGLSSAGVGMRLFTVAQRSG
YAPMVGGLGYLMAPGNAAFRTNTVAAKDIWVRTPDRVTAERIQAPVELAT
PETRPSPTRVVSSPRVLADLFWLGRYAERAESTARLLNVTRERYHEYRYR
QAFEESRCVPVLLGALGSIKGTDTGARDDDHEAIATAPTTLWSVTADRYR
PGSLAQSVERLGLAARAVRDQMSNDTWMVLAGVERAVLRTSSIPPDSHSA
GETYLANAHSQTLAGMLALSGVVSESMVQDIGWTMMDIGKRIERGLHLTA
LLRATLAQVHSPAAEHAVAESTLVACESSVIYRRRNPGRISVAAIAELVL
FDAENPRSLIYQLERLRTRLKTLPGSSGSSRSERLVDEIATRLRRLDPDD
LETVTDGMRVELADLLDAIHIGLRDLATVITAAHLSVPGGMQPLWGPDER
RILP
118473641YP_887716.1 MOSC domain-containing protein [Mycobacterium smegmatis str. MC2 155]MQIVAIHIAPGRKVPTRSVQEVRAEAGKGLVGDRYHGAKHRHVTIQSREL
LDHAAADLGRDVDSGATRRNLTVDAGPLPTKPGARIRIGDVELEVVRIAA
PCRLLDDWIAPGAARAMHNRGGTVFRLLTSGPIRVGDEVEVPVAG
118473639YP_890533.1 haloalkane dehalogenase [Mycobacterium smegmatis str. MC2 155]MQTLRTPDERFAQLPEFPYAPMYCDIDDGEGGRLRVAWVEDGPAHAEPVL
LLHGEPSWSFLYRKMIPILVAAGHRVICPDLVGFGRSDKPTRIEDHTYAR
HVEWMRSLVFDALDLRKVTLVGQDWGGLIGLRLAAEHPDRFANIVVANTG
LPTGDIPMPDIWWQFRNAIQKAPKVDVGRFVASGCRRPLSDGVIAAYDAP
FPDDSYCAGPRAMPGLVPTSPDDPAAEANRAAWKVLRASKTPMLVAFSDG
DPITGGMAPIFKKEMRGAHGIEHPVISGAGHFLQEDAGEDLASAVVEFLR
DR
118473637YP_887377.1 primosome assembly protein PriA [Mycobacterium smegmatis str. MC2 155]MTLTRRAAEHEPIARVLPMLSVPHLDREFDYLVSEELSDNAQPGVRAKVR
FHGRLVDAFILERRSDTDHEGRLGWLDKVVSPEPVLTTDVRRLVDAVAAR
YAGTRPDVLRLAIPPRHATVEKQTPAEPEPIPAIDVDSSGWARYARGEQF
LTALGEGRAARAVWQALPGEQWPQRLAEAAAATVNAGQGVLAIMPDQRDV
DALHAAVTAHVPESRVVALSAGLGPSARYRRWLAALRGHARVVIGTRSAV
FAPVADLGLILVWDDGDDNLAEPRAPYPHAREVAMLRAHQLRCAAVIGGY
ARTAEAHALVRTRWAHDLVATRSVVRSVAPRVVALEESRYQQERDPAAHS
ARLPSMALQAARTALDADRPVLIQVPRRGYVPALACARCRTVTRCRHCTG
PLALPDRDSAAAQCRWCGRAEPALRCARCGSDAVRAVVVGARRTAEELGR
AFPGTPVITSGGDTVVSDVRGTRALVVSTPGAEPAADGGYGAALLLDAWA
LLGRQDLRAAEDTLRRWMAAAALVRPRADGGVVAVVAESVLPTVQALIRW
DPVGHADAELDSRGEVGLPPAVHMAAVDGTPKAVTALLDHALLPEGAERL
GPVDLPFGARRPPGLDADAEVSRMLVRVPRAGGLALAAALRRATAVLSAR
HDQEPSRVQIDPLHIG
118473635YP_884555.1 mce-family protein mce1f [Mycobacterium smegmatis str. MC2 155]MLLTRFIKMQLVIFLTLTLVALVVLALFYLRLPTWAGLGMYKLNADLPNS
GGLYATANVTYRGTTIGKVTSVEPSESGARVEMNIYDRYKIPADATANVH
SVSAVGEQFIDLTSDSGGGAYFQPGDTITKATVPAEVGPALDAAEKGLAV
LPKEKIGTLLDEAATAFGGLGPSLQRLVDSTQAIAGDFRANIDPVNDIIE
NSGPIIDSQVNSGDAIQRWAANLNTLAAQSAQNDEALRSGLQQAAPTADQ
LNAVFSDVRESLPQTLANLEIVIDMLKRYNKNVEQVLVALPQGAAVAQTG
TIFAPEGLLHFGLGINAPPPCLTGFLPASQWRSPADTRTEPLPSGLYCKI
PKDAPNAVRGARNYPCADVPGKRAATPRECRSDEPYQPLGTNPWYGDPDQ
IRNCPAPGARCDQPVDPGRVIPAPSINNGLNPLPASQLPPPEVSSGPSSD
PLTAPRGGTVTCSGQQPNPCIYTPAAGATATYNPASGEVVGPGGVKYSVT
NSNTPGDDGWKEMLAPAS
118473633YP_886869.1 dehydroquinase dehydratase- type II [Mycobacterium smegmatis str. MC2 MRRRTVSTYSGEKMTQSSTKVFGWQRTGTRPLLITLIDGPNMPNLGNRNK
RVYGPISSITALQDHVRELGEGMGVTIEALASNHEGEILDAIHASAARSD
AYILNPAGLTKTGEPTRHALEETGRPWVEVHFANISAPPWSERGLPGGPW
ESNFTRSATGMSMGLRHHSYLGALVALVAAIDDPQFLGAAE
118473631YP_889223.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGTMLHVPTLTGPRVRLREPVPDDAEALYTRVASDPEVTRYLSWKPHADV
AETRRVITTLFNIGSEESWLIEADGEVVGLCGRRRPQAHEVELGYCLGRP
WWRRGLMSEAMSVLIDDTERDPRVYRISAYCHVDNAGSAGVLRHCGLTLE
GRLVRYSVFPNLGNEPQDVLMFGKAVR
118473629YP_890039.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMGEDIEERDDRLLDVVTEILETEGYEAVQLREVARRARTSLATIYKRFAT
RDDLILAALEYWMQKNRYSGVTPRRRTPGVSLYAALTGLLRTIFEPWERH
PAMLEAYFRVRSSRSGQKLFRFGFDIVAPAGLELLADVDDEFVADLDTIV
STVVYGLLGRFAAGEIAVTDIVPILDRTVYWLTTGYEAAGNARPGERRRR
SPARRHRN
118473627YP_885264.1 phosphatidylserine decarboxylase [Mycobacterium smegmatis str. MC2 155MARRPDLQSGPERLAALVRSSIPPMHSAGLPFVGASLAVALLGRKRRWMR
RAGLISAGANAAFFRHPPRVPPTRPGVVVAPADGLICLLGEATPPAELGL
PDIPMQRVSIFLSVLDAHVQRAPIGGEVVAVRHRPGRFHSAELEAASEDN
ERNSVVIRTPEGLHIIAVQIAGLIARRIVCDVHVGDKLSIGDTYGLIRYG
SRLDTYFPADARVLVSHGQRTLAGETVLAELA
118473625YP_884922.1 D-tagatose-bisphosphate aldolase non-catalytic subunit [Mycobacterium MTSHWIRETIAQHKTGDPVGVYSVCSAHPTVVTAAVMQAAADNSFVLVEA
TSNQVDQFGGYTGMRPADFRDLVHDIADEQGFDRDRVVLGGDHLGPNRWQ
DQPAAVAMTNADALIAAYVEAGYRKIHLDCSMRCADDPEVLSDEVVADRS
ARLLRVAEQTANRLGIEPPVYVIGTEVPVPGGAHETLTRLTPTPAEHARR
TIEAHQAAFAAAGFEYVWPRIAALVVQPGVEFDHVNVIDYERTATAQLRR
VLDTEDHMVFEAHSTDYQKPDQLRELVEDHWAILKVGPGLTFAMREALFA
LSHIEAELVDPASRANLIDVVERRMLAEPRYWHSYYEGDPVTQRTARRYS
YSDRLRYYWADAEVDAARRTLLANLDRTGIPAPLISQFLPTQYERFRAGE
LDPDPRSLVIDRIRDALRPYAAACRTTDHHATALTTGVAR
118473623YP_889924.1 hypothetical protein MSMEG_5691 [Mycobacterium smegmatis str. MC2 155]MTEPADRAEGSDLGSAAAADAPGLESVLRGAVDVARAALTEFSGADTVGE
YLGVTLEDPSSATHRFLANMPGYRGWQWAVVVAAYPGADRATISELVLVP
GPTALLAPKWVPWQERIRPGDLGPGDLLAPPPDDPRLVPGYSATGDPLID
ETALELGFGRRQVLSEWGRAAAAQRWHDGEFGPNSPMARSTKRVCRDCGF
YLPLGGALGRMFGVCANELSADGHVVDSEYGCGAHSDTPAPPGTGSPLYE
PFDDGVLDLAD
118473621YP_889743.1 hypothetical protein MSMEG_5505 [Mycobacterium smegmatis str. MC2 155]MSTSAPQNGSMRAADTDRIQVAQQLTDAAASGRLPMDEYEDRLAKAYTAE
TRNELARLSSDLAGAATYLNAGCRPAPSTTLLGLMSGFERRGRWNVPKKL
TTFALFGGGVIDLRYADFTSADVDIRCYSIFGGQTILVPPEVNVDCHGIG
IMGNFDRHVHGEGVPGAPRVHIRGFSVGGTVSVKRKHRRKPHEN
118473619YP_885254.1 citrate transporter [Mycobacterium smegmatis str. MC2 155]MLAPVLALTIFVVAFWFIATERADKVKTVLVAAGLMTLLGLVPGAEVFYS
EHEGIDWNVIFLLLGMMVIVGVVKQTGLFDFLAIWAAKRSRGKPFRLMVM
LMIITAFASPVLDNVTIILLVAPVTVVICDRLRIPPQPYLIAEVLASNIG
GAATLIGDPPNIIIGSRAGLTFNDFLIHMAPIVIVIFALFVVFTRVLFRK
ELRANHVHIEEVMALQERRAIKDMRLLVRSLIVLNIVIVGFALHSVFHVA
PSIVALLGAGVMLLVTDVDINEVLPEVEWPTLVFFMGLFVMVAGLTHTGV
IGELGSVAQSAFGDNWLGAATALLFGSSIAGAFIDNIPYTATMTPVVESM
VADAPDMVTGNALWWAFALGACFSGNGTAIAASANVVAIGIAKRAGHPIS
FWQFTRYGIVVTFLSTALAWVYVWLRYF
118473617YP_889638.1 ATP-dependent DNA helicase RecQ [Mycobacterium smegmatis str. MC2 155]MRDAIDRLGRPPVAALTATASGVVRREVIDILGLRKPVVIASGFDRPNIA
LEVFSHTDDAQKRQAVLDAVAEMAPPGLLYCATRKDVEFYAEELRRRGVS
AAGYHAGLRERERAEVQRRFHDDEVDVVAATSAFGMGIDKPNVRFVVHAS
IPESVDTYYQQIGRAGRDDEPASAVLHYRAEDLSLGTFFATHNADAELLA
RVYSALDGGGPKRLKDLRAALGSGGRSVTSAVNLLERAGAVTSGRAGFST
TGLGPDEAVRKAVEMSEISERVDRTRVEMMRSYAETPDCRRQFLLAYFGD
HLPRPCGNCDRCRDDSRPTSSGTPAIAPGTPVEHREWGPGVILDGDEDRL
TALFDFYGYRVLSVDAINETSVLEISSAEQT
118473615YP_889659.1 iron permease [Mycobacterium smegmatis str. MC2 155]MTPITDVPTSILAASNITSQLLGSGLIGLREGLEAAIVVSILVAFLVKSE
RRDALRWVWLGVSCAIAVTVTVFLVIQFGENTISGLGAEAVAGIASLLAV
VIVTTMVLWMKKAAASISGELRSDLAQALETGGPAVALLAFLAVGREGVE
TALFMVGYAEAETLWPLTGLIVGVLIAVAIAYGMYAGAVRLDLGKFFKWT
GVFLIVVAAGILAYATKALQTVGWLPGLGAKAFDVSGGGGWFNWSAWYGE
AIQGIFNIDPTPTVLQFAAWLTYIVVVLALFLKPGRASSPASSEPIVDPE
APITSERSTT
118473613YP_886379.1 molybdate ABC transporter permease [Mycobacterium smegmatis str. MC2 1MITWRRTRGRVEVGLPAWIFVPATLGALFVVIPLVAILVRVEWSQFISLI
TSESSRAALLLSLKTSAAATAVCTLLGVPMAVVLARARFPGRSVLRALVL
LPLVLPPVVGGIALLYTYGRMGLVGEYLDMAGVRIAFTTTAVVLAQSFVS
LPFLVVSLEGALRSAGDRYETIAATLGARPTTVLRTVTLPLVLPGILSGA
VLAFARSLGEFGATLTFAGSLQGVTRTLPLEIYLQRETDPDAAVALSLVL
IAVAAVIVVASASRKLAGPL
118473611YP_885476.1 large subunit of N-N-dimethylformamidase [Mycobacterium smegmatis str.MNTNGNAGTVADTDDYPELMRLTGYGSKWSVEQGDSVDFYVNCDGPATYR
AELVKLIHGDTHPSGPGFKEELVNSGINGTYPGRPQRIHAGSYAMVADRR
PLRVDSFTMQCWIWPTMPTKIEGYWAPGEQMIMGKWAQGRGYGLFLDLDG
RVCLRIDDQVLTAPHPVRDRAWHFVAATFDAATGTAVLFCEPQVRYALDP
QPAAVEAVFAQPISHTGVPFTFAAHPASAEPGKQTRQPGGWVMTGHYNGK
IDAPRLCSRALNRLEIETMKLGFAPGMDERRAGGPSPELGAVMVAAWDFS
LQIPTRTIVDCGPYRLDGELVGLPARGMTGHNWSGAVTSWSVEHREYGAI
HFHDDDVDDARWAVDFTLEVPGDLPSAVYAVKLTTDEGDEDYIPFVVRTP
LGRPGAKIAVIMSTIDYLAYANEHQASNFGSAEALIYRTPIMAPQNIFLS
VHREYGYSLYDTHSDGSGVHISSRLRPILNFRPKYDSWLTQAPWQFNADL
HLIDWLTEKGYTFDVVTDEDISYDGLERIEGYNVLITGSHPEHKDGHYLD
AIHAYKERGGRLMYMGGDGFYWRHTFHPAYGRGEVTEMRRCESGIRPWQA
QPGEYHHQSDGKLGGMWRFLGRDMAAVSGTSMVAQGFDISTYFKRTPESQ
DPRVAWAFEGISYDERLGDFGLVGGGAAGAELDTVDTTLGSPPHTLLVAT
SAGLHTDAYLLVTELILTNAPGVTGTQHPRIRADMAFHETPNGGAVWSFS
SISYCGSLSHNDYDNNISKLTANVLNHFMQDGPLPAPPANAVRPRGRFES
TPELNYHLPEEVGS
118473609YP_885444.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MTDDPLVPLPAATVMLIRDVHREGRADLEVFLMRRHAAMDFVAGVMVFPG
GGVDDRDRNADIAWYGPEPSWWAQRLGVDEGLAEALVCAAARETFEESGV
LFAGPQNGPGDPGIIADASVYGDARAALANHSLSFADFLRDEKLVLRADL
LRPWANWVTPKEERTRRYDTYFFVAALPEGQRADGENTETDRAFWCTPKA
GLDDFEAGNTFLLPPTWTQLDSLDGRTVAEVLAVERKIVTIEPSLSTEGN
NWEIEYFDSGRYNAARKHRSPGQ
118473607YP_890956.1 ABC transporter ATPase [Mycobacterium smegmatis str. MC2 155]MGTMTATLVAKNVAGGFAHRTLFEGLDLTVARGDVIGVVGANGAGKSTLL
RILAGDLDPLEGAVSVAPADAFVGWLPQEHERVPGETVAAYVARRAGCAD
ATSAMEAAAAALADPTSNADPAVDPAEAYSAALDHWLATGAADLDERLPA
VLADLGLDTEMVRPDSTLMTALSGGQAARVGLAALLVSRFDIVLLDEPTN
DLDLDGLDRLEAFVRDLRGGVVLVSHDREFLARSVTGVLELDLAQNTNTL
YGGGYDSYLEEREVNRRHKREQYDEFAEKKADLVARARVQREWSSQGVRN
AIRKAPDNDKIRRRAATESSEKQAQKVRQMESRIARLEEVEEPRKEWVLQ
FSIGAAPRSSTVVATLDNAVVRQGNFVLGPVSLQVDAGERIGITGPNGAG
KSTLLRLLLGRQEPDEGRASLGASVAIGEIDQARALFTGTARLVDRFEEF
LPTWTTADVRTLLAKFGLRADHVEREVGRLSPGERTRAGLALLQARGTNV
LVLDEPTNHLDLPAIEQLEQALETYDGALLLVTHDRRMLQNVRLDRRWLV
DGGRVTAV
118473605YP_888074.1 hypothetical protein MSMEG_3781 [Mycobacterium smegmatis str. MC2 155]MATRATSTDTASDPLGLDSLTWKYFGDLRTGMLGVWIGAIQNMYPELGAG
VEEHSILLREPLQRVARSVYPIMGVVYDGDRAPETGAQIKGFHKTIKGVD
SSGRRYHALNPETFYWAHATFFMLIIKTAEYFCGGLTEAEKRQLFDEHVQ
WYRMYGMSMRPVPQTWEEFQDYWDAKCRDELEINRATLDIFSIRIPKPWF
VLMPTPIWDQLFKPLVGAQRWIAAGLFDPVVREKAGMRWTPGDEVLLRIF
GKAVELAFLAVPDEIRLHPRAVSAYRRAKGRIPADAPLVEAPGFTAPPKD
RRGLPMHYLPQRRSLLDRAGALVHSTLSLPALRPAKKSSPRRSAA
118473603YP_889095.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MRLTPLPADEWDDEVRLALSVMLPEERLNPEGAGTALSTLARHPRLTKAF
LRFSNHLLFRSTLDPRLRELAILRIARRRNCEYEWAHHAFIGKAEGLTDD
DIDGIGRGVVSDPFDQVVIDAVDELDELSTISDPTWAALGEKLDDRQRMD
LVFTVGGYGLMAMAYNTFGIEPESGH
118473601YP_887360.1 dihydroorotase [Mycobacterium smegmatis str. MC2 155]MRDHNSTAPVLIRGVKPYGEGDPVDVLVDDGQIARIGADLPVPETADVID
ARGQVLLPGFVDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTD
PVADTVVVTDHVWRRGQEVGLVDVHPVGAITMGLKGAQLTEMGLMAAGAG
QVRMFSDDGVCVENPLVMRRALEYATGLGVLIAQHAEEPRLTVGAVAHEG
PIAARLGLAGWPRAAEESIVARDALLARDAGARVHICHASTAGTVELLKW
AKAQGISITAEVTPHHLLLDDSRLETYDGRNRVNPPLREAEDAAALRQAL
ADGVIDCVATDHAPHAEHEKCCEFSVARPGMLGLQTALSVVVETMVRPGL
LTWRGVAKVMSEAPAAIVGLPDQGRPLEVGEPANLTVVDPDATWTVAGTE
LASRSDNTPFETMTLPATVTATLLRGRVTARDGKSAAAGGGSVQ
118473599YP_884850.1 hypothetical protein MSMEG_0437 [Mycobacterium smegmatis str. MC2 155]MSIPEPEHRGTASVGSAYYPMFVAVFTALVIISNVTATKGVAFGPIITDG
GFIVFPLTYVIGDVLSEVYGFKAARRAILLGFAMNALAALAFWVTVYLPA
ADFYTNQEHFENVVGAYTQLIVAGLAGFLVGQTINAWVVVAIKQRTKEKH
LWARLIGSTFAGQLGDTLVFCAIAAGAIGISTFGDFVTYTALGWFYKTAV
EVIMLPVTYRVIAFVKRSEPTYQVAV
118473597YP_884494.1 hypothetical protein MSMEG_0078 [Mycobacterium smegmatis str. MC2 155]MGDTKLAAAAATPIIAFGLRTMTIMSNLTGVEGPEHGDRYGQGAEAFSGV
SSGLDGTRSPDSWEGSSSDAYSDRNREQKERAALMAETDRVVKEVLDKEA
GEIEDTRRQIDHQMTELTWLIPAAIAAKFWNAPPGSGEIASQIIQWGGVA
KTLPIATQRMYRMIADSSENATLIRRAGATYDRIAAEAQAQ
118473595YP_890234.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPDTPSQPASRRDELLQLAATMFADRGLKATTVRDIADSAGILSGSLYH
HFKSKEQMVEEVLRDFLDWLFGRYQQILDTATSPLEKLTGLFMASFEAIE
HRHAQVVIYQDEAKRLSDLPQFDFVETRNKEQRKMWVDILQEGVADGSFR
PDLDVDLVYRFIRDTTWVSVRWYKPGGPLSAEQVGQQYLAIVLGGITQSQ
GDKHA
118473593YP_886701.1 tRNA-specific 2-thiouridylase MnmA [Mycobacterium smegmatis str. MC2 1MRVLVAMSGGVDSSVAAARMVDAGHDVVGVHLALSSAPGTLRTGSRGCCS
KEDASDARRVADILGIPFYVWDFADRFKDDVIDDFVESYARGETPNPCVR
CNERIKFSALAARALALGFDAVATGHYARLSDGRLRRAVDADKDQSYVLG
VLTAEQLRHALFPIGDTPKPQIRAEAAERGLAVAEKPDSHDICFIPTGDT
KAFLGARIGVRPGAVVDGSGTVLAEHDGVHGFTIGQRKGLGIAGPGADGR
PRYVTAIDAETGTVRVGPAEDLEVWELTGERPVFTSGVEPGGPIECQVQV
RAHGGITDTVAELRDGKLELSLRAPLRGVAPGQTMVLYRPDPDGDEVIAS
ATITRR
118473591YP_885106.1 hypothetical protein MSMEG_0699 [Mycobacterium smegmatis str. MC2 155]MRDCLGLSVGTTNLVAVADQSPVIRRAVLTLFPHRGPEVGGPPDGSACDG
LTISDFVARVGDPVPLIAADGSAHRAEQLLAAAVGAMGRLAAPGRHPENQ
VVAVPAHWHPAAFDAVRAAMPGVRVVSDAVASLTAIQTYPGLPARGIVAL
CDFGATGTSLTLADAARGFAPLATVRHEDFSGDLIDQEILRRVLADLDAE
PAGTAAVSTLAALREQCRSAKERLSYEAATGLAGPGNTMRLTRAEVEAVV
AQPLSGVIDALHDLLRRNGVHPAQLAALVTVGGGARIPVVTQRLSEEFRM
PVTTVVQSQVIAATGAALLAHRGEDQTVTRRVIPPATEPASATEAVATTG
WAPPLAWSAADESDEAAGPEVPTASSARPDLIFAEPPEAAPEPARPWYRR
GGVVFYAALFLAVVGTAGLVYSVRADRLDAAAASTPLAPQTVPAESPLAQ
SLPAPPTRTVVVQDPGAPAAPAQAAPRPAAAPRLVQSGQVAPQAAPRQAP
RVAAPAPAPAPAPAAPPLQWPVLPRLPIPTFVLPAAPSSAPEPTATASPT
PEPTAEPEPTQEPGPTQAPQPSAEPTASPEPTVSPISDPEPTAQLEPEPE
PEPAPETSTPPVEPAE
118473589YP_889398.1 hypothetical protein MSMEG_5151 [Mycobacterium smegmatis str. MC2 155]MKFTWKAISTGMIAAAGALPVAVALSGAANAEPAPVPPAPMPNLPVVNQL
AGVPGAAPQLLQGVASALTGTPAQAPAPQPTAQATLTLPQAPATAPATVP
AATGTAPAVTPAANGVASLVPSAEVTIPQVPGMPIPLPQTVNIPGDLASL
APIGSPLAGLAPAATNTAASAATAAAPALTAPAASAPSAVAPLAPLLTAG
LP
118473587YP_890960.1 endoglucanase A [Mycobacterium smegmatis str. MC2 155]MAVTALAGAGALAEPVRPGAAIEVRLASDGNPLAGQTFYVDPNSKAMRAL
KGNPSPELEMIANTPHAYWMDNVSTFAVDAKYIQTAQAAGTMPILALYGI
PNRDCGSLAAGGFGSAAAYRGWIDGVAGAIGSGPAAVILEPDALAMADCL
SPDQRQERFDLIRYAVDTLTRNPATAVYVDAGHSRWVNAEDMAARLNEVG
VTKTRGFSLNTANFFTTEEEIGYGEAISGLTNGSHYVIDTSRNGVGPVDS
DSWCNPPGRALGSPPTTATAGAHADAYLWVKRPGESDGACNGHPSAGTFV
SQYAIDLARNAGR
118473585YP_889247.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTDTSAESARSGLHTEEFATRRTLVFRRFVRNKPAVVSLAVLVLMFVGCY
ALPPLLPYSYTDLDYYALQQPPSPEHWFGTTALGQDILAQVLRGMQKSML
IGVCVAFISTIIAATVGSIAGYFGGWRDRTLMWIVDVLLVVPSFILIAIV
TPRLNDADRVFWLIVLLSLFSWMISSRIVRGMTMSLRSREFVVAARYMGV
RSGRIIVRHILPNVASLLIIDTALNVGTAILAETGLSFLGFGIQPPDVSL
GTLIADGTGSATTFPWVFLFPAGVLVLIILCSNLVGDGLRDALDPGSGGL
RRKSRRKGRR
118473583YP_889542.1 hypothetical protein MSMEG_5296 [Mycobacterium smegmatis str. MC2 155]MRAPTSSPLASNVTSGLRHHDPPASWKNQVRGLLRAISRP
118473581YP_891029.1 caax amino protease [Mycobacterium smegmatis str. MC2 155]MRIAAVFVGVTAIWMLLGAGVGAILGEEYSRPAHIVRAVGATVLTVPAIF
AARRLLDRAPFSGLQLTSVRAGWRPFALGVLCWAVPAAVAGSVVVALGWA
DLTVAASPGRLVAGVAVLTVLVFLYEALPEELIFRGYFFANVAERWSSTV
AVPAQATLFTLWGLAIGAAESVDRVVLFFTFACALGVLRAVTGNLWSTIG
FHWAFQITAQFLGPSWDAITLDDPDLAFGVAISLVPFAVTLIVAGVIARR
RRSHAARLSRVGHGVPQSSC
118473579YP_887766.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSDVYEAVISRRAVRGFTDRPVPKAVLARVLSAAAWSPSSSNTQPWNIYV
VTGDALAALKKRATERVAMGVPWDEREYDMYPATMTSPYADRRAAFGKER
YSALGIARDDWEARQRAAIANWDCFGAPAALFCYIDRGLGPAQWADLGMY
LQTVMLLLRAEGLHSCPQMAWSQVRTTVAEAVSPPPRLMLFCGMSIGYED
PSVDYVRTGRAPLKETVTFVQ
118473577YP_886633.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
MYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRA
YFVTGFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVE
DVFDDPPPAAVCLTGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGL
GAQEMRDWLPRGWHPDRFSVAETNDALAALNTR
118473575YP_886710.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPERQRRRYAPRLPREQRRQQLLDAALTVLADCPLHELSMEAVAEAAGVG
KPVLYTAYRTRAELVTALLTREHKRGLDQVRAALPNDLIVAGPTEAYTAT
VSAFLQSVLENPTRWRLILTVPDSAPREYRAAVRHARSQIVALAESFARA
GIELDPRLTNLDPELIGHTMLSFAEMLGRLAVHDPETYTRERLEQYAATT
MKMFAGQFPVPT
118473573YP_889775.1 hypothetical protein MSMEG_5539 [Mycobacterium smegmatis str. MC2 155]MTLSPTVKQVAAVLTVVVPLFVPEVVLSFTPFHADAAMVMAGMLPTVLAW
VFAPRYAAGAAVLAALANTLAVLAFGNLALTALLAGALALLVGLSARRGL
HIVGMFIAVQPLITLVAGFPTVELSGQTPGTGGQAVLCGVFALGGGLWAL
AVGALMLRDEVVGPPDPVPVPIVGFYTAALLLMLVPGTVVAASWFLHTTA
GWLLATIVLVTRPTYDESRRMIVERSLGTVVGGLAAAGVALVVQNGLALV
LLGTAAMVVAAVLQLMHARYAYFAGFLTAAVVLVNAERADVLTTGAERIL
WTVLGALAVAAVVTTAEALLGRHSDRAAEAAPSRATS
118473571YP_890703.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMSWRHEITRTQWLVLAGTTLGWGLDGFAGSLYILVLGPTMTELLPHGGIE
PTGASIGFYGGLTVAMFLIGWATGGILFGMLADYFGRTRVLSIGILTYAV
FSALAALADTWWQLAILRFIAGVGSGVEAPVGAALIAESWRNRFRARAGG
VMMAGYAGGFFAAAAAYALLGDHGWRAMMLLAGLPALLVWFIRRYVPEPP
EISDHMRSRRQRKAQGNSHSDDHFVLRRLFRAPLLRPMLVCTALATGALI
TFWSVSTWYPQILRALTAAAGLPREVADHRVAVAAMLFNAGGIVGYASWG
FIADAIGRRRAFLISFAVSAAGIVWTFPFDRGYTEFLIAMPILGFGLFGA
LSGTFIYAPELFPPSVRATALAVCNSVGRYITALGPFVAGVIATSWFGGN
LGIATAAVSAVGLIALVGLVFARETRGEPLPTDTTAHPVPHPEKSLS
118473569YP_884583.1 transmembrane transporter [Mycobacterium smegmatis str. MC2 155]MTSSAQPTYREVVDDNGRVYRIGETDRDILGRSRAWMVWLPWISMMAISS
SEYAFTSAEDTLADAHGWHGSHIFWLLGAWVLFQAAVAFPAGKLRESGKL
SARAAMMLGAAGSLMGYLALAYSPNVFFAYLGFSFFGGGAAGFVYATCVN
MVGKWYPERKGGKTGFVNGGFAYGSVPFIFIFTSYMDLANYQGVLFAVGV
FLAGLVAVSGFFFKDPPKNWWPPHVDPLGAASDPRIARALRKNPPAVKQF
TPMEAIKTGILPLMWFVLLCTAGINIFGIAMQVPFGKEMGFAGGIVALAM
SLKAIINGTGRGVIGWISDRFGRRDTLILVCLVLGLAQYAVYFSGSIGNM
PLFLLASMVSGFGGGAIFPLFAAMTADYFGENNNATNYGLVYSSKLVSGL
VGAGMGSVVVSAWGYGAAFIIAGSVGVACAFLTLLLKQPKLPKSERLAAE
DPARHSSQAKEASLAAD
118473567YP_888332.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMIEKQTLPLDGIRVVAIEQAVAAPLCSRHLADLGADVIKIERPGGGDFAR
DYDTYAKGMSSHFVWLNRGKRSVALDLKDDAGREVLLRLLDTADVFLTNL
APGAVDRIVDDSTLAERNPRLVWCAISGYGPDGPYEKRKAFDLLVQGEAG
VTLNTGEPGCPAKPGVSLADLGGGIYAVTAILSALRQRDATGRGDRVHVA
MFDVLVEWMSPLLIAYLEAGVEIPPAGTRHATITPYGPFTTQDGKVINIA
VQNDRQWLALCGCVGASALSDDPDLRHNAGRLARRNDVEKAVASAVAGIS
EKALVERLDAAGVPWGRMNGVADVVAHPQLQAGNRWTTATLPSGATVPVV
AAPFRFASRPTAADDSASVPAVGAHTDELLEELGIR
118473565YP_887174.1 hypothetical protein MSMEG_2854 [Mycobacterium smegmatis str. MC2 155]MVVRTLHPRLTRELRRPVDVAGRLGDHTSFYGRALAGTPHAAMHYRREVI
RLIAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGNIGIEAL
TGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEIDALESMG
IRPVEYLVSTRIVAGMVAITPLYAVAVILSFAASNLTTVVMFGQSAGLYN
HYFSTFLNPVDLLWSFLQAILMAIAILLVHTYFGFFAAGGPSGVGVAVGN
AVRTSLIVVIAVTLLVSLAVYGSNGNFNLSG
118473563YP_886995.1 beta-lactamase [Mycobacterium smegmatis str. MC2 155]MTNLSRRSVLIGSLAVMAAAGVRMPTASAAPVDDRIADLERRNNASIGIY
AVDLDSNRTVAHRADDSFAMCSTFKAYLAARILRGAERGELSLDDRVFVD
PAALLSNSPITETHAGGEMTLAELCQAALQRSDNAAANLLLKQIGGPAEI
TAFARSIGDQRTRLDRWETELNSAVPGDPRDTSTPAALAGGFRAVLTGDV
LAPPQRQLLDEWMRANETSSLRAGLPDGWTSADKTGSGDYGSTNDVGIAY
GPQGQRILLALMVRTRGDDPNADGFRPLIGELTALVLPELGVH
118473561YP_887392.1 gamma-glutamyltransferase [Mycobacterium smegmatis str. MC2 155]MLIASGCSDGAERPRRPAPGPCEIVSNGTPVPKTPESPPPPPGAPAGRDI
ATQPEVATGYRTDMTAVRTATYAVATANPLATEAACKVLRDGGTAADALI
TAQAVLGLVEPQASGLGGGGFLLYHDAATGAVRAFDGRETAPAAATENYL
RWISEADRTEPRPDARASGRSIGVPGIVRLLDVVHREYGKKAWRELFDPA
VNLADRGFDISPRLAAALLDAAPQLRLDPEASAYFLNQDGTPKRVGTRLT
NPAYAKTLGAIATDGADAFYTGDIARAIVAAAADTSGGRTPSLLTENDLA
TYTVKTRDPLCTTYRGREICGMPPPSSGGIAVAATLGILEHFAMKQHRPT
DLDRNGGHPTVMGVHLISEAERLAYADRDRYVADTDFVALPGGSPNTLLD
SAYLTGRAALISEDRTMGTAQPGSFGPPVTAAPVREHGTSQVSIIDSFGN
AAALTTTVESAFGSFHMVDGFLLNNQLTDFSAEPVSPEGTPIPNRVEPGK
RPRSTMAPTLIFDHDGGERGPLYAVLGSPGGSVIIQFVVKTVVGLLDWGL
DPQQAVSMVDFGAANTPKTNVGGEHPNVDTSDNGDHDPLVRGLRRLGHDV
NLDDQSSGLSAIARTESGWIGGADPRREGLVMGDPG
118473559YP_886874.1 transporter protein [Mycobacterium smegmatis str. MC2 155]MANAPGNNLTPKSDDSARRSALRKVNLRLMPFIFLLYLVNYVDRTALGIA
APNGMSDELQMTATLFGLASGIFFVGYILLEVPSAMAAQRTGARVWIARI
AITWGAVASLTAFVPNYQWLIVARFLLGVAEAGFAPTVLLYLTIWFSNRE
RPKAFSVYLLGIPISSVVAGPVASWLINAGDGVFGLSGWRFMTLMTGVPA
IILGVAALFWLTDRPSQAAWLTDAEKEALIADHDEHTPAEARGHAGGMLS
SLRSGRVWIMGFAYLGVVYSLYTIGFFLPSVVSGFAERFGTDFTVIENGF
IIAVPYVFAAAALMLWPRHATRSGDIGWHVLISTVVGALGIVIAAFAGDP
WIVMLGVTLCAVGVISAMPLVYSLPARILSSVAVGAGLALVNTIGNVGGF
AGPFVTGWLRDLFGNDQGAFAVVALLLLTSGVISVAVQSRTHSINEALQR
NDPASRRHRATIE
118473557YP_885465.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSVPESSSGDSQTLRREFSLWSAFAFAFAFISPIVALYGIFGLALSAAGP
SFWWGFGLVFAGQFLVALVFAMLVSRWPLEGSIYQWSRRLLGTTYGWFAG
WVYMWTLVIAMATVALGAAGFVANIAGLEEPSGGTLALIALVILLAGTAV
NLAGRQALKIFMAASIAAEVIGSVVLGTWLLLFHRENSLSVLFSGGGVDV
DMWSYLSGPFLLAVAFIGWSFVGFESAGSIAEEVHEPRKYLPKAVLFSLT
FIALVVGYSSLAIILAIPDLDAVAEGAVADPVYDTLTNALGHGVAKPVEV
MFVIGFLASFLALQTSASRVIWAYARDGALPAASALGRLRGPARIPTVAI
LVTTVIGACLFLLSIVAGDIYSLMVNFTAGGFYLAFLFPLVGFLVVLLRR
TWTPATFSLKGFTLPVALVAVVWASLQFLNIAWPRAAFDQRWLDWSVWIG
VAALAVLGTAILASVRSHITGTAVVEEAELRDELADRS
118473555YP_887399.1 nucleoside-diphosphate sugar epimerase [Mycobacterium smegmatis str. MMMCSERVFSTVVDAPRDEVFAWHARPGAIHRLFPPWQPLRIEAEAASLAD
GTARLALPGGLTWVARHVAESYDPPRCFVDTIATDGVTSLPARAVVRWRH
IHEFDDTGDGRTRMTDRVQTYVPERALRPMFAYRHRQLADDLAAHRQARA
HGLKPMTIAVTGSSGLVGTALSALLSTGGHRVIRLVRRAPAGPGERRWNP
DDPHPELLTGVDAVIHLAGASIAGRFTDEHRRAIRDSRVGPTRRLAELAA
ATGLETFVSASAIGFYGACPGGPVTEESGRGDGFLADVVAQWEDAAAAAE
QAGVRVVRVRTGVVQSPRGGILRVLAPLFRLGLGGRVGDGAQWLSWIGID
DLVDIYLRALWDTDLTGPVNAVAPEPVRNSQYTRTLARVLHRPAVLPVPA
AGPRLLLGEQGAREVALASQHVTSAELRRAGHRFRHPDLESALRHVLG
118473553YP_889662.1 nucleoside triphosphate pyrophosphohydrolase [Mycobacterium smegmatis MIVVLVDPRRPALVPVDAVEFLTGDVQYTEEMPVKVPWSLPSARPAYDGE
DAPVLLSSDPEHPVVKARLAAGDRLIAAPEPQPGERLVDAVALMDKLRTS
GPWESEQTHDSLRRYLLEETYELFDAVRSGNADELREELGDVLLQVLFHA
RIAEDAPHHPFSIDDVADALVRKLGNRVPAVLAGESISLDEQLAQWEERK
AQEKKVKARASSMDDVPTGQPALALAQKVLARVSQAGLPAELIPASLTSV
SVSADTDSENELRTAVLEFMDTVREVEAAVAAGRRGEDVPEELDVAPLGV
ISEDEWRAYWPGAESSASEAEPEE
118473551YP_888838.1 hypothetical protein MSMEG_4569 [Mycobacterium smegmatis str. MC2 155]MLARNAESLYWIGRYVERADDTARILDVTVHQLLEDSSVDPDQASRTLLR
VLGIDPPRERLDVWSLTDIVAFSRGTYGGASIVDAISAARENARGAREVT
STEIWECLNTTYNALAERERAAKRLGPHEFLSYVEGRAAMFAGLADSTLS
RDDGYRFMVLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGAHDTY
LRTYRGVLDAGRVVEFMMLDRLFPRSIFHSLRLAEHNLDELLNRPHNRLG
ATDEAQRLLGRARSELEFLQPGALLESLETRLAGLQKTCRDVGEALAQQY
FHSAPWVAWTDAGRGDALVIEEGEI
118473549YP_886883.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPIPRLRRAMRDEVRDALLAMLMDGRLAAGTSVSIDRLSRDLGVSQTP
VREALVEIEATGLVHRVAHRGYQVAPPMTAQQAAELADARLVVETTAAHW
ATRLRDPELLPDLRAAHRAHEEAAWAVREWDGVTRDRNGLPVPLKPYFEA
DWRFHQTILDHCGNGFLRRMVGSLGASVQRMRQNVHRGPVDTELAVAEHG
RVLAAVETGDPQAAADAMRAHIEAVRERSIADA
118473547YP_890376.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
MYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRA
YFVTGFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVE
DVFDDPPPAAVCLTGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGL
GAQEMRDWLPRGWHPDRFSVAETNDALAALNTR
118473545YP_890564.1 hypothetical protein MSMEG_6347 [Mycobacterium smegmatis str. MC2 155]MTSRPPSSPTEPSELDQPQRVEHGHRGRIDEILPEHRTLGGVDRPLSQGR
AGGVPADRAQPAQHGRLGAVGVHEGVAVGRDGHRIDDQRIQFGAHELTHR
RCGSRQVAHVGRTEPSALVAGDVQQVVLPVAQLDALAQRQGDVDHRQHRR
LAARRVEPGDVTREPFVVETPGLVVEEMPILVHVNVYVAVVRGRSEVRLQ
RLTVRVLDEHLVERNGLPRGEEQPRREGIRYLTLHYPTPKAATFTSYPLK
WIEVCCVTAYREISYGRANQILDSTRDY
118473543YP_884755.1 hypothetical protein MSMEG_0342 [Mycobacterium smegmatis str. MC2 155]MGRMTSEVMTHDVSLLWQNIFTWASWVITLAMIAIAIRMGLRQRTPFYLF
AVVAAGVAAYAEPLYDVAFDLWFYDAQNGQPGAGLMHFSAFGIPQPNWTH
SGYIILYAGACLYAGRRLYEGRFDRRSLLALWGLEIVTSCVFEVIGTGTD
VYTYYGPHVLRIWNYPLVIGVLEGTQVVLFTVAAVLIWRRASDWWLLLGL
FVLFPMTFFGANFGLGYPVIIGMHLDNGLASTPLIFAATLASIALCSITI
YGLAAFLPTRTPDAGTPAKESVTPTEAQLAN
118473541YP_884607.1 BadF/BadG/BcrA/BcrD ATPase [Mycobacterium smegmatis str. MC2 155]MWPQDADSPSQSHEAHGAPGLAAQRGVTAARDAVCAAVSPLLNDRAGLRL
STVFVGAAGAATAPEAARALAAELLAGLPADEVAVTSDAVTAHAGALGAR
PGVVLSVGTGSVAVGVGADGTFARVGGWGPWLGDEGGGAWIGTAGLRAAL
HAHDGRGPATQLLAMATARFGDLQQLPATVEAQGNPARTSASFAPDVARA
AESGDPVAAGILADAATALASAVLTTTLRIDPRNRLPVAITGGLVRLGEP
LLRPLRTALSAESPQTTLALPLGDSLHGAHLLSRDLTTPHEAHIARVRHT
STQSHPAVR
118473539YP_887383.1 riboflavin biosynthesis protein RibD [Mycobacterium smegmatis str. MC2MSISVEAAMRLAIDQAEQVKGATYPNPPVGAVILDRDGQVAGVGGTQPTG
GPHAEVMALRAAAERAEGGTAVVTLEPCNHHGRTPPCVDGLVAAGISRVV
YAVADPNPVAAGGSARMASSGIEVTSGVLSDEVAGGPLREWLHKQRTGLP
HVTWKFATSVDGRSAAADGSSQWITSAAARADVHRRRAAADAIVVGTGTV
FVDDPSLTARLPDGTLADRQPLRVVVGRREVSSDANVLNDDSRTMVIRTH
DPHEVLRALSDRTDIMLEGGPTLAGAFLRAGVVNRILAYVAPILLGGPIT
AVDDVGVPSIAHAQRWRFDCVQTIGPDVLMSLVPN
118473537YP_886880.1 hypothetical protein MSMEG_2542 [Mycobacterium smegmatis str. MC2 155]MPDTPDTLDRMPARTASAVTFLYALGYPIGNAAVAAMSPMALLVFRFSLA
AAILGAWARFAGVAWPRGGKLAHVAVAGLLMQGVQFCFLYLAIERGAPAV
LCAVVIAMNPVTTAVLSAAFLRDRLGLRRILALVLGVAAVLAACASRLAA
ESGVDPVLLLLLAALLGLSAGGVYQQRFCSDVDFRAATAVQNAVALLPAA
VFAALTPFAVHNAKHAVAAVAGVVLLNAALGVSMYVRAISRHGAPAVTML
FCVIPAVAGVLSWLMLGERPDVGIAVGLVVGAAACWLNSSGSRQQRQHDP
GRDG
118473535YP_890894.1 glutaryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTLTAPSKKSTYAPLELFDTDRLLDQDERDIAATVRQFVDTRLKPNVEGW
FESATLPSELAKEFGNLGVLGMHLQGYGCAGTNAVSYGLACMELEAGDSG
FRSFVSVQGSLSMFSIYRYGSEEQKNEWLPRLAAGDAIGCFGLTEPDFGS
NPAGMRTRARRDGSDWILNGTKMWITNGNLADVATVWAQTDDGIRGFLVP
TDTPGFTANEIHRKLSLRASVTSELVLDNVRLPASAQLPLAEGLSAPLSC
LNEARFGIVFGALGAARDSLETTIAYTQSREVFDKPLSNYQLTQEKLANM
TVELGKGMLLAIHLGRIKDAEGVRPEQISLGKLNNVREAIAIARECRTLL
GGSGITLEYSPLRHANNLESVLTYEGTSEMHLLSIGKALTGKAAFRS
118473533YP_885402.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MQIGRRELVAVIIAILLVTAAFVVPHLDLGIVTPLINSTPAQIYSFADTA
PIFGWWNAHVGWGTVPAVLIGAATVWWGPAVAQRLPWRALPLVAWVTSAL
WAFSLAMIDGWQRGFAGRLTARHEYLRQVPSVTDIGEALRTFSSRILDFQ
PDSWITHVSGHPPGALLTFVWLDRIGLGGGAWAGLLCLLVGSSAAAAIVV
ALRAVSGEATARLAAPFVAVAPTAIWIAVSADGYFAGVAAWGLALLALAV
RDSVHRRRVALPTAVGSGLLLGWGIFLNYGLALAALIALAVLITAPDWRA
ALRVAVPAVIAVLAVVAVFLVAGFWWFDGYTLVQERYWQGIANNRPFQYW
SWANLASVVCAIGLGSVAGIGRVFDIKAARRNPGLPMLVIGALLAITFAD
LSMLSKAETERIWLPFTVWLTAAGALLPPRSHRWWLGLNVAGALALNHLI
LTNW
118473531YP_885171.1 hypothetical protein MSMEG_0765 [Mycobacterium smegmatis str. MC2 155]MLRRSRRRESRPTPRTCEHLTADIAEPRPQTPGYCQDCAELGERTWAHLR
MCMTCGHVACCDSSPHQHATKHFHSTGHPVMRSAEPGESWRWCYIDHRVG
118473529YP_887110.1 hypothetical protein MSMEG_2779 [Mycobacterium smegmatis str. MC2 155]MTSAEPAQFRTAVAAMNATTVRPEIELGPIRPPQRLAPYSYALGAEVRHP
DTAIVPERSEGDAFGRLILLHDPDGAEAWDGTMRLVAYIQADLDSSEAVD
PLLPEVAWSWLVDALDARANQVTALGGTVTATTSVRYGDIAGPPRAHQLE
LRASWTATTLELGPHVEAFCEVLEHAAGLPPAGVTDLSSRTRA
118473527YP_886987.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTATSATRIGSAKDALIEAARLSAVFAEGAGARDADRRLPHDEIRALKES
GLLAITVPVAHGGIDMPSTVLAEVIRLLSHGDSSIGQIPHSHFTFLEALR
LQGTESQRAFFYGLVLDGALFANAQAERGPHPTDVDTTTLRPAGDGYVLS
GRKFYSTGALFADWILVRASLSDGSVTVPTASTPKAVAFVPRDAAGVTIV
DDWDGMGQRTTASGTVTLDDVQVPAEHVVPFTAIFTEPTVYGSRAQLLHT
AIDVGIATAALDEGVRQAARARPHFESKVASVADDPTVVQAAGELAVTVR
SAQALLAEAARQVDAARADLTDETAAAASIAVAVAKVAAVRASLDASSAL
FELGGTRSASAGGNLSRYWRDARTHTLHDSTRWKLRHIGRYTLSGTKPPR
HSQI
118473525YP_890643.1 hypothetical protein MSMEG_6430 [Mycobacterium smegmatis str. MC2 155]MIIWVIAGLLGLATGLRIGWALVNKQSLVSSAMIVALGSLGAVAALNWQP
LALLIDTLLRWPNLAVGLSQVALVACAAGSCVMITSASSERSPVTTRRIA
FAQYGIAAVVAVISLVMFFLAGRQPEMAPEEYLKHQLGDNGMSWLLPLLY
VLLALTLVAWAGLRYSNRSRRGRALFVFTVGMVLIVAASAFFLLRAVGTS
DTIGVGAAATLLGCAMVVVAAGSLLPSIEDWFGARQELRVIAPLLDELGK
RQPDVGIGVRPRGPLVFRVAERMSLISDALYLEATAAESRRRKAARHGSG
SADRPVLDVPEVTPQEQARAVAQWIHDTRDEDAPASAFPGLSWLGQPESL
SDREWILAIAQQYREIERAGTPSDSPERDLLTLHDIIAGRGPESSLRGVE
LFAAAQFLGLLDQVLLSLRRQSDGAGSNAADPFVTHVREPGEFLVELLVV
LVVGEVRGLDTEEVGKSSHGCGGRVGAVPRTQLRKIRSRHGDALGLERSN
HLGRRVGSAPGGINRVEQAVQTGGERLAHRFDLHMIHERNEKAAYLLTIV
PSVVTTTKCKPRKS
118473523YP_887339.1 recombination factor protein RarA [Mycobacterium smegmatis str. MC2 15MSDSLFDVPGGGAESGDAIAATGAVGPSSPLAVRMRPAGLDEVVGQSHLL
QAGSPLRRLVEGSGAASVILYGPPGTGKTTLASLISQATGRRFEALSALT
AGVKEVRAVIDTARRAAVHGQQTVLFIDEVHRFSKTQQDALLAAVENRVV
LLVAATTENPSFSVVAPLLSRSLILQLQPLTPADIEAVLRRAITDERGLG
GRVEVTDEAVDLIVQLSAGDARRALTALEVAAEPGERVTVETIEQSLDKA
AVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARR
LMILASEDIGMADPTALQTAVAAAQTVQLIGMPEAQLTLAHATVHLATAP
KSNAVTTALGAAMNDIRAGKAGLVPPHLRDGHYSGAAKLGHAVGYRYSHD
HPDGVVAQQYPPDELVGVDYYQPTGRGYEREISTRLDKLRAIIRRRR
118473521YP_886336.1 propane monooxygenase hydroxylase large subunit [Mycobacterium smegmatMSRQSLTKAHAKISELTWEPTFATPATRFGTDYTFEKAPKKDPLKQIMRS
YFSMEEEKDNRVYGAMDGAIRGNMFRQVQQRWLEWQKLFLSIIPFPEISA
ARAMPMAIDAVPNPEIHNGLAVQMIDEVRHSTIQMNLKKLYMNNYIDPSG
FDMTEKAFANNYAGTIGRQFGEGFITGDAITAANIYLTVVAETAFTNTLF
VAMPDEAAANGDYLLPTVFHSVQSDESRHISNGYSILLMALADERNRPLL
ERDLRYAWWNNHCVVDAAIGTFIEYGTKDRRKDRESYAEMWRRWIYDDYY
RSYLLPLEKYGLTIPHDLVEEAWKRIVEKGYVHEVARFFATGWPVNYWRI
DTMTDTDFEWFEHKYPGWYSKFGKWWENYNRLAYPGRNKPIAFEEVGYQY
PHRCWTCMVPALIREDMIVEKVDGQWRTYCSETCYWTDAVAFRGEYEGRE
TPNMGRLTGFREWETLHHGKDLADIVTDLGYVRDDGKTLVGQPHLNLDPQ
KMWTLDDVRGNTFNSPNVLLNQMTDDERDAHVAAYRAGGVPA
118473519YP_890485.1 thiocyanate hydrolase subunit beta [Mycobacterium smegmatis str. MC2 1MGRLKAHFPEIPDAPPPDLLDHDRFLAYMKTVHDVGGEPDAPMKYENKEY
EYWEHMTYVICEVLAWRGIWLSEERRRIGNVDVGRAIYQGIPYYGRWLWA
VARVLIEKHHISHGELTDRMVEVQERYRDGLAGRMLEATPKSEGDGADVR
RNEHHIRAVGIGDPQIYAGKAGTPKFSVGEAVVVRDLPALLYTRTPEYVR
GAKGVIAEVTYESPAPEDETWDRTDATPEWFYIVRFNLSELFYGYTGTST
DTLQTEIPERWLEKSL
118473517YP_888648.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MTDSTTELTPAAPVSWPDGKTCAVAFTFDVDAESPLLTTDPAFADRMGTM
SHQAYGPLVGVPRLLGILDEFNVPGTFFVPGYTAHRHPEPIRSIARAGHE
IAHHGYLHESLVGADEDTERKILTRGIEALEEVAGVHPVGYRAPMWEMNW
HTPKLLAEFGFLYDSTLMDSDHPYELAVGDGSLVELPVSWALDDWQQYCF
VPDFSGTGLIETPAKAIELWRAELNAMRDIGGAWVLTNHPFLSGRPGRAA
ALREFIAEVCAMDDVWVAGMSQIAEHVRAQKLTPRTLTRPELTPVAE
118473515YP_889874.1 amylo-alpha-1-6-glucosidase [Mycobacterium smegmatis str. MC2 155]MTVTPTILNGGEPASIGFGGGTVTLVEGATFCLSDRHGDVLAGRSHGLFF
RDARVLSRWQLHVDGGEPESLTVQTPEAFAAQFIMRRTPRAGVADSTLLL
VRDRLIADGLRETISLYNLADEPTVVSLELLVDADFADLFAVKEGRAPIG
GAEISLVDNELVLNDRSNRVRGVKITASGSPVVTPGVFRWRVVVPPRGTW
QAEVVAEPTWANQSVKTRFRTGEELEASAPARKIEAWRGTTTTVETDLRA
LAATLQRSESDLGALLIRDETDERPYVAAGAPWFMTLFGRDSLLTAWMSL
PLDVGLSVGTLQRLADAQGRRVDPLTEEQPGRIMHEIRRGPASTDVLGGS
VYYGSADSTPLFVMLLAECWRWGADEGAVRALLPAADAALSWAARYGDRD
DDGFIEYKRATDRGLLNQGWKDSFDAITDAAGHRADAPIALCEVQAYQYA
ALRARAELADAFGEPATAKRLRDRAATLKKRFAEKFWLPDRGYYALALDG
DKRPVDSLTSNVGHCLWAGIATDEHAARLVEKLGTSEMDSGFGLRTLAAD
MGAYNPMSYHNGSVWPHDTAIAVAGLLRYRHVPGAVELAERLALGLLDAA
DAFGGRLPELFCGFHRSQFASPVPYPTSCSPQAWASAAPLLLVRAFLGLE
PDVPHRKLTVRPQLPAAWGRVALTDLRLGSATVAVEAEGTVAKVTGLPGD
WQLSTAES
118473513YP_889252.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMDPQLDLNLLLALDALLDERSVGGAAERLHTSAPAMSRTLARLRRVLDDP
VLVRAGREMVPTPRALALQGRVHDVVQQARAVFTPPEVPDLPNLRRTFSV
QLGDGLFSHCGPRLLARVHAEALNVTLKFVGESHEDTHSLREGSVDIEIG
QVRRTEPETIIEPLVEENWVGVARAGHELTGKRVTLKRFADAEHVVFSRR
GRLRGPVDDLLAEHGLRRRVVACAPSPAGGLFLIQNSDLVGMLPAGIGAQ
AIATFALQTFTIPLELPPLVIGMAWHPRFDADGAHRWLRDCVRSAVRGPQ
K
118473511YP_886104.1 IS6120- transposase [Mycobacterium smegmatis str. MC2 155]MLTVVHDTEDANDKASGAGRSLLDEIVRDGARQMLAAALQAEVAAYVAQF
ADQLDENGHRLVVRNGYHQPREVLTAAGAVQVKAPRVNDRRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSSNDFTPALEQFLGSGAGLSA
STITRLTAQWQDEARAFGARDLSATDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESAESWADLLRDCKRRGMTAPVLAIGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHPSALAAIKEIYNAED
IDKAQIAVKAFEADFGAKYPKAVAKITDDLDVLLEFYKYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGRLLERPTDITPPTSPSDGGQHAGTEVA
118473509YP_891072.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MTDIVGASAGRHLQAIGPEALIGSVELLARSVRVALVSPAGQIVRRAEKE
FPVTGDAAVLRETVQDTVFGCLQGSPLCGVGVASAGLVDHTTGVLRRIDD
QPGFSGYPIAASLTRLLGCPVFVDHRARLQVLGDRWFGHGIGRASFASVA
TGDTLGLGILFEGKVIAPLGGRSGAHITVALGGRRCSCGNLGCWKTIATS
TWLRQEAATRGLGPIDGVGDLIAAARGDTGARRLMTDYADNLAVGLSSVQ
HLLAPGLYIVHGDAAAGGGTFLGRIEERLRAVSEWADFAERPRVVAADTA
ADDVALLGGAGLVLSRLSGQ
118473507YP_885164.1 hypothetical protein MSMEG_0758 [Mycobacterium smegmatis str. MC2 155]MPRPLRGLPTVGIDDVDAHHRVIVTGSAGDLAAVLTRLLKADRLDVEVAH
ARTSWSARRALRGTARRVPLIRDETGTVLVSAAEWHGKEAAPLEGEAIVD
DTVLFDGQAHGVRIEPLDAVPGLRASVLSRRGRPLGWVSGRAAQLGTPGA
VVVRDGATMARPVRRSTFYRHTQGWLRVG
118473505YP_885865.1 preprotein translocase subunit SecY [Mycobacterium smegmatis str. MC2 MLSAFISSLRTADLRRKILFTLGLVILYRVGASIPSPGVNYPNVQQCIAQ
VSGGDSAQIYSLINLFSGGALLQLTVFAVGVMPYITASIIVQLLTVVIPR
FEQLRKEGQAGQAKMTQYTRYLSIALAILQATSIVALAANGGLLQGCSLD
IIQDSSIFGLIVIVLVMTAGAALVMWMGELVTERGIGNGMSLLIFAGIAA
RIPAEGQTILESRGGVVFTAVVIAALVIIIGVVFVEQGQRRIPVQYAKRM
VGRKMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIQSGSSNPG
TGWWDKFVADYLTNPADPVYIAVYFGLIVFFTYFYVSITFNPDERADEMK
KFGGFIPGIRPGKPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLEIGNT
GSVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK
118473503YP_889049.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRRASSTLVKFGVFAVVMAVLTAFLFMTFSEYRGGSYAGYSAVFDDASRL
ESGDSVRVAGVRVGTVKNVSLQPDRTVLVDFDTERNIALTTGTKAAVRYL
NLVGDRYLELIDSPGSTRLLPAGSQIPKERTASALDLDLLLGGLKPVIQG
LDPQDVNALTSSLIQIFQGQGDTLSSLMSKTSSFSNTLADNDQVIGQLIE
NLDTVVDTLNRDGGKFSATVDRLEQLISGLSQDRDPIGTAVTQLDNGTAS
IATLLTQARPPLDATVDQLNRMAPLLDDHKVVLDRGLQKAPANYRKLARL
GSYGSWIMYYVCGISIRVTDLQGRTAVFPMIKQEGGRCAEP
118473501YP_887275.1 NAD dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MTIETREDRFNRRIDHLFETDPQFAAARPDEAISAAAADPELRLPAAVKQ
ILAGYADRPALGKRAVEFVTDEEGRTTAKLLPRFDTITYRQLAGRIQAVT
NAWHNHPVNAGDRVAILGFTSVDYTTIDIALLELGAVSVPLQTSAPVAQL
QPIVAETEPKVIASSVDFLADAVALVESGPAPSRLVVFDYSHEVDDQREA
FEAAKGKLAGTGVVVETITDALDRGRSLADAPLYVPDEADPLTLLIYTSG
STGTPKGAMYPESKTATMWQAGSKARWDETLGVMPSITLNFMPMSHVMGR
GILCSTLASGGTAYFAARSDLSTFLEDLALVRPTQLNFVPRIWDMLFQEY
QSRLDNRRAEGSEDRAEAAVLEEVRTQLLGGRFVSALTGSAPISAEMKSW
VEDLLDMHLLEGYGSTEAGAVFIDGQIQRPPVIDYKLVDVPDLGYFATDR
PYPRGELLVKSEQMFPGYYKRPEITAEMFDEDGYYRTGDIVAELGPDHLE
YLDRRNNVLKLSQGEFVTVSKLEAVFGDSPLVRQIYVYGNSARSYLLAVV
VPTEEALSRWDGDELKSRISDSLQDAARAAGLQSYEIPRDFLVETTPFTL
ENGLLTGIRKLARPKLKAHYGERLEQLYTDLAEGQANELRELRRNGADRP
VVETVSRAAVALLGASVTDLRSDAHFTDLGGDSLSALSFSNLLHEIFDVD
VPVGVIVSPATDLAGVAAYIEGELRGSKRPTYASVHGRDATEVRARDLAL
GKFIDAKTLSAAPGLPRSGTEIRTVLLTGATGFLGRYLALEWLERMDLVD
GKVICLVRARSDDEARARLDATFDTGDATLLEHYRALAADHLEVIAGDKG
EADLGLDHDTWQRLADTVDLIVDPAALVNHVLPYSQMFGPNALGTAELIR
IALTTTIKPYVYVSTIGVGQGISPEAFVEDADIREISATRRVDDSYANGY
GNSKWAGEVLLREAHDWCGLPVSVFRCDMILADTTYSGQLNLPDMFTRLM
LSLVATGIAPGSFYELDADGNRQRAHYDGLPVEFIAEAISTIGSQVTDGF
ETFHVMNPYDDGIGLDEYVDWLIEAGYPVHRVDDYATWLSRFETALRALP
ERQRQASLLPLLHNYQQPSPPVCGAMAPTDRFRAAVQDAKIGPDKDIPHV
TADVIVKYISNLQMLGLL
118473499YP_888620.1 hypothetical protein MSMEG_4345 [Mycobacterium smegmatis str. MC2 155]MWGHPVRGRRPLGIWARLSPPPAQQQTDEHSHDENDDQDEPHRRIDGHPQ
HVDVHPRAVLDDEHRGEGDEDQRHPIAQRGPWFGGGRRHLVAGHGTSSAL
LDTHDGSRRRGDHDTLPP
118473497YP_884745.1 2-nitropropane dioxygenase [Mycobacterium smegmatis str. MC2 155]MNPLPTAWSGRLVLPVIAAPMTSVSGPELVIAACRAGVIGSFPTHNATSP
EELDSWLRRITAQAGGGAPVAPNLVVHRSNARLQADLDCLIRHRVELVIT
SVGSPAAVVDRLHGIGAQLYADVASLRHAWAALDAGADGLVLLTAGAGGQ
TGWANPLAFLSAVRERFDGPLVLAGGIADGRSILAAQAAGADLAYVGTRF
IATSKSRASDEYRRAVVDSTLDDVKLSDRVGGIPASLLSAWLDRQADPEG
ASDGFAQDRLLSNGDAWSAGHSVSGVHGVTTVEELVAELAGQYQAARAEF
AALCEAGGPLR
118473495YP_885056.1 transporter [Mycobacterium smegmatis str. MC2 155]MTTEITRPPAPPSRPSESRKPSLPGLLHLVAIAAVLATIVSAWAIDFVPT
ALIDGSDNIVALLQRMIPPRLDDPARIGMLAVETLLMAVLGTTLAAIASV
PLAFLAARNTTPHPAVQAVARAVITFCRAMPDLLFAVLFVRALGIGVLPG
VLALALHSIGMLGKVFADAIEQTDAGPREAVRSTGVGYFRELLNAVVPQV
VPSWIAMFVYRIDINLRMSVVLGFVGAGGIGFALQDALRGLIYPRALGIV
CVILVIIAGMELLAIAIRRILLDPSRSNPLRDRIARFGLSGVLVGSCVAA
FVLLKINPLALFTWVFPSVGIFTRMVPPNFDALGVDLFTAAAQTVAIGVV
ATAIGIALSIPAGILAARNVSPHPALYWPARAWILVVRAVPELILAVVFV
AALGLGPIAGTCALAIGSIGFLAKLVADAVEEIDPGPMEAVRSVGGGWWK
TLFAAVLPQSMPALVGSSLYLFDVNVRTSTILGIVGAGGVGYLLFESIRT
LNFDVAGAIVIVIFVIVYAIERLSGWIRSRLV
118473493YP_885983.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKPDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDEEFAKTSWQ
LRKFLWAPKLGCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPF
FADRQWAGITDWRAELTPHYDQAQRMLGVVTNPTFTDADRVVKEVADDMG
VGDTFVQTPVGVFFGPDGEKTPGKTVPDPYFGGVGPDRTGCIECGSCMTG
CRYGAKNTLLKNYLGLAERGGAEVHPLRTVAGFEQLPDGTWRVDTVRTGR
WARKDKRSFTATHVVLAAGTWGTQRLLFKMRDTGKLPKLSSRLGVLTRTN
SESIVGAGRYEVTPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGL
LQTLMTDGDGPDGAGIPRWKQLLRNAAEDPRGTLRLLNVHRWSERTLIAL
VMQHLDNSITTYTKRNRLGIRRYLSKQGHGAPNPTWIPVGNEVTRRIAKK
IDGVAGGTWGELFNIPLTAHFLGGAAIGDSPETGVIDPYQRVYNYPTLHV
MDGAAISANLGVNPSLSITAQAERATSLWPNKGEQDQRPAQGEPYRRLAP
IAPVRPVVPADAPGALRRLPIEPVSSAG
118473491YP_885631.1 hypothetical protein MSMEG_1240 [Mycobacterium smegmatis str. MC2 155]MNAAVLRMALQFGNGTHLDSREGIGRFGMGLPSASISQCKRVEVWSWQDG
PENALYSYIDLKLIEKQEMTEVPAPVVRKIPKEWLDVASEIGAKGTLVVW
SHLDRCMWRTAKTIIRNSEFVIARMYRKFLSDGRASIRLVAFTDTDGGNH
SIDDYAVANDPGYLLTPSSTPEPFSETPMFQPDGDKWSVPVEIEYNGEKH
TVFVRFSYAREVARTGHNPGSTPYGKHAARNVGVSLVRADRELDMDESLV
ISHDVTERWWGVEVDFPPSLDELFGVTNNKQSARNFSEVAANLDALTAEE
DGITSTARRDLMREDEDPLGPLIDIVSLIDRRLSAMRKLLKVQRKGSSGK
GRHRYDPDSAEAIATTITRERQQEGKHGVSDDGEGLPVEERTAVFKRELI
DTGLSEQQADDIAAKTIEPGVKYAFAEADLEGRSFFTVRPVAGEILIKIN
VNHPAYHNLVEVLEADVDGELTVEQLRERLLRAHRGLKLLLMAWARYEDE
QPSDARREEIQDIRTDWGRVAARFMRSE
118473489YP_887915.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAAQHPHPLMAQLAALHHFRIYVDIAIVVVVLAMTNLIAHFTTPWASIAT
VPAAAVGLLALARARGWGWTELGLGREHWKTGAGYALAAVGVVLSVIAIG
ALLPWTRPMFMNDNYATLSGALIASMIIIPLQTVIPEELAFRGVLHGALD
RAWGFRGVAAAGSLLFGMWHIATSLGLTSSNVGFTRLFGGGILGTVAGVV
LAVVATGIAGFVFSWLRRRSGSLLAPIALHWSLNGMGALAAAVVWHIST
118473487YP_888254.1 hypothetical protein MSMEG_3965 [Mycobacterium smegmatis str. MC2 155]MSIRTRRRIAILAGTLTVTALFAVGCQSSTEQEPSPPSTTTTTTTTTTTP
APTTTPAPPAPTEKGLSPTGGNLFTPEVKAPPAPTEPPGVHRHKN
118473485YP_888678.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473483YP_888605.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKLEGKSAVVAAGAKNLGGLISTTLASRGVNVAVHYNSASTEADADKTV
AAVQDAGVKAVKVQGDLTVPANVEKLFDTAIDAFGGVDIAINTVGKVLRK
PIAETTEAEYDSMFDINSKAAYFFLQQAGKRLNDNGSITTIVTSLLAAYT
DGYSTYAGSKSPVEHFTRAASKEFGVRGINVNNIAPGPMDTPFFYPEETP
ERVEFHKSQAMGNRLTDIGDIAPLAVFLADEGHWINGQTLFTNGGYTTR
118473481YP_886354.1 hypothetical protein MSMEG_1990 [Mycobacterium smegmatis str. MC2 155]MTAHLSTPYLRDMGAKAADLVASSLTPAAAAYLNQPVDHLASLPWPFADD
VTSFRYTVNVDPARVPRPTRAGEWGRHIVDLGGADYPVNMAERRHVLDTD
PQRVKVRPGMELACWDLLIYYLRDLAQSYPDLLHLDEDGDHFHWRNDLLG
TDQHFVLGDTGTLPGGPLFFLAAEIPDDLLLVIERDGRLYFDAGAVTFAA
AWSASFDIGMDMYEIHGPVPRMTGEGMTARAEQFLKRLPANQVYRRLNWN
LAASPTRTFDISLETLPDWGTHMPRALRDGDVSQVQFRIELEHFIRLPMT
GAVTFNIRTFMASLEEIRAIPEYAEQLAAIIEELPDDIATYKGFADYQDD
VVAYLRR
118473479YP_887939.1 ABC transporter ferric iron-binding periplasmic protein [MycobacteriumMSLMSKVNSVRSVAVVATVAAAAALTLGACGSGSDEADSADKIVVYSGRS
ENLVAPLIEKFTSDTGIEVETRYAGSGELAAQLITEGDKSPADVFLSQDA
GALGAVSEAGLFAPINDEAMAAVPANFSAADKSWLGVSGRARVLVYNPDI
APNPPDTIDGLLAPEWKGKIGFAPSNASWQSFVTGLRVIRGDDGARQWLE
AFKAQDPQPYENNVAVRDAVDAGQIPLGVVNHYYLYELVDAKGEQAVKAR
NKFMAPGDPGGLINVAGVGVLKSAANPEGAQAFASYLIGKSAQEYFAGET
KEYPLIEGVEPSGEMPQLSELQPPAVDLSQLSDLEATQELLVETGLLTN
118473477YP_885027.1 hypothetical protein MSMEG_0616 [Mycobacterium smegmatis str. MC2 155]MTGPVNPDDRRSFSSRTPVNENPDGVQYRRGFVTRHQVSGWRFVMRRIAS
GVALHDTRMLVDPLRTQSRAVLTGALILVTGLVGCFIFSLFRPGGVPGNN
AILADRSTSALYVRVGEQLHPVLNLTSARLISGSPDNPTMVKTSEIDKFP
RGNLLGIPGAPERMVQNAATDAEWTVCDAVGGANPGVTVIAGPLGADGER
AAPLPPDHAVLVHSDAEPNPGDWLLWDGKRSPIDLADRAVTDALGLGGQA
LAPRPIAAGLFNAVPAAPALTAPVIPDAGAAPQFELSLPVPVGAVVVAYD
ADNTARYYAVLSDGLQPISPVLAAILRNTDSHGFAQPPRLGPDEVARTPM
SRGLDTSAYPDNPVTLVEASAHPVTCAHWTKPSDAAESSLSVLSGAVLPL
AEGLHTVDLVGAGAGGAANRVALTPGTGYFVQTVGAEPGSPTAGSMFWVS
DTGVRYGIDTAEDDKVVAALGLSTSPLPVPWSVLSQFAAGPALSRGDALV
AHDAVSTNPNSARMEASR
118473475YP_889754.1 hypothetical protein MSMEG_5517 [Mycobacterium smegmatis str. MC2 155]MNNGPVGTRQARELLRVAFGPSVVALVIIAAVVLLQLVIANSDMTGAFGA
IASMWLGVHQVPVSIGGRELGVMPLLPVLAMVWGTAKTTAAATAPNSSWF
VTRWVVASALGGPLLIAALLLAVIHDAASVITELQTPSALRAFGGVLAVH
AIGALIGVSTKIGRRTLAASPLPKWLPDAVRAASAGVLALFALSGIVTAG
SLVVHWGTMHDLFAITDTVFGQLSLTGLSVLYIPNVIVGTSAIAVGSSAH
IGLATFSSFTVFGGDIPAVPVLAAAPTPPLGPVWVALLIVGAASAVALGQ
QCAARPLTPFAALAKLIVASLISAVTMALLGYAGSGRLGNFGHVGVDQST
FGPAVFLWFVGIGGLTVVMSGGIVRRVRVAPAAPPPAPEPEPEPVVPGEV
LGEPAEADEPDDEPFGDEPYEETPEEPLVSWHADEPPEPAETDDDAGAPV
APRSPRDLLDEDPEDHFFVDEFGDEEVSGDKPRNAED
118473473YP_889213.1 peptide synthetase ScpsB [Mycobacterium smegmatis str. MC2 155]MTSSRQDHTATETATLVRPVDALERLFYRYSDRNPVHFMLVAEFDDVLDE
DAVRSALELLSRRHPLLQVHVEDRQGGRLGFHRIENPEPVPLRVVETTNW
QAVAAEEFVEPFDRSRAPLMRAVLLVDATSSALLLTIDHTIGDGISTIQA
LRDVLAVLNGETLPVLPVPPSQEVMLENVFGPRQQWTLVTPPDPDPRMLR
PTSVREFDGTPTTIHSLAIPAHDTAALLRRCRAERTTVHAAIVTAASRVR
NRWGGEDFVRVLSPINFRSLIRADDEVAPYFSCVITGMAPQDGASFWDQA
RNVTADLAAARSAPRTLAASAGVQQLIGVDADTATAEEVFTRAIPFDLLI
TNLGIQDLEGTGPLRPTAVWAPVLESQIAGNVVIGITTYAGVLRMVACGY
APVQEFLEPVAQTLVDESA
118473471YP_884739.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MSNDGMWGVLPDVLDRACAYYGERTAILDAATGASVTYRELGQWRNQIAH
ALIDNGVQKGERVGLLMPNCLEFIPIQQAIWAAGAVLVQMPTRAAAEGFK
SNLAQTDATTLLYHAKFEDAIASIRDGLPKLQTLIRVGTAENEKSVDALD
FATLVAGQPTHRPQVDIDEHDEAYVLFTSGSTGEPKGVVNSHYTWSYYSI
SAGLEIGDIRFGEVFAHGAPLTHFTQIFVLPTFVRGGTNVMLPGLEPESL
LTFIERHGVTAVALVPTIIYLLLDHPRRSEFDLSTLQTVVYAGSPIAPER
LRQALEVFGPIFIQTYAGTEPGYVACLRKPEHVQREGESVEEWTARLAAA
GRPMFPVRVSVQDENDRILPVGEVGEICSQQLGQMLSYLDPARNAETLRD
GWVHTGDVGYLDHDGYLYIVDRKKDMVVSGGFNVFPRQVEDALATHPAVA
QSAVIGVPHEKWGEAVMAVVVPQSGEITGPELESELIKHVKAALGSVAAP
KTVLFADSLPLNPAGKVDKKAIRKPYWRNQTRQVG
118473469YP_886277.1 catechol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MTTFEAPHIEKIELAEKAGKATAAASGASATERFHLDKSPFDAVRDVPAE
RVDLLAREVLDAVHATIRRHKVTYEEYNALKAWLINVGEDGEWPLFLDVW
VEHVVEEVATAHRHGNKGSIEGPYYVPDSPELGADATMPVRPGEAGTPLV
WEGTITSTDGRPLAGKVELWHADSEGFYSQFAPGIPEWNLRGTISTGDDG
AFRITTMRPAPYQIPTDGSCGKLIAAAGWHAWRPAHLHVKVSAPGHELLT
AQLYFPGDPHNGDDIATAVKPELMLDPQPQPDGSEKVRYDFVLDPES
118473467YP_889087.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTPPQGQAEAARPYETLLAKGEDRRQRILSVAERLLARNGWRNTSLAQIA
KEAGVTTAGLLHHFESKEHLLNAVLDARDLDDDAHADRSGDLADEIKRVA
ERFVRAPELVGTFTVLLVENIQPDAPLHDRLLKRQQDARDIVADIIRRGQ
RSGRYRPDFDPVIKAVEILAFVNGMETSWLLDPSLPLQDVFKGYAEMLAR
EIELT
118473465YP_890940.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MASHTTQHPRPSTAVTDDQWLQTYYLLRAAVAGVWVAAAFIVGTQVSTVA
AVLLLIYPAWDAVANYIDAQRTGGLTQNPTQSLNVAVSLLTTVAVAIGLA
MSMNAVLGVFGVWASLSGIFQLATGVRRWKGHGAQWAMILSGAQSALVGV
TFLKQANAPEVPGIADIAPYAAFGALYFLISAVWLLVAEARRRLPA
118473463YP_886655.1 hypothetical protein MSMEG_2307 [Mycobacterium smegmatis str. MC2 155]MSLAENVQFGIFTPPHQVDYADLLRVWTEADEIPEIAHAWLFDHLIPIAG
DVTGPVLEGWTLLSALAAQTKRLRIGLMVTSNRFRPPSMLAKIATTVDIV
SGGRLDFGIGSGSRPGHPVARHEYISNGLPYHDADHAVASLAEACTLIRR
LWAEEEPFDFDGGFYRLERAFANPKPVQRPHPPIVIGGRAKATLRVVAEH
ADVWNIPGGDIEDMVRRSEMLDSYCAEIGRDPKEIARSTVLGVSYDQPGQ
TRAAVKEAVDAGFGHIVLMLPTPYPDNVVRWGVDEIVTPTAS
118473461YP_890647.1 hypothetical protein MSMEG_6434 [Mycobacterium smegmatis str. MC2 155]MGLFTRRKSRATRRAEARAIKAKAKLEARLAAKNEARRIKADRKAEQKAL
KAQLRAQRETDRNALKIAETQLRAAREGKLLSPTRVRRLLTVTRLLAPVL
VPVVYRAAIAARGAIDERRADQLGVPLSQLGQFSGHGAQLSARIAGAEQT
LRLVAEKKPKDAETKQFVAAINDRLTDLAAAVTAAENMPSARRRGAHAAI
SAQLDGIDADLMARLGLV
118473459YP_886473.1 glucose-6-phosphate isomerase [Mycobacterium smegmatis str. MC2 155]MKPGTFVKVPAHARHNLTNTGTDDLVFLVIYDSAEPRLSRGPAESLSGQT
VSSR
118473457YP_885818.1 30S ribosomal protein S10 [Mycobacterium smegmatis str. MC2 155]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
118473455YP_885748.1 hypothetical protein MSMEG_1362 [Mycobacterium smegmatis str. MC2 155]MRAVAARVAGSAVFVDEIDERERRLRASNLASALPRPGTSEGRQLRRWLT
QLAVAERVVAAEVAGDVAPAEGELLPDTAARLEIGSVAASLLASAHARAV
FMRVTASVSVTDADVAAYHARNPLRFAPRPDVDADGWRGRPVAPPLADVE
NAVRQHLLAAARRREFRRWLDESCAKLVGLAPGYEHPGDPRQPDNTHRH
118473453YP_890802.1 hypothetical protein MSMEG_6590 [Mycobacterium smegmatis str. MC2 155]MSDHQHIVDVLTRYATGIDRRDWRLFRTVFTDDCAIDYGEIGAWNSVDAV
TDFMEQTHAMAGHTLHRLSNHVVTVDGDTAEARTYVDALIMSQDNASGVN
AAGFYDDDLVRTSDGWRIARRRFTSVRVAAV
118473451YP_891040.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MCPDWREREAFCSGPGELLDALIDHWEQHGDRDRLHYERFQPKIGGDAGA
GNGGTVTFLDSETTAECGGGTPILEAGEQAGLKLAYGCRIGICHTCTGTV
RSGKVRDLRSGEIAEPTGQDVRICINAAEGDVEIEL
118473449YP_891111.1 hypothetical protein MSMEG_6914 [Mycobacterium smegmatis str. MC2 155]MPPDPSFAPTQLAARAAYLLRGNDLGTMTTAAPLLYPHMWSWDAAFVAIG
LAPLSVERAVVELDTLLSAQWRNGMIPHIVFANGVDGYFPGPARWATQAL
AANAPRIRHTSGITQPPVHAIAVQRILDQARNRGRSTRAVAAAFLDRRWS
DLVRWHRWLAEKRDPDGHGRITLYHGWESGMDNSPRWDSAYANVVPGNVP
EYQREDNTIVTDATQRPSDLEYDRYLWLLEEMKSVRYDDDLLPKVMSFAV
EDVFVSAIFSVACQVLAEIGEDHKRPHADVRDLYAWADRFRAGVIDSTDD
RTGAARDFDVRAGRWVATETVAQFAPLLCGGLPHDKERTLIKRLEGPRFC
GHPDLRYSVIPSTSPVSRDFRPREYWRGPVWPVMTWLFSWCFARRGWAER
ARLLRQEGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
118473447YP_887301.1 periplasmic binding protein [Mycobacterium smegmatis str. MC2 155]MRVRGRATIRRSALATGSVITVAGLLLAGCGSKASETDAANAESCVDTSG
PTIKVGSLNSLSGTMAISEVTVRDAIKLAVEEINADGGVLGKQIELIGED
GASEPTVFAEKAEKLISSDCVAAVFGGWTSSSRKAMLPVFESANALLYYP
VQYEGLESSPNIFYTGATTNQQIVPALDYLKEKGVKSLYLVGSDYVFPQT
ANRIIKAYAEANGIEIKGEDYTPLGSTDFSTIVNKVRSANADAVFNTLNG
DSNVAFFREYRNVGLTPDTMPVVSVSIAEEEVGGIGVQNIDGQLTAWNYY
ETIDTPENKAFVKAYKDFVKDPKKPTSDPMEAAYVSVYLWKNTVEKAQSF
DVKAIQDNADGVSFDAPEGKVTIDGENHHITKTARIGEIRPDGLIYTVWE
SKGPIEPDPYLKSYPWAAGLSS
118473445YP_884819.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSHYKSNVRDQVFNLFEVFGVDKVLGADKFSDLDADTAREMLTEIARLAE
GPIAESFVEGDRNPPVFDPETHTVTLPEGFKKSMRALFDGGWDKVGLAEH
LGGIPMPRALQWALIEHILGANPAAYMYAMGPGMSEIFYNNGTDEQKKWA
TIAAERGWGATMVLTEPDAGSDVGAGRTKAVQQPDGTWHIEGVKRFITSA
DSDDLFENIMHLVLARPEGAGPGTKGLSLFFVPKFHFDHETGEIGERNGV
FVTNVEHKMGLKVSATCELSLGQHGIPAVGWLVGEVHNGIAQMFDVIEQA
RMMVGTKAIATLSTGYLNALEYAKERVQGADMTQMTDKTAPRVTITHHPD
VRRSLMTQKAYAEGLRAIYLYTATFQDAEVAQAVHGVDGDLAARVNDLLL
PIVKGFGSETAYAKLTESLQTLGGSGFLQDYPIEQYIRDSKIDSLYEGTT
AIQAQDFFFRKIIRDKGQALAYVAGEIEQFIKNENGNGRLKTERELLATA
LADVQGMAASLTGYLMAAQEDAASIYKVGLGSVRFLMAVGDLLSGWLLAR
QAAVAIEKLDAGATGADKSFYEGKIAAASFFAKNMLPLLTSTRQIIENLD
NDVMELDEAAF
118473443YP_890714.1 hypothetical protein MSMEG_6501 [Mycobacterium smegmatis str. MC2 155]MTAEIITYQADHPLLLAVPAFAPAIVVAGVVAYIAIRDRRRKDPPKDQPA
GTRDGVHSERGGVASEDDSP
118473441YP_884991.1 Fis family transcriptional regulator [Mycobacterium smegmatis str. MC2MVSVSEVVGVRALGLRGVLMGRGDADIRWVATSELPDPTPFLEGGEILLT
TGIETRTWGREWDDYVRRLAGAAVAAVGFGIGLTHERTPTALIAACREHD
VNLFEVPRRTTFVAISREVARLLSEQESAATQAALQTQRKLISAATKRHP
ATAVITALAQALDGAACLMSPDGRALTGPVGPRRGEFPFDDAAADVRRLQ
TQAGRSAATQSRPALSLSVQPIGLRGRPAAYLATMGPVRLSDAERDALTT
SVAVLGLVDEQRRSRSTTRQHLHSRAIELLAGNDSRTAQLILEVDAPALV
IPERIRFLRATGGDSEITDAVTALERRGILAGTYADELCTVAVPERAEAA
GESMVDAGLQVGVGAAVPSDDGASGYRTAGLALAQTTPTAALVVWDRVVN
DGPLGLIDPQRAAAFAESWLSGLDSEQLETLRCFLRHHGSRLKVAEELGL
HRNTVRNRLDAIEALLPGRLDDPQTRVSAWIALQSLPPENRPVSP
118473439YP_886202.1 hypothetical protein MSMEG_1832 [Mycobacterium smegmatis str. MC2 155]MPRLNHPRSRRGRDIRGPLLPRSVPGWRSRAERFDMAVLEAYEPIERRWS
SRVSSLDVAVDEIPRMTPKDPDSVQWPPEVVADGPIALARLIPAGVDVRG
NSTRARIVLFRKPIERRVKGSDELADLLHEILVAQVATYLGVEPSVIDPT
IDDD
118473437YP_890289.1 50S ribosomal protein L33 [Mycobacterium smegmatis str. MC2 155]MARNEIRPIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEF
REER
118473435YP_889255.1 DNA repair exonuclease [Mycobacterium smegmatis str. MC2 155]MRFLHTADWQLGMTRHFLNGEAQPRYSASRREAVASLGEIAKRTGAEFVV
VSGDVFEHNQLAPRDVSQSLEAMRAIGVPVYLLPGNHDPLDASSVYTSAL
FVAERPDNVVVLDRAGVHEVRPGVQIVAAPWRSKAPTSDLIGDVLADLPA
DGVTRVLVGHGGVDILDPDKNKPSLIRMAAVEDALARGAVHYVALGDKHS
RTEVGGSGRVWYSGSPEVTNYDDIESDPGHVLVVDIDENDARRAVRVESE
KVGRWRFVTLRRSVDTDRDIADLDLNLDLLDDKERTVVRLALTGSLTVTD
KAKLDECLDRYARLFAALTTWERHTDIAVIPADGEFDDLGIGGFAAAAVD
ELVATARSEAAEAEDARAALGLLLRLVDRDKGAA
118473433YP_889417.1 hypothetical protein MSMEG_5171 [Mycobacterium smegmatis str. MC2 155]MATIDGNTLEGISATTPWTLHHRASGAKRSNVVRFLAPLLAAIVTSAGCG
ALPTEVTETPAAAEVEVLPEVTVQRFEYAADSEQNWADLYLPAGPQQVDS
IPLVVLIHGGAWQSKLGADVFDGLARELADHGMAVYNIEYRRVGSGGGWP
TTFHDVATALDYVTEVDKRFPQLTVDDELVVGHSAGAQLAVWAGTRHKLR
DDEVGSHPSFRPTRVVSLAGPLDMVYAAEHGDHHIVRVLGGRPTEVPDRY
TSVDPIQNIDPEVPVLALHGTRDTVVSPENSRRYVAAVKQQGGRAAVKML
TGENHTSIVSLRSPSHDEVLRAITTTSQTDLDDLLTE
118473431YP_888095.1 hypothetical protein MSMEG_3802 [Mycobacterium smegmatis str. MC2 155]MTIAGELERARHLMLSADEDQARDLLVSLMPRIEQADRDDYALEVFALLG
EIYLVRSAYDGVGECIRRIGDCLGIYTAIRAGRMPEAAAQVRMSDADVDH
MICRYTRRAEFLAAGLAAARGDHDRAAEHLDTLIDSVGPEDLDAEHRRLG
IHARILVATGLCDDDLYARSAPLWDAVLESVTRSGGGDPEDDHLFIAGAL
GYGRFCAESGRLEEAQPWLRRAGARADARGWALPRARTQLERAAACWTAG
QYAETQDLVTEAYPVIADHARAHDVSRSWLYFGLIRLGIGRLQEANTCWE
HAERHWRELGKPLYIHRILLQRSWLSIFRGAFDEATQLVAEARELLDSSP
RHSWLQYARLDDHLGNILRAEALAEMGFDGLGTPEQTWQQVEATHRSGKG
VFRCRPGSRKWLRGTAKLEQAAELKVPAALAVDSVRYTIDDAGARMRWAS
WVSAPMLAGAFAVAWEWDNTELISELVEYHSARGAFSAEPIGQTAGDWAA
TATAPVPVEAELAPAVAANAGTPGSGGLTRLGPLPPLRMDPQTGPILSRY
RELAWQRYGREITSAEPEWATWP
118473429YP_887104.1 RNA methyltransferase [Mycobacterium smegmatis str. MC2 155]MTELTLTTGAPANGGSCVARHDGRVVFVRYALPGETVRVRVVDERGSFWR
AEVVEVIDPSPDRVDSLCPIAGVDGAGCCDLAFATPDASRRIKGAVVANQ
LSRLGGYHWRDEDSATAEPVGSGAATGWRTRVRLDTTADGRPGFHRYHSA
DLVTDLGCAQLPSGMVDGLDDLRVPGGAQLHLALDSEGTRHVVQSGPKNG
RKSPTRVVDGQYEAVQRIGSRVWRVPVTAFWQAHREAAALYSDLVAGWAQ
LEPGMTAWDLYGGAGVFAASLAEQVGESGHVVTVDTSRGSSRSARAALAD
LKSVSVITDSVRRALATQHQRADVAVLDPPRTGANREVIDQIAAADVPRI
IHIGCEAASFARDVGLYLRHGYHVEEIRVFDSFPLTHHIECVAVLNR
118473427YP_888273.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSSNAHNVAPAWALSAIYPLQNDLPVLAETDVLVVGAGASGVAAATTAAE
AGKSVLIVEKYGFAGGAAVAGMSGTICGMYYATARPRQPEQVVYGFTERF
RSALAARGGLTEPQLYGKTFTCAHDPHMWAEVADEFLENAGVRILFHTAV
TGVVMDGDRYAGVVLESNAGRSVVLAQRTIDASGDAAVVSRANGAYYFGA
DGRIQNPTMFFRLADVDIDEFDEYYGQDTICPPKLTDMIEQERKAGANLP
RSRIWVFRTPRRNELMVNATRVAGRDGRALNVIDPEDFTEGEVVGRRQAR
EYADFFRKHVPGCASSYLEDTGTEVGVRQTRSIVGHETLRNDDVLQGRKR
DDGICRVPWPIELHDSKGSNLHWLLDDYYEVPYLSLVPVAGENIIVAGRC
LSAEHEALASARVTAQCFEYGHAAGVASVLSLDENLPYAKIDGRAVRNAM
AANGSAL
118473425YP_890671.1 glutamate synthase subunit beta [Mycobacterium smegmatis str. MC2 155]MADPRGFLKHTTRELPKRRPVDLRLKDWKEVYEDFDHAPLQTQASRCMDC
GIPFCHNGCPLGNLIPEWNDLVYRDRWRDAIERLHATNNFPEFTGRLCPA
PCEAACVLGINQDPVTIKQVEVEIIDHAFDQGWVVPKMPDVQTGKKVAVV
GSGPAGLAAAQQLTRAGHTVTVFERADRIGGLLRYGIPEFKMEKRHIDRR
LEQMAAEGTQFRPNVNVGVDITVAQLRLNYDAVVLAGGATAWRDLPIPGR
ELDGIHQAMEFLPWANRVQLGDPVTDENGQPPITAKDKHVIIIGGGDTGA
DCLGTSHRQGAASIHQFEIMPRPPETRADSTPWPTYPLMFRVSSAHEEGG
ERVFSVNTEEFIGENGHVTALRAHEVKMNAGKFEKVEGTDFELKADLVLL
AMGFVGPEKEGLLDKLGVELTDRGNVKRDDNFQTSVPGVFVAGDMGRGQS
LIVWAIAEGRAAAAGVDRYLMGRSALPAPIKPTAAPQR
118473423YP_887543.1 hypothetical protein MSMEG_3229 [Mycobacterium smegmatis str. MC2 155]MFAVPAVSRWREGSLTDMTDERAGEPGSDRPEPTESSGQPSDPGQTPPPT
RSGESTESSDTASPPPESNPPYTYGASQGAYDTASQAPYGTAPQAPYGSQ
PYGSQPYGAYPGAYPGSYPPPYGGGYPAQPPAQGAAGPRNGLGIAALIAA
IAGLVLCWSIIGGLIVGVVAIVLGFLGHGRAKRGEATNGGVAIAGIVLGG
IAVVLSLAFIAIWATLGFKWFEELGGREYIACLEDAGNDQAAQERCRVQF
EERVEDEFGTPQSR
118473421YP_885902.1 50S ribosomal protein L36 [Mycobacterium smegmatis str. MC2 155]MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
118473419YP_885994.1 kumamolisin [Mycobacterium smegmatis str. MC2 155]MAGTTRHVGVSIRNPGGFRHWHTHWSLALIMIGALLISVFRITSGPDGHG
PAEIAGPYAHLLAASTDLGPADGGPVQLTVTLDGSPEALTSWARERGLSV
RWRHGDTWAIVEGPPADMAAAFEVDIHDYRGRRGQEFYASPQQPSIPEPV
RSEVTEVGRILGYTPYRMNTPDLQHLPAEVPDRGLTPQLLLNTYNLRGLA
EQGYTGKGQTIVIFAFDGFDQADLDTYADTFDLPRFTPILVGGQPSTPRG
ETTMDLQVAHAIAPDARKVVVNARPTVQGDGAYEKIGQMLEDADRQFPGA
VWSFSIGWGCDKLITAADLAPVRSALAAAHTRGTTAFNASGDLAGLECKG
GQDWSSAPGDDDIGLDSVASLPEITDVGGTTLSTTADGAWLAEQAWFDVP
LSQGTGGGVSALFDRPDWQQGFSAPDDGGAQRRLTPDIAAVADPFTGVKI
VLNNQVLVGGGTSQAAPLWAGIAAVMNQYLVANGGRAIGDLNPMLYQIAR
GAPLPAFRDVTLGGNAVATAGPGYDLVTGLGTPDTENLVKNLLVLQKANP
118473417YP_887647.1 hypothetical protein MSMEG_3340 [Mycobacterium smegmatis str. MC2 155]MSNPYAAGTPGWPAPAWSGYTAPAAPRPRRRVRRIALAVTGIVAVVGIGS
YLLGDTNTHNKWYQKGYDIGYNTKKSVVYTDAETACRWRTLTAVDPGENK
YQTRMRQVEKGCIDGFNDRNGTST
118473415YP_885108.1 hypothetical protein MSMEG_0701 [Mycobacterium smegmatis str. MC2 155]MRVTLVRGRFRDVDVSPSSSLVCDRVRGGVRGADDSDVVSSPSDGGVSVP
DGSAPSGGRPISVVSGGLVLVIVDVVDDVVLDVVDAYVGSTKSRGAC
118473413YP_890168.1 peroxisomal multifunctional enzyme type 2 [Mycobacterium smegmatis strMPIDLDKALGAELEPIEFSWTSSDIQLYHLGLGAGADPMDERELRYLVDG
TPQVLPTFGNVAASFHMTEPPKVQFPGIDIELSKVLHASEAVSVPGPIPT
SGTAKSVQRFTEIWDKGKAAVIVSETTVTDPSGKVLWTTKRSIFARGEGG
FGGERGPSTSFEPPSRAPDFEISLPTLPQQALLYRLCGDRNPLHSDPTFA
KAAGFDRPILHGLCTYGIGCKAIVDNLLDGDVSRVASYGARFAGVVFPGE
TLSANIWKEDGKFIGVLTAPSRDNTVVLSGVELVPA
118473411YP_890816.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGADGLTAREAKRLQTRERLMGAAIAEFKRAGMADADVGTIVAAAGVAH
GTFFFHFPTKEHVLLELEQREEERIAKQFAQFVKKPHDLEAALREIVRLV
IGLERRLGDLLFKDFLALHFSQTRPRVDEGMEHPVIARVTEEIEAARQRG
DVAADVNPVNSAVFFLLGFYALLVTTNDWPTRDEVLDDYVRRTLRSMRP
118473409YP_889799.1 NAD(P)H dehydrogenase- quinone family protein [Mycobacterium smegmatisMKVLWVFAHPEQASLNGSLMQEGLGILEELGHEYQVSDLYAMKWKAALDR
DDYTRDTEGRFSVSRASQQAFRTGTLSADIVAEQRKLEWADLFVLQFPLW
WYSVPAILKGWIDRVFVKGFAYGIADPENPGRTLRYGDGPLAGKKALTIL
TSGSPPAALGPRGINGQLDQVLFPLLHGTLWYVGIAPLAPMCLYGADRFS
DHEFASATAELRRRVEAIDDEEPIPFRRQNGGEYDADLVLRPELAPGATG
ISVHYHDR
118473407YP_884552.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRTLQGSDRFRKGLMGVIVVALIIGVGSTLTSVPMLFAVPTYYGQFADTG
GLNIGDKVRIAGMDVGNVKSMEIDGDKVVIGYTLGGRTIGTESRAAIRTD
TILGRKNIEIEPRGSETLKPRGVLPVGQTSAPYQIYDAFLDVTRNAAGWD
TQAVRQSLNVLSETVDQTSPHLSAALDGVARFSETIGKRDEDVKKLLASA
NKVATVLGDRSTQVNQLLVNAQTLLAAVNERGRSVSLLLERVSSVSRQVE
GFVDENPNLNHVLEQLRTVSDVLNERKQDLADILTVAGKFITSLAEALAS
GPYFKVMLVNLIPPTILQPFVDAAFKKRGIDPEEFWRNAGLPAFRFPDPN
GERHENGAPPAAPTPLEGTPEHPGPAVPPGSPCSYTPPADGIPSPGNPLP
CAHLSQGPYGPVPGGYPPPNVATSAPNPDGIAHSPGVPSAAIPGQMPPEQ
PGAPVEIAPGPPGARTVPVSPIPGAPDFTPGIAPPPPAITGPPPPPGPGP
QLAPVGEAPLPGNPPFLPPGSQSR
118473405YP_886451.1 SsrA-binding protein [Mycobacterium smegmatis str. MC2 155]MTKKSASSNNKVVATNRKARHNYTILDTYEAGIVLMGTEVKSLREGQASL
ADAFATVDDGEIWLRNVHIAEYHHGTWTNHAPRRNRKLLLHRKQIDNLIG
KIRDGNLTLVPLSIYFTDGKVKVELALARGKQAHDKRQDLARRDAQREVI
RELGRRAKGKI
118473403YP_884541.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTSLAQRVVAGLKDKIFAGDLPPGHKLPSEAELIDEFGVSRTVVREAVT
RLRAEGLIETFQGRGSFVLAVPEPTAFTIESAAIRTQRDVLDMVDFRLGV
ECEAAALAAARIDARGRDAVRTALDEFVGAAPEDAVEADFRFHRTIAEVS
GNRFYLDLLNSLGPMMIMLPRTRLGDAHSITDAAHAERVRREHDQVAAAV
AAGDPDLARAAMRLHLGNTRRRLAGDR
118473401YP_885622.1 hypothetical protein MSMEG_1230 [Mycobacterium smegmatis str. MC2 155]MTRRALAEDRGLQAERTALAWTRTALAIAASGVLVLLRDSHIQDDPGRLV
VVAAVAVVALGVFALGAHRRRRLLAHPRGNAGRRYIRAAGVTILAEGLLV
MIYLMLA
118473399YP_886145.1 hypothetical protein MSMEG_1773 [Mycobacterium smegmatis str. MC2 155]MMTIPTTLQPPLPDAQGRISAAVISELKGRAPHNHLEPVWVPLRDADPLG
LDIQLALYVCYELHYRGFDGVDPDWEWSAGLLHLRSQLERAFLEAVRKEI
GTIPSDVTAASEMERLSVEPVDGNGPSYFLRDHGTWEQMREYFVHRSLYH
LKEGDPHAWLIPRISGQAKASFVAIEYDEYGAGHGNHLHQQLFADLMEAA
DLDTTYLGYIGHVPAESLALVNLMSMFGLHRKLRGAAAGHFAATEITSSP
GSQRLTAALKRLGAPEPCVRFYAEHVEADAVHEQVVRLNVIGDLVEREPE
LDADVVFGIRAFDALEDRLADHLMKNWAADRSSLSRPLDD
118473397YP_890222.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGSVEQ
IIGGCVTQYGEQSNNITRVGWLTAGLPEHVGATTIDCQCGSAQQANHLVA
GLIATGAIDIGIACGIEAMSRVGLGANAGPDRSLIRASSWDIDMPNQFEA
AERIAQRRGITRADVDALGLASQRKAKQAWDEGRFDREISPISAPVLDEN
KQPTSEWAPVTRDQGLRDTTPEALASLKPVLDGGIHTAGTSSQISDGAAA
VLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTARVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHNADMDKVNVNGGAIALGHPVGSTGA
RLITTALHELERTGKGTALITMCAGGALSTGTIIERI
118473395YP_884608.1 RpiR family transcriptional regulator protein [Mycobacterium smegmatisMARQDATATLADIRAVRPTLAPSERRVADVVLADPARASGFSISVLAEHA
ETSVATVMRFCRTVGLTSYSQLRLALAAAAARELAREGESPAPGTDISVT
DTVDEIVKKIIYNEIRVLEDTGAALDIEMLNRAIDVVSGARRVDISGVGA
SAFVAQDLHQKLHRIGRIAFVWSDRHSAVTAAALLGPGDVAFAVSHSGET
DDVVEFLDAAAGCGATTIALTNSPRSALAEAADIVLTTCARETPFRSGAT
VSRIAQLAVVDCLFVGVAQRSFGETTTALEKTHAAVQRHRRSPRRTSNNG
118473393YP_885022.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MSEVTAELVATGAGTVRGLLAADHRVFYGIPYAAPPQGRARFTAPEPYEP
WPGVRDATTPGPTAPQAQRDGFGRLDMSPFFGPGWVRDPDYLTVNVWTPR
TERAPGHPVMVFVHGGGFVSGSTRSPLYDGSAFARDGVVLVTVTYRLGIT
GFLDIAGAPRNRGLLDVLGALRWVRDNIAAFGGDPGNVTLFGQSAGATLT
AGVLAEPQAQQLIRRVIIQSGNPYGAFTGEQAARVTHAAADALGVDPVLE
DFEGISDERLIGAAGGLGGLDLRTADGFDPLVGLSPFSLVCDEQPAVGAH
PDVGVLIGTTLEEGNLYLVPQGQFGTSTREDVHALAARVHADPVALVQEY
RERHPDADWDRLRSAILGDALFRAGSERFALSRNAYRYEFGWRSTAVDGL
LGAAHAVELPFVFDRLDAEVLRGPDALLGPGDVPQALADEMHGAWVRFAT
TGDPGWAPGEVRRFTEIEVRDSKRADRVPHGNLGVR
118473391YP_887332.1 hypothetical protein MSMEG_3014 [Mycobacterium smegmatis str. MC2 155]MADWYDVARIAAALPETDEQTPRTWRVRKKRIAWERPLRKADLAALGADA
PTGDILGVRVSDEGVKLALVADDPAVYFTTPHFDGYPIVLIRLAAIEPDE
LEELVTEAWLTQAPATLVEKFLADVQ
118473389YP_886180.1 Fe-S metabolism associated SufE [Mycobacterium smegmatis str. MC2 155]MPAALAEVVSDFQEVAGQDKLQLLLEFANELPPLPAHLEEAAMEPVPECQ
SPLFLDVDASDPQAVRLYFSAPAEAPTTRGFAAILAAGLDGQPAADILAV
PDDFYSELGLAALISPLRLRGMSAMLTRIKRRLRTA
118473387YP_891001.1 hypothetical protein MSMEG_6793 [Mycobacterium smegmatis str. MC2 155]MTVTGERPEIILTDVDFNRRDHPDRPLRPIPPGRDHFADQWRRMREIMFG
EWIDVDKEVEPNELTRLRDDYFWQGDEHMIGVVDAFERIGHEQGRAMFEQ
ALTQGIDTVENPPQELVDLFEHLDNLPKQFDLVAAERGRMLAMSSTMAAT
TIIRAWAVYETAMTGDISAATGATGRFADDGPRRFIETARVFAEFTLPEI
FDRHSEAFCDVVRVRLMHALASRGLRRKWGDDLYLKFGEPIPVTSLLGFG
SGMLLGRLVDHAFGRKLTPQQLEDLAEYSSFSGRLWGAPERLYSPNGIEL
IKSLNYVLSRGGNPSPWRAELVDAVAGPEHLQTLTDTLPGLLKKVIYKYA
NTITATIAFAPAGVVFGYEQIEAMLKDTMFEPLGYDIRRRVKNFERLTKL
NVRVAMLADRVPWSNPIREHRKRTGAAARERIAMLDKIAAGRQIPLTYTH
HDRSTSGEGFTG
118473385YP_886556.1 dimethylaniline monooxygenase [Mycobacterium smegmatis str. MC2 155]MTPALPRTAIIGAGISGLTAGKMLKDYRVPYTTFETSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKHRLSFKDFPMPEHYPSFPHHTQIKEYLDAYADAFG
LLDHIEFGNGVVHAERGAHGGWVIEDQASARRDFDLLVVANGHHWDPRMP
DFPGEFTGEQIHSHHYIDPRTPLDLTGKRILVVGIGNSAADITVELSSRT
LQNQVTLSTRSSAWIVPKYLAGQPGDKFFRTTPYLPLSWQRKAVQMIAPM
LGTDPTAYGLPAPNHKLFEAHPTQSVELPLRLGSGDVTPKPNVARLSGDT
VLFEDGTSDVFDVIIYATGYNITFPFFDRDFISAPDNQIRLYKRMFKPGI
DDLVFIGFAQAIPTLFPFVECQSRLLAAYAVGRYALPSTDEMERVIDADQ
RLHAGHCTDRPRHTQQVDYFYYEHDIRAREMPAGAKRAERRAAGTRTAIV
GSVA
118473383YP_885675.1 hypothetical protein MSMEG_1285 [Mycobacterium smegmatis str. MC2 155]MATVTDAVARILAEQGPLHTDEIERLLQASGEPVPEPVVDELSMPVGMLV
DDRWVWLPTVLDGRVFTHRLSAHEVAHDMLDAAVDLDPVSDLFHLDEYLR
LADGSPVSFAVADYDDELLEDRGIPLELAGESGVVLLAPGTLAALKAAEG
DLVGLRLTDQGLALETIETVVDADIGNRLAEVLPGDEPTFVDAAALTLCA
EDPTVFVEATAPLSEVIREAGLAYSDGFIAPAGFDFGRWRFETACHRSAD
THGLDPDDAVALQTLIMALEQLTVDADSLPLLRRAGAALENPVVADALVE
ETVDAGRGSPESLSRLTEALEAQVPRPARAAVRWLRATALERAGDIAAAE
RELLAAETMDTEWPLTLVDLAHIASDRGDAERALALLRRAGFPPDHPNVQ
FLQRYLVAPRPDLGRNEPCWCGSGRKYKKCHLGNEQLSLEERAAWLYSKA
AQHVSETHWHGMLLELALERSRYADDLHDAIAEAMSDPLVMDALLHEGDA
FADFLRVRGPLLPDDERALAEQWLLVDRSVFEVQAVRPGETVTVRDVRTG
DRHEVRERLASREVKPGELLCARVLPTGSIMQFFGGIERVSLGERDELIE
LLDSRPDEVTLVAALTRRFAPPTLTNTEGDLLMVCEAAVRFADPAALDAV
YVRADDDPPHWFEHVPGKPQIRASLKLDGDTLRVETNSEERMDRVLAELG
RLDPAMTVLEESRRPISEVTPPSRELLEPDDPEMIAAMEEFMRDYETRWL
DESIPALNGLTPRQAADDPTRRGDLIKLLDSFPATERGMNADRLRAALGL
D
118473381YP_886300.1 ATP-binding protein [Mycobacterium smegmatis str. MC2 155]MEVKIGVTDSPRELTFNSAQSPTEVEQQFTDALSSGTGVLALTDEKGRRF
LVQTAKIAYVEIGAADVRRVGFGVTVESA
118473379YP_888151.1 polyprenol-monophosphomannose synthase Ppm1 [Mycobacterium smegmatis sMADDRARRFDRFRVRPEEITEVIPAVTDDDPLEDPLDDDVAPGLDDAEPE
PEPRDEHDEPSRPATGSRIGGWVARRGSRFGKGVLDRCAPLSAAIGGGLA
LWLSFPPIGWWFTAFPGLALLGWVLTRTATTKAGGFGYGVLFGLAFYVPL
LPWISGLVGAVPWLALAFAESLFCGLFGLGAVVVVRLPGWPLWFATLWVA
AEWAKSTFPFGGFPWGASSYGQTNGPLLALARIGGAPLVSFAVALIGFSL
TLLTAQIVWWWRHGHKPGVPAPAVMLPGVAIAASLLVTALVWPQVRQSGT
GAGDDTAVTVAAVQGNVPRLGLEFNAQRRAVLDNHVKETLRLADDVKAGR
AAQPMFVIWPENSSDIDPLLNADASAQITTAAEAIDAPILVGGVVRADGY
TPDNPVANNTVIVWEPTDGPGERHDKQIVQPFGEYLPWRGFFKHLSSYAD
RAGYFVPGTGTGVVHAAGVPIGITTCWEVIFDRAARESVLNGAQVLAVPS
NNATFDEAMSAQQLAFGKLRAVEHDRYVVVAGTTGISAVIAPDGHEISRT
EWFQPAYLDNQIRLKTDLTPATKWGPIVQAVLVIAGVAVLLIAILHNGRF
APRMLRRRSATTVKR
118473377YP_885639.1 hypothetical protein MSMEG_1248 [Mycobacterium smegmatis str. MC2 155]MWWELTLPATNLTYKQVRELNLRGGLSLDAFEHVVANADFVSRTVQAIIE
IIGDSTHMHDLLGSLGLDGAAEPVSAPATIRRIPVEANLSERFSIDYKKL
SVEDRTRKEAELQRDYANYLNSKGHTTCRHEISVDGQRLYTDLYDETTCE
LIEVKSSNDRDTMRLALGQILDYAEVVKPKRMTVVVPSRPSYGITNLFYR
HGVRAVWRCESDFESSLIQEAD
118473375YP_884731.1 hypothetical protein MSMEG_0317 [Mycobacterium smegmatis str. MC2 155]MNRAVALRIAACGLLGLGAALLIAALLLTTYTKGKIAKIPLDIDTSLVSD
GTATAFDPDSLVAERFKIDRDVPVALQQQMSVEAPSNADVVTFQVGTTLR
RTDRQQDAGLLLALVDTVTMNRNTAEAVSSENNPGGAVQKPRAIEDEKPP
TNIALPHEGLTYRFPFDTEKKTYPFFDPIAQKAFDANYDGEEDVNGLTTY
RFVQNVGYDADGKLADPIKYSSLYEDDADASVTARAEVWGVPGEPDESIT
MDRFYAASRTFWVDPVSGTIVKSEEHGYQYYAREALKPEVTYVDFKVTTN
EESVESQVAAASDERDRIALWTRILPITFTALGLVSLVGGAVLGSFALRT
ESTLIDPGLDTADHGFFDTQGIQVPGAEAKTEKLPAQRPTDLPPDRPI
118473373YP_890837.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAASARRVGAETSKTRDTLLDHVEQMMLGEGYASVSYRALASAAGVTPSL
VQYYFPTLDDIFLAAIRRYSERNLAQLQKALAARIDDPLRALWEYSRSEA
TGALMTEFMALGNHRKSIRAEIAEVTERGRKIQLDALVAKFGKDARPGGH
FSLPALLLLISGLPKFLSLEEGIGVKTAHKEVTAAFEKYLDEIEPTPRRK
RSR
118473371YP_887496.1 hypothetical protein MSMEG_3181 [Mycobacterium smegmatis str. MC2 155]MRSRHVSVWIEAPPDAVYVFASDPGEWPRWAAGLAQGGLRLTAEGWIADS
PMGIVRVSFTPANTHGVLDHVVELPSGERVYNPLRVVPAGENESRCEVVF
TVRQRAGMTDEQFDADVAAVEADLERLRALLER
118473369YP_886100.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
LTESECTRVVEVLNSARFVDAAPMQVWATLLDEGSYLCSVSTMYRVLNAN
KLVKERRRLARHRKAVCPELVATAPRQVYSWDITKLAGPVKGVYYDAYVM
IDIHSRYIVGVHVHARECGQLAKEMMEQIFGTYGIPHVVHADRGTSMTSN
TVAGLLSDLGVIRSHSRPKVSNDNPYSESWFKTLKYAPAFPERFESIHHA
RDFMDRFVQWYNHEHRHSGIGLHTPADVFYGLAGGKDTQRRAVLADARAR
HPRRFGRDTAPKVIDLPESAAINPPKPAEQETETEAA
118473367YP_890874.1 hypothetical protein MSMEG_6666 [Mycobacterium smegmatis str. MC2 155]MRSLGNTVGMVVGTVAVIVMAATGCTEIATGTPVADPAAATESTTAPKTR
ASATTTAPVPDQSAPVGSAVMSVTGGSGPVTISYRINGGPEQTETNVFLP
WEKRYPVYEKLESEVTADGGDTSLICTIIMEGDMLVSFKSEPRPTCNFAY
WG
118473365YP_885555.1 taurine transporter permease TauC [Mycobacterium smegmatis str. MC2 15MVIPPAEPQAGRGRRFRALTWRLVRPVVVIALFLGVWETAPRIGMVDNVF
LPPLSHVVQAWFTLLGNGQLWEHVSASLSRALAGFALAILVSIPLGVAIG
WYRPVADFLNPILELFRNTAALALLPVFVLILGIGETSKVALVVYASAFP
ILLNTISGVRTVDPLLIKSARSLGLSPVRLFQKVVLPAAVPTIFTGLRMA
AASSILVLIAAEMVGAKAGLGYLITASQLNFQIPNMYAGIVTIALVGVVF
NSVLVAIEGRLSGWRNTN
118473363YP_884575.1 formate dehydrogenase subunit gamma [Mycobacterium smegmatis str. MC2 MKRTTTGETSVATLVREIAADHRDHRGPLLPILHAVQERLGCVPAEAVPV
LAEELNLSRADVHGVITFYHDFRSEPAGRTTVRVCRAEACQALGASRLVA
HLQDRHGVQLGDATDDGTLTAEQVFCLGNCALGPSAQVDGRLYGRLDEAR
LSALIDSAVTR
118473361YP_890628.1 hypothetical protein MSMEG_6415 [Mycobacterium smegmatis str. MC2 155]MRMDPQRFEELVSDALDQVPPELAAAIDNVVVLVEDRNPDEPEILGLYQG
VALTERDSWYAGSLPDTITIYRDALLDICDTEDDVIDEVAITVIHEIAHH
FGIDDERLHELGWG
118473359YP_886707.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium smegmMSQISRDEVAHLARLARLALTEDELDGFAGQLDAILGHVSQIQSVDVTGV
EPTDNPLKDVNVTRPDTVQPCLTQDEALAAAPKAADGRFAVPRILGEPE
118473357YP_886412.1 NADH dehydrogenase subunit M [Mycobacterium smegmatis str. MC2 155]MVSTFPWLTVLWAVPVVGAAVVILLPAAQQVLAKWLALAVSVLTLAVTAV
VAIGFDPAAAQYQFVESHRWIPSFGTGYILGVDGIALALVVLTAVLVPLL
IIAGWNDASRQTGLAGRSVQAYLALTLAVEGMVLMSLVALDILLFYVFFE
AMLIPMYFLIGGFGGENRSRAAVKFLLYNLFGGLIMLAAVIGLYVVTAGS
DAFAAGTFDFREIVAAVSSGEFAVNPAIMNFLFLGFMFAFAVKAPLWPFH
RWLPDAAVEATPASAVLMMAVMDKVGTFGMLRYCLQLFPDASTYFRPVVI
TLAAIGIVYGAVLAIGQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGS
TLYMINHGISTAALFLIAGFLVSRRGSRLIDSYGGVQKVAPVLAGTFLVA
GLATLSLPGLAPFISEFLVLIGTFTRYPVVAVFAATALVLSAVYILWTYQ
RMMTGPVRDGIGDGDRPVRDLVPRELVVVAPLLALLLVLGIYPKPALDVI
NPAVEHTLTTIGQTDPEPTVPPTIAEGAR
118473355YP_887773.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMSRWEPDARGRLERAALELYAERGFELTTVAEIAERAGLTERTFFRHYAD
KREVLFGGQHVLQELFVGAVATAVGAPWASGPAVAALDAVAAGLDTVGEM
FAGRHADARRRQAVVNANTALQERELIKLATLAAAIAEALRDRGIPRATA
EVAGEAGIAVFKVAFARWVEVEHETDLRMVMREVLDDLRNLFVAG
118473353YP_886803.1 nicotine dehydrogenase chain A [Mycobacterium smegmatis str. MC2 155]MKPAPFQYLRPATVAEALEQLASYPDAKVMAGGQSLMALMNLRLARPGVI
VDIGRLDELRRIFDDTEDLILGALVTHRTVETDPLIAARAPLLADAARYI
GHVGIRNRGTIGGSVAHADPAAEMPLSTLVLDATFHVESATRGRRQVRAE
DMFVSYFTSALEPDELITWVSIPAARYGQGWGFVEYAHQHGDYGLAGAGA
VLGLDADGRICELRCAVLSAADRPLLFVGDDAVGERPSARLWETLASRWA
RSTDPSSDDPDYSRQLCETALFEALTEATRRVGERQERVDAYR
118473351YP_888747.1 acyl-CoA oxidase [Mycobacterium smegmatis str. MC2 155]MTTTAEHLRNALDGRWRDVKNAMRENLSNEVFRPHYTPNTAIARAKVAEQ
LKIMAAAGAAEDGFRKEHGGNGNVGAAIAQIEMLAMSDLSLMVKAGVQWG
LFGGAIENLGTERHHQAYVRRIIDLDLLGCFAMTETGHGSDVQSIETTAT
YDPATQEFVIHSPTPTARKDYIGGAAETARVAAVFAQLITPDGMNHGVHC
LVVPIRDDEGNDLPGVTTSDCHYKGGLPGVDNGRIVFDHVRVPRENLLNR
YADVSPEGVYSSPIENPGRRFFTMLGTLIRGRVTVGGSAAAAARVALDIA
TRYALQRTQFSAPDDEHEVVIMDYLVHQRRLLPLIAKSYALQFAQNELVA
KCHELQTSDDPDPEEQRELEARAAGLKAANTWHASTAIQEAREACGGAGY
LAENRLIALRADTDVFTTFEGDNHVLTQLVAKELLTAYADDIKGMSPVEW
VRFAANFAGERVLKRTAAQTIIQTILDTRQDNEEEGSLFNRGTQIKMFED
REEYMVASVARRLQGKAKEMSAFDAFNAVQDHVLHAAQAHIDRVILEAFV
AGIDACEDEAARELLADVCDLYALSVIEEDKAWFIEHRFLSTERAKAVTR
GINERCRTLRPHAETLIDGFGIPEQLRYAAMLDPEELLNG
118473349YP_888815.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MTRFLLARAARMVLTVFAVVLITFGLTRVAYRNPARMLAPENASEETIAA
IANSLRLNDPWYQQLWYYVVRGPEIKGTPTGLVNWPPSLGYSYRQQRPVT
ELILEKIPVTFSLAAGALLLWITISVVLGVYAARRPGSVFDHVTSGVSYV
LLSVPTFVTGVILLFVLYYQLSLAGVKFFPSGGYVALTESPAEWARHLLL
PWTTLVLVEVGLFQRVVRASVLEVADKDYIRTARAKGLGAHGVYFNHALS
AALNPILTLGAIEFAAILGGAIITEQIFGLDGVGRLAVNAANNGDAPVVI
GCTLLGAVIFVVSTFVIDVITHARSGK
118473347YP_886228.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
LTESECARVVEVLNSARFVDAAPMQVWATLLDEGSYLCSVSTMYRVLNAN
KLVKERRRLARHRKAVCPELVATAPRQVYSWDITKLAGPVKGVYYDAYVM
IDIYSRYIVGVHVHARECGQLAKEMMEQIFGTYGIPHVVHADRGTSMTSN
TVAGLLSDLGVIRSHSRPKVSNDNPYSESWFKTLKYAPAFPERFESIHHA
RDFMDRFVQWYNHEHRHSGIGLHTPADVFYGLAGGKDTQRRAVLADARAR
HPRRFGRDTAPKVIDLPESAAINPPKPAEQETETEAA
118473345YP_886494.1 phosphoglucomutase [Mycobacterium smegmatis str. MC2 155]MSANPRAGQPAQPEDLIDVAHVVTAYYTRRPDPEDVAQQVAFGTSGHRGS
SLDTAFNEAHILATTQAIVEYRAAQGITGPLFIGRDTHALSEPAWASALE
VLAANDVVAMIDSGDRYTPTPAVSHAILTFNRGREGDLADGIVVTPSHNP
PRDGGFKYNPPNGGPADSDATSVIAKRANEILADNLKAVKRMPLARALQT
VHRYDYLDAYVADLPNVVNLHAIRAEGVRIGADPLGGASVDYWGAIAERH
QIDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPNAMASLIANRDAYQIAT
GNDADSDRHGIVTPDGGLLNPNHYLAVAIDYLYTHRPDWPQSTAVGKTAV
SSSIIDRVVAGLERKLVEVPVGFKWFVDGLVGGSIGFGGEESAGASFLRT
DGTVWTTDKDGIILALLASEIFAVTGKTPSQRYAELAEQYGAPSYARIDA
PADREQKARLSKLSPEQVTATELAGEPITAKLTAAPGNGAALGGLKVTTE
NAWFAARPSGTEDVYKIYAESFKGPEHLAEVQQAAKDVVNTVIG
118473343YP_886174.1 ChaB protein [Mycobacterium smegmatis str. MC2 155]MPKTTREGTAKKSELPSTLKKSDAKAQRTFAKAHDAAAEEYGEGERAHRV
AYSALKHSYEKVGDHWEAKKRRGPSDERALSGGPNAKGRSAEGVDAHASK
AHLLQIARRLDIRGRSTMNKGDLVTAIEKANRRETRARR
118473341YP_884981.1 hypothetical protein MSMEG_0570 [Mycobacterium smegmatis str. MC2 155]MPEMTFEVRWPDGSTQRCYSPSLVIHDHLTAGTHYAVDDFVERSSRALAE
ASERVRAKYGFACTSAAETRQRIVNVARRFSGDAVLEVVAMHPEPGPS
118473339YP_887873.1 hypothetical protein MSMEG_3570 [Mycobacterium smegmatis str. MC2 155]MQTGGPAADALRLSTPDPGAVARSLVGALAMTTAALALASPPAAMWTLGA
GVIAGAVALQRSPGGRVPLVVTASLEMAIVVALAVLTGSHDVVFVLAVAV
WCFAAGMQWSVGANAGLIASAASSLLVIAPPDGYATAPTAFDGLLAPLLV
FGAGVLQAVLIATLPPHRWRVQREGLTRAYRSLATDARNVAADRSADVDD
APLTWLREVFADSEAAQRSRANYGGYQVPERIAVTLAELRSAYAEPASDA
PGVPRLLAAAAALLDAIADQGHTARRDAEHALVRVDSAVASVDGPEKALA
QRLGDLLREAAVLRFGQLHRPDLIGSLASAPSVVRSHLRWTSPILRHAVR
LSAATALAAVAARFGGVEHGHWIALTVLVVLRPETAHTYTRCAGRIATLA
AGVTVASGLTLMWQPEALPAAACALALVALAYWLSRFGYLAVGVPLGAAL
MFFLGVGGAAEWSGLADRLVEILIGGGLAVMAHVALPDHALIRLRQRAGE
LLMTEIDYAAMVVRAFVHEIDHPAEALSAAWQRAFRARAAFEAAWGAARL
DSPTLRRWLRSYRTALNSVTSACTTLENNLPTHPSSALHPDFQAAVDDYV
TALRGAPPSPAVPWSLDTGELAAALRRVQEVASTLAADNGAARILVGELS
TITRSLIGISIDRVTPAGESS
118473337YP_887660.1 hypothetical protein MSMEG_3353 [Mycobacterium smegmatis str. MC2 155]MDGMVATLATDVELVSPISGRMVFRGRDDLRVLLAAIYGSLRELKWADAV
GDATVAVAVSEGNVAGIRITDALVFDLDESGQIRRLRPHLRPLLAIIVFT
AMLGPKMARHLGVVRRALSRP
118473335YP_890186.1 hypothetical protein MSMEG_5959 [Mycobacterium smegmatis str. MC2 155]MDELSDEEIDAWHALRASNQALDSPYFHPGFAAAVHATGRPVSVVVVRDA
AGAVSALLPGHREGAVLHPVGWPAADFQGPICGPGEAPSPLELLVDGLRV
LTFDHLVPQKAGFEPWIVSRRSSPWMDITGGLDGYLDRVSRSGRDKMKEA
RRCRVRAERTHGPLRFGVDVVDDDALARLIELKRAQYVKTGSRDYFAKSA
HVQLMHRLLHTRGPGFGGVLSTVHIGDRLVAAHFGIRSGHVLHWWFPVYD
PAFAQLSPGWILLREVIDAAAEIGITRMDLGRGDDDYKRRAKTGETVVSQ
AFVSNSVTRRVMRSGRQAMTDAVKRSPLAPSLRRALHHVRGVKSSGFPRS
VWT
118473333YP_886893.1 beta-glucosidase [Mycobacterium smegmatis str. MC2 155]MTDPLAHAPTLTLTQQAALGSGASFWTTEAVGHIPSIVLTDGPHGVRRQS
GASDHLGVGGSEPATCFPPAVALSQTWDPDLVERVGAALGAEARALGVHV
LLGPGVNIKRDPRCGRNFEYFSEDPLLSGVLGAAWVRGVQGRGVGASLKH
FAVNNSEHDRMRASSDVDARTLREIYLRAFEHVVREAAPWTVMCSNNRIN
GVYASENTWLLTDVLRGEWGFDGVVVSDWGAVRDRVAAVAAGLDLEMPSS
GGFGDAEVVAAVTAGALDARAVTTAAERVAGLAVRAYESHSAAGHFDIGE
LTEAHHRLACEAAAQAVVLLKNDLRDGEPILPLAPSRLAVIGPFAEEPRH
QGGGSSHVNPTRLDIPLDEIRARNGDQAATHFPGLPTDSGQDSEQVRAEA
VRGAAEAEAAVLFLGLTADEESEGYDREHIDLPQAQLALLRAVVEVQPRT
VVVLSHGGVVRLDEVAKHAPAILDGALLGQAGGGAVADVLFGAVNPSGRL
AETVPVRLQDCPAFLNFPSENGHTVYGERVFVGYRWYDARALEVTFPFGH
GLSYTAFAFSDLEVDSDGPTVRVVVANVGPRAGREVVQVYVSKPDSQISR
PPRWLAGFGSLSLESGERRTLEIPIRRTDLAFWEIRSGQWGVEPGDYTVS
VGASSRDLRLHATVTVEGDVPRAVFTRESTLGEILADPAAAPLLFETLGT
AAQDAPAMGTDLLRMLESVPIERMVALSGGKVTPERLDDLLAALNAVRP
118473331YP_889060.1 hypothetical protein MSMEG_4804 [Mycobacterium smegmatis str. MC2 155]MAHVFTFSRTKLAIAAAGFAAALPLSAGIASAQPDFSAVVNTTCSYEQVM
AALNAQQPDLAAQFNTSPMAQGMLRNFLAAAPAERQQTVNQLQTNPMAQQ
YFGTISSIASSCSRY
118473329YP_888610.1 diacylglycerol kinase [Mycobacterium smegmatis str. MC2 155]MTGRVTVLTNPMSGHGNAPHAAERAVVRLQQRGVDVTAIVGRDARHAREL
VREHLDRGTDALVVVGGDGVIGLALQELAGTDVPLGIVPAGTGNDHAREY
RIPTGDPEAAADVIADGHTRTVDLGRIDADDGTRRWFGTVVATGFDSLVS
DRANRMSWPHGRMRYNLAMVAELSKLRLLPFRLSFDGGDAEDHALTMTAI
GNTRSYGGGMLICPGADPTDGLLDITMIASASRSRLIRLFPTVFKGTHVN
LDTVTTRRARSVRVECPGINAYADGDFAAPLPATITAVPGALKILTSAPG
118473327YP_889725.1 sensor histidine kinase [Mycobacterium smegmatis str. MC2 155]MASATCCGKRLRSEMAFPPNSWRPTGPLPTSSLSLRWRVMMLAMSMVALV
VVLMAVAVYAVVSRALYDDLDNQLHSRARLLIESGSLAADPGKAIEGTAY
SDVNAMLVIPGRSIYTANQQGQTLPLGEPEKDVISGELLMSLRTANHQRV
LAVHLANGSSLLISKSLAPTVQVLRRLGTVLLIVGGIGVAVAAIAGGAVA
RAGLRPVGRLTEAAERVARTDDLRPIPVVGSDELARLTEAFNMMLRALAE
SRERQARLVSDAGHELRTPLTSLRTNVELLMAAQEPGAPPLPEDEMAGLR
ADVIAQIEELSTLVGDLVDLTREDAGGITPEPVDMADVIDRSLERVRRRR
NDIEFDVDVIGWQVFGDAQGLGRAVLNLLDNAAKWSPPGGRVGVRLHQVD
HMHAEIVVSDQGPGIPPEERRLVFERFYRSDAARAMPGSGLGLAIVQQVV
LKHGGALRIDETVPGGNPPGASVHMLLPGQRIPDPGATRSAEGFVDDRGG
HTVATE
118473325YP_890633.1 abortive infection protein [Mycobacterium smegmatis str. MC2 155]MTGPLEHREHSEHRQPSRRTIKIEIVVVLAVTFGLSAYTALLRLIEAVLL
GLSGQTVALNPRRSPFDLIDLGLHLAGVFNLLAWGALALYLLWRSGIGPK
AIGLGRPQARADGLGGLALAALIGLPGLGFYVVARILGLSADVEPAELYD
TWWRIPVLLGSAFANGWAEEIIVVGFLLTRLRQLDISPTRALVLSALLRG
AYHLYQGYSAGPGNLVMGLVFGYAWQRTGRLWPLIIAHTLIDAVAFVGYA
LLAQHLGWLR
118473323YP_890295.1 TrmH family RNA methyltransferase [Mycobacterium smegmatis str. MC2 15MAGNSQRRGAVRKPGTKKGPTVGSGGVRRRGLEGRGATPPAHMRPNHPAA
KKARAAAKAQQQRAGRKADETELVLGRNPVLECLRAKVPATALYVALGTD
ADERVTESVQIAADRGISILEVPRTDLDRMSNHGLHQGLGLQVPPYAYAH
PDDLLATARADAAPALLVALDNISDPRNLGAIVRSVAAFAGHGVVIPQRR
SASVTAVAWRTSAGAAARVPVARATNLNRTLKSFADAGLQIVGLDAGGDT
TLDELDATGPTVVVVGSEGKGLSRLVREHCDAIVSIPMAGPTESLNASVA
AGVVLAEIARQRRS
118473321YP_887884.1 FabG protein [Mycobacterium smegmatis str. MC2 155]MSAHEHVHEDSVAGQVVTITGASSGIGEATARLLAARGASVVLGARRTDR
LDRIVEEIRSTGGAAVAVAVDVTRRADVDNLVATAVREFGRLDVLVNNAG
IATLGPLADGDTDTWSAVIDVNVRGVLHGIAAATPVFTCQGRGHVITVVS
TAGLKIVPEMGVYAGTKNAVRTIMEALRQESTDGVIRTTSISPGYVRTEL
GGPPGGPAGNAARATMDRIGLPPDAVARAIAFAIEQPHDVEIGDLTIRPT
VQG
118473319YP_889527.1 LpqV protein [Mycobacterium smegmatis str. MC2 155]MRSYPWARKTAAGFAAAAGLSLLTACGSDTGKNTEEGQPAESSSVSAPAS
TSAEAAPPTVAPGEVGVSPGGVTTAVGAPAQSTEEEYFQACHAAKVWMDE
KGGDPRAQIEPYLASLQAPDAAPGPGTYDKTWAELEPARQAAVIVAVAAA
ADDMCG
118473317YP_890359.1 metallopeptidase [Mycobacterium smegmatis str. MC2 155]MTRSKKVAKKAGHPPVIDPYLPGNGNFGYRVSRYELDLEYKVASNRLTGT
ATITAVTLAALRTFTLDLSDNLSVGKVSVNGRRPAQFRCSGAKLHITLPA
ALPAGSAMTVVIRYSGNPRPIDTLWGDVGFEELTNGALVAGQPNGAASWF
PCDDHPSAKASYRIQISTDSPYHAVANGELLSRKVRAGHTVWTYELAEPT
SPYLVTLQIGMYESHRMTKTPVPMHAVLPPRLRSAFDHDFERQPQMMKLF
VKLFGPYPLSTGYTVVVTDDDLEIPLEAQGISIFGANHCDGSRGSERLIA
HELAHQWFGNSVTARRWRDIWLHEGFACYAEWLWSENSGGRGAAEWAQHY
YDKLRHSPQDLLLADPGPRDMFDDRVYKRGALTLHVLRERIGDKNFFALL
QDWTTRHRHGTAFTDDFTGLAAGYTSESLQPLWQAWLYSEALPPL
118473315YP_886483.1 glycerol operon regulatory protein [Mycobacterium smegmatis str. MC2 1MIQAVDRALRILTVLQGGRRMSLGEIASAIELAPSTVHGLVRTLLAHGMV
QQELDSGRYRLGPATLRLGNVYLDTLELRSRVTVWAESLARRTGCAVRTA
VLLFDEVVVVAHEPRPDGTRQMPEVGIVIPAHASALGKAMLAFQDDYRPE
APLRSMTGETVTDPEVLAAQLAQVRATGMATEAEEAVLGECSSAAAVFDA
TGEVAGAIALVVPAARWPLAPDAVDALRDTARAVSRELGATVWPARRV
118473313YP_884523.1 cell envelope-related function transcriptional attenuator [MycobacteriMNSPAHALTKPRRRTPRRAVRLARRALVGLTAAAILAGTGMGWVTYHGAL
DGITTSNALAGESGSVGDTENILIMGLDSRLDQHGNPLPEDVYQALHAGD
ETVGGYNANVLIVVHLPGDGGPATAFSIPRDDYVDLAGCPSGICKGKVKQ
AYGFAYQAEMEATESEEEDPATREQKAREAGRKAEIATVRNLLGIPIDHF
VEVTLGAFFEIAKAVAPITVCLNDDTSDPYSGADFRKGVQQIDAAQAMAF
VRQRRDINDENFTDLDRTRRQQAFLAALVSALRQSGALSSPSKLRGLLDV
TKQNVALDAGFDLASFTKRASALTDAPPTLYTLPIKEFGQNAYGEDINII
DVPTIRKIVHDLVSKDDPATTTATPDKPELNGHGATLDVINGSTYTGLAA
KLQTTFAADNFTEGQIGDAEALEPATTIDYGPGADAAAHSLATELGVTAT
PSDWVLADTVRLTIGTDFPGTDYLGADMFTSTTSGASESESYGPSETAEL
TPITTVAATATGTYTPAPTDLSQMTASGIPCVK
118473311YP_890720.1 glycogen debranching protein GlgX [Mycobacterium smegmatis str. MC2 15MEIWRGKAYPLGATYDGSGTNFALFSEVAERVELCLFDDDGDGGLRETRI
TLPEVDGFVWHGFIPNIEPGQRYGYRVHGPYDPAAGHRCNPNKLVLDPYA
KAIDGQFDWGQPLFSYNFGDPDSRNDDDSAPNMPKSVVINPYFDWGVDRP
PSHDYADTVIYEAHVKGLTQTHPDIPDNIRGTYAAVAHPAIVEHLQNLGI
NAIELMPVHHFANDSTLIDKGLSNYWGYNTIGFLAPDSKYSSSPNPGGQV
QEFKAMVRTLHEAGIEVILDVVYNHTAEGNHMGPTLSFRGIDNAAYYRLV
DDDKRYYMDYTGTGNSLNVGHPHALQLIMDSLRYWVIEMHVDGFRFDLAS
TLAREFYDVDRLATFFELVQQDPVVSQVKLIAEPWDVGPGGYQVGNFPPL
WTEWNGKYRDTVRDYWRGEPATLDEFASRITGSADLYEQTGRRPFASINF
VIAHDGFTLRDLVSYNEKHNEANGEDNNDGESHNRSWNCGAEGPTDDPEV
NALRSRQQRNFITTLLLSQGVPMLAHGDELGRTQQGNNNVYCQDSELSWI
DWESADTELLEFTQKVSALRSAHPVFRRRRFFNGRPVRRPGEPRLPDIGW
YAPDGSEMTDEDWDAGYAKSMAVYLNGQGIPDRDERGQRIVDDSFYMCFN
AHYEPIEFVLPPSDFAEQWVEVINTAADCGTDPIEAGTRVTVESRAMLVL
QAHHD
118473309YP_886824.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium smegmatis strMNTSHASAHQMTTEVVIVGFGPVGKLLAVQLGRRGHSVIVVDRNEASYPL
PRAVTHCSDAARILQSVGLSPDKIPHITEPYDDMYRWRNGDDDTLLDVDW
SGRGESGWYNTYFFNQPALEDALEALVARVDNVRVIRGWEATALRQCEDR
ATVAIRSASTGAEMTIDAEWVIGADGANSKVREWAGLGWHNDGYYFDWLV
VDVKPSHELNFPHIAVQSCDHRRPATMVPGGPGRRRWEFMRLPHESREEL
NTDAKAWELLAPYGVGPGNARLERHAVYTFKACWADRWRDGRVLVAGDAA
HLMPPFAGQGLGAGMRDAMNLSWKLDAVLRGRADAGLLDTYGSERLHHAV
AFVKFSTSLGQVICITDEHEAAARDERMIADWRAGMAPPAPPRPGLGAGP
HVGEAGGTLARQGRIRMGSAEPTLFDDALGGPGAVITRTAATLAEISPDV
RSGLADLGMASVALAGTPSAGIVVADDVDGTYRAWLDELGADTVVIRPDF
HVYGAGPADRTHDLITGLLTSVSGQSVVSAHPVSR
118473307YP_889164.1 hypothetical protein MSMEG_4909 [Mycobacterium smegmatis str. MC2 155]MRKWKRVEAADGPRFRSALEGHEAALLSSLVGSMLGMLDERESSAPADEL
EAITGIKTGHSRPPEDATMKRLLPDFFRPQTDHPAGSGTAESLNSALRGL
HEPQIIDAKRQAAQRLLDTMPDGGGKFELTEDDAHAWAAAVNDVRLALGT
LLEIGPDGPDRLPPEHPMAGHLDVYQWLTVLQEYLVLELVGK
118473305YP_887358.1 bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltMGSSSTDRELLSAADVGRTVSRIAHQIIEKTALDDPAERTRVVLLGIPTR
GVILATRLAAKIKEFAGEDVPHGALDITLYRDDLNFKPPRPLEATSIPAG
GVDDAIVILVDDVLYSGRSVRSALDALRDIGRPRIVQLAVLVDRGHRELP
IRADYVGKNVPTSRSESVHVLLSEHDDRDGVVISK
118473303YP_890711.1 hypothetical protein MSMEG_6498 [Mycobacterium smegmatis str. MC2 155]MRKTAKRFGVATVAASGLAATLIGLAAPSQAAPSGPSNAQQTISQLQSQG
YHVIVNRIGATPIDKAVVVAVRPGTNFTRTDSLNTGVTQKTVYVDVK
118473301YP_891115.1 hypothetical protein MSMEG_6920 [Mycobacterium smegmatis str. MC2 155]MLIAALLCLSAAVVVAVLGLWLLTRPHYGDPVRGVLRAVAPTQLAAAVML
AAGGVTALAAAPQTGLMVVVVCVIGAVATVAAGCWQSAKAVAVSQAASEA
ARAESGGCAPEACAACTLSCSK
118473299YP_888161.1 alpha-ketoglutarate-dependent taurine dioxygenase [Mycobacterium smegmMQVTVTKLGAHIGARIDGVRVGGDLSPATVSAINAALLEHKVIFFSGQDH
LDDAGQLEFAELLGTPTVAHPTLAEGAEQLLPIDSRYDKANSWHTDVTFV
DRIPKASLLRAVTLPSYGGTTAWASTEAAYQQLPAPLRTLADNLWAVHTN
RFDYADSAISAEQRGYRQRFESDYYEVEHPVVRVHPETGERVLLLGHFVK
SFVGLKDTESAALFRLFQDRITRLENTVRWSWKPGDLAIWDNRATQHYAV
ADYDDQYRRLNRVTLAGDIPVDVYGERSRVIAGDASSYSPVDSPVALAS
118473297YP_888679.1 hypothetical protein MSMEG_4404 [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
DPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQM
DGVGTSIIGRPRPLSRHRRADDLYTLNCEEPPNAQHLRRTDAAGRKLGAL
SHGVDTGSLRAHPHELRHLQLHHEWRLLARRAGV
118473295YP_886223.1 transposase IstA protein [Mycobacterium smegmatis str. MC2 155]MLTWEDDVEVHALRKRGWTISAIARHTGRDRKTIADYLSGKRTPGVRARP
GPDPFEPFVDYVAARLTEDPHLWARTLLDELEQLGFPLSYQSLTRNIRAR
NLRPDCQACRTATERPNSVIEHAPGDETQWDWLELPDPPESWGWGKTAHL
LVGSLAHSGKWRAALTPSEDQPQLVAALDRVTRELGGCTRVWRFDRMATV
CDPGSGRVTASFAGVAKHYGVSVAICPPRRGNRKGVVEKVNHTAAQRWWR
TLDDELTAEAAQASVDRFARVRGGTRMRATADGRSAVAVVAKTEPLAPVP
ATPYPVIISQTRTASRQALVSYRGNRYSVPPELAAAQVVVSHPVGAQFCD
IATVAGIVIARHRMAADGLGVMVRDSGHVIALDTMAMATASTGRPHRRKE
RIPPGPAAKAAAAQLLHLNDANQEAAESSTWSTDSTVIDLSAYERAAQKR
TIQ
118473293YP_887478.1 gp55 protein [Mycobacterium smegmatis str. MC2 155]MSIAILIAITLICIAWSLWIRRVTWTCRWEVAATMNVALQGLAVLLMSPF
ASETIGQFLYNLTGKWNLEDYIGHDCYIVAASAVVYNALGRLQDDHSMQQ
SFKQYVERPATLCIPLLLAAFSLGNGAAVYRPDFFQVPTDLWLGVYWTIL
CAILIYLLAYGARAILILRRDPRSRRIANIYLVASVSGIIACVVRLVTTF
LPDLQPVENGRLVWIFACICGAVFALASAHSWRIKTRWLTPSR
118473291YP_890283.1 hypothetical protein MSMEG_6061 [Mycobacterium smegmatis str. MC2 155]MSRETENALLLLIGVSIAIITVTGSYTRYVKPSLLPYLAATAGLLIALAL
VAIVRDIRRGGHHDDDSDNQDHSHRRGVAWLLLIPIVLLAFVAPPAIRPD
AASVTEVANDSVRRPFPPLPEGHAPEISLPDVLIRIAQDSAATLDGRTIT
VTGFTMRDGDHIDLARIVIICCAADAQLARIRLAGPAAAQAVTYPENSWI
KVEGTVAAAQDDSTRRTIPTMTAARLSRIDPPPHPYAY
118473289YP_888171.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMAASRGKATTRLTTDALAFLTERHLAMLTTLRSDGSPHVVAVGFTFDPKT
HIARVITTGGSQKAVNAQERGVAVLSQVDGARWLSLEGKSTVSSDPDAVR
DAELRYAQRYRTPRVNPRRVVIEVRIERVLGSSELLDRS
118473287YP_886258.1 transferase [Mycobacterium smegmatis str. MC2 155]MSGEIDGAVIDAIGADFRAAGYTVDGVAELLGEQADAALLRGVWWPALHA
TRKVPPHRQRLAALVCLFLLGTEEPRDAVEAAFPSAGVDAMVANGVLDVT
EGGALRAALDIRPHSDGTHDFFVVSDQDAVVRSGPLRHDHVLGIGGASVS
LARAVMRTPADRVLDLGTGCGIQALHLDAHSDHIVATDTNARALALAAAT
ARLNGMSWDLRHGSLFEPVAGERFDLIVSNPPFVVGSGARDYIYRDSGMA
GDTVCQKLIEQVGDHLNPGGTAHIMANWIVKRDTDWRDRVAGWLAGTGLH
AWVVQRELADPISYISLWLADAGETPQQAARRGGEWLEWFTEQDIAGIGM
GLILLRAPAGGEPPEQIFEEITGADELVTGTEVEAFFARRAYLRDTSDEQ
LLAARLSTAPVFLEEQSLPGPDGWQQVGAAVRRPGGPGAVIGVDDVMRAL
LAGCRGEVPLGMLIDLLAAHHGVDANALAEAALPEVRDAIARGILYQAQ
118473285YP_888741.1 extracellular solute-binding protein UspC [Mycobacterium smegmatis strMRRSTLLAGGLAVTMAVLLVIAMLMGRTTEPAGKTVVTVRLWDPQVAAAY
RESFDAFSAEHPGIEVRVNTVAYASYFDSLRTDVAGGSADDIFWISNGYF
AGYADNGHLLDIADLLGPDAATAWEPSVVEQFTRNGALWGVPQLTDAGIA
VYYNADLLEKAGVSPADLSTLRWSNGPDDTLRPLLARLTVEESGRTRQWG
YNAANDLQGIYLNFIGSAGGTFSEGDRFTFDNPQAVEAFEYLVRLINTDR
VAPPASDTNDNGDFSRNAFLAGRMALFQSGTYNLAAIADQAPFPWGVAML
PIGPKGRVSVTNGIAAAGNAATRHPEAVREVLAWMGSRRGNEFVGRRGAA
IPAVLAAQPVYHEYWASRGVDVSPFFRVLQGPRIAAPGGAGFPAGFEALT
PYFAEMFLGRRDVAGTLAEAQRAANAAASR
118473283YP_890603.1 transporter major facilitator family protein [Mycobacterium smegmatis MRRYLAATFSALTIRDYRRYALGQTISVSGTWMQKLTQAWLVLELTDSPL
LLGVTVAGQQLPTLLFTTLAGVLADRYSKRTILLWTALGGMLPALVLGVL
VWIDVVNIWIVLAAAVAQGFADAVDKPARLTFVNDIATPETLANAVTLNS
IIQNSGKIAGPAVAGVLISAVGVSASFFLNAASYLPVVIALLLIRPHAPV
ITGNVSAKGHLGETLRYVSARPHIAAALVLMAVSGLLAFNWNVLLPTLAR
DTFGGDARVVGFAFTSMGVGAVFGGLALAGVLRGTSKWLILNGCVLGAAL
ALTGLMPTVTIAYALLFVVGAASVTFRSTATTLLQLYSDPGVRGRIISLL
VLATNGTTPVGGPMIGWICTHANPRVACLVGGLGTVAAALAHWAYLRKAG
TRKDPIPL
118473281YP_887428.1 carbohydrate kinase [Mycobacterium smegmatis str. MC2 155]MPEFTIGVDIGTTGTKTVLVDVDAARIVAQSTGETTLHSDAPGHAEADPW
QWLANTHAGIRAVLAESGISPDRVGAVATTGMVPAVVAVDRDGNPVRRAI
LQNDARATREIDTLKERIDDETVLAATGSAITQQSVAPTALWLRGNEPDC
WQRTARLVGSYDWVLMALGAAPHVELNWAIESGLGMLDGGRFDPMFAAAG
LSTDLVPQVLSPGQRAGELSPAAAEATGLLAGLPLIVGGADHVLSAYAAG
VNRPGDCLVKLGGAGDILAASERPVVDARLYLDAHPVPGRWLPNGCMATS
GSLIRWFQTLSGGHDLVALDDEAQTRSPAEVLCLPYFLGEKSPLHDPDLR
GAFVGLDLSHTRADMYRSVLEAIAFGFRHHTEVFAHMGVSLERAMVTNGG
SRSVLWKQILADVLGTPLIPVIGHPGASLGAAVIAAVGIGLLGDWDSTQA
FQTLGDPVVPDARHVDRYAEAYAEWRTLGDVLTPVSHRMARKARS
118473279YP_884431.1 hypothetical protein MSMEG_0009 [Mycobacterium smegmatis str. MC2 155]MRFVVLAVVAAVAVIVWRSRHGQEVWHQAG
118473277YP_890740.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMLRQERTGRWRKGMQTRERLLGAALAEFKRNGIAAADTAAIVAAAGVAHG
TFFFHFPTKEHVLIELEAREQERMVTELTRLYTRPHSVRDTLAETVRLLE
KLERRLGRRLFKDFLALHFSTTRPPSQEWTRYPALTVIISELQRAQQRGE
IPADVDVMHVGVSFVVGLYALLITIPEARDARAPVLEVYLTTYLYGLRVL
P
118473275YP_887370.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantotheMSARKRIVVGVAGGIAAYKACTVVRQLTEAGHSVRVVPTESALRFVGAAT
FEALSGNPVHTGVFTDVHEVQHVRIGQQADLVVIAPATADLLARAVAGRA
DDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVLEPAS
GRLTGADSGPGRLPEAEEITTLAQLLLERADALPYDMAGVKALVTAGGTR
EPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEM
VHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKKGASEPS
SIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAK
LERKGCDLLVVNAVGENRAFEVDHNDGWLLSADGTESALEHGSKTLMATR
IVDSIAAFLKSQDG
118473273YP_890073.1 NikQ protein [Mycobacterium smegmatis str. MC2 155]MRADLTDLDNFADGFPHALFEAHRREAPVYWHEPTEHTPDGEGFWSVATY
AETLAVLRDPVTFSSVTGGSRPYGGTLLQDLAIAGQVLNMMDDPRHAQIR
RLVSSGLTPRMIARVEEDLRVRARRLLDAVEPGVPLDFLVEVAAELPMQM
ICILLGVPESERHWLFHAIEPQFDFSGSRTASVGQLTPEEAGNRMYRYGM
ELIAAKRAAPTDDMLSVVANAHDAELSDLELYLFFSLLFSAGAETTRNAV
AGGLLALIEHPSQMALLRADLALLPTAVEEMVRWTSPSPSKRRTATRDVE
LGGCRIAAGDKVQIWEGSANRDPLVFTDPDVFDITRKPNPHLGFGQGVHY
CLGANLARLELRVLFEELLSRFSAARLVKPVEWTRSNRHTGIRHLVVEFD
A
118473271YP_885765.1 hypothetical protein MSMEG_1379 [Mycobacterium smegmatis str. MC2 155]MAAPRIGVIGAGIVGLAVARRLQQKLQADVTVLDKENVVAAHQTGHNSNV
VHSGVYYPPGSLKATLCRRGVGLLRAYCMERGLPYDELGKVIVAVQTDEL
PRLHDLAKRAVDNGIPDTRVIDRAELREREPHVDGLAALLIPSTAVVSFP
AIAEEFRADIEAAGGQFRLGSPAVGIASRDGGVVITTDTDEFVFDHVVVC
AGLQSSMIAEMAGAPRDPEIIPFRGEYYSLVASRSDLVKGLVYPVPDPRY
PFLGVHFTRGIDGHVHVGPNAVLALAQEGYRWRDVNVRQLWRSVSYPGML
RLARHHWRMGASEIVGSMSKSVFLRRARAYIPELTASDIVRAESGVRAQA
LKPDGNLVDDFVIHRLAGMTFVRNAPSPAATASLAIAEHIVDALA
118473269YP_884545.1 cyclase/dehydrase [Mycobacterium smegmatis str. MC2 155]MSKTVEVAASAETITSIVSDFEAYPQWNPEIKGCWILARYNDGRPSQLRL
DVEIQGQSGVFITAVYYPAENQIFTMLQQGDHFTKQEQRFSIVPLGPDST
LLQVDLDVEVKLPVPGPMVKKLAGETLEHLAKALEGRVEQLTQS
118473267YP_887314.1 hypothetical protein MSMEG_2996 [Mycobacterium smegmatis str. MC2 155]MTEWFLFLPQVRLEIGDIVERARIAEAAGFDGIAFIDHLEAPGATHQGIW
EAMTTATWVAAHTERLRIGHLVLCDAFRHPAVLAKQAVTLSTASDGRFEL
GLGSGSWPQEFFRFGVDGGDDAAARVDRLERDLALLREHWGEGERGQVPA
PAHKIPLVIGGTGRRTMGLVRRYADWWNIPSHQLDRLPDLLPTVGAARAS
MQQMVGFVGRGIDRAAVTERSSRLFGHLGSGLVCGDAAELTEHFAGLAAQ
GIERFYVWFADFAAPQTISEFAETVMHTGQKGTT
118473265YP_889079.1 cytochrome p450 [Mycobacterium smegmatis str. MC2 155]MTHMAIDPAGIDWFKDPRLVDDPYPYFNALRDKCPVQSEDHYGVTMVTGW
EEAVSVYNDEKSFSSCTSVTGPFPGFPVPLEGRDDVAELIEKHRDELPFS
DQLPTLDPPVHTNHRSLMMRLITPKRLKENEDAMWQLADEVLDDFLAPGK
GEFIKGFASPFTLLVIADLLGIPAEDRNAFVDGISQNSGGGVGSTGDESL
SHSPLEFLYGQFEAYIEDRRSNPREDILTGMATALFPDGTTPSPGDVARV
ATNVFSAGQETTVRLLGTALKVLGDRPDVQKMVREDRSLLPNFIEEALRH
ESPVKGDFRLSRCPVTVGDKDLPSGRTVMVVNGAANRDPRRFENPDDFDP
ARKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTTDIRISEEHHG
PAANRDYKYIPTFILRGLTHLHLEFDVK
118473263YP_885659.1 Ser/Thr protein phosphatase [Mycobacterium smegmatis str. MC2 155]MNNSVSSGYDVIGDVHGCASQLEVLLHKLGYETGASGEYRHPERQAIFVG
DLIDRGGEQLRVLEVVKAMVDAGSALIVMGNHEFNALAYHTEWPVGSGKY
LRPHDDPDNPWSAKNTKQHAAFLDQVRGEDRQRCLEWFATIPLWLDLGEL
RVVHACWHDDSIGVVENLCGSNAPFGDVSHLVAASTEDDPLYEAVETLLK
GPEINLVAHGQPEYHDKDGIPRDNARVQWWNSDARTLRDIAEMGGGFTTS
TGEPYPPLPEIALTGADRSYIYTAEIPVFYGHYWRQGSPKHRHDWTDYTA
CVDFSAVKGGRLTAYRWSGESTIKAENYVTAD
118473261YP_885609.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MSEITVENLDAGYGSVQILHQVSMTARSGEVTCIFGPNGCGKSTLLKAIV
GMIDPWAGTVKIDDEDITHLPSHKTLGRGVAMMPQGGGVFPHLSVRENLR
IGGYTLRDKKELDQRIDTLLDEFPRLRERYTVAAGQLSGGEQMILSIARA
LVLNPRFLLFDEPSAGLSPKLVGDVLVRAAELAQRGVGVLMIEQNIREAM
RVADRMYVLVGGRNRFDGTPADVADDRELMHLYLGGR
118473259YP_885005.1 iron-sulfur cluster binding protein [Mycobacterium smegmatis str. MC2 MSTTFLGSPGLGNLRGDESFPHAARGALANSQLRRNIGHATQTIRGKRLR
AVAECDDWEDLRAAGSALKQDVMARLPELLEQLESNVTARGGVVHWARDA
DEANRIVTDLIRATGSDEVVKVKSMATQEIGLNEHLEAQGIAAFETDLAE
LIVQLGHDKPSHILVPAIHRNRSEIREIFSREMPDAGELSDDPRVLAMAA
RAHLRRKFLTARVAISGANFGVAETGTLAVVESEGNGRMCLTLPETLITV
MGIEKIVPTFADLEVFMQLLPRSSTAERMNPYTSMWTGVHPGDGPQEFHL
VLLDNGRTRVLADEVGRAALHCIRCSACLNVCPVYERTGGHAYGSVYPGP
IGAILSPQLTGTTGHDDPNASLPYASSLCGACFEACPVRIDIPSILVHLR
AQQVDSERGGLPGGQDIAMKAAGWAMSDAKRFSLAEKALAAGRVIAGKDH
RISTLPWPASKWTSSRDLPEPPKETFRQWWNRTHEGGSR
118473257YP_890529.1 saccharopine dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRILLVGAGGVGSAFCAIAARRNFFDQIVVCDYDESRARQAAEAVGDARF
TSAQVDATSADAVADLVREHQITHVMNAVDPRFVMPIFNGALAGGADYLD
MAMSLSRRHPDRPYELTGVKLGDEQFGAAEDWEAAGRLALVGIGVEPGLS
DVFARYAADHLFSEIDELGTRDGSSLVVEGCDFAPSFSIWTTIEECLNPP
VVWEADRGWFVTEPFSEPEVFDFPEGIGPVECVNVEHEEVLLMPRWVKCK
RATFKYGLGSEFIDVLKTLHKLGLDRTDKVRVPGANGPVEVSPRDVVAAC
LPNPATLGPQMHGKTCAGLWVTGKGKDGAPRSTYLYHVVDNQWSMAEYGH
QCVVWQTAINPVVALELLASGMWSGAGVLGPEAFDAVPFLNLLKDYGSPW
GIKEL
118473255YP_889189.1 F0F1 ATP synthase subunit gamma [Mycobacterium smegmatis str. MC2 155]MAATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYAAEI
TNMLTELAGASALDHPLLVERKQPKRAGVLVVSSDRGLCGAYNANVLRRA
EELFSLLRDEGKDPVLYVVGRKALGYFSFRQRTVVESWTGFSERPTYENA
REIADTLVNAFMAGADDEGDDAGADGILGVDELHIVFTEFRSMLSQTAVA
RRAAPMEVEYVGEVETGPRTLYSFEPDPETLFDALLPRYIATRVYAALLE
AAASESASRRRAMKSATDNADDLIKALTLAANRERQAQITQEISEIVGGA
NALAGSK
118473253YP_888368.1 nitrilotriacetate monooxygenase component A [Mycobacterium smegmatis sMGRDFTELIHIARSAEESGVRALLLDDAGDGGSDPVVVACALARKTRTIE
LVAAVNTARQHPFGIARRLSGLVQVSGGRAGWAPQDSNRYRLLEAVTIAR
ALWYSWPPEAVVADKAAGVWVETTLVSSIHFDGVHYSVHAPLDLPRSLTG
EPHLYLPAELRGSLAAPATYLDEVRVDRYEDSPTGYPQIEKAL
118473251YP_886087.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MQPVVEMRGISIEFPGVKALDGVDFRLLPGEVHALMGENGAGKSTLIKAL
TGVYDIDDGTIVVAGTPCTFAGPRQAQEAGISTVYQEVNLCPNLTVGENI
LLGREPRRWGRIDYRTLNRRARELLAELELDIDPRSQLGSHPIAIQQLVA
IARATAVRAQVLILDEPTSSLDAREVGELFRVIRRLRDSGTAILFVSHFL
DQIYAISDRMTVLRNGKLVGEYLTAELPKSDLVAAMLGRQLDVLDEVAEA
ANVTAETAEHQSETLVRADALGRVPAVHPVTLDIGRGEILGLAGLLGSGR
TELARLLFGADRATSGHVEIRGRRVALRTPRSAIAHGFAFTSENRKDEGV
VGDLSVRENLVLALQARRGFARPLSTKTKDQLVAKYLDALDIRPRNPDTL
LKNLSGGNQQKVLLARWLITEPDLFILDEPTRGIDVGAKTQIQKLVTELA
GDGMAIVFISAELDEVTRISTRIAVMRDRHNVALAEAGTSPSKLTALIAG
TS
118473249YP_884803.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MGKVFDPRNNALNALRLLLAVGVILWHSWPLSGHGVTYKPLEQLLEQVWV
DGFFAISGFLITSSWLRNPRLRDYATARVLRIFPGLWVCLLIIAFVMAPI
GVLLQGGSVSGLMSSYAPIEYVLNNAVLNVYYAGINGTPQGIPWPGVWNG
SLWTLVFEMICYIAVAVLGIVGLLKRRWVIPAIFVLTLCATAYFSYPVFA
MQTIPQMVARFAVMFAAGALIHQYRDVIPARWSLVGIAVVLVLASGFLSN
YRVIGALPLAYAVIVAGALLRNRRLNLRNDLSYGVYIYAFPVQQLLAILG
FANSQPFLFFVIATAATVPLAALSWFLVEKRAIALKSRLKRRRTDTVADT
TQKVSDRGAG
118473247YP_884723.1 dihydrofolate reductase [Mycobacterium smegmatis str. MC2 155]MKTVYYTASSLDGYIVDENQSLDWLTSRDITPDGPFGYEQFIETIGVLVM
GASTYEWVVEHGDWSYDQPAWVLTHRPEIAAESHPMQVFSGDVAELHPEL
VAAAGGKDVWVVGGGDVAAQFVAADLIDEIIVSYAPCTLGVGSRVLPMRS
EWVLDDCARNGDFVCARWKRPVLHT
118473245YP_888590.1 hypothetical protein MSMEG_4314 [Mycobacterium smegmatis str. MC2 155]MKNLIPAVAVSTAIGFVVGGMEASAPPAEPAANPAPPLPDPGVYLVTETA
AAELFEPYDWSLSDCGPGCLHVLSHSPGAPGASWDMEMPWLASADDAQGA
WVGEHTNPGMVCDIGTPEQRQTGPVRMKYIIRPDLTGFVNMGFSQDNPSC
AGDTEPRSRNLVLRRAPMVWS
118473243YP_888604.1 propionyl-CoA carboxylase subunit beta [Mycobacterium smegmatis str. MMTIMAPEAAAESLDPRDPLLRLSTFFDDGSVELLHERDRSGVLAAAGTVN
GVRTVAFCTDGTVMGGAMGVEGCAHIVDAYDTAIEEQSPIVGIWHSGGAR
LAEGVKALHAVGLMFEAMIRASGYVPQISVVVGFAAGGAAYGPALTDVIV
MAPDSKIFVTGPDVVRSVTGEDVDMVSLGGPEAHHKKSGVCHIVADDELD
AYERGRRLVGLFCQQGHFDRSKAEAGDSDLHALLPDSARRAYDVHPLVHA
LLDEGVPFEEFQAKWAPSIVVGLGRLAGRTIGVIANNPLRLGGCLNSESA
EKSARFVRLCDAFGIPLVVIVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
STVPRVTLVTRKIYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAVEDPAEREALHEQLAVEHEKIAGGVDSAIEIGVVDEKIDPSH
TRSKLTEALAEAPHRRGRHKNIPL
118473241YP_887771.1 AMP-binding protein [Mycobacterium smegmatis str. MC2 155]MTPAPLTVPALLQRSVREFGDDTYLVTPTGRATYREIDNLSVRAARWLLG
QGAGKGTRVGLFFANGIEWITWWLAVSRIGAVAVPLSTLYTPAEIAKVLR
LADVGILVAPPRVLNIDVGLRLREALPELAGQPSRAIAVRATPFLRRIAI
TGETDLPCATRIDDTGVPQEILAAAESEVSPADLAVMVHTSGSTADPKGV
LHTHGTLVRQTSTWPAAIRAVTGSQGHARILCAMPFFWIGGLLAATGALH
EPVTLAILPKLDAGAALDLAERERITGIVGWPAFTQRLREHPTFSVRDLS
SAPMLRDGPLDIAMTDVPDGFPVHRTMTETAGGFAYTDMRIVDDNGVPAP
DGTVGELHVRGIGVMAGYNKRERFETFDDDGWYHTGDKVYRRPGDPRVFY
VGRTTDLIKAAGANVSPLEVEAVLAGFGEVAQCLVLGVDDAERGEEVCAV
VVPSGTPGDTLDVALLAQRAREQLSAYKVPTRWVIACSDDIPTLPSGKFD
RKALRRWIIDERLGVTAR
118473239YP_885600.1 glycosyltransferase- group I [Mycobacterium smegmatis str. MC2 155]MTDTPSTDAPPQPRFDHLLRMTDNRGTFEHAFLDEPRTENGYCTDDMARV
LVVASRQPQASGPVHRLGGVAVRFLNEAQALTGPCRNRMDKTGSWTDEPA
LEDPWGRCVWGLGTAAAHSDVNVVRTLALLQFERAAQCRSIWPRAMAFAA
IGAAELLAVKPDNAAARALITDYIAGLSPPAADRSWPWPEPRLTYANAVL
AEAIIAAGIVLEDSGLWTRGLELLRWLVERETGNGHLSVTPVDGWAAGET
RPGFDQQPIEVATLADACARAATVDADSVWPDTVRAAAAWFEGANDLGEP
MWDPQTGAGFDGLHADRVNRNQGAESTLAVISTFQQVQRFSHTAS
118473237YP_888085.1 50S ribosomal protein L35 [Mycobacterium smegmatis str. MC2 155]MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTV
SAADNSRINKLLNG
118473235YP_888910.1 carbohydrate kinase PfkB [Mycobacterium smegmatis str. MC2 155]MTVLGNLAIDIINGAPPSPGGCASFAGVALQAAGGVGRIVAMGAERDHSL
FDGLQERFGPLVQILPSAVTSSFRLDYDDTDHRHMGVEAIGPVWSPADVE
AADPATTWVHLAPLLRTDFPAETLAALVERGHRIAYDGQGLVRADSLGPL
VEDRHFPADLLTHLDILKLAEDEAVIVADGPFTAATAQRLGVPEILVTYG
SEGCDIFVDGDRVRVPAAWRVLGVQTTGAGDMFTACYVAHRAAGADPRRA
AELASGLVARELDKRVHVEPADRV
118473233YP_885855.1 50S ribosomal protein L30 [Mycobacterium smegmatis str. MC2 155]MAELKITQVRSTIGARWKQRESLRTLGLKKIRQSVVREDNAQTRGLINTV
HHLVEVEEVGK
118473231YP_888796.1 salicylate synthase MbtI [Mycobacterium smegmatis str. MC2 155]MTQAGIETASENAEVTGLSLPPGADPVDFVAELARALPERDGEEYVVYER
DRQWTLAAGVRAVIELDSDEIRVISDDVVQSQPWTGRPGAALGEAVDRLL
LETEQLFGWVAFEFGTYRFGLQEHLKPGTPLARVLAPRTRIVVADGRVEL
IGADERQVEAVRRLLAGTIGPAPVSTAVDVRADGSRYRDRVATAIGEITG
GRYQKVILSRRLELPFAVDFPATYRVGRRNNTPARSFLLRLSGIRALGFS
PELVAAVHADGTVITEPLAGTRAFGRGADDDRAAREDLVSNPKEIVEHAI
SVKTSISEIEEVAEAGTAVVLDFMTVRERGSVQHLGSTVGGRLKGSMDRM
HALEALFPAVTASGIPKAESMDAILRLDEAPRGLYSGAVVTFSADGAMDA
ALTLRSAYEAHGATWLRAGAGIIAESTPEREFEETCEKLTTLAPHLVPRV
118473229YP_890311.1 hypothetical protein MSMEG_6090 [Mycobacterium smegmatis str. MC2 155]MTSPAHQSVAPALDLSATKAALWLSVTAFLALAVLYFVGLDQGATSVFGN
NTYVHEFVHDARHLLGFPCH
118473227YP_888627.1 hypothetical protein MSMEG_4352 [Mycobacterium smegmatis str. MC2 155]MTLPLLNGKAADITGPGRTDRFGVTCTDLGASVLAPDGKLVSVFGDTFSG
HRVGQGDWRSPVVLIGTGDADHEIVYERAGGPDPGYARQLWHYIHDDAAS
GWRRGGISTVIPSDLLRVGDSLYLHAIVNRGFGNVIWTEIWRSDDCGVSW
DHLGERAKFPAGWHGGHAQCWSWDHDPDDGWVYVAATGFQRKQGIILMRV
RPAHIGDRTCYVSWGYTGRRWEWGERATPITPAEERWGELSFRRLGPGRW
ILGGFFASRYALGYRVVDSPVANMHTTQVQTPVLGCAWHDEHHEGSRVAQ
LYGGYVLPGSRLDRTGGIGLVVSQWHTDSGWPYRAMQFKARLKDTATAPP
SVL
118473225YP_889736.1 hypothetical protein MSMEG_5498 [Mycobacterium smegmatis str. MC2 155]MPSKIRHIACTATGAVGFAGLMLFGFTGAAVAQPPPVPPPCTAAEMARVM
SGVTFDTSNYLTEHPDVNDFFTSLKGQPKDQIAENVRGYLDANPAVRDDL
QRIRQPAADFRNRCGLPPTP
118473223YP_889591.1 transporter major facilitator family protein [Mycobacterium smegmatis MSLDSSRAVLSSGDELHKRATRKAVLRLLPVMCVVYFMAYIDRTNVALAK
THLDTDVGISAAAFGFGAGIFFISYAFLEVPSNLVMYRVGPRRWIARIAL
TWGALSALMMFVQGDMSFYVMRFLLGAAEAGLYPALMYMVTLWFAQSYRA
TVVGFIYLAPTIALVVGGPMGGALMELDSAMGLHGWQWMFLIEGLVTMLV
GVLVWFKLPQSPTEAKWLTPDEARILSERAAGAHHETVTHLRGNLGKAFG
RPFVIVVALIYFFNQITNVGIVFNIPAIVEDLDISGSFVIGLLSGSAGIG
ATIGVLVVPRLFAWYQREAAAVGILAAATLVTSVLFMLSTSAFARIILIA
ISMIFVFGTLPLFWSIAMARMSGLVAAASLAFINTIGLIGGFVGPYLFGL
AETATHNPSAGFYIVIVSSVIGVALAPVLAHAIRREDSTA
118473221YP_885726.1 flavohemoprotein [Mycobacterium smegmatis str. MC2 155]MTVTTPEPADVRVDLEPEHAEIVSATLPLIGANIDAITSEFYRRLFTNHP
ELLRNLFNRGNQAQGAQQRALAASIATFAKHLVDPDLPHPAALLSRIGHK
HASLGVTAEQYPIVHDNLFAAIVAVLGADTVTPEVAAAWDRVFWIMADTL
IALERNLYDEAGVEPGDVYRRLRVVGRVDDPSGAVLVTVRAAEPVNFLPG
QYVSVGVTLPDGARQLRQYSLVSVAGATDLTFAVKPVEATAAQPAGEVSN
WIRDNVCVGDLLDVTLPFGDLHTDDLSTGPVMLISAGIGITPMIGILEHL
AAERPDAHVRVLHADRSDTAHPLRERQRELVDALPEASLDIWYEDGVTAG
MPGVHAGLLDLDGIELPVEPQIYLCGGAGFVDAVRGQLAARGVPAERVHC
ELFAPNDWLLD
118473219YP_891098.1 hypothetical protein MSMEG_6898 [Mycobacterium smegmatis str. MC2 155]MRVGDPSDLPSRTGSGALARPHRRSDRRDLRPRAGQPTEVATGPAAPHGF
PRARRACVSGGNQRPNPPSTHGRRSLGLKPCRRGRQQHQHHRGDREHEAH
RIGSDAAVVLVLADVRGHQAGGDDRAQQVRDASRDHDPAARHLAQQQHHR
PGQKQHAAQDVQHRDRDQRGPRAVVDRGTACPGRVRHDHGE
118473217YP_890175.1 hypothetical protein MSMEG_5949 [Mycobacterium smegmatis str. MC2 155]MTALSLICLLITPAWFLMSHRGIDVLPLLLAGLGWISFLASCLVNDVSVL
WPNALAPAAFGLYFIGLTVITRRSVDSIAVALAGLAVGAIIFFLAEGIEL
TQTGRFADTWKYGIASAVTILLVFGLTILRAPRLVVPGALLALGLASLGL
NYRAHALVCFLAAGTLLINHVFGSRLRRGWQFIGLIIVGAAFAYAMPIVA
RTGLFGSALQRKTIEQDAFNVPLLLAGRTEPPMSVSAILERPFLGWGSAM
NLTPDVYTSAQHLATRLGFDPTFPFDVYWILPPTNYSAMHSILLGSWAEG
GALAVLLPVALLVACFGIVWNFTRLGRWAPLGVTVALQGIWDIMYGPWLY
NMIPTFACIALLFSATHFRGRPVRSDGQ
118473215YP_889021.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MMFSRNGIRALRIWTAVVLVFLYIPLLLVLINAFNASRTFAFPPTGFTLA
WWADAARSPGMWHALANSVVVGLAATAIALVLGTMIAFAVQRHRFFGRTT
VSFLVVLPITLPGIVTGIALNATFTSALGLMLGMATVIIGHATFCIVIVF
NNTQARLRQMGSSLQDASADLGASSWQTFRFVTFPMMRGALLAGAILAFA
LSFDEIVVTTFTAGPTVQTLPIWIFSNLFRPNQAPVINVVAAALTVLAII
PVWLAGRFGGDPAGARV
118473213YP_889818.1 HNH endonuclease [Mycobacterium smegmatis str. MC2 155]MCLLVVPVCDTGCMPFEHTFDDLDDAALVAGIEGCERAQNAAAARKLALV
ARFTARRAADSEDEVLRWAGDDWAATAAEVGAALNVGPAVASKWMRVAQE
VGERLPRVQEMFAAGWLSAQVVATLTWATHLVGDEQVLAIVDAQLAARAR
EFGPMTVDGVKAAVASLLEKYDPAAVRRSREASRDRDVRFGKPDDVTGTV
SISGRVNTADAVAYQKRSAHLTGGVCGDDPRTAGQRRADAFGVIAVQGDR
LVCLCGDPQCPWAGVDPRAANTMVHIFAEPSVVDAKPDPYVHGDYASNPV
PFVDPEFDPWPVYPERDSTPPPEPPSEPQWAPQWWSEIPLPPEPEPEPEP
EPEPEPEPEPEPELRFESEPQTASAPQPEPEPEARPEPQPKTGPEPEPVS
TPKPQPQDPPAAAESWGGGGVNPLVVAPAPVVSPQRATAVIVGGGLVPAS
YVAQMIASGAKVKQGRVPLEDPESGYRPSVGLAEFVRMRDLTCRFPGCGR
PAECCDIDHTEPFPGGVTHASNIKCLCRFHHLIKTFWAGFVDTQLPDGQV
VWTMPSGRTYTTVPGSRWVFPQWDTTTTTLPPPPPRATSPARGVMMPQRK
LTRAEQRARQIRAERARNEKYLSERNKPPPQ
118473211YP_890567.1 hypothetical protein MSMEG_6352 [Mycobacterium smegmatis str. MC2 155]MTDARGTFEAFKNRDGEIPDAELDAFWALLRPAGIDFMLGEWKGGEFYTG
HKANGFMKKLNWFGKTFVSASEAKPLVCLDADGNKFSNTEAMGGEASLWL
EEFRGEVTASMVYDGRPVHDHFKVVDDNAVIGIMNGKGALDLSSGTPRHL
YFYLERI
118473209YP_888460.1 phosphoribosyl-ATP pyrophosphatase [Mycobacterium smegmatis str. MC2 1MKQFMLVKTFDALFAELSDKARTRPAGSGTVAALDAGVHGIGKKILEEAG
EVWLAAEHEGDEALAEEISQLLYWTQVLMVSRGLTLDDVYRKL
118473207YP_886768.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MGEPMDRDALAEFLRRRREAIRPQDVGLPEGPRRRTAGLRREEVAQLTGM
SVDYYGRLEQARGPQPSPQMLRALARALRLTDDERDHLYRLAGHAVPDRG
GLSTHVRPALLFVLDRMRDAAAFVCTDTGIMLAQNAMAKLLMGDLTTAET
TVEASMIWQWFIDPVVREQFPDVEHDQHSRIMVADLRAAWARRRTEADMR
ELVDGLLARSPEFAELWSRHEVAVRRLQRKTFSTHVGPITLDCEVLAAAD
GQQLVVLTPPAGSSAADDLRLLTVIGDQALG
118473205YP_884629.1 L-sorbosone dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRAWPGISAVVVTASVVLAGCGTEPQTTEPTAQPSRSSSQTTAEHPAGAA
ELTPVTVEVPEGLDDAPLDQPRQALVPDGWTLEVVARVPKARMAAWAPDG
ALLVSVPSTGEVLKVLPTQSTLLDGLDQPHGLFFAGPTLYVAESDQIDAY
DYADGAAVNRRTVIDGLPDAKSPDLRGAYAHALKSVVVGDDGAVYFSIGS
TGNISAEDRTADPPRATIMRVPPGGGPAEPFATGVRNGTGLAFAPDGSLW
TAVNNRDNVADPDGRVVQSYVDDHPPESVARLTPGRELGWPYCNPDGPPP
AKLIRDLQTNPDGAEMDCAALPPIEQTLGAHSAPLGMSFAELPQPFGQGA
LVGVHGSWNRDAPRAPEVSFFAWRDGTLGPQQTLVGGFQDDDGQRWGRPV
AAVTGPDGAVYITDDFAGAVYRLAPPP
118473203YP_890246.1 xylose repressor- ROK-family protein transcriptional regulator [MycobaMANGTQQNRAARVGTSNDDVRRRNLSSVLTLVHRRRSLSRADLTRHTGLS
RSTTKDLVEELVALGLVDESPAPSVSQVGRPSPIVRPSDRVLAVAVTPEV
DAVTVGLVSLGGAVLDVVRHPTAGIPTPSDTVAIAAEAIGDIRRNLRDEQ
ALTAVGMAVPGLVHGRASFVQLAPNLDWHDVEIGEMLSAATGLPVYAGND
ANVGAIAEHLFGSHHDVEDLIYVNGGPSGIGAGFVVAGDLLQGVAGYAGE
LGHTFVGGQRLCHCGSTGCLETEVTQAPLAALLDDLDGAAGDATSDCAGR
DELHRQARALAIALGTAINMLNPGLVVLGGFLRVFPAFAAAVLREELARR
TMAAPCSLVRIVPATLGPDTLMIGAAELAFAPVLADPGGVEAG
118473201YP_888253.1 pyruvate dehydrogenase [Mycobacterium smegmatis str. MC2 155]MITVADHIVSVLRISGVRRVYGLPGDSLNGFTDAIRRSGEISWEHVRHEE
TAAFAAAADAGLTGQLAVCAGSCGPGNLHLINGLFDAQRSRVPVLAIAAH
IPRSEIGSQYFQETHPQELFGECSVYCELVSTPEMAPRILAMAMRAAVED
NGVAVVVIPGEIFLQRIPEQPVRPISATRSVLCPDEASLQRAADMLNAAE
RVTILGGAGVAGAHDALVQLAATLQAPVVHALRGKEFIEYDNPFDVGMTG
LLGFASGYKAIKEADTLLMLGTDFPYQQFYPENATVIQVDVRGAHLGRRT
PIDLGLRGTVGDTLAALQPLLRPKHDREHLDRALRHYRKTRASLDALAVN
DRDRTPIRPEYLAGLIDRLAAADAVFTCDVGSPVVWAARYLSMNGRRRLL
GSFNHGTMANALPHAIGAQSAYPGRQVIALAGDGGLTMLFGELVTLIQNR
LPVKVIVFNNSSLNFVELEMKAAGIVTFGTDLQNPDFAAVATAMGIHGRK
VTEPADLEDVLKEAFAHDGPAVIDVHTARQELSIPPAITIEQAKGFSLYA
IRTILAGRSDELLDLITTNVARRILD
118473199YP_888429.1 acetaldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDKVKVAIIGSGNIGTDLMMKTLRSSSLEMAVLVGVDPRSDGLARAERLG
IATTSGGLDHFVTTPEFEDVAIVFDATSAAAHERHASILAQLNKQVVDLT
PAAVGPYVIPTVNMDRVVGEPNVNMVTCGGQATVPIVAAISGVTPVHYAE
IVASIASRSAGPGTRANIDEFTETTALALESVGGATQGKAIIVLNPAEPP
LIMRDTVLCLCDEADETEIEAAVERMVASVAEFVPGYRLKQKVQFQRYTR
NSPLRLPEQEADFTGLQVSVFLEVEGAAHYLPAYAGNLDIMTSAALRTAE
RMTELDAIRGK
118473197YP_884730.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPAYALVLSVLVTAPLLAPGYLLLRDAVSTPRSYVTDAALGLTEAAPRAL
PQDFAVALASSVLDGGVVVKALLLAGLAAAGWGAARLVGHVLFDAGLAGR
FTAATLAIWNPYVAERLLQGHWSLLVGYGCLPWVAVSVLRLRERASWTPV
APLVFWMALAGLTPTGLVLAATVALVCVAAPGDGWRRARVAGLGLGVAVA
AACPWLVAAFVSGAVSSSPDPGAGVRAFAARAEPGLATLGSLAGLGGIWN
GDAVPASRTSLFAVVATVVLLGVVAAGLPVVARRRAAVPLLVLAAGAVIM
PALMASAPGLVVVEALIDAVPGLGIVRDGQKWVALAMPGYALAAGAAPMM
LRRLRIPAAAAAAVCCAALIAVLPDLTWGVGNQMRAVRYPQSWAQVAATI
NADPRPVVALPADSIREFSWAGTVLDPLPRWLRADVLTTGDLLIGGRTVP
GEGARARAVQGLLRDGASPQQLAEAGVGWLVRETDSGITAQRIGGEAPSS
PHRGLLIAAHLVWLAALAGGALGLVAGRVGRVLSRRTWRHRPRPG
118473195YP_887821.1 hypothetical protein MSMEG_3518 [Mycobacterium smegmatis str. MC2 155]MTPNPGEARPELVVNDIAAVVATGRFDEALAWYGCIFGREPDLRPVAGVA
EWQLTATAWLQLITDEARAGRTAVRFGVTDLADTRAALAGRGLIAAAEPR
VIADLVAVLEITDPDGNEVSFVQELT
118473193YP_887671.1 RhtB family protein transporter [Mycobacterium smegmatis str. MC2 155]MISQMLPTVVTYAVLTASPGPGNMAIGAVAARHGRRPGLTYAAGLLAGGF
VWAVLAATGISTLLVAATGLLTALKILCAAVLFWLAWKSMRTAFRGKHLT
EARDRDDAPNWLVLARRGFLMQVSNPKAVITWTAVMAVGLHAGSRPAVLF
VTIGICEILGMTIFAAYALMFSIGVVARGYRRAYRWVEGALGIVFTAAGI
RLLMASRL
118473191YP_885908.1 tRNA pseudouridine synthase A [Mycobacterium smegmatis str. MC2 155]MPAIESGGGHVRLRLDIAYDGTDFAGWAVQAGQRTVAGVIDEALTTVFRT
PVVTRVAGRTDTGVHATGQVAHVDVPAEALPHAYPRHTRPTDAEFTPLVR
RLAGFLPADVRVRDIVRAPAGFDARFSALRRHYVYRLTTAPYGPEPHETR
FVTPWTRPLDVDAMNAAAQELLGLNDFAAFCRYRAGATTIRDLQRLEWVR
NGFYINAYVTADAFCWNMVRSLVGALLKVGEGRRSPEWTAELLGATSRSS
EFPAAPARGLTLAAVDYPPDDELEARNVVTRDVRTIDQSRD
118473189YP_888708.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRPARIVIVGSGFAGFECARRLSKQLKRHRSEAVVTLISPVDYLLYTPLL
PEVAGGATDPRFATVPLNDRLPEVQFIRAYVDSVDLSARSLRCRDQENMS
HELSWDRLVLTPGSISRLFDIPGLAEHGRGLKSTAQALFLRDHIIEQFEL
ARIDEDRERANARKTVVVVGSSYSGTELIAQLCAMASVAVHDFGFEPGDV
RLILVERSGRLMPEIGPALAVRAEHVLKRRGVRFLTGVTLSRVAADHVIL
SDGTRIGTYTVAWVAGVVASPLITATGLPTEKGRLKVGPDLQVPGFDGVF
AGGDAAAVPDVTNPGTITPPTAQHATRQGKILARNVAASLGYGSAREYRH
RDLGTVVDLGPGFAVANPLNIPLSGFLAKLVTRAYHLYAIPRNANRWAVA
LGYLTNVLFGRPLVSIGFAQPSWAQFSASEEFMTAPTATQPLDEQMYTDD
LRFQEASADRASAPGDRARKAT
118473187YP_887905.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMSPNALLECTDIHKSFGGVPVLKGISLQLEPGTVTALAGENGAGKSTLMK
IISGQYNADQGEVSVKGATLTPGNTRDAVRHGVAIVPQELASIEDMTVYE
NLFVGRELKRGPFLNRRAMIAEAKETLAVFDVGISPTARMGSLPVGLRQI
VEIVKAARTGAQVVMLDEPTSAISEREVEGLYKIVRRLRDHGVAMVYTTH
KMAEIRAIADRVVVLRDGGLILDKPIDDVSDDDIVTAMIGRELEALFPDR
PEPADETVLEVRDLQVEGASEPVSFSVRAGEIVGLAGLVGAGRTELLEAI
FGARRSTAGDVVVRGRSVKRNQPAAAITAGMAMVPEDRKLSGAVLSMSVL
DNGTLPRLSSFSIAGWLRGKSRTQAVSEVMSSVRLRSRGLGQEVGTLSGG
NQQKVVLARWLTGKVNVLLLDEPTRGVDVGARSEIYRIITEFAAQGMAVV
MASSDMPEVVGLSHRAFVMRGGAFVGELDREALDHPEVQESVFRLATALD
ARSDQTSQEITS
118473185YP_885045.1 hypothetical protein MSMEG_0635 [Mycobacterium smegmatis str. MC2 155]MAAVALACAPSAAAVENPWFARSVGTATQVISVVGVGGSKAKMDVYQRTA
AGWQPVGVGIEAWIGANGMAPQTHDGEMKTPMGIFTLDFAFGTAPNPGGG
LKYVQVGPDHWWDGDMKSPTYNTMQVCKKAQCPFDTDPRSGTENLNIPQY
RHAVVMGVNKARVPGNGGAFFVHNTDGGPTAGCVAIDDATLVQIIRWLRP
GALIAVAK
118473183YP_889304.1 ABC transporter substrate-binding protein [Mycobacterium smegmatis strMRRILVPAVLVVLALIATGCGGQSGTPPIRVGAAPGAESALIGHLYAAAL
RYYGSPAEVVETDEGLGALDSSAVTVLPGFTGQLLVALDPGASARADEQV
YRDLLSALPEGVAAGDYTTSAQDKPALVATEATTRAWDGTDLAALRRHCA
QVRPGAVAGAQVPAAIGQCTPAKPVRFDDEDTLFAALDAGRINVAWSRTA
DPEIPSHLVVLADRTSLIRAENIVPLYRRNELDERQIRALNEIAGVLDTG
SLADMRRKVAEGADPGAVADEFLQANPLGH
118473181YP_887406.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMTTSHNTESTLSDPAVNTPLVPAVRMHDIVKTFPGTKACNGATLEVAPGE
VHCLLGENGAGKSTMMKILSGSYTPDSGTIVIDGVETSFSSPIDGVRAGI
NTIYQELDLVPDLTVAQNLFLGHEPKRGPFVARRKRDRLAQAAIERVGGS
FAPSDVVANLSVADQQLTAIAKALTTDARVVIMDEPSAALTDHDLAAVFR
VIRELTSAGKSVIYISHRLDEVKEIGDRATVMRDGATVGVFDIASVTKDE
LVEAMIGRGLQALPPRRSGPDGARTELLKVRRATIPGVLDVSDISVGRGE
IVGLAGLGGAGRSTLLATLFGDRTATLDLTLNGVRLDRLTPRGAVAAGIG
LVPEDRKSQGLFLEQSILRNAGIAALRPLRVNPMKAAEQLCMPALRRLGV
KFAGLDQPVGQLSGGNQQKVVLAKWMARGIDLLLLDEPTRGLDIGAKGDL
FEQVQALADSGVGVLMASSELSELTENCDLIWVMHEGRNIAAFDPRTTSA
TDIARCVVTGRHDND
118473179YP_889209.1 homoserine dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKKPIGVAVLGLGNVGSEVVRIIADSADDLAARIGAPLELRGVGVRRVA
DDRGVPTELLTDDIDALVSRDDVDIVVEVMGPVEPARKAILSALEQGKSV
VTANKALMAMSTGELAQAAEKAHVDLYFEAAVAGAIPVIRPLTQSLAGDT
VRRVAGIVNGTTNYILSEMDSTGADYTSALADASALGYAEADPTADVEGY
DAAAKAAILASIAFHTRVTADDVYREGITTVSAEDFASARALGCTIKLLA
ICERLTSDEGKDRVSARVYPALVPLTHPLAAVNGAFNAVVVEAEAAGRLM
FYGQGAGGAPTASAVMGDVVMAARNRVQGGRGPRESKYAKLPIAPIGFIP
TRYYVNMNVADRPGVLSAVAAEFAKREVSISEVRQEGMVDEVGKPCGARI
VVVTHSATDAALSETVEALADLDVVQNINSVLRLEGTNS
118473177YP_886677.1 hypothetical protein MSMEG_2331 [Mycobacterium smegmatis str. MC2 155]MRISTVVGVLAAGVLIGGVAAPSAAAQSTCAELGGTVDADQICQVHTANA
TYRLDYTFSTTYPDQEAVVGYLSQTRDGFVNVSDMPGSRDQPYVLDARGS
SYSSAVAPGLPARTQSLVLEVFQDVGGAQPETWYKSFNYDLVKRAPITFD
TLFKPGSRPLDVIFPIVARELETQAGIVQSISQSAGMDPTHYQNFAITDD
SVIFFFDRGALVADSAGALQASVPRWAVASLLA
118473175YP_888034.1 hypothetical protein MSMEG_3735 [Mycobacterium smegmatis str. MC2 155]MRSLLIFALVGLGAQLVDGALGMAFGVTASTLLVLSGVAAAQASAAVHLA
EVGTTLASGLSHWRFRNIDWGIVLKLGVPGAIGAFAGATVLSSLSTEDAA
PLMAAILLVIGMYVLLRFSLRTPPVFRSGATPHTAKFLTPLGLFGGFIDA
SGGGGWGPVTTSTLLSRGKTAPRTVIGSVSASEFLVAVSASLGFLVGLRA
EFLDNIPIVLGLAAGGVVAAPLAAWLVSRISPALLGTAVGGVIVLTNAQK
LVRYFGIHGGASTAIYTVIAVAWAGLVLVAWRTSRAPECVGADVDLEGLD
QADISVEAPADEPRVPTR
118473173YP_885039.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MMDEIAAVRSIWSDLGLPGLIDVHTHFMPKNVMDKVWQYFDSQGPLIGRE
WPITYRADEQQRLATLREFGVRRFSSLVYPHKPDMAAWLNQWAREFARNT
PDCLSTATFYPEEQAGRYVAEAIDAGTQIFKAHIQVGAYDPNDPLLDEVW
GMVEDAAVPVVIHCGSGPAPGEYTGPERVEKLLARHPRLVLIIAHMGMPE
YSEFLDLAERFDGVRLDTTMAFTPFSEAMMPFPPADRARLYDLGERILFG
SDFPNIPYGYADALRHTVDLPGIDDTWRRNVLHDNAARLFGVASR
118473171YP_888393.1 alpha-methylacyl-CoA racemase [Mycobacterium smegmatis str. MC2 155]MTGTLPLAGIKVLDLSTLLPGPLATLMLAEAGADVIKLERPGRGDEMRTY
EPTFGEASANYAILNRGKRAYAVDFKDPAQRDRVLEIAADADIVMEQFRP
GVAERLGLSYDAMRERNPRIVYCSISGYGPTGQHASRAGHDLNYLAESGL
LGVVTDANGSPNLPVSVLADIAAGTYPAVMNVLLALRMAERTGEGAHLQV
SMTHNLQVLAYGYIATHQAAGTWPQPSAELLTGGSPRYQIYPAADGRYIA
CAALEEKFWQRLVTLVGLDKRFHDDVGQEQAVTAALTDIFASQPSSYWRE
LLAGEDVCTVVVNTWEEAVEAGHVNINSADRVCVPGDPDLSIPTLTTSVD
PTLRIPDNTRAYPSLAPLPDGHVVWA
118473169YP_890236.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNLSEAPKEIDGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVISD
YHERRLGETRDQLADLGLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDV
LVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGG
VIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSP
SIARHKFLEKTSSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYM
TGEVVSVSSQRA
118473167YP_887621.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMAGSRGNIIDDIIADHREFESVFVEIESSDDPRTQPELVEHVISGIVRHA
VAEEQYVYPAARSVLPDGDEVADHELEEHAEAEEVMKAIEKTDPEDSRYG
ELVRRLIDDIRHHIEEEESGMLSKLRDACPPERLHELSEEFQRAKSLAPT
RPHPLAPDHPPANKILGPGAGLVDRLRDILSGRNS
118473165YP_887832.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium smegmatis str. MC2 1MLNSLGRGSRSGRGSVWKLFAAVGLAVAATAVPVNVASAAVSTPVEVAQV
EPAAGAVVGVAHPVTVRFAEPVTDRRSAERSLRIASTDTSAGRFRWPEAA
VMEWTPDEFWPAHSTISLSVGGVKTSFNTGAEVLGVADIDAHTFTVSVDG
EVLRKMPASMGKPKFPTPRGTFTALAKEPVVVMDSRTIGIPLSDPEGYKL
TVNHAVRVTWGGVYVHSAPWSVGSQGYANVSHGCINLSPDNAAWYYDMVS
VGDPIIVQA
118473163YP_884854.1 hypothetical protein MSMEG_0441 [Mycobacterium smegmatis str. MC2 155]MDDNTLLTQLQTDVLAIQSYALGEDADLARAVPTCPGWTVADLLGHLWSI
ESWVRQILRTRELAEEPQPQDEPTQAVADFLDGIPDYLTAMRAVNADEPC
WGFGPKPRLAGFWIRRQAHEHAVHHADLQHALGADPVGLTPDFCADGVDE
VLAMFYPRQVRFGRTEPVAAPILFRTADTEHAWTVGGTEPSEPGQAEPVA
TVTASAEDLYLGLWKRRDLLETAKVEGDTAAVQQALNVALTP
118473161YP_890494.1 DNA polymerase III subunit epsilon [Mycobacterium smegmatis str. MC2 1MSRAPLSSTPQLWGRPADEPGSGWAVVDVETTGFRPGQARIVSVAALAVG
DDGSVEHSMSSLLNPGVDPGPTHVHGLTAEMLEGQPCFADVVDELIEVLR
GRTLVAHNAGFDYSFLAAEAELVGAELPIDTAMCTVELARRLELGTENLR
LETLAAHWGVTQMKPHDALDDALVLAQILKPTLARARDRKVWLPLRQLTR
KRWPNGHVTHDELRPLKVEASRLPCRYANPGPFVAGRPLVQGMRVALSAE
VVRTHEELLERVLHAGLAYSDMVDLQTSLVICNDPAPEQGKGYQAKELGV
PLVRDDEFMRLLDHVVGGADVETFVDTTADGDQYALF
118473159YP_891060.1 MmgE/PrpD family protein [Mycobacterium smegmatis str. MC2 155]MGQVNTLTDPSAPEGPTGQLVNWVRTLEWDQVPEHVRVRAAHLLLDGIGC
ALVGAQLPWSRLATDAVLGIEGDGAVPVIGTGRTSTPVGAVLLNSTFIQG
FELDDFHPFAPLHSASLVVPALLATTAHLNRPVSGKELLMAAIVGFETGP
RIGRALGGTEMLSRGWHSGPVFGGIGTALACGRLRGLNGEQLEDAVGFAA
TQSAGLMSAQYEAMGKRMQHGFAARNGFYSAALAQSGYTGIDQVLERPYG
GFLAVYGEGHRPDASAITRGLGDEWETTAIMVKSWAVMGGLHGVVEAARI
LRNRLHGRTIEHIDIRVGDVVYHHGWWQPQRPLTAIGAQMNIGYAAAVTL
LDGVALPQQFTAERLDADDVWRLLARTHVELDESIDELPPTERFQTHLTL
TFSDGSTETASVMAPHGNPRDPVTNHEVVDKFARLVAPVMPADRAAAIQH
AFLGLPEVPDVAPLVELLSGPVGRVLD
118473157YP_885591.1 hypothetical protein MSMEG_1199 [Mycobacterium smegmatis str. MC2 155]MRVDGRDIVVTGKLLQPMSRRTNDILRLTLAALFLATVVASSLITRYEWV
ALERSISEVVGVLTPTQSNLVYLAYSVAIVALPFVILVSLIFSRQWKLLG
AYAAAGLITMLSLSITGNGIAAPQWHFDLGDRLDSQLSQFLDDPRWIGML
AAVLTVSGPWLPQRLRRWWWGLLLAFVPIHLVVSAVVPARSLLGLAVGWF
VGALVVWVVGTPALEVPLDGAVRALMRRGFQVQSFTVVRPAGAGPLLLEA
ASQDPDAVAVVELYGPNQRSGGAFRQLWRKIRFRSDETAPLQTSMRRAVE
HRALMAIAIGDLGLASTSTMSVAALDRGWTLYAHNRKRGTPLDQCTDEAT
VGRVWNALRMLHDHQIAHGDLRSKEITVEDGAVLFGGFGNSEYGATDAQL
QSDIAQLLVTTTALYDAQSAVGAAIKAFGRDTVLTASRRLTKAAVPARVR
ATVPDAKAVMGQARDEVKHQTGADQIEAETITRFTRTQVIQLVLLIALVY
VAYPFISTVPTFFSELRTANWSWALMGLTVSALTYVGAAAALWACADGLV
SFRNLSIMQIANTFAATTTPAGVGGLALSTRFLQKGGLSTMRATAAVALQ
QSVQVIVHVILLIFFSTMAGARADLSHFVPSATILYLIAGLALGLVGAFL
AVPKLRRWLASAVRPKLEEVWEDLIKLAREPKRLILIVLGAAGTTLGAAL
ALWASVEAFGGDTSFVTVTVVTMIGGTLASAAPTPGGVGAVEAALIGGLA
AFGVPPAIGVPAVLLYRVLTCWLPVFVGWPVMRWLTKNDMI
118473155YP_885354.1 glutaredoxin [Mycobacterium smegmatis str. MC2 155]MTLLTRAGCHLCARAAEELTVLRDELGFTLVTTDVDALAAEGDNSLRAQY
GDLLPVVLLDGTEHSYWEVDAAQLRSDLGH
118473153YP_885409.1 hypothetical protein MSMEG_1008 [Mycobacterium smegmatis str. MC2 155]MFTAPAIRTSSASSSSSFASCFAAPLPRGLRAVAQEQTWDAFLARFAAIA
GPVTLRQWSCVDSRPTGQIGPREYQATLSIGDTVATSSVTAYGPVAALTE
ILHAHGITVETTSFHQLPTRGQTATFIEGSNGVHREWAMGLDTDPVQSAL
RAVIACANRLTAH
118473151YP_886389.1 hypothetical protein MSMEG_2027 [Mycobacterium smegmatis str. MC2 155]MTDAELSPTDWVREQTERILEQGTTDGVHVLDRPIVLFTTTGAKSGKKRY
VPLMRVEENGKYAMVASKGGDPKHPSWYFNVKANPTVSVQDGDKVLPDRT
ARELEGEEREHWWKLAVEAYPPYAEYQTKTDRLIPVFIVE
118473149YP_888359.1 butyryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MEFAYTARLAELKNRARTLAEKIMPFEDECERNNGLSAQSHASIKASVLE
AGLQAINTPSEYGGAGLSVLEQVVVQDELGKLTNALWDAVWRPANPLAHA
TAEQRERYLIPAARGDRRDAVAISEAGAGSDFSSATTTATPDGKGGYIIN
GQKWFVTVGDVADFLIVLAYIEPEHAPTMFLIDVATPGVKITDVPRYTHT
FVYEHPEFTFTDVHVGPEAVLGGVGAGLELTRDWFTEERLMIGARTIGAA
ERALTLAVEWAKDRVQGGQPLINRQLIQGMIADSVVDITTNRAYTHQVAW
EFDHADPTNADQRKTLHAKAATVKLAASEASNRVVDRCVQIFGGRGYIRD
YPVERLWRELRVDRIWEGTSEIQRLVIANETNKRGLSALLSFPSAGTDQ
118473147YP_887865.1 hypothetical protein MSMEG_3562 [Mycobacterium smegmatis str. MC2 155]MSRIGDFPDDDVAGWIQRSPDIGTAMANYTHAVYTKGRLPMRVRELARMV
IALDNECVVCQNTRDGEGAAAGVDEELYVHAAEWRTWPGYSPAERVAAEF
AHRFATEHTALRDDENFWARAGEHFDPELLTDLALSCAMWLGMGRMLRTL
DIGQSCKITL
118473145YP_884861.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPRLNLADFLCFSIYSANLAFGKAYKPLLDQRGITYTQYIAIVALYDQ
DHQTVSGLGEKLFLESNTLTPILKKLESLGYVTRRRDPDDERQVVVSLTE
AGRELREQSFELELASATGLTVDEMRTMQKGIAKLRDNLREHVRATR
118473143YP_888633.1 D-beta-hydroxybutyrate dehydrogenase [Mycobacterium smegmatis str. MC2MTDFHGKTALVTGASAGLGAAVAKLLAARGASVFGIARDADRMAEVFTEV
PGGRYASVDISSSQGCDQAVEQCVEQFGQLDTLINVAGFHQMRHTVSVTD
EDWAKDLAVNLNGPFFLSRAALPHLLQAGGNIVNVASIAGVEGEVYSAGY
CAAKHGLVGLTRALAVEFTKERLRVNAVCPGGMLTAQTTEFSAPDNADWD
LIMRIAAPRGFMDVADVAKTIAFLASDDAAAVHGAVYIVDAGKTAG
118473141YP_885612.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTGLVQALVGGILIGGLYVAISIGFSLSFGVLDVVDLAVGMWVVIGAFAA
IVVSEATGIDAFALLPAVFVVFGIVGWIIAPLIYRVRMSKYALPALMGLA
FTFGLATLIRGGLLTVFGYNPRTVPTSLFTGNVSVLGITAPMIRVAGFGF
AVIATALFLAFLFYTRTGLAIRATAQSKENAGLMGIDVRRISSLVYAIYT
GLTAMAGALLGAIYAMTPEVGLRYTLFAFFVVVLAGLGSVVGVMVAGLFL
GILQSLVTTYVGANYTLLVVFAVLFVALLLFPQGISRRGIA
118473139YP_888719.1 hypothetical protein MSMEG_4443 [Mycobacterium smegmatis str. MC2 155]MQPTMYQICIRGCVTERFGSALEGMRLEAGATESMFVGEIRDQSQLYGLL
DRVRDLGLELVSVQQWSAAGPTGAIANGDGESVGLPNPYQEDAQ
118473137YP_889729.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSIWTTAEREALRKTVRAFAEREVLPHAHEWERAGEIPRELHRKAAELGL
LGAGFPEDAGGSGGDGADPVVICEEMHYAGSPGGVYASLFTCGIAVPHMI
ASGDQRLIDTYVRPTLRGEKIGALAITEPGGGSDVGHLRTRADLDGDHYV
INGAKTYITSGVRADYVVTAARTGGPGAGGVSLIVVDKGTPGFEVTRKLD
KMGWRSSDTAELSYTDVRVPVANLVGSENTGFAQIAAAFVAERVGLATQA
YAGAQRCLDLTVEWCRNRDTFGRPLISRQAVQNTLAGMARRIDVARVYTR
HVVERQLAGETNLIAEVCFAKNTAVEAGEWVANQAVQLFGGMGYMAESEV
ERQYRDMRILGIGGGTTEILTSLAAKTLGFQS
118473135YP_885483.1 glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase subunit alpha [MTDSALERTTDTVAQTIPQVRAQVDCGEITPVGLVRRALARISHVEDKIQ
AFAAVFADEALAVAQESAPQAGPLWGIPVAVKDIYDVAGYRTGNGSLGAP
EHLALRDAEAVRRLRDAGAIILGKATTHEYAYGVTTPPTRNPWSLDRIPG
GSSGGTGAAIAAGVVAAGLGTDTGGSIRIPAALCGVTGHKPTFGLVSRSG
VSALSSTLDHTGPLGRTVDDTVALLEVIAGHDPADPYSSSAPVPDFRAEF
DRGLAGLTIGVAEPYFCDRLTPDVAAAFEEAIHTLERGGATITSVTFTDV
DLCPRVVDVVCGVEAAAWHAAQIGMAPEKFSPEVRDALRLGASYTGVEYL
EARRARCAVIAGMNALFDSGPDLLISPTIAMTAPPYGSTHVDLGGRTVGV
LDGVNALTVPANVTGMPALTVPAGFGSDGLPIGLQLMGRPGADATVLGAG
RAFERIAGFVDFTPNL
118473133YP_890107.1 carbon monoxide dehydrogenase subunit G [Mycobacterium smegmatis str. MELNNEFRVAVPAAKTWEVLTDVRRVAPCLPGATLLDVDGDEFTGAVKVK
VGPITVSYKGEARFQEKDAGAQRVVLKASGKETRGNGTAAAVVTAQLKDE
GADSTLVVVTTDLQISGKAAQFGRGVLSDVASTLIDQFARSLEAELLGQA
GPAGQAAAGETPSDTAASGQPQQGAPINALALAKVMAVPMAKRFAPAIAA
VAAAGLIGYLAGRRRSKSQAGLRPEDLQAALLRLVS
118473131YP_886335.1 sigma factor [Mycobacterium smegmatis str. MC2 155]MVRHADTPTDAQRAREQFLSTGALQPDAVASSVLNSWQRSRELHVHPDRV
ELPYVRDPDTDTPLMHAAAPVLRRMAEDLSDQSVSVVLTSADGLVLDRVA
ADTEFERVLDDVRLARGYSYAEEFAGTNGIGTALETGRPAFIRGSEHYVG
TLGGLACAGSPIREPVTRRILGVIDLTCRARQADPLLFVLAKSAGSQIED
RLRTMNNETETALLDAYLKQSRRYPGGVLAIGGDVVLMNRYLRQALDAAD
QTVLLDHAAELTRSSFTSTTVAHLPSGASVKISAAERIIVGVRSDSVVFH
VSVHVAESIPVRSSQHIPRLAGQSSSFRRSAQQVERCYRDREWVVIEGER
GSGRTYLGYSVVHFVTPERSIPVLHIDNFDTPESFVAAFESETDSADFAV
IVSDVDELPDEVLNPMAAIMQTRAGRGWIAATTSTERDSQLVDLLMLPFF
THTVTVPALRHRIEDLQELVPMILNELSRGEARMDGEAMRQLAKLPWPGN
IAQLRHVLTETVRRQRSGVIGVDKLPAECRSVTRRKLTPLEAMERDAIVR
SLLENDGNKADAAAALGMSRATIYRKIKDFGIA
118473129YP_888139.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MHERTVRAEISTGIIEGFTRDGVHRWRSIPYARAPIGPLRLRAPQPAEPW
PGVRYCHGFGFCAPQQRRYTLLGVGKYQPTSEDCLTLNVVAPEKPHDGPL
PVMFFVHGGGYVLGSSATPIYDGAALARRGCVYVSVNYRLGVLGAMELSS
LSTPEHPIDDNLFLRDLVLALQWVRDNIAVFGGDPDNVTIFGESAGAHAV
ATLLAVPAARGLFARVISESPASGMVSSADTAARLAGQYAGIIGHGGRDA
AEALKTLSPAQLGRALEELINRGMTDMPGAFPVGPTYGTEFLPTDPVEAM
AAGSAHRVPLIVGNNAEEGRLFTRFLPLLPTNEPMIEKLFADADPEHRER
ILSAYPGYPDRDVCVRLGGDFAFGSATWQVAEAHSRHAPTYVYRYDYAPR
ALRWSGLGATHAMELLAVFDTYRTRYGSMLTAMADRRSARRVSRDIQTRW
RDFSRAGVPGDGWPAYRHDERAVYVFDTRPRVEYDPDADRRLAWEGFSLA
QR
118473127YP_885810.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MLIVGAGSAGSVLAERLSADPSCQVTVVEAGPAPSDPRVAAQITDGVRLP
IGAASSVVRHYGSTLTEDPPRRTEIIRGSVVGGSGAVNGGYFCRGLPTDF
TAWAVPGWSWDDVLPHFRAIETDLDFATALHGSEGPIKVRRVHEFDGCTA
AFVDAVSAAGYGWIDDLNGSDADAALPPGVGAVPLNIDGGTRLGPGGAYL
QPALDRPNLHLRADTRVRRVLVEHDAAVGVECVDGEILYADRIVLSAGAI
GSAHLLLLSGIGPAGDLAAHGIAVAANLPVGTATVDHPEWVLPVAWTPTH
DLPPLEAVLTTADGIEIRPYTAGFSALVHGPEHDPAELPHLGVALMRPHS
RGRVRLASADPAVPPIIEHRYDTVAGDVDALRAGAELARELVSHAVKVGE
ASWSTSQHLAGTAPLSADGQGVLDPTCRVLGVERLWVVDGSIMPAITSRG
PHATIAMIGHRAAEFIAT
118473125YP_887537.1 TM2 domain-containing protein [Mycobacterium smegmatis str. MC2 155]MYGDPTAPYGRHPVTGEPFSDKSKIVAGLLQLIGLVGFVGFGRIYLGQTG
LGIAQLIVGLVTCGIGAFIWGIVDAILILTDKVRDPYGRPLRDGT
118473123YP_886380.1 molybdate ABC transporter periplasmic molybdate-binding protein [MycobMIRVVSVVVGVFLLAGCTPAPANDDHLTVFAAASLKSVFTELGKRFEDAN
PGATVEFNFAGSSDLATQLTQGAPADVFASADAPNMNKVVDAGLVHGDPV
DFAANTLTIVTAPGNPKHITSFADLTKPGISVVVCAPQVPCGAATEKVEK
ATGVTLHPVSEESAVTDVLGKVTSGQADAGLVYVTDAKGAGAAVAAVAFG
ESADAVNTYPIATLKDSGDIETAQRFVDLVVSPEGQEVLSEAGFVAP
118473121YP_889325.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTRSSVAVEIHGLTKSFGRTRALDGLDMTVPYGHIVGFLGPNGAGKSTTI
RVLLGLLRAERGTVRLLGGDPWHDAVELHRRIAYVPGDVMLWPNLTGMQA
IDFLCGLRGDGVDVRRRNQLIDRFELDPHKKARTYSKGNRQKVAIIAAFS
CEADLYILDEPTSGLDPLMEQAFQQCVTEVAGRGAAVLLSSHILAEVEKL
CDDVTIIRSGRTVRSGTLAELRHLMRTTVTVRTHSDGRVLRDVPYVHDFD
CRDGQLRFSVDRTDLEFVMEHLIDLGIDDLTVTPASLEDMFLREYQGAVP
118473119YP_887374.1 lipoprotein- nlpa family protein [Mycobacterium smegmatis str. MC2 155MSTPENIDGPPRSKTPLYAGIAAVVVVVLVVAGFLWLRGSGEKKLTVAAT
QVPHAEILEFIKNGQAKDAGLDFDIRVFDDYSLGNRWLAEGDIDANYFQH
KPYLDEQVADFGYQLHAFPGVHIEPYAAFSEKYRSANDLPDGAKISITDD
GSNQARALALLASKHLVTLPTDGPVNVHTIGNPKNLQFIEAAPDLQAKAV
PDVDLAILNGNYFLDAGYTLKDALIVESLENNQYANFLVSREDNQDDPDI
VKLNELLHSDATRDFIKERWPGGDVSPAF
118473117YP_887241.1 hypothetical protein MSMEG_2922 [Mycobacterium smegmatis str. MC2 155]MTKFLDGYLESPLSGIAPWVVMAVLSTPGHFEEAVCAALGLTLLTMWINR
RRGGTLHALDFYGAAFFVVLAVIGLAVPADTVDWLQEWAGELSNIALAVF
VIATIVVRRPFTLPYAKEQAPQEHWDSPLFLRINYVISGVWAAAFTFSAV
VGFIGNAILHDPDNFWTGWVLQLGSIFFAVAFTGWYPDYATARFDEQTGE
SPETAETGASLVKLFDWLPMFVLIAGIFGWVTDALPDVVGIAMIVVGLAG
NALVSKLSGATEKV
118473115YP_890192.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMPEHRFQVAVVTGGGGGIGRAVARGLASAGYCVAILGRCMEDLAEAARDH
AHIAPFCLDVGDAARSAAVFAEVERRMGPVDILVANAAVYPKVHFLDQSP
ADFEETFRTNVHGVANAVRAVLPGMLSRNAGRVIVLGSLADQSPLAGACS
YSASKGALHALVRGIAAEIDRVRYPNVLVNEFNPGQTRTAMSDGGQPPEA
VYPLIQALIDLPPGGAHGRMFVMDREVRSNERLSRAILRRAGIGPRLTRL
ERHG
118473113YP_887002.1 hypothetical protein MSMEG_2665 [Mycobacterium smegmatis str. MC2 155]MSDGARSLRIQLLIGFMCVALIVYFVMLGRAAFVFITSGEAAAVALGIAL
LAFPVIGVWVLIATLRAGLAHQRLGRLADEQGMDLDVSDLPRRPSGRIER
DAADALFVQVKAELEADPDNWVRWYRLARAYDYAGDRSRARDAMRTAVRM
QEGRR
118473111YP_886684.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473109YP_884676.1 p40 protein [Mycobacterium smegmatis str. MC2 155]MTAHGRRSGGPYFDDLAVGQVFDTAPSMTLTEGAAAAHQAVIGDRLRLSL
DAELSSAVTGEPGPLAHPALVCDVAIGQSTLVTQRVKANLFYRGLAFHRF
PVIGDTLTTRTEVVGLKQNSNKPGRAPTGLAALRMTTTDHKDRLVLDFYR
CAMLPLSENGGDTGYSDDLSAIGADASPTPTAHWDADAYRARVPGPHLDD
LRDELAGAVLRSTADVVSSAPELARLTLNIAATHHDWRSGGRRLVYGGHT
IGLALAQATRLLPNLVTVLGWESCDHTGPVHEGDTVFSELHVESIEANVV
GLRSIVFAAGGPDGGADRQVLDWRFSALLF
118473107YP_889295.1 D-2-hydroxyacid dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAEALTERLAHIVGAGHVSTDPDVLAARSVDHTGRYRGRACALVRPGTGD
QVAAVLRACRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLTTIGDVD
TVERRISVGAGVTLAAVQKTAAAAGLVFGVDLAARDSATVGGMASTNAGG
LRTVRYGNMGEQVLGLDIALPDGSVVHRHSQVRRDNTGYDLTSLFVGAEG
TLGVITALDLRLYPVPTHRATAVCGFADLDALVETGRRFRDLDGIAALEL
IDARAGRLAAEHLGVPVPVAGSWLLLIELAGDTDQTERLADALTDAQVCD
EPAVGVDIGAQQRLWNVRESLAEVVGLFGPPLKFDVSLPLSAIGGFAESA
GKLVAAHAPDAIPVLFGHIGEGNLHLNVLRCALDTEPALYAAMMALIADC
GGNVSSEHGVGTRKRDYVAMSRTPADIAAMRAVKAALDPRGYLNPAVLFA
Q
118473105YP_884732.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MTTEQSAQAEHEVGGTRGFLPAVEGMRACAAMGVVLTHVAFQTGHTGGIS
GRIFGRFDLAVAVFFALSGFLLWRGHAAAARGLRPRPRTGHYLRSRIVRI
MPGYVVAVIVILLLLPEAKADLTVWLANLTLTQIYVPLTLTAGLTQMWSL
SVEVSFYLALPLLALLARRLPVRARIGVITAVAALSLLWVCIPFAGDTGH
NPWNWPPAFFSWFAAGMVLAELTVSPYGRVHRLARRRVLMAAIAVVAFAI
AASPLAGKEGLHPGSVGQVMLKTAMGAVVAGALLAPLVLDHPGTRHRILG
SAVMVTLGRWSYGLFVWHLAALAMVFPMLGEFLFNGRMLVVLILTLVFGF
ALAAVSYALVESPCREALRRWEYRHSRPVPPLDSSITEQPEPAPAAR
118473103YP_888694.1 glucose-1-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MIYERIRAVGGEFEGKKVVVVGGSAGMGRQAALDIVDRGGSAVVIGRSKR
RVDDTVADVKSRGGQAWGIAAELTDRAAVADVQTALSEHHGDATLMVNAA
GFFVPKPFLDYDAESYDSYLDLNYALFFLTQTVVAGMVAQTVGGSIVNIG
SMWAHQAIGATPSTAYSMQKAALHALTHNLAIELAGNGIRVNAVAPAVVK
TPLYEKFIPADEIDATLATFAPMHPLGRVGTPADVANAITFLLSDQADWI
TGAILNVDGGVMAGRN
118473101YP_886505.1 hypothetical protein MSMEG_2149 [Mycobacterium smegmatis str. MC2 155]MRFEIDTDDEHSWPPANSETLWVLPEPEARTYRVLSIPVLADGIAVNDTV
LGEFANDNLMFKGKITSGGHSTIRIFIDHQVEEGILTERIAAIISEVEAA
GCTVRRSGWDLIVAVDIPTLDAYEHVYDDCLIPRGEAGELAVESACMTFD
T
118473099YP_885331.1 UDP-N-acetylenolpyruvoylglucosamine reductase [Mycobacterium smegmatisMASSHVAGVEIAEAVPLAPLTTLRIGPVARRMLTCTSTEQLIGVLRALTA
DDEPLLILAGGSNVVLADDLTDLTVVRIANTEITVDGDRVRAEAGALWDD
VVVTSLAHGLGGLECLSGIPGSAGATPVQNVGAYGAEVADTITRVRLLDR
RTGEDRWATTEELRFGYRTSVLKHSDAVIVLEVEFGLDAAGRSAPVRYRE
LATALGVEPGERTDPLRVRDAVLRLRTGKGMVVDPDPDHPDHDTWSVGSF
FTNPVVTHADFERVERIARDAGAGPVPNYPAPDGVKLAAGWLVERAGFGK
GYPGEGARARLSTKHALALTNRGQATTADVMALAGTVRAGVLDVFGIELT
PEPILLGCVLSVP
118473097YP_887602.1 hypothetical protein MSMEG_3291 [Mycobacterium smegmatis str. MC2 155]MCLFEVGLDAVHSPGAAAGALPECRTALRPVTLFSFGHRGCDVNHAPPAR
VVPDDWI
118473095YP_885532.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MPAPDTIRPHSTSIRAAVFDGTISVEPVDLADPRPGEVRVKIAAAGVCHS
DLHVTTGAWDVPAPVVLGHEGSGVVTAVGEGVDDLEPGDHVVLSWVPGCG
ECRYCKAGRPAQCSLVASVVAVKGTLYDGTTRLSNERGTVHHYLGVSSYA
EQVVVPRNGAIKVRKDAPLEDIAIVGCAIATGVGAVRNTAGVEPGSTVAV
IGCGGVGLACVQGARLAGASRIVAVDVVAEKLELARKLGATDAVDASATD
DVVAAMREVLPDGYDYVFDAIGKIATTEQAIAALGLGGAAVIVGLPPQGE
RASFDPLTLAEADQRILGSNYGSAVPERDIPALVDEVMAGNLDLASMISG
RRPLEEAAAALDDLAAGHALRQLLIPSA
118473093YP_889392.1 binding protein dependent transporter [Mycobacterium smegmatis str. MCMTSATTGFRRQQGHPRSVRDVRVGYLAVPALVFFVAFAVIPLVGVLLLSF
TQWDGIGAIQPAGLSSWQSVLTDPSLPHTIWVTFLLMALSWAVQTPASLL
IGAFLAGRQRYREWLAVFYFIPLLLSSAAIAITYKALLDPNFGLGVGLGI
PLLSQDWLGKDGLALGVVIFIVSWQFVPFHSLIYQGAIQQIPRSMYEAAQ
LDGAGRCRQFFSITLPQMRHTMVTSSTLMVIGSLTFFDLIFVLTGGGPGD
ATRVLALDMYRRGFQANLMGPASVIAVILVVVGLVIALVLRRLGGGAPSE
SRLDGA
118473091YP_887858.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MTVIRAAITQVEWTGDEESMVARHEALARRAAEAGAQIICFQELFHGPYF
GIVQDAKYYEYAQAVPGPLTERFSVLAKDLGVVLILPVYEEEMPGVYYNT
AAVIDSDGKYLGKYRKNHIPNVDRFWEKFYFKPGNLGYPIFDTAVGKVGV
YICYDRHFPEGWREFGLAGAEIVFNPSATKPGLSNRLWELEQPAAAANNQ
YFVAANNRIGTESEEFGDDAVTFYGSSYFVDPRGNYVGEVASENAEEIVI
RDLDLAMVRAVRNDWQFYRDRRPESYETIPAR
118473089YP_889613.1 ectoine/hydroxyectoine ABC transporter permease EhuD [Mycobacterium smMNTERSLWNWDYAHEVLPGLVAAFFKFTLGITAASSLVAIVLGLVLVLGR
RSGARWISWPSYAVVEFIRSTPIPIQLFFVYFGLPVVGIRPSALVTGIAV
LGVHYACYMSEVYRAGIDAIPQGQWEACTALSLSPYRTWRAVVLPQVVRR
ILPSTGNQVIALFKETPFLIVIGVLEMVTVANQFGGQNYRYIEPITIAGL
IFLAASYPTSVLMRKLEIRVAR
118473087YP_886752.1 pyruvate carboxylase [Mycobacterium smegmatis str. MC2 155]MISKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQ
IGEVGHPVRAYLSVDEIIRVAKHSGADAVYPGYGFLSENPDLAAKCAEAG
ITFVGPSAEVLQLTGNKARAIAAARAAGLPVLSSSEPSSSVDELMAAAAD
MEFPLFVKAVSGGGGRGMRRVTDRESLAEAIEAASREAESAFGDASVYLE
QAVLNPRHIEVQILADGAGNVMHLFERDCSVQRRHQKVVELAPAPNLSDE
LRQQICADAVAFARQIGYSCAGTVEFLLDERGHHVFIECNPRIQVEHTVT
EEITDVDLVSSQLRIAAGETLADLGLSQDRLVVRGAAMQCRITTEDPANG
FRPDTGRITAYRSPGGAGIRLDGGTNLGAEISAHFDSMLVKLTCRGRDFS
AAASRARRALAEFRIRGVSTNIPFLQAVIDDPDFRAGRVTTSFIDDRPHL
LTSRSPADRGTRILNYLADITVNKPHGERPSTVYPQDKLPPLDLQAPPPA
GSKQRLVELGPEGFAGWLRESKAVGVTDTTFRDAHQSLLATRVRTTGLLM
VAPYVARSMPQLLSIECWGGATYDVALRFLKEDPWERLAALRESVPNICL
QMLLRGRNTVGYTPYPELVTSAFVEEAAATGIDIFRIFDALNNVESMRPA
IDAVRETGSTIAEVAMCYTGDLSDPAENLYTLDYYLKLAEQIVEAGAHVL
AIKDMAGLLRAPAAHTLVSALRSRFDLPVHVHTHDTPGGQLATYLAAWSA
GADAVDGASAPMAGTTSQPALSSIVAAAAHTQYDTGLDLRAVCDLEPYWE
AVRKVYAPFESGLPGPTGRVYTHEIPGGQLSNLRQQAIALGLGDRFEEIE
ANYAAADRVLGRLVKVTPSSKVVGDLALALVGAGITAEEFAEDPAKYDIP
DSVIGFLRGELGDPPGGWPEPLRTKALQGRGPARPVEKLTADDEALLAQP
GPKRQAALNRLLFPGPTAEFEAHRETYGDTSSLSANQFFYGLRYGEEHRV
QLERGVELLIGLEAISEADERGMRTVMCIINGQLRPVLVRDRSIASEVPA
AEKADRNNADHIAAPFAGVVTVGVAEGDSVDAGQTIATIEAMKMEAAITA
PKAGTVARVAVAATAQVEGGDLLVVVS
118473085YP_889364.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MGMIRQVSTREVYRNNWLTLREDAIERPDGSDGIYAVVDKPTYALVIPHD
GERFHLVEQYRYPLGLRRWEFPQGTAPDRQDLEPHALAERELREETGLRA
AHLVKLGLLDVAAGMSSQRGWVFLATELTEGDHEREHEEQDMHSAWFTRA
EIEDMMRSGDITDAQSIAAWALLLLYERR
118473083YP_890016.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSSSITDTARPRLDQVDVRGPRFAAWVTTAVLIVALLVSGVSSAAAAVVL
AAQALVFAIGALGGPRRQPYGRLFATLVAPRLGPVTEREPVPPLKFAQLV
GFVFAAVGAVGFAFGISAIGLAATAFALVAAFLNAAFDICLGCQIYPLVA
RLRRTSEYA
118473081YP_889034.1 hypothetical protein MSMEG_4777 [Mycobacterium smegmatis str. MC2 155]MSTQKALAPEISTWPDENPQLIGSRCDTCGSYVFPVQDHCPRCSSADTSE
VLLPRRGTVVAWTTQGFPPGAPYAGPTGKDFVPFGVGLVELADETGPVIR
VEGRLTENDPDKLEFGQQVELTMIPFTTDDEGNEVVTFAFQPV
118473079YP_884864.1 oxidoreductase- FAD-linked [Mycobacterium smegmatis str. MC2 155]MSDNSAVARIDEVAPGDVVTLGTGEPTCKVVHKEDTESGLLVTFEGDDGE
TFQREFAAGTPVTRTMESKWESSQSPTPNTSP
118473077YP_888869.1 hypothetical protein MSMEG_4600 [Mycobacterium smegmatis str. MC2 155]MTGSVGHRVAKFARVERFAMTGCRAMVSPGGCGGERW
118473075YP_887561.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTEPPQVAEEVIEDLAGVHREINAAEGEILLQTHDLTVKFGGLVALDSVN
FGIRRGEILGLIGPNGAGKTTCFNAITGVYRPSSGSVTFDGAPLGRIKRH
QITRRGIARTFQNIRLFGEMTALENVMVGTDARHRTSVPGALIRSPRHFR
EERSAVERSAALLHFVGIAHRGEEKAKNLSYGDQRRLEIARALATEPKLL
CLDEPAAGFNPSEKAALIDLIRKIRDDGYTVLLIEHDMRLVMGVTDRIVV
LEFGRKIADGLPSQIREDPKVIAAYLGVPDDEIR
118473073YP_884504.1 phosphoenolpyruvate-protein phosphotransferase [Mycobacterium smegmatiMVPGVRYAPVIRPGRLPVIELPDTEVAEPDRAAEAGRFRAAATAVTERLR
ARADRATGAAAEVLGATATLAQDRAWLGAADKRIAAGAPAVRAVSEAVDQ
FIDMFTKMGGLMAERVTDLRDIRDRVVAELSGYPEPGVPLPELPSILCAT
DLAPADTAGLDPELVVGLATTLGGPTSHTAIIARQLGIPCVVAVSGLDDI
EAGRMVLLDGTAGTVTADPDPSEAATAVDAARRSAATARNWHGPGATGDG
HAVAIMANVADGAAARAARETPAEGIGLFRTELCFLNRDTEPTVAEQAAI
YGEVLDAFSGAKVVIRTLDAGSDKPLKFAGHPPEEANPALGVRGIRIAEA
NPGLLEHQLDAIADAAENTRSAPWVMAPMIATPDEAKRFAAQVRSRGLTP
GVMVEVPAAALLAEQILDHVDFLSIGTNDLAQYTMAADRMSAELAALTDP
WQPAVLALVGTAARAGAAADKPVGVCGEAAADPLLACVLVGLGVTSLSAA
AAAIPSVGAKLATVTVQQCREAARAVLATAGPAEARAAALGILT
118473071YP_891052.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MGTFVISGGTDGIGKAIAANRLKLGHEVVVIGRDTAKGQAFLDSAADIGA
VDRAHFVVADLSLVSQTRRAIDEIGNCISEIDGLVLCARHFRTTRAVTAE
GLEHTFALYYLSRFVLSHRLVGLLDAAEAPVILNVSGPGSGTDSIRWDDL
GGEHDYEPQRILAQGGQLNDLLGVGFARRRVSPKTRYVLVHPGVVNTGFS
GEYDAATADRIEQIRATAQPVEDAIVPILDIVDHPPAEPLTAVVEGRPID
VHGPAFDAALADRLYDQTTVLLGSLASAAMGVSPARLRQVLDAPVFGTVA
TIDPDGAPQQSVVWVGRDGDDVLFAVATGSRKERNLRRDPRVSILLSPPD
EPYTYAVIHGKATLHTEGGHQLRDALAVKYTGKTYAEGNADAAARYGDVA
MTVVRVTPERTVGRL
118473069YP_888986.1 mycocerosic acid synthase [Mycobacterium smegmatis str. MC2 155]MTQNCVAPVAIIGMACRLPGAINSPQQLWEALLRGDDFVTEIPTGRWDAE
EYYDPEPGVPGRSVSKWGAFLDDPAAFDPEFFGITEREAAAIDPQHRLLL
ETAWEAVEHSGLNPAGLAGSATGVFMGLTHNDYAHLAADAKALEGPYGFT
GTSFSLASGRIAYALGVHGPAITVDTACSSSLSAIHMACRSLHDGESDVA
LAGGVSVLLEPRKAAGGSAAGMLSPTGHCHAFDTAADGFVSAEGCVVLTL
KRLDDAVADGDRILAVIRGTATNQDGRTVNIATPSADAQAKVYRMALKAA
GVEPGTVGLVEAHGTGTPVGDPLEFSSLAEVYGTDGPCALGSIKTNFGHT
QSAAGALGVMKAVLALQHNVIPQNLHFTRLPDQMAEIETGLFVPETITPW
PVREGQPRRAAVSAYGLSGTNVHAVLEQAPESPAETAAEAISPKAGNALV
FPVSASSADALRSTAQHLADWLLRSGDGNGRGPAIDLGDLAYTLARRRGF
RAARSAVLAGDRGTLVEGLRQIADGEAMPQQAVTNDDRGPVWVFSGQGSQ
WASMGAELLDREPAFAAAIAELEPLIAAESDFSVTEALTASETVTGIDRV
QPTIFAVQVALAAAMRSHGVVPGAVIGHSMGEVAASVVSGALSLEDGVKV
ICRRTRLMTRIAGSGAMAMVELPAQQVLSELASRGVDDVVLSVVASPQST
VVGGATASVRELIEMWESRGVMAREIAVDVASHSPQVDPILDDLIEALAD
LDPAEPEIPYYSATLYDPRDYADYDAYYWADNLRHTVRFSAAVQAALEDG
HRVFAELSPHPLLTHPVEQTARSLDMPLAVFAAMRRQQEMPHGLLGFVAD
LHSAGAAVDFSVLYPTGRLLDAPLPAWTHSTLLLDRELESSAPGVPSVSV
HPLLGSHVVLPQEPEEHLWQGDVGTEAHPWLSDHRVHQVAVLPGAAYCEM
ALAAVTPVLGDTGEVHDLKFHDMLLLDDATPVWVSAAVTAPGTAEFGVET
HQSGDRTQRATAVLRGDVDAERPAAHSIDALLAAHPNRVDGDELRAGFGT
VGIGHGAAFAGLSEAYVATAAEPTVVAAVALPGPLRSGQRGYTVHPALLD
ACFQSVIAHPEVQNIASGMLLPLGVRRLRAYGSTRNVRYCLSRIVKADSF
GVEADLELLDADGTVLLSAMGLQLGTGNSDKAEEERLLDERLLTIEWQQR
ELPRPEGSETVDAGSWLVILAGDDDENPRAAGVVSALIGAGMPTTTMAWS
HDADHDAQAAALTARLDEQPLAGVAVIVGDSETGTDAHDVGADARRGADH
VRHLVRIARTLADAVGEPPRLYVVTHRSQHVLDTDEPYLEHSGLRGLIRV
VGMEHPRLRATQIDVDDSTAHEALVRQLLSGSPEDETAWRDGQWYAARLC
PSPLRAAERRTAVADNASEGMRLVVRNPGDLESMELVTFERGTPGPGQIE
VAVKASSINFADVLVAFGRCPSFDGRLPELGSEFGGVVTAVGPGVTTHRV
GDRVGGVSANGCWSNFVTCEADLATKLPEGISEHEAAAVGLAYGTVWLGL
TELARMSAGDKILIHSATGGVGQAAIAVARAAGAEIYATAGSEKRRQLLR
DWGIEHVYDSRTTAFADQIRTDTDGYGVDIVLNSVTGPAQRAGLELLAFG
GRFVEIGKRDIYADTRLGLFPFRRNLSFYAVDLALMTVTHPQKIRDLLAT
VYRLIADGTLPLPEITHYPLEEAATAIRIMGGAQHTGKLVIDIPDTGQSQ
VVVPPEQVPVFRGDGAYVITGGLGGLGLFLAERMAAAGCGRIVVNSRSAP
STRSSEIIELIRATGADIVVECGDIAEPDTALRLVAAATQTGLPLRGVLH
AAAVVEDATLANITDELVEHDWAPKVYGAWNLHQAVQSGGPATSELDWFC
AFSSAAALVGSPGQGAYAAANSWLDAFMQWRRAQGLPATSIAWGAWGEIG
RGTAMAEGDNAIAPDEGAYAFEAILRHDRVYNGYAPVLGASWLTAFAQRS
PFAELFLADTQGASETRKLRSELAALPREEWPTHLRRLIAEQVGLLLRRT
VDPDRPLSEYGLDSLGHLELRTRIETETGVRVSAMDMTTIRGLAQRLCEM
LDTDDAVSAPS
118473067YP_885560.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MSQRSYAGQSAEERRRLRRARLLDAAMDAMCANAWRAVTVDKLCASAGLN
KRYFYENFTHLDSVAAAVIDDIAADVRTAALTALAGAASRPLDEQAAVAM
DALVHILLDDPRRARVLLGGVASSPSLQQHREAVMRGLTKVLVTHARTVH
GVELETDPLSQVAPAFLVGGTADAILAFVDGRAKLSREQLVDSLATLWLI
TGNGATQTARARHEAL
118473065YP_885594.1 hypothetical protein MSMEG_1202 [Mycobacterium smegmatis str. MC2 155]MRFSSGHWPGRGITAAPVAAHSFLNVLTRRETHRKAFPGKGVDMNPIVRR
VVATLTITAAPFLLVVGVATANTEPHQPVSQATHQVTHVSQN
118473063YP_889143.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTASATQNVYFDPYDVAINADPYPTFARLREEAPLYYNEQFDFYALSRFS
DVNKALIDHETFSSARGAIVELIKADIEIPSGALIFEDPPIHTAHRKLLS
RMFTPRKINALEPEIRRFCAQSLDAVAGVERFDIIKDFGAIMPMRVISAL
LGIPEEDQEKIRDHGNAQMRTEAGKPMKAAEEGLVDGSIFEAYIDWRKDN
PSDDIMTELLNVEFTDEHGVTRNLTREELLIYINVVAGAGNETTTRLIGW
AAKTLAEHPDQRRQLVENPALIPQAIEEILRFEPPAPHVARYVTRDVEYH
GRTVPEGSVMMLLIGAAVRDSRQFPPDGEVFDINRAPRQHLAFSVGTHFC
LGSALARLEGRVALEEILKRFPEWDVDLASAELSPTSTVRGWDSLPVIVR
118473558YP_884823.1 MmpL protein [Mycobacterium smegmatis str. MC2 155]MRKLADLVVRWPLVVIGVWLAMAVALPLSFPSLGEMAEKHPLQVLPAEAP
SSVTAAKMAEAFQESGNDDLMLVALINDKGLTPDDEAVYRKIVDALRGDL
INVVSVQDFIGTPQLRPFLTSQDKTTWVLPVSLEGELGTPRAFESFNRVS
EIVEHTVDQNAADGALQVHITGPAATVADLTVAGQQDRLPIEIAIAVLVL
GVLLLVYRNVVTMLLPLVTIGSSLIIAQSVVAGYSELTGSGVSNQSMVFL
SAIMAGAGTDYAVFLISRYHDFLRSGHGYDEAVRAAMISIGKVIAASATT
VGLTFLLLSFAKMGVFRTVGVAAAIGIAVAFLAGVTLLPAILVLAGPRGW
VKPRRELTTRFWRRSGIRIVRRPVPHLVGSVLVLALLGGFTLVAHYNYDD
RKVVSPDASSSIGYAALEQHFPISQSIPEYIFIQSPHDLRNPRALADLEQ
LASRVAQLPDVGLVSGITRPLGEVPPEFRATFQAGIVGDRLADGSTQIDQ
RTSDLNRLTSGAKTLADSLADVRSQINQIAPSIQSLVDTFSSVRTEYGGD
KLVRDVDTAAKLVASVNALGNAMGINLAAVKDMFAWIGPVLAALQGNPVC
DANPSCSATRAQFERVLDPSNEGNLNQINQLAQEFQGVEDRETLNSAVKK
LNAAMANVAKAVDAMGLDKPGGTQKGLKDLQQGASRLAGGSREVAGGVDE
LVKQVKVIAAGLNEASTFLLTMRNNAADPSQAGFNIPPEVFGLEDFKKAS
AAYISPDGHSVRYLVQTKLNPFSAEAMDQVNQIGDIARGAQPNTTLADAE
ISMGGFPVALRDTRDYYQQDIRFIIIATLIVVLLTLTVLLRTVIAPLYLV
GSVVVSYFAAIGLGVLMFQVVLGQQLHWSVPPLAFVVLVAVGADYNMLFV
SRLRDESPHSVRYGVIRTLGSTGGVITAAGLIFAASMAGLLFSSIGLVVQ
GGFVIGVGILLDTFVVRTITVPAIASLVGRANWWPGQIGTSPSNSRAPAE
VT
118473557YP_885465.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSVPESSSGDSQTLRREFSLWSAFAFAFAFISPIVALYGIFGLALSAAGP
SFWWGFGLVFAGQFLVALVFAMLVSRWPLEGSIYQWSRRLLGTTYGWFAG
WVYMWTLVIAMATVALGAAGFVANIAGLEEPSGGTLALIALVILLAGTAV
NLAGRQALKIFMAASIAAEVIGSVVLGTWLLLFHRENSLSVLFSGGGVDV
DMWSYLSGPFLLAVAFIGWSFVGFESAGSIAEEVHEPRKYLPKAVLFSLT
FIALVVGYSSLAIILAIPDLDAVAEGAVADPVYDTLTNALGHGVAKPVEV
MFVIGFLASFLALQTSASRVIWAYARDGALPAASALGRLRGPARIPTVAI
LVTTVIGACLFLLSIVAGDIYSLMVNFTAGGFYLAFLFPLVGFLVVLLRR
TWTPATFSLKGFTLPVALVAVVWASLQFLNIAWPRAAFDQRWLDWSVWIG
VAALAVLGTAILASVRSHITGTAVVEEAELRDELADRS
118473556YP_886063.1 hypothetical protein MSMEG_1687 [Mycobacterium smegmatis str. MC2 155]MLALFADTGTIRAHGAACAAHTADLAALAAVLRTLPSHLPSLGPAADRFA
AVFLDALDAQAKAVAALGDQVVQAGVTAQRNAAAYDAAGHHAATLL
118473555YP_887399.1 nucleoside-diphosphate sugar epimerase [Mycobacterium smegmatis str. MMMCSERVFSTVVDAPRDEVFAWHARPGAIHRLFPPWQPLRIEAEAASLAD
GTARLALPGGLTWVARHVAESYDPPRCFVDTIATDGVTSLPARAVVRWRH
IHEFDDTGDGRTRMTDRVQTYVPERALRPMFAYRHRQLADDLAAHRQARA
HGLKPMTIAVTGSSGLVGTALSALLSTGGHRVIRLVRRAPAGPGERRWNP
DDPHPELLTGVDAVIHLAGASIAGRFTDEHRRAIRDSRVGPTRRLAELAA
ATGLETFVSASAIGFYGACPGGPVTEESGRGDGFLADVVAQWEDAAAAAE
QAGVRVVRVRTGVVQSPRGGILRVLAPLFRLGLGGRVGDGAQWLSWIGID
DLVDIYLRALWDTDLTGPVNAVAPEPVRNSQYTRTLARVLHRPAVLPVPA
AGPRLLLGEQGAREVALASQHVTSAELRRAGHRFRHPDLESALRHVLG
118473554YP_887639.1 hypothetical protein MSMEG_3331 [Mycobacterium smegmatis str. MC2 155]MLVIVGLVVLLVAVIVGFTGALLNAGPAHPLTENFDVFGYHVTGSTGTLF
LFGIVIGAVAMLGLSVLLAGAQRSAGRGRAARRELDRSRRETAFLNQERD
RRLEHDQDHAVAASAVPPQRAVPSRSRDARFGRWWHGGQPVRAAGVDTAG
RPTPADTSSPRSRGR
118473553YP_889662.1 nucleoside triphosphate pyrophosphohydrolase [Mycobacterium smegmatis MIVVLVDPRRPALVPVDAVEFLTGDVQYTEEMPVKVPWSLPSARPAYDGE
DAPVLLSSDPEHPVVKARLAAGDRLIAAPEPQPGERLVDAVALMDKLRTS
GPWESEQTHDSLRRYLLEETYELFDAVRSGNADELREELGDVLLQVLFHA
RIAEDAPHHPFSIDDVADALVRKLGNRVPAVLAGESISLDEQLAQWEERK
AQEKKVKARASSMDDVPTGQPALALAQKVLARVSQAGLPAELIPASLTSV
SVSADTDSENELRTAVLEFMDTVREVEAAVAAGRRGEDVPEELDVAPLGV
ISEDEWRAYWPGAESSASEAEPEE
118473552YP_884696.1 choline dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNVEINQRYDFIVCGSGSSGSVVARRLAENPDADVLLLEAGGSDDVPEVQ
QAVQWPENLGSPRDWQFEAQANPHLNGRAIPMNMGKVLGGGSSINVMMWS
RGHRNDWDFFAAEADDEGWGYEAVLDIYRRIEDWQGKPDPQYRGTDGNVY
VQPAPDPNPIADAAVAAAASVGIPAFDHPNGAMMEGAGGAALSDIRVRDG
IRQSVFRSYVHPYLGRPNLTVLTGAVVTRVTLDGHRASGVEFVRDGVTFR
VAAGSEVVLGLGAINTPKVLMLSGIGDSAELARHGIKTVVHLPGVGRNLQ
DHPAFGCVWEYDVALEPRNTGSEATYFAKSDSRLDTPDLQTCQIEAPFAS
AETIARFGLPQAAWTMFAGIVRPESRGSVRLTGCSPDDPVRIDANMLSDP
ADMTAAMIAVELCREIGNAAPLSAHAKREVMPGNLKGRDLERFIRDAAVS
YWHQSGTAKMGRDEMSVVDGNLRVHGIERLRIADASIMPRITTGNTMAPC
VVIGERAAQLIRDTYAAQEPAHE
118473551YP_888838.1 hypothetical protein MSMEG_4569 [Mycobacterium smegmatis str. MC2 155]MLARNAESLYWIGRYVERADDTARILDVTVHQLLEDSSVDPDQASRTLLR
VLGIDPPRERLDVWSLTDIVAFSRGTYGGASIVDAISAARENARGAREVT
STEIWECLNTTYNALAERERAAKRLGPHEFLSYVEGRAAMFAGLADSTLS
RDDGYRFMVLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGAHDTY
LRTYRGVLDAGRVVEFMMLDRLFPRSIFHSLRLAEHNLDELLNRPHNRLG
ATDEAQRLLGRARSELEFLQPGALLESLETRLAGLQKTCRDVGEALAQQY
FHSAPWVAWTDAGRGDALVIEEGEI
118473550YP_887982.1 phosphohydrolase [Mycobacterium smegmatis str. MC2 155]MNGMPKLSAGVLLYRVVDDVVEVLIAHPGGPFWARRDDGAWSVPKGEYTD
DEDRWAAAQREFAEELGSPPPDGPRRELTPVRQSGGKVVTAFAVRGDFDV
TSARSNTFEMEWPKGSGRMREFPEIDRAGWFPVAVARRKLLAGQRPLLDE
LMAAPELAGYREGD
118473549YP_886883.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPIPRLRRAMRDEVRDALLAMLMDGRLAAGTSVSIDRLSRDLGVSQTP
VREALVEIEATGLVHRVAHRGYQVAPPMTAQQAAELADARLVVETTAAHW
ATRLRDPELLPDLRAAHRAHEEAAWAVREWDGVTRDRNGLPVPLKPYFEA
DWRFHQTILDHCGNGFLRRMVGSLGASVQRMRQNVHRGPVDTELAVAEHG
RVLAAVETGDPQAAADAMRAHIEAVRERSIADA
118473548YP_889822.1 hypothetical protein MSMEG_5587 [Mycobacterium smegmatis str. MC2 155]MKLRMSTLAGCLLVGGAAAAIGLAPLAGAEPVDPKEPHLLPQCEVTGGSS
VEGGQTTDCASEGNVQIDSTPPEPGYGMFPWDDEFFVL
118473547YP_890376.1 IS1096- tnpR protein [Mycobacterium smegmatis str. MC2 155]MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFRVRVDL
MYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRA
YFVTGFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVE
DVFDDPPPAAVCLTGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGL
GAQEMRDWLPRGWHPDRFSVAETNDALAALNTR
118473546YP_887844.1 hypothetical protein MSMEG_3542 [Mycobacterium smegmatis str. MC2 155]MIRPYRDRCEEFPTTMETRAVPIRDALDRLTDDTDASRVFGEPYVTPDGA
TVIPVSTVGRHGARPAGVFVVTDGKPVWEPAVDSTRIAMLGELIGLVAAT
LATVAMVRRPPWPDVRVTVSRKS
118473545YP_890564.1 hypothetical protein MSMEG_6347 [Mycobacterium smegmatis str. MC2 155]MTSRPPSSPTEPSELDQPQRVEHGHRGRIDEILPEHRTLGGVDRPLSQGR
AGGVPADRAQPAQHGRLGAVGVHEGVAVGRDGHRIDDQRIQFGAHELTHR
RCGSRQVAHVGRTEPSALVAGDVQQVVLPVAQLDALAQRQGDVDHRQHRR
LAARRVEPGDVTREPFVVETPGLVVEEMPILVHVNVYVAVVRGRSEVRLQ
RLTVRVLDEHLVERNGLPRGEEQPRREGIRYLTLHYPTPKAATFTSYPLK
WIEVCCVTAYREISYGRANQILDSTRDY
118473544YP_886426.1 hypothetical protein MSMEG_2065 [Mycobacterium smegmatis str. MC2 155]MTTLQTVLTANTGHWTLAPDRSTVRFRTRTMWGLVPVNGTFTEVSGSGAV
ADNSVTGRVVISAASVRTGIGKRDEHLRSADFFDTATHPEITAEVSGAQP
SGDGALLDLTLTVRGTSRPLRLPVGIEVLGDGGLRVSGRATLDRRDFGVS
GNMVGMVGSSTDVAADLVFTRG
118473543YP_884755.1 hypothetical protein MSMEG_0342 [Mycobacterium smegmatis str. MC2 155]MGRMTSEVMTHDVSLLWQNIFTWASWVITLAMIAIAIRMGLRQRTPFYLF
AVVAAGVAAYAEPLYDVAFDLWFYDAQNGQPGAGLMHFSAFGIPQPNWTH
SGYIILYAGACLYAGRRLYEGRFDRRSLLALWGLEIVTSCVFEVIGTGTD
VYTYYGPHVLRIWNYPLVIGVLEGTQVVLFTVAAVLIWRRASDWWLLLGL
FVLFPMTFFGANFGLGYPVIIGMHLDNGLASTPLIFAATLASIALCSITI
YGLAAFLPTRTPDAGTPAKESVTPTEAQLAN
118473542YP_887980.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MPLAAGETFAGYNIIRLLGSGGMGEVYLAAHPRLPRQDALKVLPTSISAD
PEYRERFNREADVAAALWHPHIVEIHDRGEHDGQLWIAMDYVDGTDAARL
LKEQYSGGMPPHQVCEIVTAMAGALDYAHQRGLLHRDVKPANILLGHPGT
DDQRIMLADFGIARYADEASGLTATNMTVGTVTYAAPEQLLGNHLDGRAD
QYALAATAYQLLTGRTPFEHSNPAVVISQHLSAAPPAVGTHRPDLATLDP
VFAKALAKDPRDRYARCADFARALRHRLGTDADVADPDATRLAPVARHAA
PHKRPKTAALIAGVLGVLLVAAIVVAAVEFRRADDERPVARASGAATTTS
HTTTPVTTAPASPPPEVTDTVTITDTATDTAAVDTSTPATTTAATTAAAA
AAQTAVIGASCSPVGATATTSDGSTAYCSTLATTGASIWSLTQGTIPSPT
VTPAATDEPLPFAEESPVRVCMQQTGMTRRECREAIRRSNGLP
118473541YP_884607.1 BadF/BadG/BcrA/BcrD ATPase [Mycobacterium smegmatis str. MC2 155]MWPQDADSPSQSHEAHGAPGLAAQRGVTAARDAVCAAVSPLLNDRAGLRL
STVFVGAAGAATAPEAARALAAELLAGLPADEVAVTSDAVTAHAGALGAR
PGVVLSVGTGSVAVGVGADGTFARVGGWGPWLGDEGGGAWIGTAGLRAAL
HAHDGRGPATQLLAMATARFGDLQQLPATVEAQGNPARTSASFAPDVARA
AESGDPVAAGILADAATALASAVLTTTLRIDPRNRLPVAITGGLVRLGEP
LLRPLRTALSAESPQTTLALPLGDSLHGAHLLSRDLTTPHEAHIARVRHT
STQSHPAVR
118473540YP_885188.1 phosphate acetyltransferase [Mycobacterium smegmatis str. MC2 155]MPEGEAATAIYIASPEGDTGKSTIALGILHRLAATVPKVGVFRPITRLGE
DRDYILELLLAGTTAGLPYEDCVGVSYQQVHEDPDAAIAEIVDRYHRVAD
QCDAVLIVGSDYTDIATPSELSMNARIAVNLGAPVVLAVKAADRTPDEVV
HVVEVCLAELAGQHAHTSAVVANRCDPAQLTAVSEALRPLGPPAYVLPEE
PLLVAPSVAELQKAVDGTVVAGDPALLSREALGVLVAGMTAEHVLERLTE
GVAVVTPGDRSDVVLAVVSAHAAEGFPSLSTIILNGGLDLHPAIAKLVDG
LGLKLPIIATPYGTFETASRVASARGRVTSTSQRKIDTALQIMERHVDID
DLLARLRLPIPEVTTPQMFTYQLLDRARADRKRIVLPEGDDDRILKAAGR
LLRRGVADLTILGEENQIRSRGAELGVDLSAATVLDPRTSDLCEAFAQQY
AELRKHKGITLDQAREIIVDVSYFGTMLVHNDMVDGMVSGAAHTTAHTVR
PAFEIIKTLPDVSTVSSIFLMCLEDRVLAYGDCAIVPDPTAEQLADIAIS
SARTAAQFGIEPRVAMLSYSTGTSGTGADVEKVKAATDLVRERDKTLLVE
GPIQYDAAVEPSVAKTKMPDSEVAGRATVLIFPDLNTGNNTYKAVQRSAG
AIAIGPVLQGLNKPVNDLSRGALVEDIVNTVAITAIQAQGRS
118473539YP_887383.1 riboflavin biosynthesis protein RibD [Mycobacterium smegmatis str. MC2MSISVEAAMRLAIDQAEQVKGATYPNPPVGAVILDRDGQVAGVGGTQPTG
GPHAEVMALRAAAERAEGGTAVVTLEPCNHHGRTPPCVDGLVAAGISRVV
YAVADPNPVAAGGSARMASSGIEVTSGVLSDEVAGGPLREWLHKQRTGLP
HVTWKFATSVDGRSAAADGSSQWITSAAARADVHRRRAAADAIVVGTGTV
FVDDPSLTARLPDGTLADRQPLRVVVGRREVSSDANVLNDDSRTMVIRTH
DPHEVLRALSDRTDIMLEGGPTLAGAFLRAGVVNRILAYVAPILLGGPIT
AVDDVGVPSIAHAQRWRFDCVQTIGPDVLMSLVPN
118473538YP_889460.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MLAVEQPTERMLELYANHVDPLRRYAFRLTSNQTRSEDIVQETFLRAWRH
LQNNDGDLPLRSWLFTVARNIVIDGSRSARVRYEVSSPDTPEVPDRMGAD
EVNAALDRILVAEAMAQLPESHRAVLSRSFYLGWTTGRIAEDLGIAEGTV
KSRLHYSLKRLRLILAEMGCHARS
118473537YP_886880.1 hypothetical protein MSMEG_2542 [Mycobacterium smegmatis str. MC2 155]MPDTPDTLDRMPARTASAVTFLYALGYPIGNAAVAAMSPMALLVFRFSLA
AAILGAWARFAGVAWPRGGKLAHVAVAGLLMQGVQFCFLYLAIERGAPAV
LCAVVIAMNPVTTAVLSAAFLRDRLGLRRILALVLGVAAVLAACASRLAA
ESGVDPVLLLLLAALLGLSAGGVYQQRFCSDVDFRAATAVQNAVALLPAA
VFAALTPFAVHNAKHAVAAVAGVVLLNAALGVSMYVRAISRHGAPAVTML
FCVIPAVAGVLSWLMLGERPDVGIAVGLVVGAAACWLNSSGSRQQRQHDP
GRDG
118473536YP_887434.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTPRSGRSDAASSTRSPDVPVLLRGVTKRYGSTTAVSELDLEVQRAEVLA
LLGPNGAGKTTTVEMCEGFVRADAGSIRILGLDPIADNARLRERIGVMLQ
GGGGYPAARAGEMLDLVASYAADPLDPAWLMDTLGLTDSARTTYRRLSGG
QQQRLALACAVVGRPELVFLDEPTAGMDAHARIVVWELIDALRRDGVTVV
LTTHQLTEAEELADRIVIIDHGVAVATGTPAELMRSGAENQLRFSAPRKL
DLSLLVAALPEGYNAVEAAPGEYLVEGHIDPQVLATVTAWCARVNVLATD
MRVEQRSLEDVFLDLTGRELRS
118473535YP_890894.1 glutaryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTLTAPSKKSTYAPLELFDTDRLLDQDERDIAATVRQFVDTRLKPNVEGW
FESATLPSELAKEFGNLGVLGMHLQGYGCAGTNAVSYGLACMELEAGDSG
FRSFVSVQGSLSMFSIYRYGSEEQKNEWLPRLAAGDAIGCFGLTEPDFGS
NPAGMRTRARRDGSDWILNGTKMWITNGNLADVATVWAQTDDGIRGFLVP
TDTPGFTANEIHRKLSLRASVTSELVLDNVRLPASAQLPLAEGLSAPLSC
LNEARFGIVFGALGAARDSLETTIAYTQSREVFDKPLSNYQLTQEKLANM
TVELGKGMLLAIHLGRIKDAEGVRPEQISLGKLNNVREAIAIARECRTLL
GGSGITLEYSPLRHANNLESVLTYEGTSEMHLLSIGKALTGKAAFRS
118473534YP_887403.1 preprotein translocase subunit SecG [Mycobacterium smegmatis str. MC2 MQLALQIVLVVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVVGIWLVSIVGVALQIKYNV
118473533YP_885402.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MQIGRRELVAVIIAILLVTAAFVVPHLDLGIVTPLINSTPAQIYSFADTA
PIFGWWNAHVGWGTVPAVLIGAATVWWGPAVAQRLPWRALPLVAWVTSAL
WAFSLAMIDGWQRGFAGRLTARHEYLRQVPSVTDIGEALRTFSSRILDFQ
PDSWITHVSGHPPGALLTFVWLDRIGLGGGAWAGLLCLLVGSSAAAAIVV
ALRAVSGEATARLAAPFVAVAPTAIWIAVSADGYFAGVAAWGLALLALAV
RDSVHRRRVALPTAVGSGLLLGWGIFLNYGLALAALIALAVLITAPDWRA
ALRVAVPAVIAVLAVVAVFLVAGFWWFDGYTLVQERYWQGIANNRPFQYW
SWANLASVVCAIGLGSVAGIGRVFDIKAARRNPGLPMLVIGALLAITFAD
LSMLSKAETERIWLPFTVWLTAAGALLPPRSHRWWLGLNVAGALALNHLI
LTNW
118473532YP_887100.1 integral membrane alanine and leucine rich protein [Mycobacterium smegMTQADNSPLPESAGEAEVPRARGGRAVLEQMGGISGLIYSSLPVVVFVPV
SSLFGLTAAIASALAVATLILIWRLIRRDSVQPAISGFFAVGVSALIAYM
VGESKGYFLLGIWSSLIYAVVFGISVLIRRPVVGYIWGWVHTDDAGWRDV
RKAVRAFDIATLTWVAVFGSRFVVQNHLYDADETTWLGVARIAMGWPLTA
VAALVTYLAIRSAQRAVREHQAARHIDAATGSGSEPAAESGAEPHAG
118473531YP_885171.1 hypothetical protein MSMEG_0765 [Mycobacterium smegmatis str. MC2 155]MLRRSRRRESRPTPRTCEHLTADIAEPRPQTPGYCQDCAELGERTWAHLR
MCMTCGHVACCDSSPHQHATKHFHSTGHPVMRSAEPGESWRWCYIDHRVG
118473530YP_885909.1 cutinase [Mycobacterium smegmatis str. MC2 155]MVEHSSSPQLLKWLSAVVIVAATAVALVVAPTVTTRGLPMAGAAPCADVE
VIFARGRTEPAGVGTLGNAFVNALRPKVKKSMNVYAVKYPADTEVDVGAN
DMSNRIKYMMDNCPNTRLVIGGYSLGAAVADVVLAVPFTAFGFKNPLPAG
ADQHIAAVALFGNGAAWVGPITNFSPVYNDRTIELCHGADPICNPADPNT
WQNNWPDHLAGAYISGGMVNQAADFVASKL
118473529YP_887110.1 hypothetical protein MSMEG_2779 [Mycobacterium smegmatis str. MC2 155]MTSAEPAQFRTAVAAMNATTVRPEIELGPIRPPQRLAPYSYALGAEVRHP
DTAIVPERSEGDAFGRLILLHDPDGAEAWDGTMRLVAYIQADLDSSEAVD
PLLPEVAWSWLVDALDARANQVTALGGTVTATTSVRYGDIAGPPRAHQLE
LRASWTATTLELGPHVEAFCEVLEHAAGLPPAGVTDLSSRTRA
118473528YP_885411.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTAESVPQGSNGSAGATAAQARRSRGDRQREAIVAAVRELLEEQPFADIS
VSTISERAGVARSGFYFYFDSKYAVLAVILAEAMEELDALTHNFAPRGEN
ESPAAFAKRMVGSAAAVYATNDPVMSACTVAQNTDAQIRDIMNDFEDATI
AKIVGVIEQDTGARPISDDLPALVRTLTATTAMTLSRDAGFVGRDADPAR
AVEIVERLWLSALWGGLPE
118473527YP_886987.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTATSATRIGSAKDALIEAARLSAVFAEGAGARDADRRLPHDEIRALKES
GLLAITVPVAHGGIDMPSTVLAEVIRLLSHGDSSIGQIPHSHFTFLEALR
LQGTESQRAFFYGLVLDGALFANAQAERGPHPTDVDTTTLRPAGDGYVLS
GRKFYSTGALFADWILVRASLSDGSVTVPTASTPKAVAFVPRDAAGVTIV
DDWDGMGQRTTASGTVTLDDVQVPAEHVVPFTAIFTEPTVYGSRAQLLHT
AIDVGIATAALDEGVRQAARARPHFESKVASVADDPTVVQAAGELAVTVR
SAQALLAEAARQVDAARADLTDETAAAASIAVAVAKVAAVRASLDASSAL
FELGGTRSASAGGNLSRYWRDARTHTLHDSTRWKLRHIGRYTLSGTKPPR
HSQI
118473526YP_885263.1 CDP-diacylglycerol--serine O-phosphatidyltransferase [Mycobacterium smMIKARIKRPSFTVRMLPSALTVAAICLGLSAVKMALDNRPTEAMAFLAAA
AILDALDGRVARMLKATSKMGEEIDSLADAVNFGVAPAFIVYGTLLSHSR
VGWIVVLLYAVCIVLRLARFNALLDVDQPAYEKEYFVGMPAPAGAIGAIG
PLAAKMQWPGEWWNSVTAEWVVIIWMIGVSLLVVSRIPMRKIHTFSVSPN
MAAPLLVLVAIGVAASVFYGYIVIMVIIVAYVIHIPFAVRTKHWVASHPE
SWDVKPKQRRAARRAIRRAQPHRRSMARLGLRKPGR
118473525YP_890643.1 hypothetical protein MSMEG_6430 [Mycobacterium smegmatis str. MC2 155]MIIWVIAGLLGLATGLRIGWALVNKQSLVSSAMIVALGSLGAVAALNWQP
LALLIDTLLRWPNLAVGLSQVALVACAAGSCVMITSASSERSPVTTRRIA
FAQYGIAAVVAVISLVMFFLAGRQPEMAPEEYLKHQLGDNGMSWLLPLLY
VLLALTLVAWAGLRYSNRSRRGRALFVFTVGMVLIVAASAFFLLRAVGTS
DTIGVGAAATLLGCAMVVVAAGSLLPSIEDWFGARQELRVIAPLLDELGK
RQPDVGIGVRPRGPLVFRVAERMSLISDALYLEATAAESRRRKAARHGSG
SADRPVLDVPEVTPQEQARAVAQWIHDTRDEDAPASAFPGLSWLGQPESL
SDREWILAIAQQYREIERAGTPSDSPERDLLTLHDIIAGRGPESSLRGVE
LFAAAQFLGLLDQVLLSLRRQSDGAGSNAADPFVTHVREPGEFLVELLVV
LVVGEVRGLDTEEVGKSSHGCGGRVGAVPRTQLRKIRSRHGDALGLERSN
HLGRRVGSAPGGINRVEQAVQTGGERLAHRFDLHMIHERNEKAAYLLTIV
PSVVTTTKCKPRKS
118473524YP_890896.1 CAIB/BAIF family protein [Mycobacterium smegmatis str. MC2 155]MSAAALEGVVVADFSRVLAGPYATMMLADFGAEVIKIERPGTGDDTRQWG
PPYDSTGVATYFNSVNRNKRSVALDLGSTEGREQARELIRRADIVVENFR
PGTMEKLGLGYDDVRAIRPDVIYCSITGFGHGGGAALPGYDLLVQAVGGL
MSVTGTEPGDPTKAGVALVDVLAGMHALSGILVALAHRDRTGEGQRVDTN
LFSVLLSSMVNQASGYLGAGVVPGIMGNRHPSITPYQTFDTADRPIAIAV
GNDKQFRAFAAVIGSPELADDPRFSTNPQRVAHRDVLCPLIEAALKAKGA
DHWYHELTAVGVPAGPINDLSEAFAFAEELGIEAVVQMPDGPTPQVANPI
TLSATPVTYRNSPPPLS
118473523YP_887339.1 recombination factor protein RarA [Mycobacterium smegmatis str. MC2 15MSDSLFDVPGGGAESGDAIAATGAVGPSSPLAVRMRPAGLDEVVGQSHLL
QAGSPLRRLVEGSGAASVILYGPPGTGKTTLASLISQATGRRFEALSALT
AGVKEVRAVIDTARRAAVHGQQTVLFIDEVHRFSKTQQDALLAAVENRVV
LLVAATTENPSFSVVAPLLSRSLILQLQPLTPADIEAVLRRAITDERGLG
GRVEVTDEAVDLIVQLSAGDARRALTALEVAAEPGERVTVETIEQSLDKA
AVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARR
LMILASEDIGMADPTALQTAVAAAQTVQLIGMPEAQLTLAHATVHLATAP
KSNAVTTALGAAMNDIRAGKAGLVPPHLRDGHYSGAAKLGHAVGYRYSHD
HPDGVVAQQYPPDELVGVDYYQPTGRGYEREISTRLDKLRAIIRRRR
118473522YP_890522.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MRVEEEDGLVRARGLRYGTAARFTRAEPTPLWEGVLDATRSGPACPQRPS
RVSWMTGPLLDGLVMDEDCLVLSVTAPADANGLPVMVWLHGGAYVSGSGE
SRKYDAAPLARHGDVVVVNVSYRLGTFGFLAPPGAPDGFNVGLTDQILAL
KWVRDNISAFGGDPGNVTVFGQSAGGDSVVKLMLAEEASGLFHRAIVQSA
PLGLGDERADLAVAMRSALADALDGVDPLQATTQQLLDAQAAAASWAQPV
EMLGAMMPFAPLLGHDPLPPADDVAGHLADAAARIELLVGYTRDDAAPFV
TMHPEFSEMPDLTEFIFGAPAEALAAQWNDLGGRAASYRFEWSPDDAPLG
ACHCLELPFLFGSPEAWADAAMLGNERRIDPTLADEMRTVWTQFAHHGVD
ALPARSLRFG
118473521YP_886336.1 propane monooxygenase hydroxylase large subunit [Mycobacterium smegmatMSRQSLTKAHAKISELTWEPTFATPATRFGTDYTFEKAPKKDPLKQIMRS
YFSMEEEKDNRVYGAMDGAIRGNMFRQVQQRWLEWQKLFLSIIPFPEISA
ARAMPMAIDAVPNPEIHNGLAVQMIDEVRHSTIQMNLKKLYMNNYIDPSG
FDMTEKAFANNYAGTIGRQFGEGFITGDAITAANIYLTVVAETAFTNTLF
VAMPDEAAANGDYLLPTVFHSVQSDESRHISNGYSILLMALADERNRPLL
ERDLRYAWWNNHCVVDAAIGTFIEYGTKDRRKDRESYAEMWRRWIYDDYY
RSYLLPLEKYGLTIPHDLVEEAWKRIVEKGYVHEVARFFATGWPVNYWRI
DTMTDTDFEWFEHKYPGWYSKFGKWWENYNRLAYPGRNKPIAFEEVGYQY
PHRCWTCMVPALIREDMIVEKVDGQWRTYCSETCYWTDAVAFRGEYEGRE
TPNMGRLTGFREWETLHHGKDLADIVTDLGYVRDDGKTLVGQPHLNLDPQ
KMWTLDDVRGNTFNSPNVLLNQMTDDERDAHVAAYRAGGVPA
118473520YP_885462.1 hypothetical protein MSMEG_1066 [Mycobacterium smegmatis str. MC2 155]MTETTTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQ
AILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAV
PVR
118473519YP_890485.1 thiocyanate hydrolase subunit beta [Mycobacterium smegmatis str. MC2 1MGRLKAHFPEIPDAPPPDLLDHDRFLAYMKTVHDVGGEPDAPMKYENKEY
EYWEHMTYVICEVLAWRGIWLSEERRRIGNVDVGRAIYQGIPYYGRWLWA
VARVLIEKHHISHGELTDRMVEVQERYRDGLAGRMLEATPKSEGDGADVR
RNEHHIRAVGIGDPQIYAGKAGTPKFSVGEAVVVRDLPALLYTRTPEYVR
GAKGVIAEVTYESPAPEDETWDRTDATPEWFYIVRFNLSELFYGYTGTST
DTLQTEIPERWLEKSL
118473518YP_887573.1 xylulose kinase [Mycobacterium smegmatis str. MC2 155]MIATETVSHSMDLPRPGWAEVDAEKLWWAEVCQIASKLMAQMPSGGVLAG
MCVSGVGPCLVLCDDDLRPLRPAILYGIDTRASEEIEALTAEFGAEAILD
RAGTVLSSQAVGPKLEWVRRHEPEVFERATGWYGSNSYIAAKLTGEYVMD
HHTASQCDPLYATRRFEWNKPWAQRICGHLPLPRLVWPADVVGTVTPEAA
AATGVPAGTPVSAGTVDAYSEAFSVGVRRPGDQMLMYGSTMFLVQVIDAY
HSDPVLWTTAGIEHDTLALAAGTSTAGSLINWLQSVTGGASFDELMAEAA
DVPPGSEGLLVLPYLAGERTPVFDPQARGVVAGLTLRHGRGHLFRAAYEG
ISFGIRQILERFDDAHTASRTVAVGGGLRSPIWAQTVSDVTGRPQLVPEQ
AIGASYGDALLAAIGVGLVPADTDWAKIAAEIKPDPRNHALYEDLYATWQ
ELYPATRDQVHRLAGQPIV
118473517YP_888648.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MTDSTTELTPAAPVSWPDGKTCAVAFTFDVDAESPLLTTDPAFADRMGTM
SHQAYGPLVGVPRLLGILDEFNVPGTFFVPGYTAHRHPEPIRSIARAGHE
IAHHGYLHESLVGADEDTERKILTRGIEALEEVAGVHPVGYRAPMWEMNW
HTPKLLAEFGFLYDSTLMDSDHPYELAVGDGSLVELPVSWALDDWQQYCF
VPDFSGTGLIETPAKAIELWRAELNAMRDIGGAWVLTNHPFLSGRPGRAA
ALREFIAEVCAMDDVWVAGMSQIAEHVRAQKLTPRTLTRPELTPVAE
118473516YP_889436.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGERPGGRTAAVRRAVLSAAEDLLIEAGFDGLELTVVAERAGVGKSTVY
RRWGTVPALVADLLTDMAEQSLPRADTGSLRGDLQANARLVRRTLADARQ
GRLFKAMIAAATCDPRTAEALEDFYARRIAEWSGCVTDAIARGEAPAGTD
AAAAIRQVSAPLYYQFLTSTKRLTTADADRAAEAAVAAIDAGVYTARG
118473515YP_889874.1 amylo-alpha-1-6-glucosidase [Mycobacterium smegmatis str. MC2 155]MTVTPTILNGGEPASIGFGGGTVTLVEGATFCLSDRHGDVLAGRSHGLFF
RDARVLSRWQLHVDGGEPESLTVQTPEAFAAQFIMRRTPRAGVADSTLLL
VRDRLIADGLRETISLYNLADEPTVVSLELLVDADFADLFAVKEGRAPIG
GAEISLVDNELVLNDRSNRVRGVKITASGSPVVTPGVFRWRVVVPPRGTW
QAEVVAEPTWANQSVKTRFRTGEELEASAPARKIEAWRGTTTTVETDLRA
LAATLQRSESDLGALLIRDETDERPYVAAGAPWFMTLFGRDSLLTAWMSL
PLDVGLSVGTLQRLADAQGRRVDPLTEEQPGRIMHEIRRGPASTDVLGGS
VYYGSADSTPLFVMLLAECWRWGADEGAVRALLPAADAALSWAARYGDRD
DDGFIEYKRATDRGLLNQGWKDSFDAITDAAGHRADAPIALCEVQAYQYA
ALRARAELADAFGEPATAKRLRDRAATLKKRFAEKFWLPDRGYYALALDG
DKRPVDSLTSNVGHCLWAGIATDEHAARLVEKLGTSEMDSGFGLRTLAAD
MGAYNPMSYHNGSVWPHDTAIAVAGLLRYRHVPGAVELAERLALGLLDAA
DAFGGRLPELFCGFHRSQFASPVPYPTSCSPQAWASAAPLLLVRAFLGLE
PDVPHRKLTVRPQLPAAWGRVALTDLRLGSATVAVEAEGTVAKVTGLPGD
WQLSTAES
118473514YP_889212.1 hypothetical protein MSMEG_4961 [Mycobacterium smegmatis str. MC2 155]MFSQKRIARIARIPKARFKIVSGIVGMAAVIAMAALGVMSSYAPDNGPDY
AMGPMQTGATVTQSTAASAPETSIAKPPFTWTTPEGFAVPH
118473513YP_889252.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMDPQLDLNLLLALDALLDERSVGGAAERLHTSAPAMSRTLARLRRVLDDP
VLVRAGREMVPTPRALALQGRVHDVVQQARAVFTPPEVPDLPNLRRTFSV
QLGDGLFSHCGPRLLARVHAEALNVTLKFVGESHEDTHSLREGSVDIEIG
QVRRTEPETIIEPLVEENWVGVARAGHELTGKRVTLKRFADAEHVVFSRR
GRLRGPVDDLLAEHGLRRRVVACAPSPAGGLFLIQNSDLVGMLPAGIGAQ
AIATFALQTFTIPLELPPLVIGMAWHPRFDADGAHRWLRDCVRSAVRGPQ
K
118473512YP_886961.1 hypothetical protein MSMEG_2624 [Mycobacterium smegmatis str. MC2 155]MAPDPKLPSADLPSQKQVIELLDGEFARAGYEIDDVVVNAATRPARITIV
ADGDKGLDLDAVAMLSRLASGLLDTVDTGDTPYVLEVTSPGVDRPLTTEK
HFRRARGRKAELSLADGSSLTARLGGTDGDQVNVVVAQGKDFAVRQIPLR
EITKAVVQVEFSPPNRRELELAEQTGKGARA
118473511YP_886104.1 IS6120- transposase [Mycobacterium smegmatis str. MC2 155]MLTVVHDTEDANDKASGAGRSLLDEIVRDGARQMLAAALQAEVAAYVAQF
ADQLDENGHRLVVRNGYHQPREVLTAAGAVQVKAPRVNDRRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSSNDFTPALEQFLGSGAGLSA
STITRLTAQWQDEARAFGARDLSATDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESAESWADLLRDCKRRGMTAPVLAIGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHPSALAAIKEIYNAED
IDKAQIAVKAFEADFGAKYPKAVAKITDDLDVLLEFYKYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGRLLERPTDITPPTSPSDGGQHAGTEVA
118473510YP_889107.1 caib/baif family protein [Mycobacterium smegmatis str. MC2 155]MTAPLEGYTVLDLTSGIAGGYATKLIADGGADVVKVEAPDGDPLRRWSAS
GAAIEPGRHGALFSFLAGGKRSVVVDPGLDDDLDLLDRLAGSADAVVWSP
ESALAQKVSPRELYERYPHLVVTAITPFGLDGPWCDRAATEFTLQAWSGG
AIGIGRGVQDRAPVTIGGQVGEWLTGAYAAAMTLSFLTRRHRDGHGELID
LSKLESQILGLTYYPVTYFEMLGRPWRTERRPTVPGVAQAADGLVALGCG
TAQQWWDLCAMSGHDEWIDETTELTITEQANLHAEELYAWLREQRVDDVR
DLASAFRIPNSPVGNGENVTRMDHFVERGSFVHHPDGFTAPNHPYRLDGV
ALRPPTAAPKLGAHTDAVRAATRAPRPAPAGPPARDRLPFSGLRVLDMTT
FWAGPSCTHILGMLGAEVIHVESTVRPDGTRLIAGIPASEEQWWERSPIF
SALNTNKLGITLDFQTEPGRDLLRRVIATSDVVVENFTPRVIDQIGLDYD
AVRALRDDIIMLRMPGFGLDGPWRDNPAFAYIIEDASGLSWLTGFSDRTP
FEPYSVGDPNAGIHALTALLLALEHRRRTGQGTLIEAAMVDAALHIAAEQ
VIEFSAHGALLQRDGNRGPTAAPQGLYRTVDIDEFGRPDSWVAIAVGTDA
QWEALRRVIGDPEWASDPELSTHTGRRTHHDRIDKELATWCAPRSGDEIV
ETLWPAGVPVAKVMQPHRQLELEQLRHRRFFEFVGHPVNPAAAHSTLPVS
LANGPKEFHRRPAPLLGEHNHELLAKLGLGDDEITALAEHGVIGTEPGAA
KRVTR
118473509YP_891072.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MTDIVGASAGRHLQAIGPEALIGSVELLARSVRVALVSPAGQIVRRAEKE
FPVTGDAAVLRETVQDTVFGCLQGSPLCGVGVASAGLVDHTTGVLRRIDD
QPGFSGYPIAASLTRLLGCPVFVDHRARLQVLGDRWFGHGIGRASFASVA
TGDTLGLGILFEGKVIAPLGGRSGAHITVALGGRRCSCGNLGCWKTIATS
TWLRQEAATRGLGPIDGVGDLIAAARGDTGARRLMTDYADNLAVGLSSVQ
HLLAPGLYIVHGDAAAGGGTFLGRIEERLRAVSEWADFAERPRVVAADTA
ADDVALLGGAGLVLSRLSGQ
118473508YP_887641.1 hypothetical protein MSMEG_3334 [Mycobacterium smegmatis str. MC2 155]MCKPHKRRGHGRATKDPVSVRRRVGLKRRYSRRTVSDRDEL
118473507YP_885164.1 hypothetical protein MSMEG_0758 [Mycobacterium smegmatis str. MC2 155]MPRPLRGLPTVGIDDVDAHHRVIVTGSAGDLAAVLTRLLKADRLDVEVAH
ARTSWSARRALRGTARRVPLIRDETGTVLVSAAEWHGKEAAPLEGEAIVD
DTVLFDGQAHGVRIEPLDAVPGLRASVLSRRGRPLGWVSGRAAQLGTPGA
VVVRDGATMARPVRRSTFYRHTQGWLRVG
118473506YP_886404.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMKAEASPLGKGVGAGRPRDPRIDAAILRATAELLVEIGYANLTMAAVAER
AQTTKTALYRRWSSKAELVHEAVFPAVPTGLVAPAGDIAADVHAMIAAAR
DVFTSPVVRAALPGLIADVSADANLNARVMERFTGVFAAVRERIVDGIAR
GEVHAAVSPDRLVEIIGGATMLRLLLVSDENLDDEWVHQTAAIVIHGVTV
GR
118473505YP_885865.1 preprotein translocase subunit SecY [Mycobacterium smegmatis str. MC2 MLSAFISSLRTADLRRKILFTLGLVILYRVGASIPSPGVNYPNVQQCIAQ
VSGGDSAQIYSLINLFSGGALLQLTVFAVGVMPYITASIIVQLLTVVIPR
FEQLRKEGQAGQAKMTQYTRYLSIALAILQATSIVALAANGGLLQGCSLD
IIQDSSIFGLIVIVLVMTAGAALVMWMGELVTERGIGNGMSLLIFAGIAA
RIPAEGQTILESRGGVVFTAVVIAALVIIIGVVFVEQGQRRIPVQYAKRM
VGRKMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIQSGSSNPG
TGWWDKFVADYLTNPADPVYIAVYFGLIVFFTYFYVSITFNPDERADEMK
KFGGFIPGIRPGKPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLEIGNT
GSVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK
118473504YP_886109.1 RNA pseudouridine synthase [Mycobacterium smegmatis str. MC2 155]MRRPAASPKGLPERPGHEGIGPARLKVQGGRLVDELERRFGAGWKVRAGE
VFSRDGTVLDESTVLPPGSHVYLYRDLPDEVDVPFDIPVLYRDDDIVVVD
KPHFLATMPRGGHVTQTALVRLRRELDLPELAPAHRLDRLTAGVLLFTVR
RELRGAYQTMFARGDVQKTYLAHAEGVPKIALPATLRSRIVKHRGRLQAF
EEPGEPNAETYVEAVGDGLYRLTPRTGRTHQLRVHMASIGLPITGDPFYP
TVIDVAPGDFSRPLQLLAKRLMFDDPVSGARREFVSRRTLG
118473503YP_889049.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRRASSTLVKFGVFAVVMAVLTAFLFMTFSEYRGGSYAGYSAVFDDASRL
ESGDSVRVAGVRVGTVKNVSLQPDRTVLVDFDTERNIALTTGTKAAVRYL
NLVGDRYLELIDSPGSTRLLPAGSQIPKERTASALDLDLLLGGLKPVIQG
LDPQDVNALTSSLIQIFQGQGDTLSSLMSKTSSFSNTLADNDQVIGQLIE
NLDTVVDTLNRDGGKFSATVDRLEQLISGLSQDRDPIGTAVTQLDNGTAS
IATLLTQARPPLDATVDQLNRMAPLLDDHKVVLDRGLQKAPANYRKLARL
GSYGSWIMYYVCGISIRVTDLQGRTAVFPMIKQEGGRCAEP
118473502YP_890609.1 antigen 85-C [Mycobacterium smegmatis str. MC2 155]MRRGLSLVRALMLTVVLAAGLWTVSATSGAPARADGVEYLMVPSAAMGRD
IPVAFQAGGPHAVFLLDAFNAAPDVSNWVNAGSAMSTLAGRGISVAAPAG
GAWSLYTNWEQDGSKQWETFLTAELPGWLAANKGLAPDGHAVVGAAQGGT
AAVTLAAFHPGMFRFAGSLSGFLTPSATTLNGAITAGLARFGNVDANRMW
GPPQFGRWKWHDPAVHVQLLADSNTRLWVYSPGTLTCSDPAAMIGYCDQA
QGSNRQFYSDYRRVGGSNGHFDFPASGQHDWGSWAPQLAYMSGELVATIK
118473501YP_887275.1 NAD dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MTIETREDRFNRRIDHLFETDPQFAAARPDEAISAAAADPELRLPAAVKQ
ILAGYADRPALGKRAVEFVTDEEGRTTAKLLPRFDTITYRQLAGRIQAVT
NAWHNHPVNAGDRVAILGFTSVDYTTIDIALLELGAVSVPLQTSAPVAQL
QPIVAETEPKVIASSVDFLADAVALVESGPAPSRLVVFDYSHEVDDQREA
FEAAKGKLAGTGVVVETITDALDRGRSLADAPLYVPDEADPLTLLIYTSG
STGTPKGAMYPESKTATMWQAGSKARWDETLGVMPSITLNFMPMSHVMGR
GILCSTLASGGTAYFAARSDLSTFLEDLALVRPTQLNFVPRIWDMLFQEY
QSRLDNRRAEGSEDRAEAAVLEEVRTQLLGGRFVSALTGSAPISAEMKSW
VEDLLDMHLLEGYGSTEAGAVFIDGQIQRPPVIDYKLVDVPDLGYFATDR
PYPRGELLVKSEQMFPGYYKRPEITAEMFDEDGYYRTGDIVAELGPDHLE
YLDRRNNVLKLSQGEFVTVSKLEAVFGDSPLVRQIYVYGNSARSYLLAVV
VPTEEALSRWDGDELKSRISDSLQDAARAAGLQSYEIPRDFLVETTPFTL
ENGLLTGIRKLARPKLKAHYGERLEQLYTDLAEGQANELRELRRNGADRP
VVETVSRAAVALLGASVTDLRSDAHFTDLGGDSLSALSFSNLLHEIFDVD
VPVGVIVSPATDLAGVAAYIEGELRGSKRPTYASVHGRDATEVRARDLAL
GKFIDAKTLSAAPGLPRSGTEIRTVLLTGATGFLGRYLALEWLERMDLVD
GKVICLVRARSDDEARARLDATFDTGDATLLEHYRALAADHLEVIAGDKG
EADLGLDHDTWQRLADTVDLIVDPAALVNHVLPYSQMFGPNALGTAELIR
IALTTTIKPYVYVSTIGVGQGISPEAFVEDADIREISATRRVDDSYANGY
GNSKWAGEVLLREAHDWCGLPVSVFRCDMILADTTYSGQLNLPDMFTRLM
LSLVATGIAPGSFYELDADGNRQRAHYDGLPVEFIAEAISTIGSQVTDGF
ETFHVMNPYDDGIGLDEYVDWLIEAGYPVHRVDDYATWLSRFETALRALP
ERQRQASLLPLLHNYQQPSPPVCGAMAPTDRFRAAVQDAKIGPDKDIPHV
TADVIVKYISNLQMLGLL
118473500YP_887931.1 ComA operon protein 2 [Mycobacterium smegmatis str. MC2 155]MNAGIGKGFDSEIGLNYTELGPDGGRAELKITEKLLQPWGIVHGGVYCSI
VESLASVSGHIWLSENGGGTVVGVNNNTDFLRAIGSGTVTAVSTPIHRGR
RQQLWLITLTDEDGRTVARGQVRLQNMPAES
118473499YP_888620.1 hypothetical protein MSMEG_4345 [Mycobacterium smegmatis str. MC2 155]MWGHPVRGRRPLGIWARLSPPPAQQQTDEHSHDENDDQDEPHRRIDGHPQ
HVDVHPRAVLDDEHRGEGDEDQRHPIAQRGPWFGGGRRHLVAGHGTSSAL
LDTHDGSRRRGDHDTLPP
118473498YP_887362.1 carbamoyl phosphate synthase small subunit [Mycobacterium smegmatis stMTRNGKRGGEKAVLVLEDGRVFTGVSFGAVGQTLGEAVFSTGMSGYQETL
TDPSYYGQIVVATAPQIGNTGWNDEDGESRGDKIWVAGYAVRDPSPRASN
WRATRTLDDELVAQGIVGIAGIDTRAVVRHLRTRGSMKAGVFSGDALADV
DALLERVRNQPSMLGADLAGKVTTGQTYVVDPDGDHRFTVAAVDLGIKTN
TPRNFARRGVRTHVLPASATFDQIADFKPDGVFLSNGPGDPATADHIVEV
TREVLGAGIPLFGICFGNQILGRALGRSTYKMVFGHRGINIPVVDHITGR
VAITAQNHGFALEGEAGEKFDTPFGTAEVSHTCANDGVVEGVRLVNGKAF
SVQYHPEAAGGPHDAEYLFDQFIDLMAGEHHS
118473497YP_884745.1 2-nitropropane dioxygenase [Mycobacterium smegmatis str. MC2 155]MNPLPTAWSGRLVLPVIAAPMTSVSGPELVIAACRAGVIGSFPTHNATSP
EELDSWLRRITAQAGGGAPVAPNLVVHRSNARLQADLDCLIRHRVELVIT
SVGSPAAVVDRLHGIGAQLYADVASLRHAWAALDAGADGLVLLTAGAGGQ
TGWANPLAFLSAVRERFDGPLVLAGGIADGRSILAAQAAGADLAYVGTRF
IATSKSRASDEYRRAVVDSTLDDVKLSDRVGGIPASLLSAWLDRQADPEG
ASDGFAQDRLLSNGDAWSAGHSVSGVHGVTTVEELVAELAGQYQAARAEF
AALCEAGGPLR
118473496YP_886309.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MANSTHPAEPHIGSVASKLNWLRAGVLGANDGIVSTAGIVVGVAAATASR
EPILTAGIAGLAAGAVSMALGEYVSVSTQRDTERALLNKERRELREDPAA
ELDELAALYEGKGLSPATARAVAEELSDHDAFAAHAEIELGIDPTELTNP
WQAAMSSALAFTIGALLPLIAILVPPTTARVPVTVVAVLLALMLTGAVSA
GLGGAPKGRAVLRNVIGGGLALAITYGIGLAVGTAIT
118473495YP_885056.1 transporter [Mycobacterium smegmatis str. MC2 155]MTTEITRPPAPPSRPSESRKPSLPGLLHLVAIAAVLATIVSAWAIDFVPT
ALIDGSDNIVALLQRMIPPRLDDPARIGMLAVETLLMAVLGTTLAAIASV
PLAFLAARNTTPHPAVQAVARAVITFCRAMPDLLFAVLFVRALGIGVLPG
VLALALHSIGMLGKVFADAIEQTDAGPREAVRSTGVGYFRELLNAVVPQV
VPSWIAMFVYRIDINLRMSVVLGFVGAGGIGFALQDALRGLIYPRALGIV
CVILVIIAGMELLAIAIRRILLDPSRSNPLRDRIARFGLSGVLVGSCVAA
FVLLKINPLALFTWVFPSVGIFTRMVPPNFDALGVDLFTAAAQTVAIGVV
ATAIGIALSIPAGILAARNVSPHPALYWPARAWILVVRAVPELILAVVFV
AALGLGPIAGTCALAIGSIGFLAKLVADAVEEIDPGPMEAVRSVGGGWWK
TLFAAVLPQSMPALVGSSLYLFDVNVRTSTILGIVGAGGVGYLLFESIRT
LNFDVAGAIVIVIFVIVYAIERLSGWIRSRLV
118473494YP_887117.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MVPMRDQLVRALRVSGVVVPVMSLAVLTACTPMFAADPRYATDSGAHPQG
QPETTSAEPSGPPSIETPKSDLSWRDCTSRVFGDAGVPAIPGVTLDCANY
DADLDPLEGASGTLQIGVVRAKAADTPDDAGPIVMTTGSDIASSIQLPAW
LSRTGADVLKAHPIVAVDRRGTGMSGAIDCRDLYDRQEMLDQAQFQSGND
PVANLGSITMTATTSCTDTIAPGDSAYDNAHAAEDLERLRSTWDVPTLAL
LGVGNGAQVALAYAGAHPTKVSRLVLDSPLPLAIGAEAAAEQRVKGQQAA
LDAFAAQCVATGCPLGPDPKAAVDSLLADARAGRGPGGASVATVVDAITT
ALGFPRGDRVTATAELARTLAAARDGDPNPLTDLIAETETTRLTDGHFVN
SCSDALNRPTPDRVRELVVAWGKLYPQFGAVGALSLVQCLNWPSGSAPQD
PKELPVPVLLLGVQNDPIVGNEGVAAVAATIINAGANNRRVIWQGIGHGA
SIYDTCAIAPVTSYLDNGKLPETDTYCPA
118473493YP_885983.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKPDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDEEFAKTSWQ
LRKFLWAPKLGCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPF
FADRQWAGITDWRAELTPHYDQAQRMLGVVTNPTFTDADRVVKEVADDMG
VGDTFVQTPVGVFFGPDGEKTPGKTVPDPYFGGVGPDRTGCIECGSCMTG
CRYGAKNTLLKNYLGLAERGGAEVHPLRTVAGFEQLPDGTWRVDTVRTGR
WARKDKRSFTATHVVLAAGTWGTQRLLFKMRDTGKLPKLSSRLGVLTRTN
SESIVGAGRYEVTPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGL
LQTLMTDGDGPDGAGIPRWKQLLRNAAEDPRGTLRLLNVHRWSERTLIAL
VMQHLDNSITTYTKRNRLGIRRYLSKQGHGAPNPTWIPVGNEVTRRIAKK
IDGVAGGTWGELFNIPLTAHFLGGAAIGDSPETGVIDPYQRVYNYPTLHV
MDGAAISANLGVNPSLSITAQAERATSLWPNKGEQDQRPAQGEPYRRLAP
IAPVRPVVPADAPGALRRLPIEPVSSAG
118473492YP_890537.1 diol dehydratase reactivation protein [Mycobacterium smegmatis str. MCMIPAGLIAGIDVGNHTTEIVLARVTDGTVHPVGHGQAPTRGRKGSRESLE
GAAALLHRLEVDLQVRAEMLVLSAIRPVDTETAPLAPATVPHAPVRSLRR
PDASTPAGSGYAVGRHVPLAALKHDDRHDAVIVSVDATTDFEDAAAAITD
AVGKGANVVGVLAAQDDAVLIRNRIPIDVPVVDEVDLDGLAPDVLVAVEV
VAEGRAYRALADPIAVCAALQLGHENLRDIAEFTRELADSPAIALTPRTR
PPQPPAPDDDYVEFARDGEQVRYPPAQAHTILRREPPGSVVRIRLRSVPT
ADHEMAVDDAFFTDLAALDNGTWLRRGVADASGTVVALLAADHVADAAAT
LAELTGRPARTLASEPEAAARGARTTPGLPPDSVVCDIGGGTIDLVGAER
TVTAAGAGETITVAVAKMLGIPRALAERVKRTPAIRVEGPHVAHEEDGRR
LFLDAPAPAEAIGRLCTRGTAGLVPFSSRLAAEEWRSLRLAIKQETVAAN
IARCMKAFEKPPTALVLAGGGALDDELLRTVGESLRTAGVVVGRANIDGV
HGPRFAVASGLVHLYAESAGERGAQEVS
118473491YP_885631.1 hypothetical protein MSMEG_1240 [Mycobacterium smegmatis str. MC2 155]MNAAVLRMALQFGNGTHLDSREGIGRFGMGLPSASISQCKRVEVWSWQDG
PENALYSYIDLKLIEKQEMTEVPAPVVRKIPKEWLDVASEIGAKGTLVVW
SHLDRCMWRTAKTIIRNSEFVIARMYRKFLSDGRASIRLVAFTDTDGGNH
SIDDYAVANDPGYLLTPSSTPEPFSETPMFQPDGDKWSVPVEIEYNGEKH
TVFVRFSYAREVARTGHNPGSTPYGKHAARNVGVSLVRADRELDMDESLV
ISHDVTERWWGVEVDFPPSLDELFGVTNNKQSARNFSEVAANLDALTAEE
DGITSTARRDLMREDEDPLGPLIDIVSLIDRRLSAMRKLLKVQRKGSSGK
GRHRYDPDSAEAIATTITRERQQEGKHGVSDDGEGLPVEERTAVFKRELI
DTGLSEQQADDIAAKTIEPGVKYAFAEADLEGRSFFTVRPVAGEILIKIN
VNHPAYHNLVEVLEADVDGELTVEQLRERLLRAHRGLKLLLMAWARYEDE
QPSDARREEIQDIRTDWGRVAARFMRSE
118473490YP_888216.1 peptidase M52- hydrogen uptake protein [Mycobacterium smegmatis str. MMTVLVIGIGNEARRDDGVGIAAVHEIAQRRLPGVEAMVTSGDPGELLDAW
AGVPTVIAVDAAVSPSATPGTVRRWTPADLPRDLGGVSSHALGLAGAYRL
GEALGQSPGRLIVLTVDVVDVGYGFGMTDAVAGAVPDVVAVILREAGLHE
AVRDV
118473489YP_887915.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAAQHPHPLMAQLAALHHFRIYVDIAIVVVVLAMTNLIAHFTTPWASIAT
VPAAAVGLLALARARGWGWTELGLGREHWKTGAGYALAAVGVVLSVIAIG
ALLPWTRPMFMNDNYATLSGALIASMIIIPLQTVIPEELAFRGVLHGALD
RAWGFRGVAAAGSLLFGMWHIATSLGLTSSNVGFTRLFGGGILGTVAGVV
LAVVATGIAGFVFSWLRRRSGSLLAPIALHWSLNGMGALAAAVVWHIST
118473488YP_890613.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MRISLWLSVLVVAGLFGWGAWQRRWIADDGLIVLRTVRNLLAGNGPVFNA
GERVEANTSTLWTYLVTLGAWIGGSVRLEYVVLAFALALSVAGVVLVMFG
AGRLYAPSLQGRRALLLPAGALVYIAIPPARDFATSGLENGLVLAYLGLL
WWMMVCWSQALRAYPADGGAPQDAPDNVPGRFFEGALAFVAGLSVLVRPE
LALIGGGALVMMLIAARGWRRRVLIVVAGGLLPVAYQIFRMGYYALIVPG
TAVAKDATGSKWSQGLTYLANFNQPYLLWVPAVLLVLLGLVLVATRSRPW
WLHRQVPRGYGWVRRTVQSPPAVVAFMVLSGLIQGIYWVRQGGDFMHGRV
LLAPIFCVLAPVAVIPLVLPDGTRFTRETGYLLAAATSVLWVAVVGWSVW
AANSPGMGADATRVTYTGIVDERRFYSQATGHAHPLTAADYLDYPRMRAV
LTALENTPDGALLLPSGNYDVWDVVPAIPPPPDMTPEQRKAYKAPHTVFF
TNMGMLGMNVGLDVRVIDQIGLTNPLAQHTQRLTDGRIGHDKNLFPDWAV
AEGPFLKEHPFVPAYLDEDWIAQAQVALTCPATDAVLNSVRGELTPRRFL
SNIVHSYEFTKYRIDRVPLYELRRCGLEPPEPKNPPYTGMPATGP
118473487YP_888254.1 hypothetical protein MSMEG_3965 [Mycobacterium smegmatis str. MC2 155]MSIRTRRRIAILAGTLTVTALFAVGCQSSTEQEPSPPSTTTTTTTTTTTP
APTTTPAPPAPTEKGLSPTGGNLFTPEVKAPPAPTEPPGVHRHKN
118473486YP_888255.1 hypothetical protein MSMEG_3966 [Mycobacterium smegmatis str. MC2 155]MLVHRFDRRVLVACAGAALIAMTAACGDGDTSTPPTSGPTSEETSVTTTT
TTAPSSAPPEPAPPAPTEKSIDPTGGNLFTPGVHAPAAPTVPPGQHPGLH
GIP
118473485YP_888678.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473484YP_889626.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MKFTQYYLDCLSHASYLIADETTGRAVVVDPQRDVAGYLADAEEFGYTIE
LVIETHFHADFLSGHLELAKATGAKIVYSSVAETEFESMGVADGERYSLG
EVTLEFRHTPGHTPESMSVVVYEHSNDDVPYGVLTGDALFIGDVGRPDLL
ASIGFTREELAEKLYDSLRNKLMTLPDATRVYPAHGAGSACGKNLSTERW
STIGEQKQTNYALRAPDLATFMALVTAGQPAAPSYFVYDAILNRKDRDLL
DETEIPAAMRYEQVNQALRDGAILVDGRSPEEFATGHLRQAINIGLQGRY
AEFAGSVVPADVDIVLFTEPGEELEAKNRLARIGFDRVIGHLDRPFEVML
AHPDDVQMASRLTATAFDQRTAEVADLQIVDVRNPGEVADGAIPHAITIP
VGQLPARLGELDPAKPTVVYCAGGYRSSVAASVLRRNGFADVSDILGGYG
AWRDARQGV
118473483YP_888605.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKLEGKSAVVAAGAKNLGGLISTTLASRGVNVAVHYNSASTEADADKTV
AAVQDAGVKAVKVQGDLTVPANVEKLFDTAIDAFGGVDIAINTVGKVLRK
PIAETTEAEYDSMFDINSKAAYFFLQQAGKRLNDNGSITTIVTSLLAAYT
DGYSTYAGSKSPVEHFTRAASKEFGVRGINVNNIAPGPMDTPFFYPEETP
ERVEFHKSQAMGNRLTDIGDIAPLAVFLADEGHWINGQTLFTNGGYTTR
118473482YP_885950.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLFGEPSWPDHVSMSSPNRAGLFGGLGMTFVGGSVAVSGALAEAPLHTAQ
ALRYAIACLLLLGWVRLTGHPLRRPRGTEWLWLLGVTVSGLVLFNVALVH
GSRHAEPAVLAVAVACVPVALATVGPLLEGHRPHTRILVAAVMVSVGAVV
VEGLGRADAMGLAWSAVVFVCEAGFTLLAVPVLASHGPAGVSVHTTWLAA
VMFGVLALSTEGWRAATRFDAGAVPAIGYLAVGVTAIAFILWYTCVRGLG
TGRAGLLTGVAPVAAAVIGIPLTGAVPGVAVWCGVGLIACGLAVGLGVNA
ERGLVAHIRAKTRTEVDVRGEYPKSRG
118473481YP_886354.1 hypothetical protein MSMEG_1990 [Mycobacterium smegmatis str. MC2 155]MTAHLSTPYLRDMGAKAADLVASSLTPAAAAYLNQPVDHLASLPWPFADD
VTSFRYTVNVDPARVPRPTRAGEWGRHIVDLGGADYPVNMAERRHVLDTD
PQRVKVRPGMELACWDLLIYYLRDLAQSYPDLLHLDEDGDHFHWRNDLLG
TDQHFVLGDTGTLPGGPLFFLAAEIPDDLLLVIERDGRLYFDAGAVTFAA
AWSASFDIGMDMYEIHGPVPRMTGEGMTARAEQFLKRLPANQVYRRLNWN
LAASPTRTFDISLETLPDWGTHMPRALRDGDVSQVQFRIELEHFIRLPMT
GAVTFNIRTFMASLEEIRAIPEYAEQLAAIIEELPDDIATYKGFADYQDD
VVAYLRR
118473480YP_890334.1 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase [MSDRLTRRGGSPRSIESRGSMRPTRWRRSTHVAVGVAVLALVVAVVAAAA
LFTGKHSDAAEAVPPAPPPATADPGVVPVDLSAPTPTRRGLATALAAALA
NPDLGLITGRITDADTGAELWEQGARVPMQPASVNKVLTTAAALLTLDRD
ARLTTTVVAADDQPGLVVLRGGGDTTLSAAPKGTDTWYKGAARISDLADQ
VRARGIRVTRVRVDTSAYSGPTMAPGWDPADIDGGDIAPMESVMLDGGRT
QPTTVESRRSKSPALDAGKALAAALGVEPESVTLMPSGMRGGTTIAEVQS
APLIERLRQMMNESDNVMAESIAREVAEALGRPQSFEGAVGAVLTQLRSV
GIDTSGAKLVDSSGLSVDNRLTALTLDEVVNAAAGHTQPALRPLVDLLPI
AGGSGTLSNRYLDTDAGRAAAGWLRAKTGSLTGTNALAGIVTDRSGRVLT
FALISNNAGPTGRTAIDALAAVLRSCGCGA
118473479YP_887939.1 ABC transporter ferric iron-binding periplasmic protein [MycobacteriumMSLMSKVNSVRSVAVVATVAAAAALTLGACGSGSDEADSADKIVVYSGRS
ENLVAPLIEKFTSDTGIEVETRYAGSGELAAQLITEGDKSPADVFLSQDA
GALGAVSEAGLFAPINDEAMAAVPANFSAADKSWLGVSGRARVLVYNPDI
APNPPDTIDGLLAPEWKGKIGFAPSNASWQSFVTGLRVIRGDDGARQWLE
AFKAQDPQPYENNVAVRDAVDAGQIPLGVVNHYYLYELVDAKGEQAVKAR
NKFMAPGDPGGLINVAGVGVLKSAANPEGAQAFASYLIGKSAQEYFAGET
KEYPLIEGVEPSGEMPQLSELQPPAVDLSQLSDLEATQELLVETGLLTN
118473478YP_886616.1 peptidase M52- hydrogen uptake protein [Mycobacterium smegmatis str. MMVGCGNLLRGDDGVGPVLVRHLWERGVPAGARLVDGGTAGMDVAFQMRGA
ERVVIIDAAATGSAPGTVFRVPGEELAELPPLQGLHTHSFRWDHAIAFAR
WALADDCPTDITVFLIEAENVDFGAELSERVSAAMEEVIALIERDYLGPL
RPQAADEVEVEITEDGYLRLTADVAAARFPSDAVAAMVRDDDLWVIPLRG
PRSGGLLLKQRNPAGDRSVLIAEVLRDQTRVEVRETLLSGPHRAFWDDEK
SALRIPIPADLREAR
118473477YP_885027.1 hypothetical protein MSMEG_0616 [Mycobacterium smegmatis str. MC2 155]MTGPVNPDDRRSFSSRTPVNENPDGVQYRRGFVTRHQVSGWRFVMRRIAS
GVALHDTRMLVDPLRTQSRAVLTGALILVTGLVGCFIFSLFRPGGVPGNN
AILADRSTSALYVRVGEQLHPVLNLTSARLISGSPDNPTMVKTSEIDKFP
RGNLLGIPGAPERMVQNAATDAEWTVCDAVGGANPGVTVIAGPLGADGER
AAPLPPDHAVLVHSDAEPNPGDWLLWDGKRSPIDLADRAVTDALGLGGQA
LAPRPIAAGLFNAVPAAPALTAPVIPDAGAAPQFELSLPVPVGAVVVAYD
ADNTARYYAVLSDGLQPISPVLAAILRNTDSHGFAQPPRLGPDEVARTPM
SRGLDTSAYPDNPVTLVEASAHPVTCAHWTKPSDAAESSLSVLSGAVLPL
AEGLHTVDLVGAGAGGAANRVALTPGTGYFVQTVGAEPGSPTAGSMFWVS
DTGVRYGIDTAEDDKVVAALGLSTSPLPVPWSVLSQFAAGPALSRGDALV
AHDAVSTNPNSARMEASR
118473476YP_891050.1 C4 decarboxylate transporter [Mycobacterium smegmatis str. MC2 155]MTLLKQIWRGLDTVFEALGLLCLCAVLLVVLWQVWDRQVLGSTPGWTEET
ARILMVWIGFLMTALGFREGAHIALTFVVDRFPPATRRIVEWLSPLLALL
FGLYLIYQGISFAAATRFATLPGTGLPRSVLYVVLPVAGAMICLYTVLQV
FGVKTQRYLGTPADDAPID
118473475YP_889754.1 hypothetical protein MSMEG_5517 [Mycobacterium smegmatis str. MC2 155]MNNGPVGTRQARELLRVAFGPSVVALVIIAAVVLLQLVIANSDMTGAFGA
IASMWLGVHQVPVSIGGRELGVMPLLPVLAMVWGTAKTTAAATAPNSSWF
VTRWVVASALGGPLLIAALLLAVIHDAASVITELQTPSALRAFGGVLAVH
AIGALIGVSTKIGRRTLAASPLPKWLPDAVRAASAGVLALFALSGIVTAG
SLVVHWGTMHDLFAITDTVFGQLSLTGLSVLYIPNVIVGTSAIAVGSSAH
IGLATFSSFTVFGGDIPAVPVLAAAPTPPLGPVWVALLIVGAASAVALGQ
QCAARPLTPFAALAKLIVASLISAVTMALLGYAGSGRLGNFGHVGVDQST
FGPAVFLWFVGIGGLTVVMSGGIVRRVRVAPAAPPPAPEPEPEPVVPGEV
LGEPAEADEPDDEPFGDEPYEETPEEPLVSWHADEPPEPAETDDDAGAPV
APRSPRDLLDEDPEDHFFVDEFGDEEVSGDKPRNAED
118473474YP_886678.1 amino acid carrier protein [Mycobacterium smegmatis str. MC2 155]MSEFLDLINSYVWSSWLVYLCLAAGVYFSIRTRLLQIRQVPEMIRLMVKG
EKSPSGVSSFQALTMSLAGRVGTGNIAGVATAIAFGGPGAMFWMWAVAFL
GASTSFVECTLGQIYKARDQLTGEYRGGPAYYLSRALEHTRAAGVFKVYG
LLFAAVTVLACGLLLPSVQSNSMAAAMNSAWGFSTWWVGVGIVIVLAFVI
IGGVKRIAAFASIVVPFMAVVYIVLALIIVVVNVSAVPEVLRLIFASAFG
LDSAFGAIIGSAVMWGVKRGIYSNEAGQGTGPHAAAAAEVTHPAKQGLVQ
AFAVYIDTLFVCSATGFLILTTGAYRVYEGESETGAVLAEGGMLPSDITV
GPAFAQAGFDTLWSGAGASFVAVSLAFFAFTTIVAYYYMAETNLRFLLGK
SATIPVPIVRGTVGSNATMLLQALILVSVVTGAISTATDAWTLGDIGVGL
MAWLNIIGIIILQRPALAALKDYEKQQKAGIDPVFNPLSLDIVGATFWET
YDPKGRHERTTTSA
118473473YP_889213.1 peptide synthetase ScpsB [Mycobacterium smegmatis str. MC2 155]MTSSRQDHTATETATLVRPVDALERLFYRYSDRNPVHFMLVAEFDDVLDE
DAVRSALELLSRRHPLLQVHVEDRQGGRLGFHRIENPEPVPLRVVETTNW
QAVAAEEFVEPFDRSRAPLMRAVLLVDATSSALLLTIDHTIGDGISTIQA
LRDVLAVLNGETLPVLPVPPSQEVMLENVFGPRQQWTLVTPPDPDPRMLR
PTSVREFDGTPTTIHSLAIPAHDTAALLRRCRAERTTVHAAIVTAASRVR
NRWGGEDFVRVLSPINFRSLIRADDEVAPYFSCVITGMAPQDGASFWDQA
RNVTADLAAARSAPRTLAASAGVQQLIGVDADTATAEEVFTRAIPFDLLI
TNLGIQDLEGTGPLRPTAVWAPVLESQIAGNVVIGITTYAGVLRMVACGY
APVQEFLEPVAQTLVDESA
118473472YP_885523.1 D-amino-acid dehydrogenase [Mycobacterium smegmatis str. MC2 155]MVGFGRIDGGPRSAIVVGAGTVGLSAAWFLQERGVAVTVVDRVGVGTGAS
WGNAGWIAPALTIPANSPAMLRDGLRSLFDSQAPLHIPLAADSELANFLI
QFAANCRRASWKRAMRANVPLNEESLEAFDVLFANGVDAPLTDAPITALF
STTAEAERMMRDLRALEDAGQTVSVSGLSGQQLREQVPLTSPAVAAALNV
NGQRYVDPGRFVQALRRAVEERGATMRTMEVSDVLSSGNGVQVYPRIGKW
LTADVAVVATGAWLPRLAGSRITVPVQAARRYSFTVPVDRPIPTPIYLPE
AGIACTPHKGALRVTGATELRDPYEPAMPSRVGAMVAAAEPLLEGVRWAE
RSDIWVGPGALTPDGRPLIGEMSRGVYLAGGHGMWGLAHGPVTGRLLAEY
ITTGKQPEALRPFDPLRRTGADP
118473471YP_884739.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MSNDGMWGVLPDVLDRACAYYGERTAILDAATGASVTYRELGQWRNQIAH
ALIDNGVQKGERVGLLMPNCLEFIPIQQAIWAAGAVLVQMPTRAAAEGFK
SNLAQTDATTLLYHAKFEDAIASIRDGLPKLQTLIRVGTAENEKSVDALD
FATLVAGQPTHRPQVDIDEHDEAYVLFTSGSTGEPKGVVNSHYTWSYYSI
SAGLEIGDIRFGEVFAHGAPLTHFTQIFVLPTFVRGGTNVMLPGLEPESL
LTFIERHGVTAVALVPTIIYLLLDHPRRSEFDLSTLQTVVYAGSPIAPER
LRQALEVFGPIFIQTYAGTEPGYVACLRKPEHVQREGESVEEWTARLAAA
GRPMFPVRVSVQDENDRILPVGEVGEICSQQLGQMLSYLDPARNAETLRD
GWVHTGDVGYLDHDGYLYIVDRKKDMVVSGGFNVFPRQVEDALATHPAVA
QSAVIGVPHEKWGEAVMAVVVPQSGEITGPELESELIKHVKAALGSVAAP
KTVLFADSLPLNPAGKVDKKAIRKPYWRNQTRQVG
118473470YP_889456.1 hypothetical protein MSMEG_5211 [Mycobacterium smegmatis str. MC2 155]MSAERSTVGFNFLAEPELPAPQVSEAQAEQILATHYGLQAKAASLGSQQD
KNFLVTQGDETVGVLKIANPAFNETELEAQDLAAELIAAAEPTLRIAVPI
PNVRGEKRTAVTGLLESRQATAYVRLLRFLPGDALMQRGYLRPSTVAELG
ALAGRVTRALAEFSHPGLDRILQWDLRYGAEVVATLASHVDDPARRDRLE
ATTRDAWARIEPFADSLPHQAIHMDLTDANVVVSHEPGGVVRPDGIIDFG
DLTDSWTVGELAITLSSVLQHPGATPTSVLPGIRAFHAVRPLSVDEAMVL
WPLLVLRTAVLNVSGAQQAAIDPDNAYVTENADGEWQMFEAATSVPLDVM
TALITADLGFDCAAPELGALTPMITGLEADAVTTLDLGTVSDTLDSAFTR
GGWVRSDIENELARAALADGARVVLTQFGQPRPTRAPALSHDEPAVVPTG
ITMWCAEDVALTAPFEGEISRDGDSVTLRGNTCELTLTGVSGDADTFGVA
RAGRPVEVALRPVGAPVAPALVTPSLAPGWLAWSVDPRPLFGLPALATDS
TDADLVARRDRAFAPVQEHYYDEPPRIERGWRHFLMSTSGRCYLDMVNNV
TVLGHAHPRIAEAAARQLRKLNTNSRFNYASVVEFSERLASLLPDPLDTV
FLVNSGSEASDLALRLAIAAAGRPDVVAMREAYHGWTYGTDAVSTSTADN
PNALETRPDWVHTVESPNSFRGKYRGSDVGRYADEAVAQIQELAAAGRAP
AAFICETVYGNAGGMALPDGYLEKVYAAIRANGGYAVADEVQVGYGRLGE
WFWGFQQQGVVPDIVSMAKSTGNGYPLGAVVTSRAVAEAFRSQGYFFSST
GGSPLSCALGMTVLDVLGEERLQENASRVGAHLKSRLLALSDKHPIIGTV
HGVGLYLGVEMIRDPATLEPATEETALICDRMLELGVIIQPTGDHQNILK
TKPPLCIDTESADFYVDTLDRVLTEGW
118473469YP_886277.1 catechol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MTTFEAPHIEKIELAEKAGKATAAASGASATERFHLDKSPFDAVRDVPAE
RVDLLAREVLDAVHATIRRHKVTYEEYNALKAWLINVGEDGEWPLFLDVW
VEHVVEEVATAHRHGNKGSIEGPYYVPDSPELGADATMPVRPGEAGTPLV
WEGTITSTDGRPLAGKVELWHADSEGFYSQFAPGIPEWNLRGTISTGDDG
AFRITTMRPAPYQIPTDGSCGKLIAAAGWHAWRPAHLHVKVSAPGHELLT
AQLYFPGDPHNGDDIATAVKPELMLDPQPQPDGSEKVRYDFVLDPES
118473468YP_889779.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MRRGETLPIYNRIAVLRAERRMSRAELAGLINVNPQTVGALERGDHYPSL
DLAFRICDVFGLPVEAVFSRTAFTPLSTELYGRTGQPEGSADD
118473467YP_889087.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTPPQGQAEAARPYETLLAKGEDRRQRILSVAERLLARNGWRNTSLAQIA
KEAGVTTAGLLHHFESKEHLLNAVLDARDLDDDAHADRSGDLADEIKRVA
ERFVRAPELVGTFTVLLVENIQPDAPLHDRLLKRQQDARDIVADIIRRGQ
RSGRYRPDFDPVIKAVEILAFVNGMETSWLLDPSLPLQDVFKGYAEMLAR
EIELT
118473466YP_886170.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMDDEVIARRVFSAGVIGTALEWYDFILYGTASALVFATVFFPEEDPALAT
LAAFATFGVGFLARPLGALVFGQLGDRIGRKKVLILTLVIMGVASALMGV
LPGYATVGASAPVFLVVLRLVQGFAAGAEYAGAGTMAVEFAPPKRKGIMG
AAPGIGAAIGSVLSAVAFTIPAAVMPHDAFLLWGWRVPFILSVVMLGVAV
YVRRRVLEVPGFESDRESGARQLPIVALMRQSPRNLVLGILASFGPNIGF
YVPIVFGTSYAAQHGGVTAADLTTIHMVVYLIGIGITVFSGFLADRWTKR
GTFILGALITAVSALPFFWLIESRSLPQIWAAFLLFSIGFYVMAGAQGAL
LASLFTRRTRFTGVAVSREFSAAIVGGTAPFIAALLVAWGGPLPVSIYAI
ALLVLCALAAYGTVAQDDSEHNDSAVPTLTESKNKEATWLTS
118473465YP_890940.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MASHTTQHPRPSTAVTDDQWLQTYYLLRAAVAGVWVAAAFIVGTQVSTVA
AVLLLIYPAWDAVANYIDAQRTGGLTQNPTQSLNVAVSLLTTVAVAIGLA
MSMNAVLGVFGVWASLSGIFQLATGVRRWKGHGAQWAMILSGAQSALVGV
TFLKQANAPEVPGIADIAPYAAFGALYFLISAVWLLVAEARRRLPA
118473464YP_888436.1 transposase [Mycobacterium smegmatis str. MC2 155]MTALDPNSTLGLLGRLMAGVRSEFRRDVLEFAADDAVFGGGSCRVTDCGR
SARGHGLCQGHHQRWANAGRPDLEEFTVSTDPRWRKHRPNQACRVDGCGY
GSARGGLCQLHAQRWERAGRPHLASWLRDPLPVKQPRPGATCRIRHCSLW
PQAESPLCHSHTNTWKANGRTDIDGFVTRFESNDTPANETIQLGMLTPQL
KLEMQYVLQQRHDDRRGKLTPTVVARVVRLLIDTATTSLLDFDADEWRQR
SAVLLNDTRSRGLLLYAHSTVLDLAEAGGWEAEYPRDVWRMHRLGYEGHY
TLRFDRIPQPWLREPAKRWIRLRLSRGLNLEAGGGRPLLAIARFGRFLAE
VDIEDISRIDRELLERYLAHLNREYSPQRRGAHIGLLNGFFAAIRQHCWA
TGLPATAMFFAEDHPKRGEHLPRALAEHVMTQLEHRDNLDRFNNPVYRLI
TVILMRCGLRITDALRLRGDCVTTDANGAPYLRYFNHKMKRDALVPIAPD
LVDMIGYQRRLVSERWPDGTALLFPRPTKNIDGQIPLAIPTYREALHRWL
AVCDIRDEHSDPVHLTPHQWRHTLGTRLINRDVPQEVVRRILDHDSPQMT
AHYARLHDTTVRRAWEAARKVDSHGREVNLDPDGPLAEAAWAKQRLGRAT
QALPNGYCGLPVQQSCPHANACLTCPMFLTTQEFLPQHRTQREQTLHLIT
AAEARGHQRLAEMNRQVLGNLDAIITSLDTPTDPKAAEHAS
118473463YP_886655.1 hypothetical protein MSMEG_2307 [Mycobacterium smegmatis str. MC2 155]MSLAENVQFGIFTPPHQVDYADLLRVWTEADEIPEIAHAWLFDHLIPIAG
DVTGPVLEGWTLLSALAAQTKRLRIGLMVTSNRFRPPSMLAKIATTVDIV
SGGRLDFGIGSGSRPGHPVARHEYISNGLPYHDADHAVASLAEACTLIRR
LWAEEEPFDFDGGFYRLERAFANPKPVQRPHPPIVIGGRAKATLRVVAEH
ADVWNIPGGDIEDMVRRSEMLDSYCAEIGRDPKEIARSTVLGVSYDQPGQ
TRAAVKEAVDAGFGHIVLMLPTPYPDNVVRWGVDEIVTPTAS
118473462YP_887817.1 hypothetical protein MSMEG_3513 [Mycobacterium smegmatis str. MC2 155]MITPRTLHTITDDDWTRIALLARFAFGDIEPEQTQAAWRSMVPEDATVVV
PDETDDAFVGQSLYLDMQLTVPGGEVLPVAGISFVAVAPTHRRRGVLRAM
YTELHDRIARAGYPLAVLTASEGGIYGRFGYGVATIEQHVSVDRRLAQFH
PAAPDPGGVRMLVPADHRDGLADIYDRWRRRTPGGLVRPDALWDDLLADR
PESRRGGGELFAFGHQDGYALYRVDRGPDGRRSAHVVELTAVTADAHAAL
WRALLGLDLIDRVSIGTHPHDPLPYLLTDPRQAQVTASADDLWIRIMNVP
AALEARRYQADLDVVLDVADGFRSDGGRFALQISGGRARCTTTDAPADIE
IDLDVLGGLYLGAHRVDGFAAANRLRSKDSELLQQFGAAFAGDMPAELGY
GF
118473461YP_890647.1 hypothetical protein MSMEG_6434 [Mycobacterium smegmatis str. MC2 155]MGLFTRRKSRATRRAEARAIKAKAKLEARLAAKNEARRIKADRKAEQKAL
KAQLRAQRETDRNALKIAETQLRAAREGKLLSPTRVRRLLTVTRLLAPVL
VPVVYRAAIAARGAIDERRADQLGVPLSQLGQFSGHGAQLSARIAGAEQT
LRLVAEKKPKDAETKQFVAAINDRLTDLAAAVTAAENMPSARRRGAHAAI
SAQLDGIDADLMARLGLV
118473460YP_890572.1 hypothetical protein MSMEG_6357 [Mycobacterium smegmatis str. MC2 155]MLGVLPQLRSSWSLLPQHSLFAWWCCHVYLRTDGTQRVISRLSKN
118473459YP_886473.1 glucose-6-phosphate isomerase [Mycobacterium smegmatis str. MC2 155]MKPGTFVKVPAHARHNLTNTGTDDLVFLVIYDSAEPRLSRGPAESLSGQT
VSSR
118473458YP_884788.1 phospholipase D [Mycobacterium smegmatis str. MC2 155]MMAGLADWFLTAEERGNPHTSLPDWFTGNNVEVLVHGATYFDRLTDEVEK
LGRGDHLFFTDWRGDPDERTRDGGPTIAELFCRAAQRGVVVKGLMWRSHL
DQFAYSEEQNRHLGEAIERAGGEVLLDQRVRIGGSHHQKLVVLRHPASPQ
RDVAFAGGIDLCHSRRDDAGHRGDPQAVPMGRQYGDHPPWHDAQLQIRGP
AVGALDLTFRERWTDPAPLDMLSPIAWITDKLRRSDLSADPLPGRPPDPP
PCGTQAVQVLRTYPDAHFEYDFAPRGERSIARGYTKAVLRARRLIYLEDQ
YLWSKQVSRLFAAALAANPDLHLIAVVPRHPDVDGRLSLPPNQVGRQQAI
ATCRRAAPDRVHVFDVENHKGTPVYVHAKVCVIDDVWASVGSDNFNRRSW
THDSELSCAVLDDEREEREPRDPAGLGDGARVFARELRLKLLREHLDLDG
KNDDAALIDPSDAVAAVNASANALQAWYDSGRTGPRPPGRLRPHRPERLG
LLTRAWAEPVYRAVYDPDGRNYRDRLRRYW
118473457YP_885818.1 30S ribosomal protein S10 [Mycobacterium smegmatis str. MC2 155]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
118473456YP_888472.1 phosphoglycerate mutase [Mycobacterium smegmatis str. MC2 155]MTVILLRHGRSTSNTAHTLAGRSDGVDLDDRGREQAEGVVSRIGDLPVRA
IVRSPMLRCERTIDPLATALGLQPIVDERLTEVDYGSWTGRKISDLLKEP
LWSVVQAQPSAAVFPEGEGLAQVQARAVAAVRERDRALAAEHGADVLWVA
CTHGDVIKAVLADALGVHLDGFQRITADPASMSVVRYTELRPFVMHINHT
GPQLSAGLAAEPKTDAVVGGSTD
118473455YP_885748.1 hypothetical protein MSMEG_1362 [Mycobacterium smegmatis str. MC2 155]MRAVAARVAGSAVFVDEIDERERRLRASNLASALPRPGTSEGRQLRRWLT
QLAVAERVVAAEVAGDVAPAEGELLPDTAARLEIGSVAASLLASAHARAV
FMRVTASVSVTDADVAAYHARNPLRFAPRPDVDADGWRGRPVAPPLADVE
NAVRQHLLAAARRREFRRWLDESCAKLVGLAPGYEHPGDPRQPDNTHRH
118473454YP_884735.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]METGGRGQPLHGRAAECDALRRSIADVQSAQSRVLVLRGEAGVGKTALLD
FAAQHAKGFRITQVAGVESDMELAYAGLQQLCAPLMNNLDDLPEPQRDAL
AVAFGLGVGQTPDRFLVGLAVLSLMAAAADEKPLLCIVDDAQWLDSVSVQ
TLAFVARRLLAEPVGLIFAVRDHGAPALAGLPELLVDGLSDTDARELLDS
VILGRLDERVRDRVVAETRGIPLALLEVPRTIPAAELAGGFSTIAGRRSA
GRVEDSFTSRVRSLPDEARQLLLLAAAEPIGDAALFVRAAAHLGVAVPAL
APAESAGLIEFGTRIRFHHPLVRSAAYRAASVEDRRAAHHALAEATDAVT
DPDRRAWHAANAAAGPSDAVATELEASAGRAQTRGGIAAAATFLERAAVL
SADLHLRGARAVAAAQAKRDAADLQAAYELLAIAELSPLSDLQRAQIARL
RAQMEFSHSRREDSGPAQLRDAAAMLLDAARRLESLDDELALQTHLEAIA
AAMYAGHLGAPDALLTTAAAAQAAVDRLASRDDPIALLLDGVAKCLTGDV
GDAAVPLRKALTAWCSAAQHGDGAVLPWIFVGYPIVQESAVDELWDDTLM
ERLADAMVRYTRDAGALAILPAALSCRAGAHLLSGEFGTAGNLLDEANAI
AVAIADQPLRYHRLHLAAWRGSTAETIAMIDSATAMAHRNGEGRLLAVLG
YFAALLYNGAGRYEEAYAAIRPACSTKNLGFGGWSLVELIEAAVHTGRRE
AAEEAADRLAAQAGASGTDWGLGALAGARAMLADHDTADALFTEAIERLQ
RTRIAVELARTHLRYGEWLRRVNRRPDARRHLGVAFDMFTRMGAAGFAER
ARRELTATGEKVRKQPVSSGDELTAQEAQIARLAADGLTNQEIGSQLFIS
THTVEWHLRKVFVKLGIGSRRQLRTIEWAG
118473453YP_890802.1 hypothetical protein MSMEG_6590 [Mycobacterium smegmatis str. MC2 155]MSDHQHIVDVLTRYATGIDRRDWRLFRTVFTDDCAIDYGEIGAWNSVDAV
TDFMEQTHAMAGHTLHRLSNHVVTVDGDTAEARTYVDALIMSQDNASGVN
AAGFYDDDLVRTSDGWRIARRRFTSVRVAAV
118473452YP_889787.1 stas domain-containing protein [Mycobacterium smegmatis str. MC2 155]MTRSRSPITISVTSRGEITLLTVDGVLDSTTYREVRDTVIKAALSEPRAV
VVNVSRLVVPTETAWSVFTSARWHVCVWPDVPVLLVCDHQQGRASLWRNG
IQRYVPVCSTLDEACATVLADRMSPLRRRARAHLPAVHSSVRRSRELVTD
WLLNWSLTKYIPVTCVVTDALVENVLEHTLSAPKIMLENRGDTVSIAVED
ESPAPAVRHEDPYRGGGRLSGLALVASIARSWGCTPTTTGKTVWALIGPE
SCF
118473451YP_891040.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MCPDWREREAFCSGPGELLDALIDHWEQHGDRDRLHYERFQPKIGGDAGA
GNGGTVTFLDSETTAECGGGTPILEAGEQAGLKLAYGCRIGICHTCTGTV
RSGKVRDLRSGEIAEPTGQDVRICINAAEGDVEIEL
118473450YP_888578.1 fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 155]MKIEDYLDADGNIAIPDGVTLTSYFDRNVAELADTPAYRYLDFEHDGRVV
ELTWKELDTRVRAVGARLQQVTKLGDRVAILCPQGVDYVVSFFAAIQAGA
IAVPLFSPELPGHAERLEAVLADATPSVVLTTTAAAEAVGAFVRKLPHAG
RPRMIAVDAVPAAVGATFTPAQLHTDGIAYLQYTSGSTRTPAGVEITHRG
VCTNVLQMIISVGLDWNIRSVSWLPLFHDMGLLMIMFPALCGGHITLMSP
VSFVRRPYRWIKELGASDVPTFAAAPNFAYELAAHRGLPPAGDELDLSNV
AGLINGSEPVSMASINVFNEAFAPYGLPPTAVKPSYGMAEATLFVSTIGP
AAHPSAVYLDREELGAGRAVEVPEDDPRAIAQVSCGKIARSQWAVIVDPN
SDTGAELPDGHVGEIWLYGDNVGKGYWGRPHETEVSFHNKLQSRLPQGSH
AAGAPDGAAWFRTGDLGMYLGGELYITGRIKDMVIVDGRNHYPQDLEATV
AEASSQVRAGYIAAFSVPSEHGERLVIVAERAPGAGRADPAPIVDAIRAA
ISKRHAVAVHDIKLVAAGSIPRTTSGKLARRACQAQYLAELQTS
118473449YP_891111.1 hypothetical protein MSMEG_6914 [Mycobacterium smegmatis str. MC2 155]MPPDPSFAPTQLAARAAYLLRGNDLGTMTTAAPLLYPHMWSWDAAFVAIG
LAPLSVERAVVELDTLLSAQWRNGMIPHIVFANGVDGYFPGPARWATQAL
AANAPRIRHTSGITQPPVHAIAVQRILDQARNRGRSTRAVAAAFLDRRWS
DLVRWHRWLAEKRDPDGHGRITLYHGWESGMDNSPRWDSAYANVVPGNVP
EYQREDNTIVTDATQRPSDLEYDRYLWLLEEMKSVRYDDDLLPKVMSFAV
EDVFVSAIFSVACQVLAEIGEDHKRPHADVRDLYAWADRFRAGVIDSTDD
RTGAARDFDVRAGRWVATETVAQFAPLLCGGLPHDKERTLIKRLEGPRFC
GHPDLRYSVIPSTSPVSRDFRPREYWRGPVWPVMTWLFSWCFARRGWAER
ARLLRQEGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
118473448YP_888461.1 arabinose-proton symporter [Mycobacterium smegmatis str. MC2 155]MNVIGITLLPRGRIMSHGPVSDDTPSIFGDDDQAASSGRTAVRIAAVAAL
GGLLFGYDSAVINGAVDSIQEDFGIGNYALGLAVASALLGAAAGALSAGR
IADRIGRIAVMKIAAVLFFISAFGTGFAPETVTLVVFRIVGGIGVGVASV
IAPAYIAETSPPGIRGRLGSLQQLAIVLGIFTSFVVNWLLQWAAGGPNEV
LAMGLDAWRWMFLAMAVPAVLYGALAFTIPESPRYLVATHKIPEARRVLS
MLLGQKNLEITITRIRDTLEREDKPSWRDLKKPTGGIYGIVWVGLGLSIF
QQFVGINVIFYYSNVLWQAVGFSADQSAIYTVITSVVNVLTTLIAIALID
KIGRKPLLLIGSSGMAVTLATMAVIFANATVKPDGTPDLPGASGLIALIA
ANLFVVAFGMSWGPVVWVLLGEMFPNRFRAAALGLAAAGQWAANWLITVS
FPELRNHLGLAYGFYALCAVLSFLFVSKWVEETRGKNLEDMHAEALGH
118473447YP_887301.1 periplasmic binding protein [Mycobacterium smegmatis str. MC2 155]MRVRGRATIRRSALATGSVITVAGLLLAGCGSKASETDAANAESCVDTSG
PTIKVGSLNSLSGTMAISEVTVRDAIKLAVEEINADGGVLGKQIELIGED
GASEPTVFAEKAEKLISSDCVAAVFGGWTSSSRKAMLPVFESANALLYYP
VQYEGLESSPNIFYTGATTNQQIVPALDYLKEKGVKSLYLVGSDYVFPQT
ANRIIKAYAEANGIEIKGEDYTPLGSTDFSTIVNKVRSANADAVFNTLNG
DSNVAFFREYRNVGLTPDTMPVVSVSIAEEEVGGIGVQNIDGQLTAWNYY
ETIDTPENKAFVKAYKDFVKDPKKPTSDPMEAAYVSVYLWKNTVEKAQSF
DVKAIQDNADGVSFDAPEGKVTIDGENHHITKTARIGEIRPDGLIYTVWE
SKGPIEPDPYLKSYPWAAGLSS
118473446YP_889458.1 hypothetical protein MSMEG_5212 [Mycobacterium smegmatis str. MC2 155]MRSIWKWVGLAGVAGVVAGGVLVARDQRRRKAYTPEDIRARLHERLAEAN
GADSA
118473445YP_884819.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSHYKSNVRDQVFNLFEVFGVDKVLGADKFSDLDADTAREMLTEIARLAE
GPIAESFVEGDRNPPVFDPETHTVTLPEGFKKSMRALFDGGWDKVGLAEH
LGGIPMPRALQWALIEHILGANPAAYMYAMGPGMSEIFYNNGTDEQKKWA
TIAAERGWGATMVLTEPDAGSDVGAGRTKAVQQPDGTWHIEGVKRFITSA
DSDDLFENIMHLVLARPEGAGPGTKGLSLFFVPKFHFDHETGEIGERNGV
FVTNVEHKMGLKVSATCELSLGQHGIPAVGWLVGEVHNGIAQMFDVIEQA
RMMVGTKAIATLSTGYLNALEYAKERVQGADMTQMTDKTAPRVTITHHPD
VRRSLMTQKAYAEGLRAIYLYTATFQDAEVAQAVHGVDGDLAARVNDLLL
PIVKGFGSETAYAKLTESLQTLGGSGFLQDYPIEQYIRDSKIDSLYEGTT
AIQAQDFFFRKIIRDKGQALAYVAGEIEQFIKNENGNGRLKTERELLATA
LADVQGMAASLTGYLMAAQEDAASIYKVGLGSVRFLMAVGDLLSGWLLAR
QAAVAIEKLDAGATGADKSFYEGKIAAASFFAKNMLPLLTSTRQIIENLD
NDVMELDEAAF
118473444YP_889564.1 glutamine ABC transporter permease/substrate-binding protein [MycobactMLAVAALVGLIPMVAPATASAEGETYVVATDITFAPFEFQDASGKFVGID
IDLINEIAADQNFTVTIKPLGFDAALQAVQANQADGVIAGMSITDERKKV
FDFSDPYFESGVQMAVLASDDDIKSYEDLRGKRVAVKNGTEGAEFAESIK
DKYGFTTVYFADSASMFDEVRTGNSQAVFEDYPVLQYGIAQGNGFKTVTP
KEKGANYGFAVNKGQNAELLQKFNAGLAQLKESGRYDEIISTYLGEEAVD
NDNSFLGLLKSTFPILMIGLRMTLILTVVSIAIALVLGVIFGLLRVSRSV
VLRAIGTTYVDIFRGTPLLVQAFFIYFGIPSALGFQMSALTAGIITLSLN
AGAYMTEIVRGGIQSVDKGQMEAARSLGIGYLPTMRKVILPQAIRTMIPS
YINQFVITLKDTSILSVIGIAELTQTGRIIIARNFQSFTMWLIIGIIYFV
VIMALTKLSDRVEKRLVK
118473443YP_890714.1 hypothetical protein MSMEG_6501 [Mycobacterium smegmatis str. MC2 155]MTAEIITYQADHPLLLAVPAFAPAIVVAGVVAYIAIRDRRRKDPPKDQPA
GTRDGVHSERGGVASEDDSP
118473442YP_886747.1 morphine 6-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTASHGQAAAIPTVTLNDDNTLPVVGIGVGELSDSEAERSVSAALEAGYR
LIDTAAAYGNEAAVGRAIAASGIPRDEIYVTTKLATPDQGFTSSQAAARA
SLERLGLDYVDLYLIHWPGGDTSKYVDSWGGLMKVKEDGIARSIGVCNFG
AEDLETIVSLTYFTPAVNQIELHPLLNQAALREVNAGYNIVTEAYGPLGV
GRLLDHPAVTAIAEAHGRTAAQVLLRWSIQLGNVVISRSANPERIASNLD
VFGFELTADEMETLNGLDDGTRFRPDPATYTGS
118473441YP_884991.1 Fis family transcriptional regulator [Mycobacterium smegmatis str. MC2MVSVSEVVGVRALGLRGVLMGRGDADIRWVATSELPDPTPFLEGGEILLT
TGIETRTWGREWDDYVRRLAGAAVAAVGFGIGLTHERTPTALIAACREHD
VNLFEVPRRTTFVAISREVARLLSEQESAATQAALQTQRKLISAATKRHP
ATAVITALAQALDGAACLMSPDGRALTGPVGPRRGEFPFDDAAADVRRLQ
TQAGRSAATQSRPALSLSVQPIGLRGRPAAYLATMGPVRLSDAERDALTT
SVAVLGLVDEQRRSRSTTRQHLHSRAIELLAGNDSRTAQLILEVDAPALV
IPERIRFLRATGGDSEITDAVTALERRGILAGTYADELCTVAVPERAEAA
GESMVDAGLQVGVGAAVPSDDGASGYRTAGLALAQTTPTAALVVWDRVVN
DGPLGLIDPQRAAAFAESWLSGLDSEQLETLRCFLRHHGSRLKVAEELGL
HRNTVRNRLDAIEALLPGRLDDPQTRVSAWIALQSLPPENRPVSP
118473440YP_887444.1 HTH-type transcriptional regulator [Mycobacterium smegmatis str. MC2 1MRRTGDQLKADCRAAALAEVAVAGLAGLTVEGVARRASAAKTSVYRHWAS
VDDLLIDALAAACPREEVTVEGGHLRDDLLRSLHQLTGWLSGPAAPAVAA
VLAERRRRPDLVDALYRDVFGTHGNRFTQTVIEHYAATGEIAPRSVTPVV
CDIGEALVIKHQIDTGELPDGSALEAIVDQAILPALGFPATSSGHA
118473439YP_886202.1 hypothetical protein MSMEG_1832 [Mycobacterium smegmatis str. MC2 155]MPRLNHPRSRRGRDIRGPLLPRSVPGWRSRAERFDMAVLEAYEPIERRWS
SRVSSLDVAVDEIPRMTPKDPDSVQWPPEVVADGPIALARLIPAGVDVRG
NSTRARIVLFRKPIERRVKGSDELADLLHEILVAQVATYLGVEPSVIDPT
IDDD
118473438YP_885181.1 metallo-beta-lactamase superfamily protein [Mycobacterium smegmatis stMAVALNKITDRVHFARTELVNWTLVTGDDGVLLIDAGFPGQREDVLDSVR
QLGFGPDDIKAVLLTHAHVDHFGTAIWLAKTYGTPVYCHADEVGHARREY
LEQATPAGVARQAWQPRWLKWALAISRQGAFDHSGIPSTQAFTPEIGLPG
NPTAIPTPGHTGGHCSYLVDGVLVAGDALVTGHPTSSRRGPQLLHQVFNH
DQQACLRSLGALGLLDTEVLLPGHGDVWRGSIREMADQAASSAPSPAR
118473437YP_890289.1 50S ribosomal protein L33 [Mycobacterium smegmatis str. MC2 155]MARNEIRPIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEF
REER
118473436YP_886831.1 acetylornithine deacetylase [Mycobacterium smegmatis str. MC2 155]MGISAYEQAVLDRLDETLMVDLTVALVRSAGENPPGEEAATVRTLADAAA
ALDLEVDETQVEPGRDNISVTLNGGSGPGLLMLGHTDVVPAGTGWTTDPF
GGVLRDGRIYGRGTSDMKGGLAAALAAMAALRGAGLSGPVELAALVDEEE
NGKGIRAYVDAVHRNYLGCITAEPTDLQTIIGARGASYVRVEIHGKACHA
GNPDDGANAIYGAAAAIAEIERLHRELARQPHPLLGAATWSVGQVHGGTA
GAIVPDECVLVADRRLLPGESGADVVDGLRTRLTGLADRGLSVDVSMPME
MPPFQTPADADLVLTAESALADAGGPGLPVGGWTAACDGGFIARDLGVPV
VVLGPGSVTEQAHRADESVAVEQLLVAARAYVLTALRLLG
118473435YP_889255.1 DNA repair exonuclease [Mycobacterium smegmatis str. MC2 155]MRFLHTADWQLGMTRHFLNGEAQPRYSASRREAVASLGEIAKRTGAEFVV
VSGDVFEHNQLAPRDVSQSLEAMRAIGVPVYLLPGNHDPLDASSVYTSAL
FVAERPDNVVVLDRAGVHEVRPGVQIVAAPWRSKAPTSDLIGDVLADLPA
DGVTRVLVGHGGVDILDPDKNKPSLIRMAAVEDALARGAVHYVALGDKHS
RTEVGGSGRVWYSGSPEVTNYDDIESDPGHVLVVDIDENDARRAVRVESE
KVGRWRFVTLRRSVDTDRDIADLDLNLDLLDDKERTVVRLALTGSLTVTD
KAKLDECLDRYARLFAALTTWERHTDIAVIPADGEFDDLGIGGFAAAAVD
ELVATARSEAAEAEDARAALGLLLRLVDRDKGAA
118473434YP_887763.1 hypothetical protein MSMEG_3459 [Mycobacterium smegmatis str. MC2 155]MRGHRDPAPVAGQRSRASAGMGDLHTRKVLDLVIRLAEVMLSSGSGTADV
VATAQDVAQAYRLTDCVVDITFTTIIVSAPPTADSPPLTIMRAVRTRSTD
YTRLAELDALIRDITSGGVSVDQAHAAMDVVTERPHPYPRWLSTAGWAGF
ALGIAMLLGGSWLTCLVAALTSAAIDRTGRVLNRIGTPFFFQNVVGAAIA
TLVAVAAYLVTGEGLTALVATGIVMLLSGLTLVGSVQDAITGHMITAVAR
LSEALFMTAGIVVGILAGLQIATVAGVTIQLNVDATQAFVTPYRPGPIVL
AVIGAAFASVCLTIASYAPWRTLLPAGLAAGFAEVVLIGLGWAGFGQVVA
TGVAAVGVGLFATLLSIRRQAPALVTSTAGITPMLPGMAVFRAVYFFAVE
DRFGDGLAQLLAAGATALALGAGVVLGEFIGSPLRYRAGRVGDFFRIEGP
PGLRRAVGRVVRLRPAEDAPITGPLRRPIESVALEPEPTPSTTGDESEDT
PRQDGGG
118473433YP_889417.1 hypothetical protein MSMEG_5171 [Mycobacterium smegmatis str. MC2 155]MATIDGNTLEGISATTPWTLHHRASGAKRSNVVRFLAPLLAAIVTSAGCG
ALPTEVTETPAAAEVEVLPEVTVQRFEYAADSEQNWADLYLPAGPQQVDS
IPLVVLIHGGAWQSKLGADVFDGLARELADHGMAVYNIEYRRVGSGGGWP
TTFHDVATALDYVTEVDKRFPQLTVDDELVVGHSAGAQLAVWAGTRHKLR
DDEVGSHPSFRPTRVVSLAGPLDMVYAAEHGDHHIVRVLGGRPTEVPDRY
TSVDPIQNIDPEVPVLALHGTRDTVVSPENSRRYVAAVKQQGGRAAVKML
TGENHTSIVSLRSPSHDEVLRAITTTSQTDLDDLLTE
118473432YP_889571.1 hypothetical protein MSMEG_5326 [Mycobacterium smegmatis str. MC2 155]MTVTHGGVDFCRPIGVTTGGSAVPRSVDPDDVCAVLVALDLVLERVDPYR
GVASRPEERADHGAAGLQIDIPLVGLGDDGDDLLAVGAADRDHLAVGFLV
VEFGFVIVQLDVVCVLSIQSRGILMHAEDCTQHPQGLPATCSKLPQIDA
118473431YP_888095.1 hypothetical protein MSMEG_3802 [Mycobacterium smegmatis str. MC2 155]MTIAGELERARHLMLSADEDQARDLLVSLMPRIEQADRDDYALEVFALLG
EIYLVRSAYDGVGECIRRIGDCLGIYTAIRAGRMPEAAAQVRMSDADVDH
MICRYTRRAEFLAAGLAAARGDHDRAAEHLDTLIDSVGPEDLDAEHRRLG
IHARILVATGLCDDDLYARSAPLWDAVLESVTRSGGGDPEDDHLFIAGAL
GYGRFCAESGRLEEAQPWLRRAGARADARGWALPRARTQLERAAACWTAG
QYAETQDLVTEAYPVIADHARAHDVSRSWLYFGLIRLGIGRLQEANTCWE
HAERHWRELGKPLYIHRILLQRSWLSIFRGAFDEATQLVAEARELLDSSP
RHSWLQYARLDDHLGNILRAEALAEMGFDGLGTPEQTWQQVEATHRSGKG
VFRCRPGSRKWLRGTAKLEQAAELKVPAALAVDSVRYTIDDAGARMRWAS
WVSAPMLAGAFAVAWEWDNTELISELVEYHSARGAFSAEPIGQTAGDWAA
TATAPVPVEAELAPAVAANAGTPGSGGLTRLGPLPPLRMDPQTGPILSRY
RELAWQRYGREITSAEPEWATWP
118473430YP_889682.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTPNAPHIVVIGGGYAGVLAANHLQQAAHAKITLVNPRPEFVERIRLHQL
AVGNHSATTGYDTVLGDRVRLLVDSVERIDAPIRQVQLASGDVVDYDYLL
YAVGSTGGVPTSVPGAAEFAYPLSELEQAQRLCERLQDIPMSAPVVVVGG
GLTGIEAAGEFAEAGRPVTLITDVVGASLGDQARRSVVKALRKLGVTIVS
GPDILVASVGATDVTLADGTRLPSAVTVWTTGFGVPGLAAASGLTTDELG
RLITDETLTSVDDDRIVAAGDCASPSGIPLRMSCQAAGPMGIQAANTVLA
RLAGTEPAVLNQAFTGQCVSVGRTYGTVQIAHSDDTPRRLYFGGRTGAAI
KEQVCKATITFMAKEGRKPGSYFWFKGRNRARQLAEAAKDTVGAARR
118473429YP_887104.1 RNA methyltransferase [Mycobacterium smegmatis str. MC2 155]MTELTLTTGAPANGGSCVARHDGRVVFVRYALPGETVRVRVVDERGSFWR
AEVVEVIDPSPDRVDSLCPIAGVDGAGCCDLAFATPDASRRIKGAVVANQ
LSRLGGYHWRDEDSATAEPVGSGAATGWRTRVRLDTTADGRPGFHRYHSA
DLVTDLGCAQLPSGMVDGLDDLRVPGGAQLHLALDSEGTRHVVQSGPKNG
RKSPTRVVDGQYEAVQRIGSRVWRVPVTAFWQAHREAAALYSDLVAGWAQ
LEPGMTAWDLYGGAGVFAASLAEQVGESGHVVTVDTSRGSSRSARAALAD
LKSVSVITDSVRRALATQHQRADVAVLDPPRTGANREVIDQIAAADVPRI
IHIGCEAASFARDVGLYLRHGYHVEEIRVFDSFPLTHHIECVAVLNR
118473428YP_888235.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MGVGEWLGSVVWSRNPLVRRRDRIEGALRLAAVVLCVLAIPLTASIGISV
YHDREQVYAAQARDARQVIAVAAERGALVNTEGHAQPYRADATWTVDGQQ
HRGRLVWADFPNVGDEQTIWVNPSGKVIDPPHGEGRAVGDAVLTALWAWI
LFAAGVGGGLILLHRRFDRARYAEWEREFEIIAGKREWGMQ
118473427YP_888273.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSSNAHNVAPAWALSAIYPLQNDLPVLAETDVLVVGAGASGVAAATTAAE
AGKSVLIVEKYGFAGGAAVAGMSGTICGMYYATARPRQPEQVVYGFTERF
RSALAARGGLTEPQLYGKTFTCAHDPHMWAEVADEFLENAGVRILFHTAV
TGVVMDGDRYAGVVLESNAGRSVVLAQRTIDASGDAAVVSRANGAYYFGA
DGRIQNPTMFFRLADVDIDEFDEYYGQDTICPPKLTDMIEQERKAGANLP
RSRIWVFRTPRRNELMVNATRVAGRDGRALNVIDPEDFTEGEVVGRRQAR
EYADFFRKHVPGCASSYLEDTGTEVGVRQTRSIVGHETLRNDDVLQGRKR
DDGICRVPWPIELHDSKGSNLHWLLDDYYEVPYLSLVPVAGENIIVAGRC
LSAEHEALASARVTAQCFEYGHAAGVASVLSLDENLPYAKIDGRAVRNAM
AANGSAL
118473426YP_884612.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MKFGMALPQYGPALGSAKDLARFATRLEELGYDTLWAAERLVMPLKIHSD
VPVGDDDTWASYLDMIGAFGDPFSLVAAAAAVTDRIRFNFGTLNAPLHQP
IRLAQTLTTLDVLSDGRIDAGFGLSWVRDEYDVSGLDWSSRGRRLDDTLD
FLRVWWTENPVEYASPFISLPPSRVDLRPAQAGGPPVYLGGSSNAALARV
GRRAAGWIGFDQLPDDVMKSLWSTARRAAEEADRDPDALRKIVRVNGEPG
ESVSHIADRLARQVDEGADEVMVDLVFTYKTIDERLDAAERLMHRKTW
118473425YP_890671.1 glutamate synthase subunit beta [Mycobacterium smegmatis str. MC2 155]MADPRGFLKHTTRELPKRRPVDLRLKDWKEVYEDFDHAPLQTQASRCMDC
GIPFCHNGCPLGNLIPEWNDLVYRDRWRDAIERLHATNNFPEFTGRLCPA
PCEAACVLGINQDPVTIKQVEVEIIDHAFDQGWVVPKMPDVQTGKKVAVV
GSGPAGLAAAQQLTRAGHTVTVFERADRIGGLLRYGIPEFKMEKRHIDRR
LEQMAAEGTQFRPNVNVGVDITVAQLRLNYDAVVLAGGATAWRDLPIPGR
ELDGIHQAMEFLPWANRVQLGDPVTDENGQPPITAKDKHVIIIGGGDTGA
DCLGTSHRQGAASIHQFEIMPRPPETRADSTPWPTYPLMFRVSSAHEEGG
ERVFSVNTEEFIGENGHVTALRAHEVKMNAGKFEKVEGTDFELKADLVLL
AMGFVGPEKEGLLDKLGVELTDRGNVKRDDNFQTSVPGVFVAGDMGRGQS
LIVWAIAEGRAAAAGVDRYLMGRSALPAPIKPTAAPQR
118473424YP_887847.1 hypothetical protein MSMEG_3544 [Mycobacterium smegmatis str. MC2 155]MPGMTSIEGKVRFGVGLGADTTPEDLPGIVDYLESSGADSVWFSELVYSP
AVDPFIGMAYTLSRTTRLKAGTSVAILPGRHPVLVAKQVASLAALAPRRV
LPAFGLHSALTAERDVFTVPRGRRGAVFDESLELLNAVLRGRDVSFDGEF
FKVRSANVQPVPAKPVDIWLGGSGPVALARIGRLADGWLGSFLTPVEAGA
ARRTIEREAQAAGREIEPDHYGISLAVAAGDIPDDVYDMARRRRPEVDPA
ELIAADWPTLHRRIDAYVDAGLTKFVVRPVGSGDREAFLERFVGELLPRQ
N
118473423YP_887543.1 hypothetical protein MSMEG_3229 [Mycobacterium smegmatis str. MC2 155]MFAVPAVSRWREGSLTDMTDERAGEPGSDRPEPTESSGQPSDPGQTPPPT
RSGESTESSDTASPPPESNPPYTYGASQGAYDTASQAPYGTAPQAPYGSQ
PYGSQPYGAYPGAYPGSYPPPYGGGYPAQPPAQGAAGPRNGLGIAALIAA
IAGLVLCWSIIGGLIVGVVAIVLGFLGHGRAKRGEATNGGVAIAGIVLGG
IAVVLSLAFIAIWATLGFKWFEELGGREYIACLEDAGNDQAAQERCRVQF
EERVEDEFGTPQSR
118473422YP_889002.1 hypothetical protein MSMEG_4743 [Mycobacterium smegmatis str. MC2 155]MTTAIPPVVDLETWRAALGDLRRREKAATRELDAIAAARRRLPMVELPEY
TLVGADGPVRLADIFAGRSQLITYHHMWTDGAEWQCGGCTGYTSQFTRLD
FLDNYDARFVVVTNGPIDEALRYRAKVGNMMEWYSSSESSFGADVDAAPG
EGFAVNVFLRVPDPAGDPDSDPKKDKVYRTWHTNGRGTEQLSHTFALIDL
LPYGRQEQWQDSPQGWPKHPTYSGWLDSPDIARLYGEKVQA
118473421YP_885902.1 50S ribosomal protein L36 [Mycobacterium smegmatis str. MC2 155]MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
118473420YP_888416.1 lysine decarboxylase superfamily protein [Mycobacterium smegmatis str.MKICIFMSATDLDERYTVHARQFARLVGRGGHTLIWGGSDTGLMKLVADE
VQAAGGRLNGVSVEFLRHFARGHADDMVIARNLAERKMLMLNGCDAVVVM
VGGLGTLDEATDILEMRKHGQHTKPVVILNTAGFYDGLTLQMRRMEHDGL
LPVPLDELVYITDDCAKAFAHLQFEHSRRTTEI
118473419YP_885994.1 kumamolisin [Mycobacterium smegmatis str. MC2 155]MAGTTRHVGVSIRNPGGFRHWHTHWSLALIMIGALLISVFRITSGPDGHG
PAEIAGPYAHLLAASTDLGPADGGPVQLTVTLDGSPEALTSWARERGLSV
RWRHGDTWAIVEGPPADMAAAFEVDIHDYRGRRGQEFYASPQQPSIPEPV
RSEVTEVGRILGYTPYRMNTPDLQHLPAEVPDRGLTPQLLLNTYNLRGLA
EQGYTGKGQTIVIFAFDGFDQADLDTYADTFDLPRFTPILVGGQPSTPRG
ETTMDLQVAHAIAPDARKVVVNARPTVQGDGAYEKIGQMLEDADRQFPGA
VWSFSIGWGCDKLITAADLAPVRSALAAAHTRGTTAFNASGDLAGLECKG
GQDWSSAPGDDDIGLDSVASLPEITDVGGTTLSTTADGAWLAEQAWFDVP
LSQGTGGGVSALFDRPDWQQGFSAPDDGGAQRRLTPDIAAVADPFTGVKI
VLNNQVLVGGGTSQAAPLWAGIAAVMNQYLVANGGRAIGDLNPMLYQIAR
GAPLPAFRDVTLGGNAVATAGPGYDLVTGLGTPDTENLVKNLLVLQKANP
118473418YP_886697.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MELAEAVRARRSTRKFLPDKPVPHELIEEALTLAMRAPSNSNVQPWRVYF
ASGERRERLVAALTAEVRARRPTSLGLPDAFQHLRSQLGALVYGSMGIAR
ADTEARWAAQLRNWEFFGAPLAGVVCMHRDLGLVDSVGVGMFLQTFLLAL
TERGIGSCVQVSVAMCADVLRAELDIPDELTVLCGMSIGYADPAFPANHL
DIPRNPVEQNVTFYS
118473417YP_887647.1 hypothetical protein MSMEG_3340 [Mycobacterium smegmatis str. MC2 155]MSNPYAAGTPGWPAPAWSGYTAPAAPRPRRRVRRIALAVTGIVAVVGIGS
YLLGDTNTHNKWYQKGYDIGYNTKKSVVYTDAETACRWRTLTAVDPGENK
YQTRMRQVEKGCIDGFNDRNGTST
118473416YP_889554.1 hypothetical protein MSMEG_5308 [Mycobacterium smegmatis str. MC2 155]MTMAKNILRAITAIVRRDAKTPDTDDSAGSVTFDGALDDLDVAGLVEVGR
GPIADIAIDADRETIVVTNSAADCLTVINPYTLAPVGSVRLNGEPFAVAA
ADDRAYVSVVTAGHDAIKVVDTITGSVLAEYPLAMTVTALAMSPDGKRVF
VGRSGHDRIDVAVIDTAAERVGTIDLASGAGAGVDALRVDASGKRLYVAT
TDPRGSRMVTVNIETAQIESTVWIGAPIRDLALGADGKALVLTSDRQRRG
VVHIVDLSTAAVVGAIQIGGAPTQLVLSPDATRAYVVDYDRVIVLCTLTN
EILGSIDVGMQPAAVAVRRDGARVYVADYSGQVNAFDVAAELPALYSRLV
ASEPRQDATTVLPSLQTA
118473415YP_885108.1 hypothetical protein MSMEG_0701 [Mycobacterium smegmatis str. MC2 155]MRVTLVRGRFRDVDVSPSSSLVCDRVRGGVRGADDSDVVSSPSDGGVSVP
DGSAPSGGRPISVVSGGLVLVIVDVVDDVVLDVVDAYVGSTKSRGAC
118473414YP_884996.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMIKVMQGVRVLEVAQFTFVPAAGAILADWGADVIKVEHPVRGDTQRGFIN
MGGFQLDPNRHPLIEHPNRGKRSVGIDVSKPEGQEVLYELAQVSDVFLTN
YMPQAREKNKFDVEHIRAVNPNIIYARGSAYGDKGPERLAGGFDGTAFWT
RSGVGHALTPEELGGALSQGIPAFGDSIGGMNIAGGIAAALFHRDRTGEA
LEVDVSLLSTAWWAAGASVTQGMETGETMRSQMPDTIGPTVNPFLGNYQT
SDGGTINLCIVSPTGYIRDTFEHLGLAELADDPRFCDVLPLIEHAAEAAE
RIAEAIRSRPFEYWRRHLKTMKGQWAPFQSLVDLATDEQAIANDMVVEVE
AADGGEPFRVVRGPVQFNHEPLETTRAPQASEHTEVVLMELGLDWDRIGK
LKDVGAIA
118473413YP_890168.1 peroxisomal multifunctional enzyme type 2 [Mycobacterium smegmatis strMPIDLDKALGAELEPIEFSWTSSDIQLYHLGLGAGADPMDERELRYLVDG
TPQVLPTFGNVAASFHMTEPPKVQFPGIDIELSKVLHASEAVSVPGPIPT
SGTAKSVQRFTEIWDKGKAAVIVSETTVTDPSGKVLWTTKRSIFARGEGG
FGGERGPSTSFEPPSRAPDFEISLPTLPQQALLYRLCGDRNPLHSDPTFA
KAAGFDRPILHGLCTYGIGCKAIVDNLLDGDVSRVASYGARFAGVVFPGE
TLSANIWKEDGKFIGVLTAPSRDNTVVLSGVELVPA
118473412YP_887819.1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase [Mycobacterium smegmMGRVAGKVALISGGARGMGAAHARALVAEGAKVVIGDILDDEGAALAAEL
GDAARYVHLDVTQAEDWDTAVATATTDFGLLNVLINNAGIVALGAIGKFD
MTKWQNVIDVNLTGTFLGMQASVGAMKAAGGGSIINVSSIEGLRGAPMVH
PYVASKWAVRGLTKSAALELGAHQIRVNSIHPGFIRTPMTEHFPDDMLRI
PLGRPGEVDEVSSFVVFLASDESRYATGAEFVMDGGLVNDVPHKL
118473411YP_890816.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGADGLTAREAKRLQTRERLMGAAIAEFKRAGMADADVGTIVAAAGVAH
GTFFFHFPTKEHVLLELEQREEERIAKQFAQFVKKPHDLEAALREIVRLV
IGLERRLGDLLFKDFLALHFSQTRPRVDEGMEHPVIARVTEEIEAARQRG
DVAADVNPVNSAVFFLLGFYALLVTTNDWPTRDEVLDDYVRRTLRSMRP
118473410YP_886594.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MLFTVPAVAEAVAAAIPDRPLIVQGERRHTYRQVMDRSNRLASYLHSQGL
GVHTERDGLAGHEVGQDLLGIYAHNGPEYVESMLGSFRARVAPFNVNYRY
VKNELHYLLTDAGATALVYHATFAPRIAEIRDELPTLRVLIQIADGSGNE
LLDGAVDYEQIVNFETAAPPVQPCPDDLYVLYTGGTTGMPKGVLWRQHDI
FMTAFGGRNMMTGEAATSVDEIVDRAVENPGTRLMILPPLIHGAAQWAAM
TAVTTGQTLVFPDVTDRFDAEDVVRTIEREQVLVATVVGDAMARPLLDAI
RSGIQNGTVDVSSLSVIANGGAQLTPHVKQQLIDSKPNLIVVDGVGSSET
GAQMSHMSAPGAVSTGTFKAGPDTCVVAEDFSCVLPEAHDGLGWLAQRGY
VPLGYKGDAAKTAATFPVIDGVRYAIPGDRARQLDGGMIELLGRDSVTIN
SGGEKVFAEEVEAAIASHPAVRDVVVAGRPSERWGQEVVAVVAVDDGAQV
DADELIRHADGSIARYKLPKAVVFRPAIERSPAGKADYRWAREQALSETS
118473409YP_889799.1 NAD(P)H dehydrogenase- quinone family protein [Mycobacterium smegmatisMKVLWVFAHPEQASLNGSLMQEGLGILEELGHEYQVSDLYAMKWKAALDR
DDYTRDTEGRFSVSRASQQAFRTGTLSADIVAEQRKLEWADLFVLQFPLW
WYSVPAILKGWIDRVFVKGFAYGIADPENPGRTLRYGDGPLAGKKALTIL
TSGSPPAALGPRGINGQLDQVLFPLLHGTLWYVGIAPLAPMCLYGADRFS
DHEFASATAELRRRVEAIDDEEPIPFRRQNGGEYDADLVLRPELAPGATG
ISVHYHDR
118473408YP_890325.1 GTP cyclohydrolase I [Mycobacterium smegmatis str. MC2 155]MTQSLRGHQNNNVRRVFDQPRAEAAVRELLIAIGEDPEREGLVDTPARVA
RAYKELMAGLHTDPDSVLNTTFDEGHDELVLVKQIPMYSTCEHHLVSFHG
VAHVGYIPGVDGRVTGLSKIARLVDLYSKRPQVQERLTAQIADALMRKLD
PRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGQFKTDKASRAEALELI
LRK
118473407YP_884552.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRTLQGSDRFRKGLMGVIVVALIIGVGSTLTSVPMLFAVPTYYGQFADTG
GLNIGDKVRIAGMDVGNVKSMEIDGDKVVIGYTLGGRTIGTESRAAIRTD
TILGRKNIEIEPRGSETLKPRGVLPVGQTSAPYQIYDAFLDVTRNAAGWD
TQAVRQSLNVLSETVDQTSPHLSAALDGVARFSETIGKRDEDVKKLLASA
NKVATVLGDRSTQVNQLLVNAQTLLAAVNERGRSVSLLLERVSSVSRQVE
GFVDENPNLNHVLEQLRTVSDVLNERKQDLADILTVAGKFITSLAEALAS
GPYFKVMLVNLIPPTILQPFVDAAFKKRGIDPEEFWRNAGLPAFRFPDPN
GERHENGAPPAAPTPLEGTPEHPGPAVPPGSPCSYTPPADGIPSPGNPLP
CAHLSQGPYGPVPGGYPPPNVATSAPNPDGIAHSPGVPSAAIPGQMPPEQ
PGAPVEIAPGPPGARTVPVSPIPGAPDFTPGIAPPPPAITGPPPPPGPGP
QLAPVGEAPLPGNPPFLPPGSQSR
118473406YP_886649.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium smeMEQRISLITLGVDNLAASRRFFEEGLGWTATGAYDEVVFYQLPGIALALF
GRADLATDTGVAVDGRFSGISIAINQRTEAEVDEVMTQVQAAGGTIVKPA
EKTYWGGYSGYFTDLDGHVWEVAVNPAWLINDDGSVTIR
118473405YP_886451.1 SsrA-binding protein [Mycobacterium smegmatis str. MC2 155]MTKKSASSNNKVVATNRKARHNYTILDTYEAGIVLMGTEVKSLREGQASL
ADAFATVDDGEIWLRNVHIAEYHHGTWTNHAPRRNRKLLLHRKQIDNLIG
KIRDGNLTLVPLSIYFTDGKVKVELALARGKQAHDKRQDLARRDAQREVI
RELGRRAKGKI
118473404YP_884951.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MYLPPKFALSPERIDAVLAEAGFAQLVSHTTAGLVVTPLPLLYDAERHAL
LGHVARANDHWRAAGAESVAIFTGPQAYVSPSFYPTKAETGKVVPTWNYE
VLNVYGTLRVHDDPDWLLDLVTRLTDRHEAGRDRPWQVADAPASYTRAQL
NGIVGVELPVERVEAKAKMSQNQPARNRAGVITGLAASQSALDAQVSDRV
AAFDPDH
118473403YP_884541.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTSLAQRVVAGLKDKIFAGDLPPGHKLPSEAELIDEFGVSRTVVREAVT
RLRAEGLIETFQGRGSFVLAVPEPTAFTIESAAIRTQRDVLDMVDFRLGV
ECEAAALAAARIDARGRDAVRTALDEFVGAAPEDAVEADFRFHRTIAEVS
GNRFYLDLLNSLGPMMIMLPRTRLGDAHSITDAAHAERVRREHDQVAAAV
AAGDPDLARAAMRLHLGNTRRRLAGDR
118473402YP_889636.1 sensor protein KdpD [Mycobacterium smegmatis str. MC2 155]MTTRASNASKRGELRIYLGAAPGVGKTYAMLGEAHRRLDRGTDLVAAVVE
THGRKNTAELLAGIEVIPPRYIEYRGGRFPELDVPAVLDRKPQVVLVDEL
AHTNTPGSKNAKRWQDVDELLNAGITVISTVNVQHLDSLNDVVAAITGIE
QQETVPDEVVRSADQIELVDITPEALRRRLSHGNVYAPERIDAALSNYFR
RGNLTALRELALLWLADQVDAALAKYRADNKITALWETRERVVVAVTGGT
ESETLVRRAFRIASKSSAELMVVHVVHGDGLTGISAAQMGKVRELAVSLG
ATVHTVVGDDVPTALLDFARDINATQLVLGTSRRSRWARMFDEGIGATVV
QQSQKIDVHMVTHEAAKRGFRWSSTSPRQRHAASWAAALMVPSLICAFSV
AILDPFLDVGGKSALFFVGVLVVALLGGVAPAALSAVLSGLLLNYFLTSP
RHTFTMSDPDSALTIVVLLAVAVAVAALVDGAAKRAREARHASREAELLA
LFAGSVLRGADLTALLERVRETYAQRAVSLLRETSDGATIVDCVGQDPCD
RVAAADTAVEAGDEFWLLLSGRELPARDRRVLGAVANQAAGLVRQRELTE
EAAKANAIAKADELSRSLLSAVSHDLRTPLAAAKAAASSLRSCDIDFSAE
DTAELLATIEESVDALTALVGNLLDSSRLAAGVIHPELRPVYLEETVQRA
LLGIRRGPTGYGRSAVDRVKVEVGDSVALADGGLLERVLANLIDNALRYA
PDGLIRVTAGRVANKVLIAVVDEGPGIPRGAEDALFAPFQRLGDTNTTTG
VGLGLSVAKGFVEAMGGTISAGDTPGGGLTVEIELAVPA
118473401YP_885622.1 hypothetical protein MSMEG_1230 [Mycobacterium smegmatis str. MC2 155]MTRRALAEDRGLQAERTALAWTRTALAIAASGVLVLLRDSHIQDDPGRLV
VVAAVAVVALGVFALGAHRRRRLLAHPRGNAGRRYIRAAGVTILAEGLLV
MIYLMLA
118473400YP_885544.1 hypothetical protein MSMEG_1150 [Mycobacterium smegmatis str. MC2 155]MESKQGRAALSMKRFGALIGAALTVVALATAASAGASVVSFCDDLAGRMD
GPYCNLSIESDRKATRDIKVAIPGELVDDPVAGPVVRDYLSTLVGNWMKA
GQKMVADSFGEGNYQIFRHGDALSVVFRETYHADGPDFNNAYRTFTFDMA
EGRRLQLADLMKPGVDPLTAIPPLAQPFIVQALDQAPPPHQPGTYPFVFD
RWLPDKVYSGAYKAWALTPDELIIYMPDYPVARDRPTDFTPGVMQWSMDG
GTVQAHIPLAALAPILQPRYGGA
118473399YP_886145.1 hypothetical protein MSMEG_1773 [Mycobacterium smegmatis str. MC2 155]MMTIPTTLQPPLPDAQGRISAAVISELKGRAPHNHLEPVWVPLRDADPLG
LDIQLALYVCYELHYRGFDGVDPDWEWSAGLLHLRSQLERAFLEAVRKEI
GTIPSDVTAASEMERLSVEPVDGNGPSYFLRDHGTWEQMREYFVHRSLYH
LKEGDPHAWLIPRISGQAKASFVAIEYDEYGAGHGNHLHQQLFADLMEAA
DLDTTYLGYIGHVPAESLALVNLMSMFGLHRKLRGAAAGHFAATEITSSP
GSQRLTAALKRLGAPEPCVRFYAEHVEADAVHEQVVRLNVIGDLVEREPE
LDADVVFGIRAFDALEDRLADHLMKNWAADRSSLSRPLDD
118473398YP_889671.1 peptidyl-tRNA hydrolase [Mycobacterium smegmatis str. MC2 155]MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEV
VTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID
FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFV
LENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW
118473397YP_890222.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGSVEQ
IIGGCVTQYGEQSNNITRVGWLTAGLPEHVGATTIDCQCGSAQQANHLVA
GLIATGAIDIGIACGIEAMSRVGLGANAGPDRSLIRASSWDIDMPNQFEA
AERIAQRRGITRADVDALGLASQRKAKQAWDEGRFDREISPISAPVLDEN
KQPTSEWAPVTRDQGLRDTTPEALASLKPVLDGGIHTAGTSSQISDGAAA
VLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTARVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHNADMDKVNVNGGAIALGHPVGSTGA
RLITTALHELERTGKGTALITMCAGGALSTGTIIERI
118473396YP_886010.1 hypothetical protein MSMEG_1632 [Mycobacterium smegmatis str. MC2 155]MARTAPIPVTATDARPDRKGGSFDARTGIGWLVCGVAGTLTIAWYILAAP
GELGSKAEWFFGAVVFVAVAVTMWQTVTFARQAQHDAADAAEKLRAELAA
ADQRAALELASAKKRHRTELEAQQKLHASEMAAQREIARIERRHLADQLQ
KQAMIEVSRSVATHTRMLASLWSEGARCMALEDRAEREKAMNAIFEQIGH
VVTEVSVEIDNAHLLCQDDRLHEALDRVNDAVLMAIRIAEELHDDVLEGR
TPQEDAVREAQRRLTERAGEARRLAWSLLRTGLERTGSDSPEVAGA
118473395YP_884608.1 RpiR family transcriptional regulator protein [Mycobacterium smegmatisMARQDATATLADIRAVRPTLAPSERRVADVVLADPARASGFSISVLAEHA
ETSVATVMRFCRTVGLTSYSQLRLALAAAAARELAREGESPAPGTDISVT
DTVDEIVKKIIYNEIRVLEDTGAALDIEMLNRAIDVVSGARRVDISGVGA
SAFVAQDLHQKLHRIGRIAFVWSDRHSAVTAAALLGPGDVAFAVSHSGET
DDVVEFLDAAAGCGATTIALTNSPRSALAEAADIVLTTCARETPFRSGAT
VSRIAQLAVVDCLFVGVAQRSFGETTTALEKTHAAVQRHRRSPRRTSNNG
118473394YP_888617.1 hypothetical protein MSMEG_4341 [Mycobacterium smegmatis str. MC2 155]MQTRTLAVQLAELTVQLAELTVQRAELAVHRAVLAVCEVRRPAELSGRA
118473393YP_885022.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MSEVTAELVATGAGTVRGLLAADHRVFYGIPYAAPPQGRARFTAPEPYEP
WPGVRDATTPGPTAPQAQRDGFGRLDMSPFFGPGWVRDPDYLTVNVWTPR
TERAPGHPVMVFVHGGGFVSGSTRSPLYDGSAFARDGVVLVTVTYRLGIT
GFLDIAGAPRNRGLLDVLGALRWVRDNIAAFGGDPGNVTLFGQSAGATLT
AGVLAEPQAQQLIRRVIIQSGNPYGAFTGEQAARVTHAAADALGVDPVLE
DFEGISDERLIGAAGGLGGLDLRTADGFDPLVGLSPFSLVCDEQPAVGAH
PDVGVLIGTTLEEGNLYLVPQGQFGTSTREDVHALAARVHADPVALVQEY
RERHPDADWDRLRSAILGDALFRAGSERFALSRNAYRYEFGWRSTAVDGL
LGAAHAVELPFVFDRLDAEVLRGPDALLGPGDVPQALADEMHGAWVRFAT
TGDPGWAPGEVRRFTEIEVRDSKRADRVPHGNLGVR
118473392YP_890850.1 nitrilotriacetate monooxygenase component A [Mycobacterium smegmatis sMGQRRTDKMSLVAFMQAGSASVYAGSWRHPATEHGYLDAAYYAKVGRQLE
EGCFDLMFFDDRLAMPGIYGGSVAEAVRYGARPVKLDLSVILGVLAQATS
HIGLGATYSTTYYQPFHVARTFASLDHLSRGRAAWNVVTSVNDSEAQNFG
VDAHLGHDERYDRADEFLDVVTGLWDTWDDDAIRHDRAGGMYADPDKVHE
LRHQGKYFSARGPLTVPRTPQGRPVILQAGSSGRGRDFASRWAELIFTGD
PGLAIAREHYADQKARIAEAGRNPSAVRICPMVYAVVGESESHAKEREAM
FLHDLVDPMASLTLLSELMNYDFAAHGLDDPVTDELIASVSGVRGLVQNI
RNHIGGDTVTVRDLAGHRATLLQGPRFVGTGPQVADQMAEWFEAQACDGF
VLAATHMPGAFEDVVRMVVPELQRRGLFRSAYEASTLRGHLGLERPASTR
LSA
118473391YP_887332.1 hypothetical protein MSMEG_3014 [Mycobacterium smegmatis str. MC2 155]MADWYDVARIAAALPETDEQTPRTWRVRKKRIAWERPLRKADLAALGADA
PTGDILGVRVSDEGVKLALVADDPAVYFTTPHFDGYPIVLIRLAAIEPDE
LEELVTEAWLTQAPATLVEKFLADVQ
118473390YP_885572.1 allantoate amidohydrolase [Mycobacterium smegmatis str. MC2 155]MKPLDQRFETTWADLQPVGRDKLSGGYHRFAWTGPDADMRAWFSDQAHSR
GLTYECDGNGNQWAWWGTPGPGAVVTGSHLDSVPSGGAFDGPLGVVSAFL
AIDEMRSRGVQPTHPIAVVNCVDEEGARFGVACIGSQLLTGALSPEKARN
LYDVDGVTVAEAMRTAGADPNDLGRDDTVLNRIGVFVELHVEQGRGLTTM
NAPVGVATSIWPHGRWRLAFRGEANHAGTTRLVDRHDPTLAFAAAVLAAR
DAAEANGAVATMGKAFITPNGANAIPSEINAWLDARAGDDAVLERMVRAV
EDAAVKAAGEHGTAVEVERESYSPAVVFDEALRDRLAAVLGGVPVLPTGA
GHDAGILSAHVPSAMLFVRNHTGVSHSPSEHADEEDCVAGVQALATVLEE
LACT
118473389YP_886180.1 Fe-S metabolism associated SufE [Mycobacterium smegmatis str. MC2 155]MPAALAEVVSDFQEVAGQDKLQLLLEFANELPPLPAHLEEAAMEPVPECQ
SPLFLDVDASDPQAVRLYFSAPAEAPTTRGFAAILAAGLDGQPAADILAV
PDDFYSELGLAALISPLRLRGMSAMLTRIKRRLRTA
118473388YP_890170.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MKSTDESPYDAIVVGSGAAGSWAAKELTESGLRVVLLEAGRAVDPARDFP
AEAPTGAIGMASRAKAAVSGQFVQAQCAAFFETTKHFYVNDRQNPYTTTP
GKRFLWYRGRQLGGRLHTWSRHVPRMSDNEFKSASLRGHGIDWPISYEDV
APFYDIVEQTLGVHGAPSGIASCPDGKFLGPAKTTQIEEKFKTNLENRMP
NIRVTYGRTVRYDRERIPLPLRMALGTGNLEIRTDAVVRRLMIDPRTGKA
VGVDYVDRSTGAAQAVHGRVVVLCASAIESVRILLNSRTATHPAGVGNSS
GHLGRYVCDHVAYAQSGSVAEHEIEPSPAEDGFDFAATGLYIPNFCDPAA
VGFPGGYGIQIGIGRGKPTWSMYALGEMQPRFDNRVSLDPRVTDAWGVPA
ARIECSHSPDEVRMVGHMRSTIREIATAGGLPVENDHDLGRRSIALRLLR
SRFFTDYGAYWPGAAVHESGGARMGERPDNSVLNPYCQVWDADNVFVTDG
ACFVSSGFQNHTLTMMALTVRACRFIAVDYLKC
118473387YP_891001.1 hypothetical protein MSMEG_6793 [Mycobacterium smegmatis str. MC2 155]MTVTGERPEIILTDVDFNRRDHPDRPLRPIPPGRDHFADQWRRMREIMFG
EWIDVDKEVEPNELTRLRDDYFWQGDEHMIGVVDAFERIGHEQGRAMFEQ
ALTQGIDTVENPPQELVDLFEHLDNLPKQFDLVAAERGRMLAMSSTMAAT
TIIRAWAVYETAMTGDISAATGATGRFADDGPRRFIETARVFAEFTLPEI
FDRHSEAFCDVVRVRLMHALASRGLRRKWGDDLYLKFGEPIPVTSLLGFG
SGMLLGRLVDHAFGRKLTPQQLEDLAEYSSFSGRLWGAPERLYSPNGIEL
IKSLNYVLSRGGNPSPWRAELVDAVAGPEHLQTLTDTLPGLLKKVIYKYA
NTITATIAFAPAGVVFGYEQIEAMLKDTMFEPLGYDIRRRVKNFERLTKL
NVRVAMLADRVPWSNPIREHRKRTGAAARERIAMLDKIAAGRQIPLTYTH
HDRSTSGEGFTG
118473386YP_886929.1 hypothetical protein MSMEG_2592 [Mycobacterium smegmatis str. MC2 155]MLTTVETIDGFPIAVDVAGPDKGSNVVLLSAGHHGPGAYEGICHRLHTAS
LRTVVIAPDPRLTAKSVVGILDALGIKWSLLVGDRLGGELAWELAATRLD
KFVGLVVVDRGHPRVADPTGVIRDPHCPPVEMNTTALVSTPAARAVAKAS
QRYVYGDFRLVEMLGRRNAQDTTAQLAAEIVLRTSTW
118473385YP_886556.1 dimethylaniline monooxygenase [Mycobacterium smegmatis str. MC2 155]MTPALPRTAIIGAGISGLTAGKMLKDYRVPYTTFETSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKHRLSFKDFPMPEHYPSFPHHTQIKEYLDAYADAFG
LLDHIEFGNGVVHAERGAHGGWVIEDQASARRDFDLLVVANGHHWDPRMP
DFPGEFTGEQIHSHHYIDPRTPLDLTGKRILVVGIGNSAADITVELSSRT
LQNQVTLSTRSSAWIVPKYLAGQPGDKFFRTTPYLPLSWQRKAVQMIAPM
LGTDPTAYGLPAPNHKLFEAHPTQSVELPLRLGSGDVTPKPNVARLSGDT
VLFEDGTSDVFDVIIYATGYNITFPFFDRDFISAPDNQIRLYKRMFKPGI
DDLVFIGFAQAIPTLFPFVECQSRLLAAYAVGRYALPSTDEMERVIDADQ
RLHAGHCTDRPRHTQQVDYFYYEHDIRAREMPAGAKRAERRAAGTRTAIV
GSVA
118473384YP_888386.1 transporter major facilitator family protein [Mycobacterium smegmatis MSAHTEAPTTSPPTTAVSARHRRLLIAVFSISSSMGYIAMIQIIPVILVS
MATDLNTSRTAIAAASTVSTLIGALAAFPIGRSLDRYGGRAVMTAGAAIG
AVAVALWSQATSLQLVYLSSVFIGISITMCTYEAAFAVLVFATGPTHRDR
AIIAVAMIAGLATYLVYPILGWMNITLGWRTSLLILAAAFALTSVPAHLW
IIPSRSEHRRHIAKNTGVPTGTALRQGRFWLLSIAFVGQAGSVSAFLFLV
IAYLQDIGHPMTVATAVPVSIGVMQILSRLVMTTFAARISLVPATAIAFA
IQAAGLLALPLAGLSLPLCVLCVAAVGVGQGVGVIARPSILADSFGVAHF
ASVLALMTVPIALARAGMPVFAAWLADWRFLAICGVLALIATLALLPLVG
NSRCGSDLLRGCQGLDRS
118473383YP_885675.1 hypothetical protein MSMEG_1285 [Mycobacterium smegmatis str. MC2 155]MATVTDAVARILAEQGPLHTDEIERLLQASGEPVPEPVVDELSMPVGMLV
DDRWVWLPTVLDGRVFTHRLSAHEVAHDMLDAAVDLDPVSDLFHLDEYLR
LADGSPVSFAVADYDDELLEDRGIPLELAGESGVVLLAPGTLAALKAAEG
DLVGLRLTDQGLALETIETVVDADIGNRLAEVLPGDEPTFVDAAALTLCA
EDPTVFVEATAPLSEVIREAGLAYSDGFIAPAGFDFGRWRFETACHRSAD
THGLDPDDAVALQTLIMALEQLTVDADSLPLLRRAGAALENPVVADALVE
ETVDAGRGSPESLSRLTEALEAQVPRPARAAVRWLRATALERAGDIAAAE
RELLAAETMDTEWPLTLVDLAHIASDRGDAERALALLRRAGFPPDHPNVQ
FLQRYLVAPRPDLGRNEPCWCGSGRKYKKCHLGNEQLSLEERAAWLYSKA
AQHVSETHWHGMLLELALERSRYADDLHDAIAEAMSDPLVMDALLHEGDA
FADFLRVRGPLLPDDERALAEQWLLVDRSVFEVQAVRPGETVTVRDVRTG
DRHEVRERLASREVKPGELLCARVLPTGSIMQFFGGIERVSLGERDELIE
LLDSRPDEVTLVAALTRRFAPPTLTNTEGDLLMVCEAAVRFADPAALDAV
YVRADDDPPHWFEHVPGKPQIRASLKLDGDTLRVETNSEERMDRVLAELG
RLDPAMTVLEESRRPISEVTPPSRELLEPDDPEMIAAMEEFMRDYETRWL
DESIPALNGLTPRQAADDPTRRGDLIKLLDSFPATERGMNADRLRAALGL
D
118473382YP_887911.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MNRTPVLVGYGQVSQYDENPATEPVDLMAEAARNAADPRVLQAVDSVRVV
NLLSWRYRDPGLLLAGRIGAAGARTRYTGIGGNVPQTLVNHACLDLQAGR
AEVVLIAGAETWRTRSRLRARGVRPDWTRQDDTVPVAPGGDDNVPMAGDA
ENRIKLDRPAFVYPMFEQALRIAAGETPDEHRDRIGALWSRFSAVAARNP
HAWNRDAVTAQQITQVGPDNRMISWPYPKLMNSNNMVDQGAVLILTTVQM
ATYLQIPMDRWVFPYAGTDSHDTYAIGERDELHRSPAIRIAGRRVLELAG
ADIDAIDFVDVYSCFPSAVQVAAAELGLPTDDPARPLTVTGGLTFAGGPW
NNYVTHSIATMAEKLVAEPGTRGLITANGGYLTKHSFGVYGTEPPEQEFR
WEDVQSVVDAEPTRKLAVEWVGTGTVESWTTPFNRDGAPEKAFLAVRTPD
GARTLAVITDESQAAATVREDIAGARVEVHADGTATLL
118473381YP_886300.1 ATP-binding protein [Mycobacterium smegmatis str. MC2 155]MEVKIGVTDSPRELTFNSAQSPTEVEQQFTDALSSGTGVLALTDEKGRRF
LVQTAKIAYVEIGAADVRRVGFGVTVESA
118473380YP_890696.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MLTVDFDRLGVGPGTSVIDVGCGAGRHTFEAFRRGAHVIGFDQNVADLNS
VDEMLQAMAEAGEAPATAKGEAVKGDALDLPYEDGTFDCVIASEILEHVP
EDDRAISELVRVLKPGGSLAITVPRWLPEKICWLLSDEYHANEGGHIRIY
KADELRDKVLAHGLELTHTHHEHALHSPYWWLKCLVGTEKNDHPAVKAYH
QLLVWDMMGRPWLTRTAESALNPLIGKSVALYFTKPDARG
118473379YP_888151.1 polyprenol-monophosphomannose synthase Ppm1 [Mycobacterium smegmatis sMADDRARRFDRFRVRPEEITEVIPAVTDDDPLEDPLDDDVAPGLDDAEPE
PEPRDEHDEPSRPATGSRIGGWVARRGSRFGKGVLDRCAPLSAAIGGGLA
LWLSFPPIGWWFTAFPGLALLGWVLTRTATTKAGGFGYGVLFGLAFYVPL
LPWISGLVGAVPWLALAFAESLFCGLFGLGAVVVVRLPGWPLWFATLWVA
AEWAKSTFPFGGFPWGASSYGQTNGPLLALARIGGAPLVSFAVALIGFSL
TLLTAQIVWWWRHGHKPGVPAPAVMLPGVAIAASLLVTALVWPQVRQSGT
GAGDDTAVTVAAVQGNVPRLGLEFNAQRRAVLDNHVKETLRLADDVKAGR
AAQPMFVIWPENSSDIDPLLNADASAQITTAAEAIDAPILVGGVVRADGY
TPDNPVANNTVIVWEPTDGPGERHDKQIVQPFGEYLPWRGFFKHLSSYAD
RAGYFVPGTGTGVVHAAGVPIGITTCWEVIFDRAARESVLNGAQVLAVPS
NNATFDEAMSAQQLAFGKLRAVEHDRYVVVAGTTGISAVIAPDGHEISRT
EWFQPAYLDNQIRLKTDLTPATKWGPIVQAVLVIAGVAVLLIAILHNGRF
APRMLRRRSATTVKR
118473378YP_884593.1 polar amino acid ABC transporter inner membrane protein [MycobacteriumMGHAGELDLHRCIVTGAMTATETCETQSPGVARVVRQRHLGRWLSGGVMV
VLVALALRSVATNDRFGWPLVAGYLFDPQILEGVRLTLVLTFVCMAIGIV
LGTVLAVMRLSANPVAQALAFAYVGFFRGTPVLVQLIFWFNFAALYPHLS
FGIPGVDIDANALISPVLAGVLGLGLHEAAYMAEIIRGGIGSIDVGQIEA
ARALGLRKNQVLRRIVLPQAMRVIVPPTGNEVVGMLKTSSLVSVLAVGEL
LYSAQLIYASNYQTIPLLIVASLWYLVLTAVLSAGQMRLERHFARGSVEI
RTAAAEWVRGWLGLGHLARRGVR
118473377YP_885639.1 hypothetical protein MSMEG_1248 [Mycobacterium smegmatis str. MC2 155]MWWELTLPATNLTYKQVRELNLRGGLSLDAFEHVVANADFVSRTVQAIIE
IIGDSTHMHDLLGSLGLDGAAEPVSAPATIRRIPVEANLSERFSIDYKKL
SVEDRTRKEAELQRDYANYLNSKGHTTCRHEISVDGQRLYTDLYDETTCE
LIEVKSSNDRDTMRLALGQILDYAEVVKPKRMTVVVPSRPSYGITNLFYR
HGVRAVWRCESDFESSLIQEAD
118473376YP_884484.1 early secretory antigenic target- 6 kDa [Mycobacterium smegmatis str. MTEQVWNFAGIEGGASEIHGAVSTTAGLLDEGKASLTTLASAWGGTGSEA
YQAVQARWDSTSNELNLALQNLAQTISEAGQTMAQTEAGVTGMFA
118473375YP_884731.1 hypothetical protein MSMEG_0317 [Mycobacterium smegmatis str. MC2 155]MNRAVALRIAACGLLGLGAALLIAALLLTTYTKGKIAKIPLDIDTSLVSD
GTATAFDPDSLVAERFKIDRDVPVALQQQMSVEAPSNADVVTFQVGTTLR
RTDRQQDAGLLLALVDTVTMNRNTAEAVSSENNPGGAVQKPRAIEDEKPP
TNIALPHEGLTYRFPFDTEKKTYPFFDPIAQKAFDANYDGEEDVNGLTTY
RFVQNVGYDADGKLADPIKYSSLYEDDADASVTARAEVWGVPGEPDESIT
MDRFYAASRTFWVDPVSGTIVKSEEHGYQYYAREALKPEVTYVDFKVTTN
EESVESQVAAASDERDRIALWTRILPITFTALGLVSLVGGAVLGSFALRT
ESTLIDPGLDTADHGFFDTQGIQVPGAEAKTEKLPAQRPTDLPPDRPI
118473374YP_888289.1 hypothetical protein MSMEG_4003 [Mycobacterium smegmatis str. MC2 155]MTVSIPQSWVTHGHHDVYWIRTGSLTLGVVPALGGRLLSLRLGERELLWR
NPALLGEDLQPVGGHIPAPVSGRLGDWCNYGGDKTWPAPQGWSSPQQWAG
PPDPVLDSGHYAVDVCRWEATTELAVTSPPDPRTGLQITRTFTVNTDSEF
VIHLSATNVTDHEVTWALWNVTQLPGGGTVEVDVEHRFTEPIEILAGTGV
PTWRRSGPDTITIDPQDVVGKLGFPYATGRLRYLHQNVTLAWDFPVDEDA
PYPDEGSRAELWMEHPQPAPLASLDGLDPPDRIVECEVLSASHTLAPGSS
MTFPVKLSVHTSPGGGR
118473373YP_890837.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAASARRVGAETSKTRDTLLDHVEQMMLGEGYASVSYRALASAAGVTPSL
VQYYFPTLDDIFLAAIRRYSERNLAQLQKALAARIDDPLRALWEYSRSEA
TGALMTEFMALGNHRKSIRAEIAEVTERGRKIQLDALVAKFGKDARPGGH
FSLPALLLLISGLPKFLSLEEGIGVKTAHKEVTAAFEKYLDEIEPTPRRK
RSR
118473372YP_886386.1 hydroxymethylglutaryl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MTVREPSPYTPRAELRDVTLRDGLQLTAKTLPTELKIEVVRELLRLGVPA
LEIGSMARADLVPTLADTLDVVAALTPEELDRCWIWVATPRHVEKAAAAG
ARKFQYCLSASDAHNKANIGRDTETSVAAMPDAIRIAHEAGGEIQLCIAT
AFTCPFDGLVDPQRVWGIAADPRTSGAVDIVVCDTIGQAIPTQVSALIHG
LHPVNPERRIVFHGHDTWGLGVANTLAAIDAGATMVDGSLGGLGGCPFAP
GASGNTSSEDLLFALRPDWLTPSAFESLVLLSEKILAELGEPNRSKAAQG
ARSKARAFGWVIDA
118473371YP_887496.1 hypothetical protein MSMEG_3181 [Mycobacterium smegmatis str. MC2 155]MRSRHVSVWIEAPPDAVYVFASDPGEWPRWAAGLAQGGLRLTAEGWIADS
PMGIVRVSFTPANTHGVLDHVVELPSGERVYNPLRVVPAGENESRCEVVF
TVRQRAGMTDEQFDADVAAVEADLERLRALLER
118473370YP_886685.1 hypothetical protein MSMEG_2340 [Mycobacterium smegmatis str. MC2 155]MSQRASHAVTYNAFFAAAAAPPILIGDPARQHGPIRVEALAGHLQPELVE
AAESRQVSAGEARPTGSVRHVEVFQMDGVGTSIIGRPRPLSRHRRADDLY
TLNCEEPAKAIALGADVVAIARPLLAAAIDSAAAVADWLQGFIDELRICL
HGSGAPDLAAMHAIRLVDR
118473369YP_886100.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
LTESECTRVVEVLNSARFVDAAPMQVWATLLDEGSYLCSVSTMYRVLNAN
KLVKERRRLARHRKAVCPELVATAPRQVYSWDITKLAGPVKGVYYDAYVM
IDIHSRYIVGVHVHARECGQLAKEMMEQIFGTYGIPHVVHADRGTSMTSN
TVAGLLSDLGVIRSHSRPKVSNDNPYSESWFKTLKYAPAFPERFESIHHA
RDFMDRFVQWYNHEHRHSGIGLHTPADVFYGLAGGKDTQRRAVLADARAR
HPRRFGRDTAPKVIDLPESAAINPPKPAEQETETEAA
118473368YP_889316.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSEPTSRQRLDTPRVWRGPRLQVDVEAVGRVSESIARFLGTGRYLAIQTI
FVVVWIALNLFAVGYEWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVSLEEDRRRAEQTKADTEFLARELASLRLAIGEVATRDYLRRELEEIR
DMISELQQPPPTTDRAGSGKGDGGERRSKRGG
118473367YP_890874.1 hypothetical protein MSMEG_6666 [Mycobacterium smegmatis str. MC2 155]MRSLGNTVGMVVGTVAVIVMAATGCTEIATGTPVADPAAATESTTAPKTR
ASATTTAPVPDQSAPVGSAVMSVTGGSGPVTISYRINGGPEQTETNVFLP
WEKRYPVYEKLESEVTADGGDTSLICTIIMEGDMLVSFKSEPRPTCNFAY
WG
118473366YP_886764.1 signal recognition particle-docking protein FtsY [Mycobacterium smegmaMIGLWVAIAVVAVLLVVAIVVGLVRYRRRKIKLSAPEPKKTIDRSGGYTA
SSGITFSQGGTAPPAERIDTTGLPAVGDDATIPRDAPKRPIADVQLPEPA
VEPEAPPARDSVAAPPEAPAPPEPVAEPAPEPAPEAAPETTAEPVTEPEP
VVEAAPEVTPPVTETAPVEAPPAAPGATPSAIEEIAPAEGRLGRLRGRLA
KSQNALGRSMLGLLGGGDLDEESWEEVEDTLLIADLGPVVTESVIGALRT
EMAAKNVRTEADARAVLREVLMAELRPELPRSIRALPHADKPSVLLVVGV
NGTGKTTTVGKLARVLVADGRRVVLGAADTFRAAAADQLQTWGSRVGAEV
VRGPEGADPASVAFDAVDHGISAGADVVVVDTAGRLHTKTGLMDELGKVK
RVVEKRAAVDEVLLVLDATIGQNSLPQAKVFAEVVDITGVVLTKLDGTAK
GGIVFRVQQELGVPVKLVGLGEGPDDLAPFEPGAFVDALLG
118473365YP_885555.1 taurine transporter permease TauC [Mycobacterium smegmatis str. MC2 15MVIPPAEPQAGRGRRFRALTWRLVRPVVVIALFLGVWETAPRIGMVDNVF
LPPLSHVVQAWFTLLGNGQLWEHVSASLSRALAGFALAILVSIPLGVAIG
WYRPVADFLNPILELFRNTAALALLPVFVLILGIGETSKVALVVYASAFP
ILLNTISGVRTVDPLLIKSARSLGLSPVRLFQKVVLPAAVPTIFTGLRMA
AASSILVLIAAEMVGAKAGLGYLITASQLNFQIPNMYAGIVTIALVGVVF
NSVLVAIEGRLSGWRNTN
118473364YP_889978.1 gas vesicle synthesis protein [Mycobacterium smegmatis str. MC2 155]MTVESIHAPRTDDVALVDLLDRLLAGGVVIAGDLTISLADVDLVHISLRA
LISSVGTLMEPVTEPR
118473363YP_884575.1 formate dehydrogenase subunit gamma [Mycobacterium smegmatis str. MC2 MKRTTTGETSVATLVREIAADHRDHRGPLLPILHAVQERLGCVPAEAVPV
LAEELNLSRADVHGVITFYHDFRSEPAGRTTVRVCRAEACQALGASRLVA
HLQDRHGVQLGDATDDGTLTAEQVFCLGNCALGPSAQVDGRLYGRLDEAR
LSALIDSAVTR
118473362YP_887834.1 hypothetical protein MSMEG_3531 [Mycobacterium smegmatis str. MC2 155]MDAVIGVSVTPSTVGMVLVEGDSAADFEAVNLDLELFDVAGLDLSRARAA
RKEIVATVARAENVAADNGRRLRSIGVTWSDGADMQAAELVGDLNEAGFD
NVVDVRFRQATDALANSIADMAGFATTVVCVFEPEGALALTVDRRDGVVD
TARSRAIGSVRGLVGWLERLLAASGRVPDALVVVGSAVDLDADVDRLMPK
LQAALGIPVFTPADGDLALARGAALVSARRGRFMFPDKADQQRSRWTSRQ
LAPAAMLLVGVVTFVVSLSLAISQQMSPREQAFERPTRPVVNTSGTPAAV
RQLPPALPAAPPPPPQAPPAAEVAEAVPPAVDPPLADVAESPVEQALPQL
PPQLPLPDAATALPPPVVIPAPPTKKPLLSRIRDRLRGEPDVPEQMVIGE
PPPPAEITPIPPPGAPPAPPVDDAPAPEAPPEPPPAPEAPPAADPPPPAD
VPPPDPPPAEPAPVEPEPAPEAPPAP
118473361YP_890628.1 hypothetical protein MSMEG_6415 [Mycobacterium smegmatis str. MC2 155]MRMDPQRFEELVSDALDQVPPELAAAIDNVVVLVEDRNPDEPEILGLYQG
VALTERDSWYAGSLPDTITIYRDALLDICDTEDDVIDEVAITVIHEIAHH
FGIDDERLHELGWG
118473360YP_889214.1 hypothetical protein MSMEG_4962 [Mycobacterium smegmatis str. MC2 155]MTEKTTCAVVGGGPAGMVLGLLLARAGIEVTVFEKHADFLRDFRGDTVHP
ATLRLLDELGLFEKFDALPHSRVERARFDLGGREVTVVDFGRLNLPHRYI
ALVPQWDFLDLLADAAKEEPTFTLRMQTEVTGLLKDGDTVTGVRYHGPDG
PGELRADLTVACDGRTSRVRKEAGLAPREYPVPFDVGWFRIDRIKETAYQ
LTPRISSGQALILIPREGYFQAGCFLPKGGEKQLHARGLEVFRAQVAEAV
PEASVDRLTSWDDVKVLDVKLNRLRRWYRDGLLCIGDAAHAMSPVGGVGI
NLAIADAVAAARILAEPLRTGRVTRRDLAAVEKRRYVPAAVIQAVQRVLH
IGLRRALLGGEIRQPPERVLKAVGAVLSRFPGLAKVPAYLVGVGPLPEHA
PDFARRSR
118473359YP_886707.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium smegmMSQISRDEVAHLARLARLALTEDELDGFAGQLDAILGHVSQIQSVDVTGV
EPTDNPLKDVNVTRPDTVQPCLTQDEALAAAPKAADGRFAVPRILGEPE
118473358YP_890558.1 6-phosphogluconate dehydrogenase [Mycobacterium smegmatis str. MC2 155MTTTPTVTVLGLGPMGQALSRALLDAGHTVTVWNRTESKAQALRDRGALS
APTPAAAIAASDLALVNVVDHDAVDAILTAAGDAPAGRTVIGLSSDTPDR
ARRTAKLVGNVGGRYLDGAIMTPIDTIGTRGASILFAGPQALFDEHRGVL
DTLGQLTWVGEDHGRAAAFDMALLDLFWTSVGGFGHALMVARANGIEPSE
LMPHAHGIVGILSPIFTEVAQRVEDDRHSDASASVSSVASSVRHLIAASR
EAGVDAGLLEAFRGYVDATVAAGHGDDEISRIASEMTTLTRG
118473357YP_886412.1 NADH dehydrogenase subunit M [Mycobacterium smegmatis str. MC2 155]MVSTFPWLTVLWAVPVVGAAVVILLPAAQQVLAKWLALAVSVLTLAVTAV
VAIGFDPAAAQYQFVESHRWIPSFGTGYILGVDGIALALVVLTAVLVPLL
IIAGWNDASRQTGLAGRSVQAYLALTLAVEGMVLMSLVALDILLFYVFFE
AMLIPMYFLIGGFGGENRSRAAVKFLLYNLFGGLIMLAAVIGLYVVTAGS
DAFAAGTFDFREIVAAVSSGEFAVNPAIMNFLFLGFMFAFAVKAPLWPFH
RWLPDAAVEATPASAVLMMAVMDKVGTFGMLRYCLQLFPDASTYFRPVVI
TLAAIGIVYGAVLAIGQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGS
TLYMINHGISTAALFLIAGFLVSRRGSRLIDSYGGVQKVAPVLAGTFLVA
GLATLSLPGLAPFISEFLVLIGTFTRYPVVAVFAATALVLSAVYILWTYQ
RMMTGPVRDGIGDGDRPVRDLVPRELVVVAPLLALLLVLGIYPKPALDVI
NPAVEHTLTTIGQTDPEPTVPPTIAEGAR
118473356YP_890200.1 hypothetical protein MSMEG_5974 [Mycobacterium smegmatis str. MC2 155]MGTSGKNHAIGHAVSRSTACSGSRRQKGIIAHQSLALRNTLNSDHLPRCV
FF
118473355YP_887773.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMSRWEPDARGRLERAALELYAERGFELTTVAEIAERAGLTERTFFRHYAD
KREVLFGGQHVLQELFVGAVATAVGAPWASGPAVAALDAVAAGLDTVGEM
FAGRHADARRRQAVVNANTALQERELIKLATLAAAIAEALRDRGIPRATA
EVAGEAGIAVFKVAFARWVEVEHETDLRMVMREVLDDLRNLFVAG
118473354YP_889354.1 hypothetical protein MSMEG_5105 [Mycobacterium smegmatis str. MC2 155]MTVLRALALVVAAVIVLAGCGNPDRDADRQAIEEALRQWPQAFNDRDIDA
VCGLFADDAVLAYPDSADRDRDAFCDQMRDRFNDPSKSLHYDEPDIKEIL
VDGDLATVRLVWTLTVRDSAGAVLETVHEDGVDVFQRQPDGRWKIHISHA
FTQ
118473353YP_886803.1 nicotine dehydrogenase chain A [Mycobacterium smegmatis str. MC2 155]MKPAPFQYLRPATVAEALEQLASYPDAKVMAGGQSLMALMNLRLARPGVI
VDIGRLDELRRIFDDTEDLILGALVTHRTVETDPLIAARAPLLADAARYI
GHVGIRNRGTIGGSVAHADPAAEMPLSTLVLDATFHVESATRGRRQVRAE
DMFVSYFTSALEPDELITWVSIPAARYGQGWGFVEYAHQHGDYGLAGAGA
VLGLDADGRICELRCAVLSAADRPLLFVGDDAVGERPSARLWETLASRWA
RSTDPSSDDPDYSRQLCETALFEALTEATRRVGERQERVDAYR
118473352YP_886043.1 RNA polymerase sigma factor SigJ [Mycobacterium smegmatis str. MC2 155MTTAARTDQFEALRPHLLAVAYRLTGTYADAEDIVQEAWIRWAGQEAPIE
NLQAWLTTVVSRLGLDRLRSAAHRRESYYGEWLPEPVVTGIDGNDPLNAV
VAGEDARFAAMVVLEQLSPDQRVAFVLYDGFGVPFPDIADVLGVSAASAR
QLASRARRAVADAPPPVDDNTHNEIAGALMAALAAGDMDGVVRLLHPDVT
FTGDSNRKAPTAPRVIHGPEKVARFLFGLARRYGPNWLAGAQLALINGEL
GTYTPGAPAGDGYPELLPRITAMTVRDGKVCAVWDVANPDKFTGSPLGTA
VRRP
118473351YP_888747.1 acyl-CoA oxidase [Mycobacterium smegmatis str. MC2 155]MTTTAEHLRNALDGRWRDVKNAMRENLSNEVFRPHYTPNTAIARAKVAEQ
LKIMAAAGAAEDGFRKEHGGNGNVGAAIAQIEMLAMSDLSLMVKAGVQWG
LFGGAIENLGTERHHQAYVRRIIDLDLLGCFAMTETGHGSDVQSIETTAT
YDPATQEFVIHSPTPTARKDYIGGAAETARVAAVFAQLITPDGMNHGVHC
LVVPIRDDEGNDLPGVTTSDCHYKGGLPGVDNGRIVFDHVRVPRENLLNR
YADVSPEGVYSSPIENPGRRFFTMLGTLIRGRVTVGGSAAAAARVALDIA
TRYALQRTQFSAPDDEHEVVIMDYLVHQRRLLPLIAKSYALQFAQNELVA
KCHELQTSDDPDPEEQRELEARAAGLKAANTWHASTAIQEAREACGGAGY
LAENRLIALRADTDVFTTFEGDNHVLTQLVAKELLTAYADDIKGMSPVEW
VRFAANFAGERVLKRTAAQTIIQTILDTRQDNEEEGSLFNRGTQIKMFED
REEYMVASVARRLQGKAKEMSAFDAFNAVQDHVLHAAQAHIDRVILEAFV
AGIDACEDEAARELLADVCDLYALSVIEEDKAWFIEHRFLSTERAKAVTR
GINERCRTLRPHAETLIDGFGIPEQLRYAAMLDPEELLNG
118473350YP_889652.1 hypothetical protein MSMEG_5411 [Mycobacterium smegmatis str. MC2 155]MSEPVGQPYDPLRLCVYATVALLAWLLGPWAVAGFAALGLVGYVRARRAG
LMHSKCALRDTRLVIGYLGVIAAVAVAAIVASYWPR
118473349YP_888815.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MTRFLLARAARMVLTVFAVVLITFGLTRVAYRNPARMLAPENASEETIAA
IANSLRLNDPWYQQLWYYVVRGPEIKGTPTGLVNWPPSLGYSYRQQRPVT
ELILEKIPVTFSLAAGALLLWITISVVLGVYAARRPGSVFDHVTSGVSYV
LLSVPTFVTGVILLFVLYYQLSLAGVKFFPSGGYVALTESPAEWARHLLL
PWTTLVLVEVGLFQRVVRASVLEVADKDYIRTARAKGLGAHGVYFNHALS
AALNPILTLGAIEFAAILGGAIITEQIFGLDGVGRLAVNAANNGDAPVVI
GCTLLGAVIFVVSTFVIDVITHARSGK
118473348YP_887564.1 hypothetical protein MSMEG_3253 [Mycobacterium smegmatis str. MC2 155]MGRSPSLARRFFDRLEPVHAVTYFSGESRSALEGLGFRGFWQGYFAARSA
PLGRVAPEVVAAVFYNFTPERVAKTLPAVWDLAAPSTVLAVRSEAAVAAL
RRAGVTDSPATRTAADLAAAAARNAPLDARPLFAANRALDWPDEPVAMLW
HAVTLLREQRGDAHVAVLAAEGISGRECNVLHAAAGRVPAEMIKRSRDYD
DEQWNLHVDALRRRGWLDGAGELTEAGRAIKKHVEDRTDTLALTALEALT
DTEVETLFATLTPITRLVVAAGDIPVDTPMGLRRDDLDDDSAHLT
118473347YP_886228.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
LTESECARVVEVLNSARFVDAAPMQVWATLLDEGSYLCSVSTMYRVLNAN
KLVKERRRLARHRKAVCPELVATAPRQVYSWDITKLAGPVKGVYYDAYVM
IDIYSRYIVGVHVHARECGQLAKEMMEQIFGTYGIPHVVHADRGTSMTSN
TVAGLLSDLGVIRSHSRPKVSNDNPYSESWFKTLKYAPAFPERFESIHHA
RDFMDRFVQWYNHEHRHSGIGLHTPADVFYGLAGGKDTQRRAVLADARAR
HPRRFGRDTAPKVIDLPESAAINPPKPAEQETETEAA
118473346YP_885497.1 twin-arginine translocation pathway signal [Mycobacterium smegmatis stMPAADLVFYGTVMTVDPARPTAEALAVSGGQIVAVGDRADVAQWVGPDTD
VRELGNSCVAPGFVEAHGHPLMEAVAVSDRIVDIRPVTLGTADAVVDAIH
AEVAKRGAAGAYLNGWDPLLQTGLPEPTLAWLDGIAPEHPLVILHNSGHK
AFFNSAAARAAGLTRDTPDPKGAKYGRDANGDLDGTAEESAAVFTLLGGA
ISVADYPAMLRAECARLNRAGLTTCSEMAFDPMFRPLLANLHDHLTVRLR
TYEMSTAALHTDAQPFEGDDVVRQVGIKIWVDGSPWIGNIDLTFPYLDTD
ATRTIGVVPGSCGHANYTPEQLAEIVDTYYPQGWQMACHVHGDAGVDTIL
DVYEKALRRWPRDDHRLRLEHVGAITPEQLQRAHDLGVTCSLFVDQIHYW
GDIIVDGLFGAERGERWMPVGSAVATGMRVSLHNDPPVTPEEPLRNIAVA
ATRTAPSGRVLAPEQRITVEQAIRAQTIDAAWQLFSDDVIGSLEVGKYAD
LVVLSADPRATEPARIADLDVQATFLAGRQVYPALG
118473345YP_886494.1 phosphoglucomutase [Mycobacterium smegmatis str. MC2 155]MSANPRAGQPAQPEDLIDVAHVVTAYYTRRPDPEDVAQQVAFGTSGHRGS
SLDTAFNEAHILATTQAIVEYRAAQGITGPLFIGRDTHALSEPAWASALE
VLAANDVVAMIDSGDRYTPTPAVSHAILTFNRGREGDLADGIVVTPSHNP
PRDGGFKYNPPNGGPADSDATSVIAKRANEILADNLKAVKRMPLARALQT
VHRYDYLDAYVADLPNVVNLHAIRAEGVRIGADPLGGASVDYWGAIAERH
QIDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPNAMASLIANRDAYQIAT
GNDADSDRHGIVTPDGGLLNPNHYLAVAIDYLYTHRPDWPQSTAVGKTAV
SSSIIDRVVAGLERKLVEVPVGFKWFVDGLVGGSIGFGGEESAGASFLRT
DGTVWTTDKDGIILALLASEIFAVTGKTPSQRYAELAEQYGAPSYARIDA
PADREQKARLSKLSPEQVTATELAGEPITAKLTAAPGNGAALGGLKVTTE
NAWFAARPSGTEDVYKIYAESFKGPEHLAEVQQAAKDVVNTVIG
118473344YP_890970.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MWVTVIDEDRADALFHALADRTRRDIMRRVLAGEQSVSALASKYDVSFAA
VQKHVAVLEKAGLLTKRRRGREQLASGDVATVRSVSQMLAELEQIWRGRI
ARIDQLISSEPLKED
118473343YP_886174.1 ChaB protein [Mycobacterium smegmatis str. MC2 155]MPKTTREGTAKKSELPSTLKKSDAKAQRTFAKAHDAAAEEYGEGERAHRV
AYSALKHSYEKVGDHWEAKKRRGPSDERALSGGPNAKGRSAEGVDAHASK
AHLLQIARRLDIRGRSTMNKGDLVTAIEKANRRETRARR
118473342YP_890830.1 luciferase [Mycobacterium smegmatis str. MC2 155]MDLGFVSLNTPRDLAPDVLARELESRGFESLWVGEHPQIPVAAAGQFHPG
LLRAQRQIRDPLLSLMMAAQATTTLRLATAVALPLEHELFTLAKQVATLD
RMSGGRLLFGVGVGARAELEVATSIPWQARYRALGDMVGALDALWRDDES
EHHGEFFDFDPVWSHPKPHQRPRPPVLAAATGPNAIRECLAWADGWLPGD
AALRDVERALTRFRRTAEDAGRDPATLDLTIMAWGDPGVDVLARYRDLGF
NRTVIGGGRRGGSDHTATLEFIDHYAEMLGKLS
118473341YP_884981.1 hypothetical protein MSMEG_0570 [Mycobacterium smegmatis str. MC2 155]MPEMTFEVRWPDGSTQRCYSPSLVIHDHLTAGTHYAVDDFVERSSRALAE
ASERVRAKYGFACTSAAETRQRIVNVARRFSGDAVLEVVAMHPEPGPS
118473340YP_891000.1 inner membrane permease YgbN [Mycobacterium smegmatis str. MC2 155]MDEITLAERPAALLVVIALVAIAVLLFLIIKVRLHAFFSLIVVSVLTGLA
AGISMGDVINVVIAGFSNTVGSVALLVGFGAVLGRLVEMTGGAQVLADKM
LDRFGEKRAPLALAVASLFYAFPIFLDAGFIVMLPIIYTVARRLGGSFML
YVLPSIGAFLMMHALTPPHPGPTAAATVMGADVGMVVIVALLVGLPTWYL
AGYRLSLIIAKRYPNMPVPNLLGEPKDYPEDERPGFWTVILVLLLPLVLI
FFNTVFSTLEADGAVTKDNVFFQLSRLIGTTSIALLISVLLAMVLLYIRP
RRRRNERIGGLLEDLVDDALAPVCSIILITGAGGAFGRILTETGIGKTLA
DGLDAFGLPVILAGFLIAIAFRVAQGSATVAATTAGSIMAPAVAELNLTG
VALAAIVVAIAAGSITFSHVNDSGFWLVGRFCGFDTVTTLKTWTVVGTAI
GFMSFVLATAVYLVAS
118473339YP_887873.1 hypothetical protein MSMEG_3570 [Mycobacterium smegmatis str. MC2 155]MQTGGPAADALRLSTPDPGAVARSLVGALAMTTAALALASPPAAMWTLGA
GVIAGAVALQRSPGGRVPLVVTASLEMAIVVALAVLTGSHDVVFVLAVAV
WCFAAGMQWSVGANAGLIASAASSLLVIAPPDGYATAPTAFDGLLAPLLV
FGAGVLQAVLIATLPPHRWRVQREGLTRAYRSLATDARNVAADRSADVDD
APLTWLREVFADSEAAQRSRANYGGYQVPERIAVTLAELRSAYAEPASDA
PGVPRLLAAAAALLDAIADQGHTARRDAEHALVRVDSAVASVDGPEKALA
QRLGDLLREAAVLRFGQLHRPDLIGSLASAPSVVRSHLRWTSPILRHAVR
LSAATALAAVAARFGGVEHGHWIALTVLVVLRPETAHTYTRCAGRIATLA
AGVTVASGLTLMWQPEALPAAACALALVALAYWLSRFGYLAVGVPLGAAL
MFFLGVGGAAEWSGLADRLVEILIGGGLAVMAHVALPDHALIRLRQRAGE
LLMTEIDYAAMVVRAFVHEIDHPAEALSAAWQRAFRARAAFEAAWGAARL
DSPTLRRWLRSYRTALNSVTSACTTLENNLPTHPSSALHPDFQAAVDDYV
TALRGAPPSPAVPWSLDTGELAAALRRVQEVASTLAADNGAARILVGELS
TITRSLIGISIDRVTPAGESS
118473338YP_889427.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
PAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIE
PSSKADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGL
GPASLVLFDVSTLYFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFP
LTVEAFEGNRAETATMLPVINAFKAAHQLTDVTVVADAGMISEANQVALQ
SAGLSYILGAKIPFLPDVVREWRDKHPDEAIPDGLVLTQPWPATSSEKAR
GIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPVKRNRYIQLTG
ATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFRM
SKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTA
RRYRTVKIKAGTQTLTAADPLPEDLRAVLIKIRADGAH
118473337YP_887660.1 hypothetical protein MSMEG_3353 [Mycobacterium smegmatis str. MC2 155]MDGMVATLATDVELVSPISGRMVFRGRDDLRVLLAAIYGSLRELKWADAV
GDATVAVAVSEGNVAGIRITDALVFDLDESGQIRRLRPHLRPLLAIIVFT
AMLGPKMARHLGVVRRALSRP
118473336YP_887489.1 lipoprotein signal peptidase [Mycobacterium smegmatis str. MC2 155]MTDETSGPAEPVTDAPGDAESPAQPKRRLRLLLTVAAVVLFLDVVTKVLA
VRLLTPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLVATGVVIGI
IWMGRRLVSPWWALGLGLILGGATGNLVDRFFRSPGPLRGHVVDFFSVGW
WPVFNVADPSVVGGAILLVALSLFGFDFDTVGRRRPGEDAEPSAGASDST
PEAPAADGPDKPAGPVGPEDAAEESKTVGHQAEPS
118473335YP_890186.1 hypothetical protein MSMEG_5959 [Mycobacterium smegmatis str. MC2 155]MDELSDEEIDAWHALRASNQALDSPYFHPGFAAAVHATGRPVSVVVVRDA
AGAVSALLPGHREGAVLHPVGWPAADFQGPICGPGEAPSPLELLVDGLRV
LTFDHLVPQKAGFEPWIVSRRSSPWMDITGGLDGYLDRVSRSGRDKMKEA
RRCRVRAERTHGPLRFGVDVVDDDALARLIELKRAQYVKTGSRDYFAKSA
HVQLMHRLLHTRGPGFGGVLSTVHIGDRLVAAHFGIRSGHVLHWWFPVYD
PAFAQLSPGWILLREVIDAAAEIGITRMDLGRGDDDYKRRAKTGETVVSQ
AFVSNSVTRRVMRSGRQAMTDAVKRSPLAPSLRRALHHVRGVKSSGFPRS
VWT
118473334YP_890066.1 hypothetical protein MSMEG_5840 [Mycobacterium smegmatis str. MC2 155]MAVFATLVLGTVIARIVGLLGVAYVDTWSSAAAVGLAAMFALTGIAHFVD
PLRRDMIAIVPPRLPAPGLLVTVTGALELLGAAGLLYPPTRVAAAVCLFV
LMLAMFPANVYAARMPDPPKSMTSKLGVRTAEEGVYLAAAVLVAIGGGQ
118473333YP_886893.1 beta-glucosidase [Mycobacterium smegmatis str. MC2 155]MTDPLAHAPTLTLTQQAALGSGASFWTTEAVGHIPSIVLTDGPHGVRRQS
GASDHLGVGGSEPATCFPPAVALSQTWDPDLVERVGAALGAEARALGVHV
LLGPGVNIKRDPRCGRNFEYFSEDPLLSGVLGAAWVRGVQGRGVGASLKH
FAVNNSEHDRMRASSDVDARTLREIYLRAFEHVVREAAPWTVMCSNNRIN
GVYASENTWLLTDVLRGEWGFDGVVVSDWGAVRDRVAAVAAGLDLEMPSS
GGFGDAEVVAAVTAGALDARAVTTAAERVAGLAVRAYESHSAAGHFDIGE
LTEAHHRLACEAAAQAVVLLKNDLRDGEPILPLAPSRLAVIGPFAEEPRH
QGGGSSHVNPTRLDIPLDEIRARNGDQAATHFPGLPTDSGQDSEQVRAEA
VRGAAEAEAAVLFLGLTADEESEGYDREHIDLPQAQLALLRAVVEVQPRT
VVVLSHGGVVRLDEVAKHAPAILDGALLGQAGGGAVADVLFGAVNPSGRL
AETVPVRLQDCPAFLNFPSENGHTVYGERVFVGYRWYDARALEVTFPFGH
GLSYTAFAFSDLEVDSDGPTVRVVVANVGPRAGREVVQVYVSKPDSQISR
PPRWLAGFGSLSLESGERRTLEIPIRRTDLAFWEIRSGQWGVEPGDYTVS
VGASSRDLRLHATVTVEGDVPRAVFTRESTLGEILADPAAAPLLFETLGT
AAQDAPAMGTDLLRMLESVPIERMVALSGGKVTPERLDDLLAALNAVRP
118473332YP_890470.1 hypothetical protein MSMEG_6251 [Mycobacterium smegmatis str. MC2 155]MIEPMRAVTVGLGVAGLVLASVAPAAARPSDPGVVSYAVMPKGSVSNIVG
APIRWESEFTAPFQAFSVDNPVCNNWADIGLPEVFNDPDLASFGGATAQT
AAGDATHLVKQAVGVFATVDAADRAYHRVVDRTVGCAGQTTAMHLDNFHT
EVWTFTGGPAGPADADWVKQEAGTDRRCFNTTRKRENVLLQAKVCQSGNG
GPAVNVLAGAMQNTLGQ
118473331YP_889060.1 hypothetical protein MSMEG_4804 [Mycobacterium smegmatis str. MC2 155]MAHVFTFSRTKLAIAAAGFAAALPLSAGIASAQPDFSAVVNTTCSYEQVM
AALNAQQPDLAAQFNTSPMAQGMLRNFLAAAPAERQQTVNQLQTNPMAQQ
YFGTISSIASSCSRY
118473330YP_887165.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MSITVGPPSDHPDTETRRNKSLSALRAAPWSARISGALLVLVAAWAVAPG
VFTSADPLNGNRLEKFQPPSWAHWFGTDHLGRDVLTRVIHGTSHTLLTAG
LAVAVGLVVGSIIGILAGVSGPVADAVGMRLSDVLLALPGFLVSVWIVTA
YGAGPLSVGIGVGIGSIAIFARVFRAEVMRVRALDYVEAAFLSGESRWSV
IRRHIVPNAIGAVVALAVIDLSAAILAISALGYLGYSAPPPTPEWGLLVA
EGRSYLATAWWLTSLPGAVILVVIVALGVVSRRVLKSNNI
118473329YP_888610.1 diacylglycerol kinase [Mycobacterium smegmatis str. MC2 155]MTGRVTVLTNPMSGHGNAPHAAERAVVRLQQRGVDVTAIVGRDARHAREL
VREHLDRGTDALVVVGGDGVIGLALQELAGTDVPLGIVPAGTGNDHAREY
RIPTGDPEAAADVIADGHTRTVDLGRIDADDGTRRWFGTVVATGFDSLVS
DRANRMSWPHGRMRYNLAMVAELSKLRLLPFRLSFDGGDAEDHALTMTAI
GNTRSYGGGMLICPGADPTDGLLDITMIASASRSRLIRLFPTVFKGTHVN
LDTVTTRRARSVRVECPGINAYADGDFAAPLPATITAVPGALKILTSAPG
118473328YP_888109.1 hypothetical protein MSMEG_3817 [Mycobacterium smegmatis str. MC2 155]MRAVDVYTVEPWGLYMARPTPGRAQFHYLQSWLLPSLGLRATIFHFNPGH
ERDQDFYLDVGHYTPGETRWHSEDHYLDLVVRTGRGVELCDVDELLTAVR
AGLLPQEAGEQAMQTAAAAIDGLARHDYDLDRWLTTKGMALSWRAA
118473327YP_889725.1 sensor histidine kinase [Mycobacterium smegmatis str. MC2 155]MASATCCGKRLRSEMAFPPNSWRPTGPLPTSSLSLRWRVMMLAMSMVALV
VVLMAVAVYAVVSRALYDDLDNQLHSRARLLIESGSLAADPGKAIEGTAY
SDVNAMLVIPGRSIYTANQQGQTLPLGEPEKDVISGELLMSLRTANHQRV
LAVHLANGSSLLISKSLAPTVQVLRRLGTVLLIVGGIGVAVAAIAGGAVA
RAGLRPVGRLTEAAERVARTDDLRPIPVVGSDELARLTEAFNMMLRALAE
SRERQARLVSDAGHELRTPLTSLRTNVELLMAAQEPGAPPLPEDEMAGLR
ADVIAQIEELSTLVGDLVDLTREDAGGITPEPVDMADVIDRSLERVRRRR
NDIEFDVDVIGWQVFGDAQGLGRAVLNLLDNAAKWSPPGGRVGVRLHQVD
HMHAEIVVSDQGPGIPPEERRLVFERFYRSDAARAMPGSGLGLAIVQQVV
LKHGGALRIDETVPGGNPPGASVHMLLPGQRIPDPGATRSAEGFVDDRGG
HTVATE
118473326YP_886342.1 molecular chaperone GroEL [Mycobacterium smegmatis str. MC2 155]MAKELRFNSDARARLEQGVNALADAVKVTLGPKGRNAILEKLTGPPTITN
DGVTIAREIQLRDPFANMGAQLVKEVAMKTNGVVGDGTTTATVLAQAMVR
EGLAAVEAGANPMRVRRGIERTVPVVVESLRSHSVEVGSSSDLRRIAALA
ASDDEAIGDVIAAAVEHVGKTGVVTTEESDTLGMAVDVVDGIEFDHGYTS
GYMVTDPERMEAVLDNPLILLTNKKISQVQEIMPTLEVAKRADRPLVVIA
EDVDGPALQLLVGGNMHKTMQSVVVRAPGFGHRRVAELEDLAVALGGHVI
AKDTGIDLGEVAREHLGSCDRLTATESDTTIVGPRGHQNLVDARVAQLEV
QRERARIDADRDILDLRIARLTGRVAVIRVGGATSVELKERMLRVEDALA
ATRAALEAGIVSGGGTALAQAHRVLDAVELVGDEAIGRDVVRRALSEPLR
WIAFNAGFEGGDVVDVVADLPLGHGFNALTGEYGDMFEEGIIDPFKVTRA
ALESAASIAALLITTETAVVEEILGQPGAIMAPGFGDLAEGMVRPSNIY
118473325YP_890633.1 abortive infection protein [Mycobacterium smegmatis str. MC2 155]MTGPLEHREHSEHRQPSRRTIKIEIVVVLAVTFGLSAYTALLRLIEAVLL
GLSGQTVALNPRRSPFDLIDLGLHLAGVFNLLAWGALALYLLWRSGIGPK
AIGLGRPQARADGLGGLALAALIGLPGLGFYVVARILGLSADVEPAELYD
TWWRIPVLLGSAFANGWAEEIIVVGFLLTRLRQLDISPTRALVLSALLRG
AYHLYQGYSAGPGNLVMGLVFGYAWQRTGRLWPLIIAHTLIDAVAFVGYA
LLAQHLGWLR
118473324YP_890096.1 hypothetical protein MSMEG_5868 [Mycobacterium smegmatis str. MC2 155]MADAVRWEAEGEEPASPNERDDRFEWMDLDVPAASWWEVADHPELIRRGV
DGWVFFDCTDSPDDPDNVVLTYYRPFKVPVSHGARPAWRGRRFERGTCAT
RH
118473323YP_890295.1 TrmH family RNA methyltransferase [Mycobacterium smegmatis str. MC2 15MAGNSQRRGAVRKPGTKKGPTVGSGGVRRRGLEGRGATPPAHMRPNHPAA
KKARAAAKAQQQRAGRKADETELVLGRNPVLECLRAKVPATALYVALGTD
ADERVTESVQIAADRGISILEVPRTDLDRMSNHGLHQGLGLQVPPYAYAH
PDDLLATARADAAPALLVALDNISDPRNLGAIVRSVAAFAGHGVVIPQRR
SASVTAVAWRTSAGAAARVPVARATNLNRTLKSFADAGLQIVGLDAGGDT
TLDELDATGPTVVVVGSEGKGLSRLVREHCDAIVSIPMAGPTESLNASVA
AGVVLAEIARQRRS
118473322YP_885951.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMARGADFLQLDPASAPARGLTSWLVDALRSAIADGRLPPGVRLPATRTLA
GELAVSRGVVVEAYRRLADEGLVSGRTGGGTRVLARPVRPPRRARTAAPL
DRPRLPRSRLPTGEGIDLSPGVPDLSAFPRSTWLRAERAVLSETAPEDLG
YGDPRGHPRLRAALAPWLGRTRGLRVDPDDILVVAGVAQAVALLAQQLRR
EGLDTIAVEDPGSRGAVDELEYWGLRAMPVPVDDEGIQVQSLGETGAAAV
FLTPAHQFPTGVVLGPRRRRELLAWDGELVIEDDYDAEYRYDRAPVPALH
PSAPERIAYAGSTSKTLAPALRLGWLVAPRRRHPDLVAAKHATDLGSPTV
PQLVLARLLESGEYDRHIRLVRARHRARRDALLETLATALPAARVTGVAA
GLHLLVTLLADVDDVALADELRRAGVLVHPLSWHRRTPGPPGLVLGYASH
SPDRLREAGSIIARIAE
118473321YP_887884.1 FabG protein [Mycobacterium smegmatis str. MC2 155]MSAHEHVHEDSVAGQVVTITGASSGIGEATARLLAARGASVVLGARRTDR
LDRIVEEIRSTGGAAVAVAVDVTRRADVDNLVATAVREFGRLDVLVNNAG
IATLGPLADGDTDTWSAVIDVNVRGVLHGIAAATPVFTCQGRGHVITVVS
TAGLKIVPEMGVYAGTKNAVRTIMEALRQESTDGVIRTTSISPGYVRTEL
GGPPGGPAGNAARATMDRIGLPPDAVARAIAFAIEQPHDVEIGDLTIRPT
VQG
118473320YP_889470.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium smegMSGKRVLLAEPRGYCAGVDRAVETVERALEKHGAPVYVRHEIVHNRHVVE
TLAKAGAIFVDETDEVPEGAIVVFSAHGVAPTVHQSAAERNLKVIDATCP
LVTKVHNEAKRFARDDYDILLIGHEGHEEVVGTAGEAPDHVQLVDGPESV
DAVTVRDESKVIWLSQTTLSVDETMETVRRLREKFPTLQDPPSDDICYAT
QNRQVAVKAMAPECELVIVVGSRNSSNSVRLVEVALNAGSDAAHLVDYAD
DIDPAWLDGVTTIGVTSGASVPEILVRGVLERLAEHGYDTVQPVTTANET
LVFALPREIRPPRG
118473319YP_889527.1 LpqV protein [Mycobacterium smegmatis str. MC2 155]MRSYPWARKTAAGFAAAAGLSLLTACGSDTGKNTEEGQPAESSSVSAPAS
TSAEAAPPTVAPGEVGVSPGGVTTAVGAPAQSTEEEYFQACHAAKVWMDE
KGGDPRAQIEPYLASLQAPDAAPGPGTYDKTWAELEPARQAAVIVAVAAA
ADDMCG
118473318YP_885469.1 polysaccharide deacetylase [Mycobacterium smegmatis str. MC2 155]MASESAPGLVWPEGKVAAAAFTFDVDAESAILWGNEAVGARMSVMSHQAY
GPLVGVPRILDLLDRHQIASTFFVPGHTAHRYPDAVRAIVAAGHEVAHHG
YLHEQPTALTLEEEIEALDRGLEALAEVAGVTPAGYRAPMWDLSWHTPGL
LAERNFLYDSSLMDADVPYELAVGDTSLVEIPIQWALDDWEQYCFLPDIS
GSGLIESPRKARELWQLEFDALRRAGGCWVLTNHPFLSGRASRAAELDDL
MRYVTEHADVWTTNLGTLARHVRAQGLTPRSITQPGK
118473317YP_890359.1 metallopeptidase [Mycobacterium smegmatis str. MC2 155]MTRSKKVAKKAGHPPVIDPYLPGNGNFGYRVSRYELDLEYKVASNRLTGT
ATITAVTLAALRTFTLDLSDNLSVGKVSVNGRRPAQFRCSGAKLHITLPA
ALPAGSAMTVVIRYSGNPRPIDTLWGDVGFEELTNGALVAGQPNGAASWF
PCDDHPSAKASYRIQISTDSPYHAVANGELLSRKVRAGHTVWTYELAEPT
SPYLVTLQIGMYESHRMTKTPVPMHAVLPPRLRSAFDHDFERQPQMMKLF
VKLFGPYPLSTGYTVVVTDDDLEIPLEAQGISIFGANHCDGSRGSERLIA
HELAHQWFGNSVTARRWRDIWLHEGFACYAEWLWSENSGGRGAAEWAQHY
YDKLRHSPQDLLLADPGPRDMFDDRVYKRGALTLHVLRERIGDKNFFALL
QDWTTRHRHGTAFTDDFTGLAAGYTSESLQPLWQAWLYSEALPPL
118473316YP_889396.1 mannosyltransferase [Mycobacterium smegmatis str. MC2 155]MLLVVSILARLAWTYLVPNGANFVDLHVYVGGADALDGPGALYDYVYADQ
TPDFPLPFTYPPFAAIVFYPLHLLPFGVVAFIWQIGIIAALYGVVRVSQR
LMGLQSQRRVAMLWTALGIWTEPLRSTFDYGQVNVVLVLAVLCAVSTTRW
WLSGLLVGLAAGIKLTPAVAGLYFLGARRWAAVACSAAVFFATVGVSWLV
VGAQARRYFTELLGDADRIGPIGTSFNQSWRGGISRILGHDAGFGPLVLI
GIGITAVLALLAWRAIGGAQDRLGGILVVSLFGLVLSPISWTHHWVWLIP
LMMWLLHGPLSALRGARILGWGWLALTLLGVPWLLSFAQPTIWEIGRPWY
LAWAGLVYIVATLATLGWIAFSRKGSG
118473315YP_886483.1 glycerol operon regulatory protein [Mycobacterium smegmatis str. MC2 1MIQAVDRALRILTVLQGGRRMSLGEIASAIELAPSTVHGLVRTLLAHGMV
QQELDSGRYRLGPATLRLGNVYLDTLELRSRVTVWAESLARRTGCAVRTA
VLLFDEVVVVAHEPRPDGTRQMPEVGIVIPAHASALGKAMLAFQDDYRPE
APLRSMTGETVTDPEVLAAQLAQVRATGMATEAEEAVLGECSSAAAVFDA
TGEVAGAIALVVPAARWPLAPDAVDALRDTARAVSRELGATVWPARRV
118473314YP_890085.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGQYGTNFEDKVAIVTGAGGGIGQAYAEALAREGAAVVVADINLEGAQKV
ADAILGEGGNALAVRVDVSDIDSAKDMAAQTLSEFGGIDYLVNNAAIFGG
MKLDFLLTVDWDYYKKFMSVNLDGALVCTRAVYRKMAKRGGGAIVNQSST
AAWLYSNFYGLAKVGINGLTQQLSRELGGQNIRINAIAPGPIDTEANRTT
TPKEMVDDIVKGIPLSRMGQPEDLVGMCLFLLSDQARWITGQIFNVDGGQ
VIRS
118473313YP_884523.1 cell envelope-related function transcriptional attenuator [MycobacteriMNSPAHALTKPRRRTPRRAVRLARRALVGLTAAAILAGTGMGWVTYHGAL
DGITTSNALAGESGSVGDTENILIMGLDSRLDQHGNPLPEDVYQALHAGD
ETVGGYNANVLIVVHLPGDGGPATAFSIPRDDYVDLAGCPSGICKGKVKQ
AYGFAYQAEMEATESEEEDPATREQKAREAGRKAEIATVRNLLGIPIDHF
VEVTLGAFFEIAKAVAPITVCLNDDTSDPYSGADFRKGVQQIDAAQAMAF
VRQRRDINDENFTDLDRTRRQQAFLAALVSALRQSGALSSPSKLRGLLDV
TKQNVALDAGFDLASFTKRASALTDAPPTLYTLPIKEFGQNAYGEDINII
DVPTIRKIVHDLVSKDDPATTTATPDKPELNGHGATLDVINGSTYTGLAA
KLQTTFAADNFTEGQIGDAEALEPATTIDYGPGADAAAHSLATELGVTAT
PSDWVLADTVRLTIGTDFPGTDYLGADMFTSTTSGASESESYGPSETAEL
TPITTVAATATGTYTPAPTDLSQMTASGIPCVK
118473312YP_886211.1 rubredoxin [Mycobacterium smegmatis str. MC2 155]MSHYRLFVCVQCGFEYDEAKGWPEDGIAPGTRWEDIPEDWSCPDCGAAKS
DFDMVEVSRP
118473311YP_890720.1 glycogen debranching protein GlgX [Mycobacterium smegmatis str. MC2 15MEIWRGKAYPLGATYDGSGTNFALFSEVAERVELCLFDDDGDGGLRETRI
TLPEVDGFVWHGFIPNIEPGQRYGYRVHGPYDPAAGHRCNPNKLVLDPYA
KAIDGQFDWGQPLFSYNFGDPDSRNDDDSAPNMPKSVVINPYFDWGVDRP
PSHDYADTVIYEAHVKGLTQTHPDIPDNIRGTYAAVAHPAIVEHLQNLGI
NAIELMPVHHFANDSTLIDKGLSNYWGYNTIGFLAPDSKYSSSPNPGGQV
QEFKAMVRTLHEAGIEVILDVVYNHTAEGNHMGPTLSFRGIDNAAYYRLV
DDDKRYYMDYTGTGNSLNVGHPHALQLIMDSLRYWVIEMHVDGFRFDLAS
TLAREFYDVDRLATFFELVQQDPVVSQVKLIAEPWDVGPGGYQVGNFPPL
WTEWNGKYRDTVRDYWRGEPATLDEFASRITGSADLYEQTGRRPFASINF
VIAHDGFTLRDLVSYNEKHNEANGEDNNDGESHNRSWNCGAEGPTDDPEV
NALRSRQQRNFITTLLLSQGVPMLAHGDELGRTQQGNNNVYCQDSELSWI
DWESADTELLEFTQKVSALRSAHPVFRRRRFFNGRPVRRPGEPRLPDIGW
YAPDGSEMTDEDWDAGYAKSMAVYLNGQGIPDRDERGQRIVDDSFYMCFN
AHYEPIEFVLPPSDFAEQWVEVINTAADCGTDPIEAGTRVTVESRAMLVL
QAHHD
118473310YP_890860.1 hypothetical protein MSMEG_6651 [Mycobacterium smegmatis str. MC2 155]MLAFLDDLGLERGCPWECLNNGGSDLGLTRRVRPSRW
118473309YP_886824.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium smegmatis strMNTSHASAHQMTTEVVIVGFGPVGKLLAVQLGRRGHSVIVVDRNEASYPL
PRAVTHCSDAARILQSVGLSPDKIPHITEPYDDMYRWRNGDDDTLLDVDW
SGRGESGWYNTYFFNQPALEDALEALVARVDNVRVIRGWEATALRQCEDR
ATVAIRSASTGAEMTIDAEWVIGADGANSKVREWAGLGWHNDGYYFDWLV
VDVKPSHELNFPHIAVQSCDHRRPATMVPGGPGRRRWEFMRLPHESREEL
NTDAKAWELLAPYGVGPGNARLERHAVYTFKACWADRWRDGRVLVAGDAA
HLMPPFAGQGLGAGMRDAMNLSWKLDAVLRGRADAGLLDTYGSERLHHAV
AFVKFSTSLGQVICITDEHEAAARDERMIADWRAGMAPPAPPRPGLGAGP
HVGEAGGTLARQGRIRMGSAEPTLFDDALGGPGAVITRTAATLAEISPDV
RSGLADLGMASVALAGTPSAGIVVADDVDGTYRAWLDELGADTVVIRPDF
HVYGAGPADRTHDLITGLLTSVSGQSVVSAHPVSR
118473308YP_890820.1 hypothetical protein MSMEG_6611 [Mycobacterium smegmatis str. MC2 155]MRHSRRSRRSTRSGPCADQLLGRTARVRGIDHGAPVELEICQIRQQWRGG
RQFTVGDVVDLHVLRSHTGHCVQEVAHLAAQFGGGLRGREFTATQPCCNG
AHGPRVPAFGDLGADRGQHRHLTAGTGERENSRVPTDECHSERDGDPQPH
RRIGCGADQVSQQVIRHARTPRSSR
118473307YP_889164.1 hypothetical protein MSMEG_4909 [Mycobacterium smegmatis str. MC2 155]MRKWKRVEAADGPRFRSALEGHEAALLSSLVGSMLGMLDERESSAPADEL
EAITGIKTGHSRPPEDATMKRLLPDFFRPQTDHPAGSGTAESLNSALRGL
HEPQIIDAKRQAAQRLLDTMPDGGGKFELTEDDAHAWAAAVNDVRLALGT
LLEIGPDGPDRLPPEHPMAGHLDVYQWLTVLQEYLVLELVGK
118473306YP_886017.1 ATP/GTP-binding protein [Mycobacterium smegmatis str. MC2 155]MAYEHSEKRSAASTKIVISGGFGAGKTTFVGAVSEIMPLRTEALVTNVSE
GIDPLEGTPDKRTTTVAMDFGRITLAEDLVLYLFGTPGQRRFWFMWDDLV
RGAIGAIILVDVRRLQDSFAAVDFFEARKLPFIVAVNEFDGAPKHPTHAV
RKALALPEHIPVITVDARDRNSAKAALIAVTEYSLSTLTPLPG
118473305YP_887358.1 bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltMGSSSTDRELLSAADVGRTVSRIAHQIIEKTALDDPAERTRVVLLGIPTR
GVILATRLAAKIKEFAGEDVPHGALDITLYRDDLNFKPPRPLEATSIPAG
GVDDAIVILVDDVLYSGRSVRSALDALRDIGRPRIVQLAVLVDRGHRELP
IRADYVGKNVPTSRSESVHVLLSEHDDRDGVVISK
118473304YP_889378.1 GTP-binding protein TypA [Mycobacterium smegmatis str. MC2 155]MSSHPDFRNVAIVAHVDHGKTTLVDAMLRQSGALTHRGDDSTERIMDSGD
LEREKGITILAKNTAVHRHNADGTVTVINVIDTPGHADFGGEVERGLSMV
DGVLLLVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVS
DSHDLLLDVASDLDEDAQAAAEKALDLPTLYASGRAGVASTVQPADGEVP
EGDNLDPLFDVLMKHIPPPSGDPEAPLQALVTNLDASAFLGRLALVRIYN
GKLKKGQQVAWMREVDGAPVVTSAKITELLVTEGVERTATAEAVAGDIVA
VAGIPEIMIGDTLADPDHAHALPRITVDEPAISVTIGTNTSPLAGKVSGH
KLTARMVKNRLDSELIGNVSIRVVDIGKPDAWEVQGRGELALAVLVEQMR
REGFELTVGKPQVVTKNIDGKLHEPFEAMTIDCPEEFVGAITQLMAARKG
RMEEMTNHAAGWVRMDFIVPSRGLIGFRTDFLTLTRGTGIANAVFDGYRP
WAGEIRARHTGSLVSDRAGTITPFAMIQLADRGQFFVEPGQETYEGMVVG
INPRAEDLDINVTREKKLTNMRSSTADVMETLARPLELDLEKAMEFCAED
ECVEVTPEVVRVRKVELTASLRARAKARAKARG
118473303YP_890711.1 hypothetical protein MSMEG_6498 [Mycobacterium smegmatis str. MC2 155]MRKTAKRFGVATVAASGLAATLIGLAAPSQAAPSGPSNAQQTISQLQSQG
YHVIVNRIGATPIDKAVVVAVRPGTNFTRTDSLNTGVTQKTVYVDVK
118473302YP_884956.1 LuxR family transcriptional regulator [Mycobacterium smegmatis str. MCMTEKLSTGTKTLLMARVDRAEELWQTELDQTIAAIPWLRASMAHLIALND
GTLQRDASDSFVAAFDRASDAVMCALDLQLAPLEPFALCIGVHAVEHTDS
ADSDGAARLRDIARGGQTLISAAAAALVSARMPAHAALTPLRDRVRHEPV
YQLNHPGLRTEADEVPHLPYGRVVR
118473301YP_891115.1 hypothetical protein MSMEG_6920 [Mycobacterium smegmatis str. MC2 155]MLIAALLCLSAAVVVAVLGLWLLTRPHYGDPVRGVLRAVAPTQLAAAVML
AAGGVTALAAAPQTGLMVVVVCVIGAVATVAAGCWQSAKAVAVSQAASEA
ARAESGGCAPEACAACTLSCSK
118473300YP_885150.1 carbon monoxide dehydrogenase [Mycobacterium smegmatis str. MC2 155]MQVPGPFEYERATSVDHAVGLLDRLGEDARIVAGGHSLLPMMKLRIANPE
YLVDINDLAVELGYVITDPTLVRIGAMARHRQVLESDPLAAVCPIFRDAE
RVIADPVVRNRGTLGGSLCQADPAEDLTTVCTILGAVCLARGPGGEREIG
IDDFLVGPYETALAHNEMLVEVRIPVRHRTSSAYAKVERRVGDWAVTAAG
AQVTLDGDSIVAARVGLTAVNPDPDALRALADDLIGKPATEETFAAAGEL
AVQACEPVTDTRGSADYKRHLARELTIRTMRTAVERVRTAPAPEGN
118473299YP_888161.1 alpha-ketoglutarate-dependent taurine dioxygenase [Mycobacterium smegmMQVTVTKLGAHIGARIDGVRVGGDLSPATVSAINAALLEHKVIFFSGQDH
LDDAGQLEFAELLGTPTVAHPTLAEGAEQLLPIDSRYDKANSWHTDVTFV
DRIPKASLLRAVTLPSYGGTTAWASTEAAYQQLPAPLRTLADNLWAVHTN
RFDYADSAISAEQRGYRQRFESDYYEVEHPVVRVHPETGERVLLLGHFVK
SFVGLKDTESAALFRLFQDRITRLENTVRWSWKPGDLAIWDNRATQHYAV
ADYDDQYRRLNRVTLAGDIPVDVYGERSRVIAGDASSYSPVDSPVALAS
118473298YP_885292.1 succinate-semialdehyde dehydrogenase [Mycobacterium smegmatis str. MC2MTATPEVDLPNPYTGTGTIHNPATGAVAGEVRWTDPADVPRIAAGLREAQ
KEWEARGPKGRAKVLARYAVWLGDHRDEIEKLLIAETGKSAVDAAQEVPL
ILMILSYYIKTVEKAMAPEKRPAPLPFLSIKKIEVHYRPRAVVGIIAPWN
YPVANAMMDAIGALAAGCSVLLKPSERTPLTAEVLLRGWLDSGAPEVFAL
AQGARAVSEAVIDNSDYIQFTGSSATGAKVMERAARRLTPVSLELGGKDP
MIVLEDADIELAANAAVWGAMFNAGQTCVSVERVYVLESVYDQFVAATVR
AVENLKMGAGEGYDFGSLIDAGQVDITERHVNEALEKGAKALTGGKRPED
GGSFYPPTVLVDVDHSMSCMNEETFGPTLPIMKVSSVEEAVRLANDSPYG
LSASVFSKDTERAKKIALQLDCGAVNINDVISNLMCTTAPMGGWKTSGIG
ARFGGVDGVRKFCKQETVVAPRTSVGAGGTYYNNSHKALARMNRLMTKLA
LARPRRTAK
118473297YP_888679.1 hypothetical protein MSMEG_4404 [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
DPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQM
DGVGTSIIGRPRPLSRHRRADDLYTLNCEEPPNAQHLRRTDAAGRKLGAL
SHGVDTGSLRAHPHELRHLQLHHEWRLLARRAGV
118473296YP_887521.1 imidazoleglycerol-phosphate dehydratase [Mycobacterium smegmatis str. MSALANRRARVERKTKESEIVVDLDLDGTGVVDIDTGVPFFDHMLTSLGS
HASFDLTVHAKGDIEIEGHHTVEDTAIVLGQALGQALGDKKGIRRFGDAF
IPMDESLAHAAVDVSGRPYFVHTGEPESMVSFTIAGTGAPYHTVINRHVF
ESLAFNARIALHVRTLYGRDPHHITEAQYKAVARALRQAVEYDARVTGVP
STKGTL
118473295YP_886223.1 transposase IstA protein [Mycobacterium smegmatis str. MC2 155]MLTWEDDVEVHALRKRGWTISAIARHTGRDRKTIADYLSGKRTPGVRARP
GPDPFEPFVDYVAARLTEDPHLWARTLLDELEQLGFPLSYQSLTRNIRAR
NLRPDCQACRTATERPNSVIEHAPGDETQWDWLELPDPPESWGWGKTAHL
LVGSLAHSGKWRAALTPSEDQPQLVAALDRVTRELGGCTRVWRFDRMATV
CDPGSGRVTASFAGVAKHYGVSVAICPPRRGNRKGVVEKVNHTAAQRWWR
TLDDELTAEAAQASVDRFARVRGGTRMRATADGRSAVAVVAKTEPLAPVP
ATPYPVIISQTRTASRQALVSYRGNRYSVPPELAAAQVVVSHPVGAQFCD
IATVAGIVIARHRMAADGLGVMVRDSGHVIALDTMAMATASTGRPHRRKE
RIPPGPAAKAAAAQLLHLNDANQEAAESSTWSTDSTVIDLSAYERAAQKR
TIQ
118473294YP_888281.1 N-carbamoyl-L-amino acid amidohydrolase [Mycobacterium smegmatis str. MTVPVNATNLRIPLDTGRDREFLDSWAELEAIGATPAGGVERQAGTAEDG
QMRDWLSRWLRTRGFSVEVDPIGNLFGLLEFNPGAPYVLVGSHLDSQPRG
GRFDGAYGVLAGAVAADRTRRYVTRSGFTPRYNVAVVDWFNEEGSRFKPS
MMGSAVFTGTLDLEEALNTTDDDGVSVRDALAAINGIGDREVFSSTGPRQ
LAAYAEIHIEQGRELEKNNVTIGLVDRTWAANKYELNVVGIQGHTGATAI
EDRQDALLGAALIVVALRDIADEFGEELHTSCGQLTVLPNSPVVVPREVH
MHLDLRSDNDELLAAADAALRRRIAEAEIRAGVKVEHRKAHVWPGHHYQP
QGVELARDAANDLGISSMLVQTRAGHDSTNMKEIVPSVMLFVPSVEGISH
AEAEYTSDEDLCSGVDLLTEVVARMLDGSLDAAGAGHP
118473293YP_887478.1 gp55 protein [Mycobacterium smegmatis str. MC2 155]MSIAILIAITLICIAWSLWIRRVTWTCRWEVAATMNVALQGLAVLLMSPF
ASETIGQFLYNLTGKWNLEDYIGHDCYIVAASAVVYNALGRLQDDHSMQQ
SFKQYVERPATLCIPLLLAAFSLGNGAAVYRPDFFQVPTDLWLGVYWTIL
CAILIYLLAYGARAILILRRDPRSRRIANIYLVASVSGIIACVVRLVTTF
LPDLQPVENGRLVWIFACICGAVFALASAHSWRIKTRWLTPSR
118473292YP_888896.1 peptidase S9- prolyl oligopeptidase [Mycobacterium smegmatis str. MC2 MNSTPFHDLDAYLDLPRVSGLAVSPDGTRVVTTVSTLNAKRTEFVTALWE
LDPAGQQPARRLTRGLKGESAPVFTADGDVLFLAVRPTEDDEKPPAALWR
LPAHGGEAHEMLSLPGGVSAAASARTADVTVVAAPLLPSAADVEADRSLR
KARKDNKVSAILHTGYPVRQWDHDLGPDLPHLFDADGARNLTERPGVALR
ESTFDVSPDGAFVVATWHVPAPGAATRSTLVRIDRETGARTTIAEDPQAD
LEHPVIAPDGGALAFTRETHSTPTEPPRITLCCMRFGNDDEQLGEWAEVA
TEWDRWPSSLAWSADASALIVTADDNGRGPVFSVHPDTGTVTRLTDDDHT
YTDVCPAPGGIIYALRSSYAVPPHPVRIDPDGTVTELPCFDAPALPGSLT
EITATAEDGTPVRSWLTLPESTDPAPLVLWVHGGPLGSWNTWHWRWNPWL
LTAHGYAVLMPDPALSTGYGQDFIARGWGAWGEAPYTDLMAATDAACEHP
RVDASRTAAMGGSFGGYMANWVAGHTDRFDAIVTHASLWALDQFAPTTDG
AYWWAREMTPEMMQRNSPHRFVDQINTPMLVIHGDKDYRVPIGEALRLWY
ELLTESALPADDNGDSPHRFLYYPAENHWVLTPQHAKLWYQVVTAFLDEN
LRNEPAQWPELLG
118473291YP_890283.1 hypothetical protein MSMEG_6061 [Mycobacterium smegmatis str. MC2 155]MSRETENALLLLIGVSIAIITVTGSYTRYVKPSLLPYLAATAGLLIALAL
VAIVRDIRRGGHHDDDSDNQDHSHRRGVAWLLLIPIVLLAFVAPPAIRPD
AASVTEVANDSVRRPFPPLPEGHAPEISLPDVLIRIAQDSAATLDGRTIT
VTGFTMRDGDHIDLARIVIICCAADAQLARIRLAGPAAAQAVTYPENSWI
KVEGTVAAAQDDSTRRTIPTMTAARLSRIDPPPHPYAY
118473290YP_888053.1 3-methyladenine DNA glycosylase [Mycobacterium smegmatis str. MC2 155]MSVDLLTGDPIAAARRLIGAHLVGRDVTATIVEVEAYGGPPDGPWPDAAS
HSFRGPGVRNSVMFGPPGHLYTYRSHGIHVCANVVCGYDGVAGAVLLRAA
VVTDGVDSAQRRRGPQVPPKGLARGPGNLCSALGIVMEDNGIDLFDDASP
VRLSLDGRAPGSADVLEGPRVGVSQAADRPWRFWLASTPEVSAYRRSPRA
PAPGSSD
118473289YP_888171.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMAASRGKATTRLTTDALAFLTERHLAMLTTLRSDGSPHVVAVGFTFDPKT
HIARVITTGGSQKAVNAQERGVAVLSQVDGARWLSLEGKSTVSSDPDAVR
DAELRYAQRYRTPRVNPRRVVIEVRIERVLGSSELLDRS
118473288YP_884726.1 2-dehydro-3-deoxyphosphogluconate aldolase [Mycobacterium smegmatis stMSLDSLLDLVPVIPVVVVHDAADAVPIAKALVEGGLPVIELTLRTPAALD
AIKRIADEVPEILVGAGTVVDSAQPEQAAANGAQFLVSPGSTPSLRAAMR
DSGLPHLPGVSTVSEVLTLLEEGYTELKFFPAEQAGGAKYLRAIHSPVPA
ARFCPTGGITPANMGDYLASPNVGCVGGSWLTPADVVGRKDWAEVARLAR
TAKAAAEAF
118473287YP_886258.1 transferase [Mycobacterium smegmatis str. MC2 155]MSGEIDGAVIDAIGADFRAAGYTVDGVAELLGEQADAALLRGVWWPALHA
TRKVPPHRQRLAALVCLFLLGTEEPRDAVEAAFPSAGVDAMVANGVLDVT
EGGALRAALDIRPHSDGTHDFFVVSDQDAVVRSGPLRHDHVLGIGGASVS
LARAVMRTPADRVLDLGTGCGIQALHLDAHSDHIVATDTNARALALAAAT
ARLNGMSWDLRHGSLFEPVAGERFDLIVSNPPFVVGSGARDYIYRDSGMA
GDTVCQKLIEQVGDHLNPGGTAHIMANWIVKRDTDWRDRVAGWLAGTGLH
AWVVQRELADPISYISLWLADAGETPQQAARRGGEWLEWFTEQDIAGIGM
GLILLRAPAGGEPPEQIFEEITGADELVTGTEVEAFFARRAYLRDTSDEQ
LLAARLSTAPVFLEEQSLPGPDGWQQVGAAVRRPGGPGAVIGVDDVMRAL
LAGCRGEVPLGMLIDLLAAHHGVDANALAEAALPEVRDAIARGILYQAQ
118473286YP_890149.1 acetyl-CoA acetyltransferase [Mycobacterium smegmatis str. MC2 155]MAVNAAVLGTGQTKYVAKRTDVSMNGLVREAIDRALADSGSTMADIDAVV
VGKAPDFFEGVMMPELFMADAVGATGKPLIRVHTAGSVGGSTAIVAASLV
KSGRYRRVLTMAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRAY
IRRSGAPTHIGAMVAVKDRLNGAKNPLAHLHQPDITLEKVLSSQMLWDPI
RFDETCPSSDGACAMVIGDDHIADARVAEGHPVAWIHATALRTEPLAYAG
RDQVNPQAGRDAAKALWRDAGITSPIDEIDVAEVYVPFSWFEPMWLENLG
FAPEGEGWKLTEAGETAIGGRIPFNPSGGVLSSNPIGASGMIRFAESAIQ
VMGKAGEHQVQGARKALGHAYGGGSQYFSMWVVSSDKPAAKP
118473285YP_888741.1 extracellular solute-binding protein UspC [Mycobacterium smegmatis strMRRSTLLAGGLAVTMAVLLVIAMLMGRTTEPAGKTVVTVRLWDPQVAAAY
RESFDAFSAEHPGIEVRVNTVAYASYFDSLRTDVAGGSADDIFWISNGYF
AGYADNGHLLDIADLLGPDAATAWEPSVVEQFTRNGALWGVPQLTDAGIA
VYYNADLLEKAGVSPADLSTLRWSNGPDDTLRPLLARLTVEESGRTRQWG
YNAANDLQGIYLNFIGSAGGTFSEGDRFTFDNPQAVEAFEYLVRLINTDR
VAPPASDTNDNGDFSRNAFLAGRMALFQSGTYNLAAIADQAPFPWGVAML
PIGPKGRVSVTNGIAAAGNAATRHPEAVREVLAWMGSRRGNEFVGRRGAA
IPAVLAAQPVYHEYWASRGVDVSPFFRVLQGPRIAAPGGAGFPAGFEALT
PYFAEMFLGRRDVAGTLAEAQRAANAAASR
118473284YP_888784.1 polyketide synthase [Mycobacterium smegmatis str. MC2 155]MMTDGTLCDHRVPVVLSAHAEDLIAHDATAILRYLDGRTDTAPSDVAYTL
LRTRRLRRHRAVIRAGGLDELTAGLRALADGDDHPLVTRAAAPQPGSRRR
VAFVFPGQGSQWPSMGVEAYRLDDYRAEVDRCAAAFEAAGAASPLDYLLA
HPDSGVSTNDFSQVQIQGAQFVHGVALARVWRSHGVVPDITVGHSLGEIG
AAYVAGAITLPEAVAIVIARATVLDRLTGPYRVAVLGITPEQAAEVIAET
PGWLELSVVNSPSSVAVSGETGAVAAAVRTVAARGAFAKEIEMWFPAHTT
ALDGVRADLDALLPAGRFAETPVQFIGSATADVVTTGTDFADYWYTNLRT
TVRFDQAVARAARRGARIFVELSAHPALLFNMGELLESTRGVVLVGSGRR
DEPLPERLADNVITVALADAGYRWRDQLGDCHAVLPDFPFAPMRAEHLWA
QPDPLPPVTGLTVAAEQWHQVAVPEVSGHHRIAVVGLDSECAVAGHLRDA
AERIEGVEVVAPAAADTLLVVAPMISENDPVLAGEELGRRIDEGLLRYPD
LLTETTRDVWLVTGRGEHVPVDRDGSLPVGAAVAAMHRSIAFEHPDQNFR
QLDVPMGLDTEAAVTAVAAMVTGTTDLALRCDVADGPGTTLWRRGMRDAS
AAAAPWPTGVLDDVVITGGTGAVGLQFARRLAALGARRIVLLSRNGIEGN
RVDELPLGVEIVAPRCDLTDIPRVRDVAAEFGGQGASLIVHAAATATIAA
GSALTGAAAQATFTAKLAGIENVLAAWPVRPDARILLCSSVSGLWGGHGH
AAYAAANRLLDVMAERLRSEGRRCTAVRWGLWPGAGIIDADEITRVERSG
LRAMAPDRAVDTALQDFAGDPLVFSADAQRLALFLGTDADTGTGREATHA
AQHRDAGPPADAEHHDTGAAVRIALAAVLKLADTTGLDLDASLLDLGVDS
LLALDLRKKLKKTTGRSVPLATLLGGVTATELIEHLERPEKETFSRD
118473283YP_890603.1 transporter major facilitator family protein [Mycobacterium smegmatis MRRYLAATFSALTIRDYRRYALGQTISVSGTWMQKLTQAWLVLELTDSPL
LLGVTVAGQQLPTLLFTTLAGVLADRYSKRTILLWTALGGMLPALVLGVL
VWIDVVNIWIVLAAAVAQGFADAVDKPARLTFVNDIATPETLANAVTLNS
IIQNSGKIAGPAVAGVLISAVGVSASFFLNAASYLPVVIALLLIRPHAPV
ITGNVSAKGHLGETLRYVSARPHIAAALVLMAVSGLLAFNWNVLLPTLAR
DTFGGDARVVGFAFTSMGVGAVFGGLALAGVLRGTSKWLILNGCVLGAAL
ALTGLMPTVTIAYALLFVVGAASVTFRSTATTLLQLYSDPGVRGRIISLL
VLATNGTTPVGGPMIGWICTHANPRVACLVGGLGTVAAALAHWAYLRKAG
TRKDPIPL
118473282YP_891032.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MVGRSEELAAVTDVLADISTGGAALVIDGDPGIGKSTLLAAASDWAVANG
YARLGCSGLQSQMEIGYAGLHELLHPLLAQVDALPPRQRAALMTAFGLED
GPPPDRMLIGLSVLGLLEEAAGNRRLFLVIDDAQWLDPSSVDVLNFVARR
LSNAPLMMLCSTRTTLDGFSVQFDGLPRLTMGPLEPADAAELLALTLRDP
ERSDRVDEVARQRILEQANGNPMAVIELTIALIESGDGAPIFAGEPLPTT
RRVERAFLTQLGPLSDESRLLLLLIATGNGLLSEIDWAADHLGFSLTEHL
GSLEESGLITVAGGRIQIRHPLIRSTVYGAAALASRAAVHRALAAAATDP
ARAAWHRAEAAFGPNEEVAADLERVADRARVRGAGAEAAAALRRAAALTD
DPQERLRRMTVAAEVARSSGLIAESVRILREAEPLIREHESETPLAITRF
VLNATAATPGQSADELLALSRKIADDDPGRRQLLWAAAIECRMHGLPEHS
RRDVVAEIGRLDDDPHDPLTAIALALADDTGKGAGLRARLPQLVDTVGDS
PLLMLSLAFAAEAVTDRAGALKCWTHVQNQARNCGSLAEECEGLRGAANI
LLTEGHVEAAAMSAQTALHMAESMNIAMTAGSAAAILARALVWQGQGERA
RHVLDRARHHLSPAPTILWNDDVHWAAGLAALCEADHTQALGHLTQMTLH
RTSRRWAIADLAEAAAGAEKADIARPLLAEAEEQAERLGIDSFLVHRAHA
LLADSVAESEDRFRAALGAAERTGAELESARTHLLYGVWLRRRRRIVDAR
VHLSAALTAFDRAGAVPFAERAAAELRAAGVTSAPRPGTHSGADAGALTP
QELQIAQMAAAGMTNREIADRIYLSHRTVAAHLYKVFPKLGITRRNQLHA
ALGAPTGIA
118473281YP_887428.1 carbohydrate kinase [Mycobacterium smegmatis str. MC2 155]MPEFTIGVDIGTTGTKTVLVDVDAARIVAQSTGETTLHSDAPGHAEADPW
QWLANTHAGIRAVLAESGISPDRVGAVATTGMVPAVVAVDRDGNPVRRAI
LQNDARATREIDTLKERIDDETVLAATGSAITQQSVAPTALWLRGNEPDC
WQRTARLVGSYDWVLMALGAAPHVELNWAIESGLGMLDGGRFDPMFAAAG
LSTDLVPQVLSPGQRAGELSPAAAEATGLLAGLPLIVGGADHVLSAYAAG
VNRPGDCLVKLGGAGDILAASERPVVDARLYLDAHPVPGRWLPNGCMATS
GSLIRWFQTLSGGHDLVALDDEAQTRSPAEVLCLPYFLGEKSPLHDPDLR
GAFVGLDLSHTRADMYRSVLEAIAFGFRHHTEVFAHMGVSLERAMVTNGG
SRSVLWKQILADVLGTPLIPVIGHPGASLGAAVIAAVGIGLLGDWDSTQA
FQTLGDPVVPDARHVDRYAEAYAEWRTLGDVLTPVSHRMARKARS
118473280YP_888021.1 pyrroloquinoline quinone biosynthesis protein PqqE [Mycobacterium smegMDRPYALLAELTYACPLHCPYCSNPVALQNYRDELSTVEWQRVFAEAAEL
GVLQVHLSGGEPMQRHDIVDLVRCANGLGMYTNLITSGLGFSTRRAEQLR
DAGLDHVQVSIQADQPEVSDRIAGTASFERKHDVARLVKKLGWPLTLNVV
LHRQNIDRIGAILDMAAVMEADRIELANTQYYGWAGRNRAELLPSRDQLE
RAQTVVRAARGRLGNRMEIIYVIPDYYEKYPKPCMAGWARRQFTVVPNGE
ALPCPAAHELARGLSLPGTNVRRHSLEWIWMQSPLFRQFRGDDWMPDPCR
TCDRREIDFGGCRCQAFALTGDAARTDPVCHLSPDHGLVETAVAAANDPT
LPHDGVMIPRPNPGRTRTQLPLEVRR
118473279YP_884431.1 hypothetical protein MSMEG_0009 [Mycobacterium smegmatis str. MC2 155]MRFVVLAVVAAVAVIVWRSRHGQEVWHQAG
118473278YP_888825.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MTPGRRWTRLCTAGAAAAVMCLLSGCVTVVGGTATRDPAAPPPGAAVTEV
DLDNLLLPVTELGDIVGSDDLTVTVELDQFNDSSAAMDDPDCLAAAFGAQ
ERVYAGTGWTAVRDQIVREPGSFSPHWIEQVVVLFTSDLHARDFFDQSRE
TWRGCVGTLTTYDIDQMPLEWVVGEVTAEESTISQLSVPETAVRGGCHHA
LSVAANLVAEAWACGEGVEDQASEIVDQIVANIE
118473277YP_890740.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMLRQERTGRWRKGMQTRERLLGAALAEFKRNGIAAADTAAIVAAAGVAHG
TFFFHFPTKEHVLIELEAREQERMVTELTRLYTRPHSVRDTLAETVRLLE
KLERRLGRRLFKDFLALHFSTTRPPSQEWTRYPALTVIISELQRAQQRGE
IPADVDVMHVGVSFVVGLYALLITIPEARDARAPVLEVYLTTYLYGLRVL
P
118473276YP_886116.1 hypothetical protein MSMEG_1744 [Mycobacterium smegmatis str. MC2 155]MTSRKWTATLDSLTILPRGEQFAALTELRARLRRMDTEAWNTTFGPDSLY
NAWTQLPFVDAIYGHNREAIGAVLHGRSNWHVVEIGGGNGALWHGLLDPL
PPGTFTLIDPNPDAHQAVQQRFPGNVDFHSVVAPVASAALPPADVVVCSL
TLHHHAGENAAQREAFGMTGDGKLEILRRVVAALRSRSGIGILNEADCYN
DIPLSPGDETLVDHFLDVYVRRAARAVAHAIDSAPTDFTLTEAWEAILRH
WCIEQVDYAFRSREERDVYELDVTSWVRLLAEAGAADITHRYTDRWNLFV
QYLFR
118473275YP_887370.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantotheMSARKRIVVGVAGGIAAYKACTVVRQLTEAGHSVRVVPTESALRFVGAAT
FEALSGNPVHTGVFTDVHEVQHVRIGQQADLVVIAPATADLLARAVAGRA
DDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVLEPAS
GRLTGADSGPGRLPEAEEITTLAQLLLERADALPYDMAGVKALVTAGGTR
EPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEM
VHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKKGASEPS
SIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAK
LERKGCDLLVVNAVGENRAFEVDHNDGWLLSADGTESALEHGSKTLMATR
IVDSIAAFLKSQDG
118473274YP_890466.1 hypothetical protein MSMEG_6247 [Mycobacterium smegmatis str. MC2 155]MTLSLANYLAADSAAEALRRDVRAGLTAAPKSLPPKWFYDAVGSDLFDQI
TRLPEYYPTRTEAQILRTRSAEIIAAAGADTLVELGSGTSEKTRMLLDAM
RDAELLRRFIPFDVDAGVLRSAGAAIGAEYPGIEIDAVCGDFEEHLGKIP
HVGRRLVVFLGSTIGNLTPAPRAEFLSTLADTLQPGDSLLLGTDLVKDTG
RLVRAYDDAAGVTAAFNRNVLAVVNRELSADFDLDAFEHVAKWNSDEERI
EMWLRARTAQHVRVAALDLEVDFAAGEEMLTEVSCKFRPENVVAELAEAG
LRQTHWWTDPAGDFGLSLAVR
118473273YP_890073.1 NikQ protein [Mycobacterium smegmatis str. MC2 155]MRADLTDLDNFADGFPHALFEAHRREAPVYWHEPTEHTPDGEGFWSVATY
AETLAVLRDPVTFSSVTGGSRPYGGTLLQDLAIAGQVLNMMDDPRHAQIR
RLVSSGLTPRMIARVEEDLRVRARRLLDAVEPGVPLDFLVEVAAELPMQM
ICILLGVPESERHWLFHAIEPQFDFSGSRTASVGQLTPEEAGNRMYRYGM
ELIAAKRAAPTDDMLSVVANAHDAELSDLELYLFFSLLFSAGAETTRNAV
AGGLLALIEHPSQMALLRADLALLPTAVEEMVRWTSPSPSKRRTATRDVE
LGGCRIAAGDKVQIWEGSANRDPLVFTDPDVFDITRKPNPHLGFGQGVHY
CLGANLARLELRVLFEELLSRFSAARLVKPVEWTRSNRHTGIRHLVVEFD
A
118473272YP_885900.1 hypothetical protein MSMEG_1518 [Mycobacterium smegmatis str. MC2 155]MTAVYLAAFIVGGVSVLTALLLADVGHGDGMPFLSLTGISAALVGAGTGG
LLGIWGGLGTVPTALLAGASALGLAFVLNGALLPYLRKQQANSHRGRSSY
IGLLGTVTLEVPAGGWGEVSFVDADGNRVFSRAKSDEPAPLPKSTRVYIA
DIDADSVHVVAVPEP
118473271YP_885765.1 hypothetical protein MSMEG_1379 [Mycobacterium smegmatis str. MC2 155]MAAPRIGVIGAGIVGLAVARRLQQKLQADVTVLDKENVVAAHQTGHNSNV
VHSGVYYPPGSLKATLCRRGVGLLRAYCMERGLPYDELGKVIVAVQTDEL
PRLHDLAKRAVDNGIPDTRVIDRAELREREPHVDGLAALLIPSTAVVSFP
AIAEEFRADIEAAGGQFRLGSPAVGIASRDGGVVITTDTDEFVFDHVVVC
AGLQSSMIAEMAGAPRDPEIIPFRGEYYSLVASRSDLVKGLVYPVPDPRY
PFLGVHFTRGIDGHVHVGPNAVLALAQEGYRWRDVNVRQLWRSVSYPGML
RLARHHWRMGASEIVGSMSKSVFLRRARAYIPELTASDIVRAESGVRAQA
LKPDGNLVDDFVIHRLAGMTFVRNAPSPAATASLAIAEHIVDALA
118473270YP_888518.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTPTETHKPNPGLAEHVSRLAAFAVSAEARPARLGCLGATVLTIGGLGAG
STRLHDPLLESLHLSWLRFGHGLVVSSILLWTGVALMLIAWLWLGRRVID
RTATEYTMVATTGFWLAPLLLSVPLFSRDTYSYLAQGALLRDGFDPYVVG
PVENPNSLLENVSPIWTTTTAPYGPAFILVAKFVTMLVGNDVVAGTMLLR
LCMLPGLLLLIWAAPRVARHVGANAAAALWICVLNPLVIIHLMGGVHNEM
LMVGLMMAAIALTFAGRPIWGVGLIATAVAVKATAGLALPFMVWVWMRQL
RDRHDMPPVRAFVVSTAASVLIFGAVFAVLSWVAGVGLGWLTALAGSVKI
INWLTVPTAASNLINAIGGLFFSVNFYAVLEVARIIGIAAIVIALPLLWW
RYRHTDREALTGIALAMVVVVLFVPAALPWYYTWPLAVAAALVQTRPGIA
AIAGFSTWIMVMWKPDGAHGMYSWAHVLLTTACAVAAWYSLYRAPESAEA
TASRQ
118473269YP_884545.1 cyclase/dehydrase [Mycobacterium smegmatis str. MC2 155]MSKTVEVAASAETITSIVSDFEAYPQWNPEIKGCWILARYNDGRPSQLRL
DVEIQGQSGVFITAVYYPAENQIFTMLQQGDHFTKQEQRFSIVPLGPDST
LLQVDLDVEVKLPVPGPMVKKLAGETLEHLAKALEGRVEQLTQS
118473268YP_889402.1 base excision DNA repair protein- HhH-GPD family protein [MycobacteriuMPTLQLVQDPDADALLESNPFALLVGMLLDQQIPMETAFAGPKKLADRIG
KVDAVHIAEYNPDKFAEKFSETPAVHRFPGSMAKRVQALAQAVVDDYDGD
VTAIWTGGDPDGPEVLRRLKRLPGFGDQKARIFLALLGKQYGVTPEGWRE
AAGDYGKAGTYMSVADVVDAGSLQKVRAYKKDMKAAAKAAKNK
118473267YP_887314.1 hypothetical protein MSMEG_2996 [Mycobacterium smegmatis str. MC2 155]MTEWFLFLPQVRLEIGDIVERARIAEAAGFDGIAFIDHLEAPGATHQGIW
EAMTTATWVAAHTERLRIGHLVLCDAFRHPAVLAKQAVTLSTASDGRFEL
GLGSGSWPQEFFRFGVDGGDDAAARVDRLERDLALLREHWGEGERGQVPA
PAHKIPLVIGGTGRRTMGLVRRYADWWNIPSHQLDRLPDLLPTVGAARAS
MQQMVGFVGRGIDRAAVTERSSRLFGHLGSGLVCGDAAELTEHFAGLAAQ
GIERFYVWFADFAAPQTISEFAETVMHTGQKGTT
118473266YP_886501.1 hypothetical protein MSMEG_2144 [Mycobacterium smegmatis str. MC2 155]MTTREFDFEVAFVTEPLDGPDDERIDRAMELIPNLVVSFDGNLTVVTTLV
HAADAIEAGVKAAKALEASGIPVIRTYQDLVTRQDIAERIGVTRQAVGNW
VRGERHDDVPFPAPVSLVAGGIWLWGDVAGWARSRNYEVEDVSFPSLDAH
NRIDLLISAGIGSVTVTTYECVADIAFRHRGTKASLGHTYQRSYAPAS
118473265YP_889079.1 cytochrome p450 [Mycobacterium smegmatis str. MC2 155]MTHMAIDPAGIDWFKDPRLVDDPYPYFNALRDKCPVQSEDHYGVTMVTGW
EEAVSVYNDEKSFSSCTSVTGPFPGFPVPLEGRDDVAELIEKHRDELPFS
DQLPTLDPPVHTNHRSLMMRLITPKRLKENEDAMWQLADEVLDDFLAPGK
GEFIKGFASPFTLLVIADLLGIPAEDRNAFVDGISQNSGGGVGSTGDESL
SHSPLEFLYGQFEAYIEDRRSNPREDILTGMATALFPDGTTPSPGDVARV
ATNVFSAGQETTVRLLGTALKVLGDRPDVQKMVREDRSLLPNFIEEALRH
ESPVKGDFRLSRCPVTVGDKDLPSGRTVMVVNGAANRDPRRFENPDDFDP
ARKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTTDIRISEEHHG
PAANRDYKYIPTFILRGLTHLHLEFDVK
118473264YP_887840.1 hypothetical protein MSMEG_3537 [Mycobacterium smegmatis str. MC2 155]MTLACRVFGHDPTFRVDGRTMRWECARCGEARGAKDYASEADARRFAAAF
NKRDTDDMGKRAPLLGLLPLRLWRMLKRR
118473263YP_885659.1 Ser/Thr protein phosphatase [Mycobacterium smegmatis str. MC2 155]MNNSVSSGYDVIGDVHGCASQLEVLLHKLGYETGASGEYRHPERQAIFVG
DLIDRGGEQLRVLEVVKAMVDAGSALIVMGNHEFNALAYHTEWPVGSGKY
LRPHDDPDNPWSAKNTKQHAAFLDQVRGEDRQRCLEWFATIPLWLDLGEL
RVVHACWHDDSIGVVENLCGSNAPFGDVSHLVAASTEDDPLYEAVETLLK
GPEINLVAHGQPEYHDKDGIPRDNARVQWWNSDARTLRDIAEMGGGFTTS
TGEPYPPLPEIALTGADRSYIYTAEIPVFYGHYWRQGSPKHRHDWTDYTA
CVDFSAVKGGRLTAYRWSGESTIKAENYVTAD
118473262YP_887815.1 ISMsm2- transposase [Mycobacterium smegmatis str. MC2 155]MPTPHAAEIVLSADERAELEGWARRRTSAAGLAMRARIVLAAADGGSNTE
LADRLELSIGTVRRWRNRFAELRLDGLVDEPRPGRPRVVGDEQIEALITA
TLETTPPDATHWSTRSMAAHLGLSQSMVSRVWRAFGLAPHKQDSWKLSKD
PLFVAKVRDVVGLYLNPPERALVLCVDEKTQIQALNRTQPVFPMLPGTPA
RASHDYVRHGTSSLYAALDLTTGKVIGALHSRHRATEFLAFLKKIDVEVP
DDLDVHLVLDNASTHKTPAVKRWLTGHPRFVLHFTPTSSSWLNLVERWFA
ELTTKKLRRSTHTSVRQLNADIRAWIDTWNDNPKPYVWTKTADQILASIA
NYCARINDSGH
118473261YP_885609.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MSEITVENLDAGYGSVQILHQVSMTARSGEVTCIFGPNGCGKSTLLKAIV
GMIDPWAGTVKIDDEDITHLPSHKTLGRGVAMMPQGGGVFPHLSVRENLR
IGGYTLRDKKELDQRIDTLLDEFPRLRERYTVAAGQLSGGEQMILSIARA
LVLNPRFLLFDEPSAGLSPKLVGDVLVRAAELAQRGVGVLMIEQNIREAM
RVADRMYVLVGGRNRFDGTPADVADDRELMHLYLGGR
118473260YP_890424.1 hypothetical protein MSMEG_6205 [Mycobacterium smegmatis str. MC2 155]MISLAEYRRCARREPRDLDDAIEAPVAAVVDEPADAAAAADYEGDEGGII
LCW
118473259YP_885005.1 iron-sulfur cluster binding protein [Mycobacterium smegmatis str. MC2 MSTTFLGSPGLGNLRGDESFPHAARGALANSQLRRNIGHATQTIRGKRLR
AVAECDDWEDLRAAGSALKQDVMARLPELLEQLESNVTARGGVVHWARDA
DEANRIVTDLIRATGSDEVVKVKSMATQEIGLNEHLEAQGIAAFETDLAE
LIVQLGHDKPSHILVPAIHRNRSEIREIFSREMPDAGELSDDPRVLAMAA
RAHLRRKFLTARVAISGANFGVAETGTLAVVESEGNGRMCLTLPETLITV
MGIEKIVPTFADLEVFMQLLPRSSTAERMNPYTSMWTGVHPGDGPQEFHL
VLLDNGRTRVLADEVGRAALHCIRCSACLNVCPVYERTGGHAYGSVYPGP
IGAILSPQLTGTTGHDDPNASLPYASSLCGACFEACPVRIDIPSILVHLR
AQQVDSERGGLPGGQDIAMKAAGWAMSDAKRFSLAEKALAAGRVIAGKDH
RISTLPWPASKWTSSRDLPEPPKETFRQWWNRTHEGGSR
118473258YP_890321.1 hypothetical protein MSMEG_6100 [Mycobacterium smegmatis str. MC2 155]MGPTRKRDLVGAAVAAALLSYLLIHALYRWFPPITVWTGLSLLGVAAFEA
GWGFYVRAKINDGQIGVGAGRLDPLTVARSVVIAKASAWVGALVAGWWVG
VLVYLLPRRTTIRVAGEDTPGVVVAALCALALAIAGLWLQHCCKSPEEPP
EDGDAVPE
118473257YP_890529.1 saccharopine dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRILLVGAGGVGSAFCAIAARRNFFDQIVVCDYDESRARQAAEAVGDARF
TSAQVDATSADAVADLVREHQITHVMNAVDPRFVMPIFNGALAGGADYLD
MAMSLSRRHPDRPYELTGVKLGDEQFGAAEDWEAAGRLALVGIGVEPGLS
DVFARYAADHLFSEIDELGTRDGSSLVVEGCDFAPSFSIWTTIEECLNPP
VVWEADRGWFVTEPFSEPEVFDFPEGIGPVECVNVEHEEVLLMPRWVKCK
RATFKYGLGSEFIDVLKTLHKLGLDRTDKVRVPGANGPVEVSPRDVVAAC
LPNPATLGPQMHGKTCAGLWVTGKGKDGAPRSTYLYHVVDNQWSMAEYGH
QCVVWQTAINPVVALELLASGMWSGAGVLGPEAFDAVPFLNLLKDYGSPW
GIKEL
118473256YP_887140.1 hypothetical protein MSMEG_2809 [Mycobacterium smegmatis str. MC2 155]MPNVYYSRIIAAPAAGVWKIVGDFGSLPVWFPFVTASELDPPGGRREVGA
LRTNHIDDGTVVVERLVELSDRDRRVTYDVIGGDAPVKNYTATITVHEIS
DQEACFVTWTASFDVIGDADSIVDWVRNGIFRDCLAELERVLRVTAPA
118473255YP_889189.1 F0F1 ATP synthase subunit gamma [Mycobacterium smegmatis str. MC2 155]MAATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYAAEI
TNMLTELAGASALDHPLLVERKQPKRAGVLVVSSDRGLCGAYNANVLRRA
EELFSLLRDEGKDPVLYVVGRKALGYFSFRQRTVVESWTGFSERPTYENA
REIADTLVNAFMAGADDEGDDAGADGILGVDELHIVFTEFRSMLSQTAVA
RRAAPMEVEYVGEVETGPRTLYSFEPDPETLFDALLPRYIATRVYAALLE
AAASESASRRRAMKSATDNADDLIKALTLAANRERQAQITQEISEIVGGA
NALAGSK
118473254YP_884990.1 hypothetical protein MSMEG_0580 [Mycobacterium smegmatis str. MC2 155]MSVFDKAIDLQPAGDGHFQGSTVPEWANMVGPFGGITAAALIRAIQLHPQ
CHGQPIALTVNYVAPIADGDFDVDTKLVRTNRSNQHWIVEQSQGGEVKTT
ATAVFGLRRDTWSDAEATPPTAPEPDGLEQAASPLTWFANYDIRYVDGAV
PAAEGPGSDSSTTTLWVRNNPARPLDFAALTAVGDIFFPRVFLRRGQFLP
AGTVTLTIYYHANAAQIDSAGDDFVLGTARAHQFTRGYFDQTAHLWSRDG
VPLATSHQYVYFKG
118473253YP_888368.1 nitrilotriacetate monooxygenase component A [Mycobacterium smegmatis sMGRDFTELIHIARSAEESGVRALLLDDAGDGGSDPVVVACALARKTRTIE
LVAAVNTARQHPFGIARRLSGLVQVSGGRAGWAPQDSNRYRLLEAVTIAR
ALWYSWPPEAVVADKAAGVWVETTLVSSIHFDGVHYSVHAPLDLPRSLTG
EPHLYLPAELRGSLAAPATYLDEVRVDRYEDSPTGYPQIEKAL
118473252YP_890680.1 starvation-induced DNA protecting protein [Mycobacterium smegmatis strMTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGV
HEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERD
TVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQW
FVRAHLESAGGQLTHEGQSTEKGAADKARRKSA
118473251YP_886087.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MQPVVEMRGISIEFPGVKALDGVDFRLLPGEVHALMGENGAGKSTLIKAL
TGVYDIDDGTIVVAGTPCTFAGPRQAQEAGISTVYQEVNLCPNLTVGENI
LLGREPRRWGRIDYRTLNRRARELLAELELDIDPRSQLGSHPIAIQQLVA
IARATAVRAQVLILDEPTSSLDAREVGELFRVIRRLRDSGTAILFVSHFL
DQIYAISDRMTVLRNGKLVGEYLTAELPKSDLVAAMLGRQLDVLDEVAEA
ANVTAETAEHQSETLVRADALGRVPAVHPVTLDIGRGEILGLAGLLGSGR
TELARLLFGADRATSGHVEIRGRRVALRTPRSAIAHGFAFTSENRKDEGV
VGDLSVRENLVLALQARRGFARPLSTKTKDQLVAKYLDALDIRPRNPDTL
LKNLSGGNQQKVLLARWLITEPDLFILDEPTRGIDVGAKTQIQKLVTELA
GDGMAIVFISAELDEVTRISTRIAVMRDRHNVALAEAGTSPSKLTALIAG
TS
118473250YP_887202.1 5-exo-alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTLASGTGRIARFDEPGKPFEIQTVPVPQVGPGEILIRVTRANICGSDVH
AWHGTFATRGLGGQLPTVLGHEMVGVVAVLGDDVHSDSDGRPLEVGTRVV
FPYFFCCHTCRNCLAGRRNACVNLKMAMLGRADEPPHFVGGYADYFLLPA
KAVVYTVPDSVSDEIAAGANCALSQVMYGLERVDLQLGETVVVQGAGALG
LYAVAVAKARGAKTVIAIDGVPERLELAKAFGADEVIDITATTDKDRVKI
VRRLTDRQGADVVVEVVGHPSAIDEGLKLLGQFGRYVEIGNINIGKTFEF
DPSRFVFANKTMVGVSLYDPAVLSRALTFLAEYQDRLPFDRLAAACYRLE
DINDAFSAAENKRDVRASIVP
118473249YP_884803.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MGKVFDPRNNALNALRLLLAVGVILWHSWPLSGHGVTYKPLEQLLEQVWV
DGFFAISGFLITSSWLRNPRLRDYATARVLRIFPGLWVCLLIIAFVMAPI
GVLLQGGSVSGLMSSYAPIEYVLNNAVLNVYYAGINGTPQGIPWPGVWNG
SLWTLVFEMICYIAVAVLGIVGLLKRRWVIPAIFVLTLCATAYFSYPVFA
MQTIPQMVARFAVMFAAGALIHQYRDVIPARWSLVGIAVVLVLASGFLSN
YRVIGALPLAYAVIVAGALLRNRRLNLRNDLSYGVYIYAFPVQQLLAILG
FANSQPFLFFVIATAATVPLAALSWFLVEKRAIALKSRLKRRRTDTVADT
TQKVSDRGAG
118473248YP_889387.1 nitrate/nitrite transporter [Mycobacterium smegmatis str. MC2 155]MSTATTPYTRQGVNLALATWVSAINFWAWNMIGPLSTTYAGDMRLSSTEA
SMLVATPILVGSLGRIVIGSLTDRFGGRTMFIAVTVASILPVLAVGAAGS
AGSYPLLLVCGFFLGVAGTIFAVGIPFSNNWYDVSRRGFATGVFGMGMVG
TALSAFFTPRFVNWFGLFTTHLIVAIALALTAVLCVVMMRDAPSFRPNTD
PVVPKLKAAAKLPVTWEMSFLYAVVFGGFVAFSNYLPTYIKTIYDFSAVE
AGSRTAGFAVAAVLARPVGGALSDRIPPKYVVLASFAGTALLAFVAVFQP
PPDVWSATTFITLAIFLGVGTGGVFAWVARRSPAQSVGSVTGIVAAAGGL
GGYFPPLVMGATYDADDNDYTVGLLLLVATALVAFAYTALRLHAHEPGRG
GVRSDQIDR
118473247YP_884723.1 dihydrofolate reductase [Mycobacterium smegmatis str. MC2 155]MKTVYYTASSLDGYIVDENQSLDWLTSRDITPDGPFGYEQFIETIGVLVM
GASTYEWVVEHGDWSYDQPAWVLTHRPEIAAESHPMQVFSGDVAELHPEL
VAAAGGKDVWVVGGGDVAAQFVAADLIDEIIVSYAPCTLGVGSRVLPMRS
EWVLDDCARNGDFVCARWKRPVLHT
118473246YP_890392.1 hypothetical protein MSMEG_6172 [Mycobacterium smegmatis str. MC2 155]MAAHDTFPPFGAPDGLQETRSQISCDFRQLHVYSEHYSAYAEVYQPDPPG
LIRDDLRLLPPWRGSSSFPGKIPVSANRAEIARHCRARSAGVSGEWSLPE
NFRSKLSTTCDLSTDCGSAVVPTYRWPSHLWHGRCEGHPDRQAKEHRRRS
RGPRRSAAAWGGGPGRCRGRRRPGRGGDAVES
118473245YP_888590.1 hypothetical protein MSMEG_4314 [Mycobacterium smegmatis str. MC2 155]MKNLIPAVAVSTAIGFVVGGMEASAPPAEPAANPAPPLPDPGVYLVTETA
AAELFEPYDWSLSDCGPGCLHVLSHSPGAPGASWDMEMPWLASADDAQGA
WVGEHTNPGMVCDIGTPEQRQTGPVRMKYIIRPDLTGFVNMGFSQDNPSC
AGDTEPRSRNLVLRRAPMVWS
118473244YP_886313.1 hypothetical protein MSMEG_1947 [Mycobacterium smegmatis str. MC2 155]MTTASSELIMYTTTWCGYCSRLKTALKAEGIPYTEVDIEGDPAAAEFVGS
VNGGNHVVPTVKFADGSTLTNPTIKQVKAKLG
118473243YP_888604.1 propionyl-CoA carboxylase subunit beta [Mycobacterium smegmatis str. MMTIMAPEAAAESLDPRDPLLRLSTFFDDGSVELLHERDRSGVLAAAGTVN
GVRTVAFCTDGTVMGGAMGVEGCAHIVDAYDTAIEEQSPIVGIWHSGGAR
LAEGVKALHAVGLMFEAMIRASGYVPQISVVVGFAAGGAAYGPALTDVIV
MAPDSKIFVTGPDVVRSVTGEDVDMVSLGGPEAHHKKSGVCHIVADDELD
AYERGRRLVGLFCQQGHFDRSKAEAGDSDLHALLPDSARRAYDVHPLVHA
LLDEGVPFEEFQAKWAPSIVVGLGRLAGRTIGVIANNPLRLGGCLNSESA
EKSARFVRLCDAFGIPLVVIVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
STVPRVTLVTRKIYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAVEDPAEREALHEQLAVEHEKIAGGVDSAIEIGVVDEKIDPSH
TRSKLTEALAEAPHRRGRHKNIPL
118473242YP_888267.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPNKSTQAYDVLERMIIFQDIQAGVMVSEAELMEKSGFGRTPLREALQR
LSRDNLVQVVPRRGILVPPISVEAQFKLLETRRPLEELAATLAATRARPE
QQAAALQRASEFKNFTERDLHELERVLRAGHELVAKSTQNQFLENAMAPL
QGLSRRFWFAHLRSDPDDVAIAIDRHGELLTAIGEQDQERAIAAARSLID
YLTEFAYASVKVPA
118473241YP_887771.1 AMP-binding protein [Mycobacterium smegmatis str. MC2 155]MTPAPLTVPALLQRSVREFGDDTYLVTPTGRATYREIDNLSVRAARWLLG
QGAGKGTRVGLFFANGIEWITWWLAVSRIGAVAVPLSTLYTPAEIAKVLR
LADVGILVAPPRVLNIDVGLRLREALPELAGQPSRAIAVRATPFLRRIAI
TGETDLPCATRIDDTGVPQEILAAAESEVSPADLAVMVHTSGSTADPKGV
LHTHGTLVRQTSTWPAAIRAVTGSQGHARILCAMPFFWIGGLLAATGALH
EPVTLAILPKLDAGAALDLAERERITGIVGWPAFTQRLREHPTFSVRDLS
SAPMLRDGPLDIAMTDVPDGFPVHRTMTETAGGFAYTDMRIVDDNGVPAP
DGTVGELHVRGIGVMAGYNKRERFETFDDDGWYHTGDKVYRRPGDPRVFY
VGRTTDLIKAAGANVSPLEVEAVLAGFGEVAQCLVLGVDDAERGEEVCAV
VVPSGTPGDTLDVALLAQRAREQLSAYKVPTRWVIACSDDIPTLPSGKFD
RKALRRWIIDERLGVTAR
118473240YP_885851.1 30S ribosomal protein S8 [Mycobacterium smegmatis str. MC2 155]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYR
TEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLLTDRQAARQGVGGEVLAYVW
118473239YP_885600.1 glycosyltransferase- group I [Mycobacterium smegmatis str. MC2 155]MTDTPSTDAPPQPRFDHLLRMTDNRGTFEHAFLDEPRTENGYCTDDMARV
LVVASRQPQASGPVHRLGGVAVRFLNEAQALTGPCRNRMDKTGSWTDEPA
LEDPWGRCVWGLGTAAAHSDVNVVRTLALLQFERAAQCRSIWPRAMAFAA
IGAAELLAVKPDNAAARALITDYIAGLSPPAADRSWPWPEPRLTYANAVL
AEAIIAAGIVLEDSGLWTRGLELLRWLVERETGNGHLSVTPVDGWAAGET
RPGFDQQPIEVATLADACARAATVDADSVWPDTVRAAAAWFEGANDLGEP
MWDPQTGAGFDGLHADRVNRNQGAESTLAVISTFQQVQRFSHTAS
118473238YP_890926.1 transporter major facilitator family protein [Mycobacterium smegmatis MATAVHIAIRDLIDRNPIGGHQRRTLVLCFFCIVVDGLEVTVVGFLSAAL
KDDWAIGTAQLAPAVTAGLIGLGVGALLGGPLGDRFGRRYVIVWAIGSFA
ATTLLTAAADGVLTFSLLRLLTGFGLGASMPNVAALVSETVPTPRRRSIV
AVVWSGFPSGAAIGAVVVPFVVETFGWRVAILGCGAAAAVIFVCVGTLLS
ESPVYLANSGHDPARLRRYCNAIEPGSADAGSVFVRDEKVRPRAYPIGAL
LTPELRIGTLTLWVGFMAVMFSIYLTNTWLPYLFKVAGFATGSISILSTA
LQIGGAVGCAAIGFIQDRFGPHITLVWTSVLGGGTAAAIAVSPNTTVVLG
TLIFVLGMCTNAISTGYTAVSTTFYPTDIRSTGTSWAAGMSRVGAVLGAG
IGTSLASLGVSLQQVFLLLLIPITIGALCMAIKAVTSQRAGITPAPDNTM
NGARK
118473237YP_888085.1 50S ribosomal protein L35 [Mycobacterium smegmatis str. MC2 155]MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTV
SAADNSRINKLLNG
118473236YP_885371.1 glutamate-1-semialdehyde aminotransferase [Mycobacterium smegmatis strMAMRVDQTCGSEEHSPASTQRSAQLFADACAVIPGGVNSPVRAFNSVGGT
PRFITSAGGYWLTDADGNRYIDLVCSWGPMLLGHAHPAVVEAVRKVAEHG
LSFGAPTPSETELAAEIIDRVAPVEMMRFVNSGTEATMSAIRLARGFTGR
AKIVKFSGCYHGHSDALLADAGSGVATLGLPSSPGVTGAAAADTIVIPYN
NVAAVEDVFAHFGDEIACVISEASPGNMGTVPPLPGFNAALRRITAEHGA
LLILDEVMTGFRVSRSGWYGLDPVEADLLTFGKVMSGGLPAAAFGGRTEV
MSRLAPLGPVYQAGTLSGNPVAMAAGLTTLRHADDAVYAKLDANADRLAG
LLTGALTEAGVAHQVQRAGNMLSVFFTDAPVHDFAAAKATETWRFPPFFH
ALLERGVYPPCSAFETWFVSAALDDDAFARIAEALPAAARAAAAATPEGT
A
118473235YP_888910.1 carbohydrate kinase PfkB [Mycobacterium smegmatis str. MC2 155]MTVLGNLAIDIINGAPPSPGGCASFAGVALQAAGGVGRIVAMGAERDHSL
FDGLQERFGPLVQILPSAVTSSFRLDYDDTDHRHMGVEAIGPVWSPADVE
AADPATTWVHLAPLLRTDFPAETLAALVERGHRIAYDGQGLVRADSLGPL
VEDRHFPADLLTHLDILKLAEDEAVIVADGPFTAATAQRLGVPEILVTYG
SEGCDIFVDGDRVRVPAAWRVLGVQTTGAGDMFTACYVAHRAAGADPRRA
AELASGLVARELDKRVHVEPADRV
118473234YP_888984.1 oligoribonuclease [Mycobacterium smegmatis str. MC2 155]MRILWIFVRDELVWIDCEMTGLDLKSDRLIEIAVLVTDADLNILGDGLDV
VIHADDESLSSMVDVVKQMHARSGLTEEVRRSTVDLATAEEMVLDYIRGH
VKQAKTAPLAGNSIATDRGFIARDMPKLDDYLHYRMIDVSSIKELCRRWY
PRIYFGQPEKGLAHRALADIHESIRELKYYRATAFVPQPGPSTSDIAAIA
AELGPPSSNSADTDSA
118473233YP_885855.1 50S ribosomal protein L30 [Mycobacterium smegmatis str. MC2 155]MAELKITQVRSTIGARWKQRESLRTLGLKKIRQSVVREDNAQTRGLINTV
HHLVEVEEVGK
118473232YP_885529.1 hypothetical protein MSMEG_1135 [Mycobacterium smegmatis str. MC2 155]MRTTIIATVTAGLAMAGMALAGGAAAAPTGDTSADQTIRQLQSEGYRVIQ
TRVGNKSSANCSVSAVRPGRDVTELRESTRGNTEEFVRYTTVYVDLKCD
118473231YP_888796.1 salicylate synthase MbtI [Mycobacterium smegmatis str. MC2 155]MTQAGIETASENAEVTGLSLPPGADPVDFVAELARALPERDGEEYVVYER
DRQWTLAAGVRAVIELDSDEIRVISDDVVQSQPWTGRPGAALGEAVDRLL
LETEQLFGWVAFEFGTYRFGLQEHLKPGTPLARVLAPRTRIVVADGRVEL
IGADERQVEAVRRLLAGTIGPAPVSTAVDVRADGSRYRDRVATAIGEITG
GRYQKVILSRRLELPFAVDFPATYRVGRRNNTPARSFLLRLSGIRALGFS
PELVAAVHADGTVITEPLAGTRAFGRGADDDRAAREDLVSNPKEIVEHAI
SVKTSISEIEEVAEAGTAVVLDFMTVRERGSVQHLGSTVGGRLKGSMDRM
HALEALFPAVTASGIPKAESMDAILRLDEAPRGLYSGAVVTFSADGAMDA
ALTLRSAYEAHGATWLRAGAGIIAESTPEREFEETCEKLTTLAPHLVPRV
118473230YP_890619.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium smegmatis str. MC2 1MQSRRPAPSILFTAIAATLIVVPWALSGTGDEHHNPAADAPSLTQQPLDD
LGGGETIREIHQDEPFSLVALTAHDLDGTSARIRAKKADGSWGPWYEAEA
LDGVGADTPGPRGTDPVFVGRTNTVQIAITRPENAAPTAPAPKNKDDKNK
PDLGYRPATVQQPLGQNVTAVLISPPQAPADIGPLPTAVTAPGVPPHIIG
RAQWGADESMRCPAVYDAGIRAGIVHHTAGSNDYAPEDSAGIVRSIYEYH
TRTLGWCDIAYNALVDKYGQVFEGRAGGMDRPVEGAHTGGFNRDTWGVAM
MGNFDAVPPTPIQLRTTGRLLGWRLGLDRIDPHGTVVLASEGGSFTHFPR
GATPTLPAIFTHRDVGNTDCPGNAAYAEMGRLRDIAARFNQPPGPEELAE
QMRGGAIFARWESVGGPAGPLGNPTSPEAAAEGEARYATFERGAIYWSPV
TGAQPLTGAIYEAWGRLGFERGALGLPTSGEIHEPLWIKQNFQHGTLNFD
REKHTVVRVIDGVPQELPPAAPDDQPVQLERFTPIA
118473229YP_890311.1 hypothetical protein MSMEG_6090 [Mycobacterium smegmatis str. MC2 155]MTSPAHQSVAPALDLSATKAALWLSVTAFLALAVLYFVGLDQGATSVFGN
NTYVHEFVHDARHLLGFPCH
118473228YP_886788.1 hypothetical protein MSMEG_2448 [Mycobacterium smegmatis str. MC2 155]MLDDSAHIKPSVGRTTSPFTVRHRTLSGADHCVCVIDRLLTLCK
118473227YP_888627.1 hypothetical protein MSMEG_4352 [Mycobacterium smegmatis str. MC2 155]MTLPLLNGKAADITGPGRTDRFGVTCTDLGASVLAPDGKLVSVFGDTFSG
HRVGQGDWRSPVVLIGTGDADHEIVYERAGGPDPGYARQLWHYIHDDAAS
GWRRGGISTVIPSDLLRVGDSLYLHAIVNRGFGNVIWTEIWRSDDCGVSW
DHLGERAKFPAGWHGGHAQCWSWDHDPDDGWVYVAATGFQRKQGIILMRV
RPAHIGDRTCYVSWGYTGRRWEWGERATPITPAEERWGELSFRRLGPGRW
ILGGFFASRYALGYRVVDSPVANMHTTQVQTPVLGCAWHDEHHEGSRVAQ
LYGGYVLPGSRLDRTGGIGLVVSQWHTDSGWPYRAMQFKARLKDTATAPP
SVL
118473226YP_890936.1 hypothetical protein MSMEG_6728 [Mycobacterium smegmatis str. MC2 155]MQTFLPCPDFADTARVLDPRRLGKQRAETIQVLRALTVPGYGWRHHPAAA
MWAGYEEALVRYGLVVCEEWIARGHQDASTATLLADLETGTGLATVRDQE
ALACTHDLPPWLGDKAFHLSHQSSLLRKDPVHYGPYFPGVPDDLPYVWPR
SDRERRVPITSV
118473225YP_889736.1 hypothetical protein MSMEG_5498 [Mycobacterium smegmatis str. MC2 155]MPSKIRHIACTATGAVGFAGLMLFGFTGAAVAQPPPVPPPCTAAEMARVM
SGVTFDTSNYLTEHPDVNDFFTSLKGQPKDQIAENVRGYLDANPAVRDDL
QRIRQPAADFRNRCGLPPTP
118473224YP_889909.1 citrate synthase 2 [Mycobacterium smegmatis str. MC2 155]MAAVPDDFIAGLEGVVAFTTEIAEPDKDGGALRYRGVDIEELVDKKVTFA
DVWGLLVDGRFGNGLPPAEPFPLPIHSGDVRVDVQAGLAMLAPIWGYAPM
LDIDDETAREHLARASVMALSYVAQSARGIYQPAVPQRTIDECPTVTARF
MTRWQGEPDPRHVEAIDAYWVTAAEHGMNASTFTARVIASTGADAAAALS
GAVGAMSGPLHGGAPARVLPMIEEVENTGDARAVVKGILDRGDKLMGFGH
RVYRAEDPRARVLRATAQRLGAPRFEVASALEQAALAELRERRPDRAIET
NVEFWAAVILDFAQVPASMMPAMFTCGRTAGWCAHILEQKRLGKLVRPSA
IYVGPEPRSAEAVEGWEKIAAAGSGAA
118473223YP_889591.1 transporter major facilitator family protein [Mycobacterium smegmatis MSLDSSRAVLSSGDELHKRATRKAVLRLLPVMCVVYFMAYIDRTNVALAK
THLDTDVGISAAAFGFGAGIFFISYAFLEVPSNLVMYRVGPRRWIARIAL
TWGALSALMMFVQGDMSFYVMRFLLGAAEAGLYPALMYMVTLWFAQSYRA
TVVGFIYLAPTIALVVGGPMGGALMELDSAMGLHGWQWMFLIEGLVTMLV
GVLVWFKLPQSPTEAKWLTPDEARILSERAAGAHHETVTHLRGNLGKAFG
RPFVIVVALIYFFNQITNVGIVFNIPAIVEDLDISGSFVIGLLSGSAGIG
ATIGVLVVPRLFAWYQREAAAVGILAAATLVTSVLFMLSTSAFARIILIA
ISMIFVFGTLPLFWSIAMARMSGLVAAASLAFINTIGLIGGFVGPYLFGL
AETATHNPSAGFYIVIVSSVIGVALAPVLAHAIRREDSTA
118473222YP_884955.1 hypothetical protein MSMEG_0543 [Mycobacterium smegmatis str. MC2 155]MSSAHLRWTVIGAGPAGIATVGRLIDNGIRHDEIAWVDPGFAVGDFGTKW
SVVPSNTRVSGFVHFLQASAAFQFHRGPDFAIRELDPRQTCSLAMVTEPL
QWITDQLAERVTAVKALATRLELHGRHWEVRTDIATLVSDNVVLAIGSEP
RRLDHPGIQEIPLDVAVAPHKLATESLDGATVAVFGSSHSTMLVLPNLLR
RPVARVVNFYQHPLRYAVDFGDWTLFDDTGLKGHAAQWARENIDGTLPER
LRRCLVSDPRFDELLAQCDRVVYTVGFQPRRIDAPQLGSLLHNPANGIIA
PGLFGVGIAFPGFRTDPTGLGEHRVGLQKFMEQLATCMPIWLRYGA
118473221YP_885726.1 flavohemoprotein [Mycobacterium smegmatis str. MC2 155]MTVTTPEPADVRVDLEPEHAEIVSATLPLIGANIDAITSEFYRRLFTNHP
ELLRNLFNRGNQAQGAQQRALAASIATFAKHLVDPDLPHPAALLSRIGHK
HASLGVTAEQYPIVHDNLFAAIVAVLGADTVTPEVAAAWDRVFWIMADTL
IALERNLYDEAGVEPGDVYRRLRVVGRVDDPSGAVLVTVRAAEPVNFLPG
QYVSVGVTLPDGARQLRQYSLVSVAGATDLTFAVKPVEATAAQPAGEVSN
WIRDNVCVGDLLDVTLPFGDLHTDDLSTGPVMLISAGIGITPMIGILEHL
AAERPDAHVRVLHADRSDTAHPLRERQRELVDALPEASLDIWYEDGVTAG
MPGVHAGLLDLDGIELPVEPQIYLCGGAGFVDAVRGQLAARGVPAERVHC
ELFAPNDWLLD
118473220YP_885975.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MTETPVRRRRADAQRNRDAILRAAREAFETDGIFAPLDSIATAAGVGNAT
LYRNFPTRDDLLRAVLEDGVAEMVAESEAYERHSDAEEALRDWLFRVTWA
LRIWHDLPNCIATAHDDAESPVRPVTDRMTDRTARLLDNYRAGKGPSPVT
AEELFQLVTAVSWAVDRFGDDRDRARRRLEFATSGLFDS
118473219YP_891098.1 hypothetical protein MSMEG_6898 [Mycobacterium smegmatis str. MC2 155]MRVGDPSDLPSRTGSGALARPHRRSDRRDLRPRAGQPTEVATGPAAPHGF
PRARRACVSGGNQRPNPPSTHGRRSLGLKPCRRGRQQHQHHRGDREHEAH
RIGSDAAVVLVLADVRGHQAGGDDRAQQVRDASRDHDPAARHLAQQQHHR
PGQKQHAAQDVQHRDRDQRGPRAVVDRGTACPGRVRHDHGE
118473218YP_890746.1 hypothetical protein MSMEG_6533 [Mycobacterium smegmatis str. MC2 155]MQEVRSDIERYAGFLPAGYRQALAPASTWWSWRGHDVHILRAQLPDSRAR
VLVLHGAGGHAAALWPFAGLAAAEGADVLVPDLPLYGHTRVPQPRRVRYD
DWVECVSDLVRHECANDDRPLVVFGASMGGLLGYEVAARTGLVAHVVATC
LLDPADPAARAAAARVPVLGRVAPRVLGAADRYVGGVRMPIRWVVKMAAM
SGNPDLNRLVLRDTRGGGVHIPLGFLGSWMNFRHTAPERFDAASVTLVHP
GADRWTPPPLSIRFADRISAPTRTVLLQNCGHYPVEEPGIGQLVAALHEV
RDSVLAGA
118473217YP_890175.1 hypothetical protein MSMEG_5949 [Mycobacterium smegmatis str. MC2 155]MTALSLICLLITPAWFLMSHRGIDVLPLLLAGLGWISFLASCLVNDVSVL
WPNALAPAAFGLYFIGLTVITRRSVDSIAVALAGLAVGAIIFFLAEGIEL
TQTGRFADTWKYGIASAVTILLVFGLTILRAPRLVVPGALLALGLASLGL
NYRAHALVCFLAAGTLLINHVFGSRLRRGWQFIGLIIVGAAFAYAMPIVA
RTGLFGSALQRKTIEQDAFNVPLLLAGRTEPPMSVSAILERPFLGWGSAM
NLTPDVYTSAQHLATRLGFDPTFPFDVYWILPPTNYSAMHSILLGSWAEG
GALAVLLPVALLVACFGIVWNFTRLGRWAPLGVTVALQGIWDIMYGPWLY
NMIPTFACIALLFSATHFRGRPVRSDGQ
118473216YP_890901.1 glutamine synthetase [Mycobacterium smegmatis str. MC2 155]MTITPLDAHRQANATSPDLAAVLETIAERGVEFVYFQAVTITGRVVGKVA
PAKHFERLAVRGVQQHQTAVANLQGTREGVLLAGGVNAPEYTAIPDLETF
AVLPWDTSFARVFCRLYEPDHLAERAGAEFACDSRGLLRRLHAGFTDRTG
LELRTGCEPEMTWQGEGLEAQFRPGSSPAYHIEHLERNRPIVKKVVEYAQ
ALGLDMIEGDYEDEFQVELNFMYDRADLTADRLTTYRQICKQVARELGIQ
ASFMPKPATGMMGNGCHHNFSLWRDGVNVLAEPGVTELHLSELGQHALGG
LLAHSAGAMLINGSTVNSYKRYWDAGQFAPSRINWGLDNKTCTVRLSAVG
RLEYKLPDAAVNPYLSHAVILAACEDGMKNEIDPGAPTQGSSYDAPVDTR
FPALPLTLGEAIEAFRADEVLTQALGPDLSSLLIDFHADEWARFCGYVTD
WEREMYWSDAP
118473215YP_889021.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MMFSRNGIRALRIWTAVVLVFLYIPLLLVLINAFNASRTFAFPPTGFTLA
WWADAARSPGMWHALANSVVVGLAATAIALVLGTMIAFAVQRHRFFGRTT
VSFLVVLPITLPGIVTGIALNATFTSALGLMLGMATVIIGHATFCIVIVF
NNTQARLRQMGSSLQDASADLGASSWQTFRFVTFPMMRGALLAGAILAFA
LSFDEIVVTTFTAGPTVQTLPIWIFSNLFRPNQAPVINVVAAALTVLAII
PVWLAGRFGGDPAGARV
118473214YP_884744.1 LuxR family transcriptional regulator [Mycobacterium smegmatis str. MCMMTTKERPIGTELLSRSSSAVATTLLSEKAFAAGRATHRDLASPGEQISA
ALDALLASLDEVRQATSPAETLECAPRALATSAVFQRVMLSRVSGSTWLP
DAVYGVDGQRRRDVRFECYPDERLEDLQIPLASPLVEAEVVRRRLPALVS
DAHHETRVHPPLIERMQAGEYVVAPITAGSTVLGLLHASRPTDGRPLTTA
HRDLLRMFADGVGLSYEHALLVERIERQRRYVLDACDSAVRSAAGTDLTT
PIPLRPRPFRTNTVVSTQTSFTQTSQRRESSRLTILTSREREVLALLASG
ATNAQLADQLTVAESTVKSHVKHILHKLGASNRAAAISFYLRETRGRSRS
118473213YP_889818.1 HNH endonuclease [Mycobacterium smegmatis str. MC2 155]MCLLVVPVCDTGCMPFEHTFDDLDDAALVAGIEGCERAQNAAAARKLALV
ARFTARRAADSEDEVLRWAGDDWAATAAEVGAALNVGPAVASKWMRVAQE
VGERLPRVQEMFAAGWLSAQVVATLTWATHLVGDEQVLAIVDAQLAARAR
EFGPMTVDGVKAAVASLLEKYDPAAVRRSREASRDRDVRFGKPDDVTGTV
SISGRVNTADAVAYQKRSAHLTGGVCGDDPRTAGQRRADAFGVIAVQGDR
LVCLCGDPQCPWAGVDPRAANTMVHIFAEPSVVDAKPDPYVHGDYASNPV
PFVDPEFDPWPVYPERDSTPPPEPPSEPQWAPQWWSEIPLPPEPEPEPEP
EPEPEPEPEPEPELRFESEPQTASAPQPEPEPEARPEPQPKTGPEPEPVS
TPKPQPQDPPAAAESWGGGGVNPLVVAPAPVVSPQRATAVIVGGGLVPAS
YVAQMIASGAKVKQGRVPLEDPESGYRPSVGLAEFVRMRDLTCRFPGCGR
PAECCDIDHTEPFPGGVTHASNIKCLCRFHHLIKTFWAGFVDTQLPDGQV
VWTMPSGRTYTTVPGSRWVFPQWDTTTTTLPPPPPRATSPARGVMMPQRK
LTRAEQRARQIRAERARNEKYLSERNKPPPQ
118473212YP_888231.1 hypothetical protein MSMEG_3942 [Mycobacterium smegmatis str. MC2 155]MEDKPETAVAQRDRVFAFGNLDAQIRETHTGLVALIGDLAYKAKKPVRTD
FLDFTTAQQREAACLREVELNSRLAPNSYLGVAHLVGPGDRPDEPVVVMR
RYRDADRLSTLVTRGAEVNDQLDVIAEILARFHRDAGRGAVIDDQARATS
VWARWDENLTELARMSLVPPEQLSEVRRLASQYLSGRAELFAERIADGRI
VDGHADLLADDIFCTPEGPAILDCLEFDDTLRYVDGVDDAAFLAMDLEFL
GSPELSAFFVDRYRHHAHDTAPQSLMDFYVAYRAVVRAKVECIRVGQGRP
EAATDACRHIDIALDRLRAATVQLVIVGGGPGTGKTTVSRALAEELGAVV
ISTDDVRRYLQESGVIGGAAGELDTGLYAPKNVAAVYDEVLARARHALTH
GRSVILDGTWRDVGRRQRAHLLASETAVPVVEFTCSLPVVAAGERIASRS
GTTSDATPEIADALAEQGAGIVHGHSIDTSRPLRESVTEAQRVCCLAI
118473211YP_890567.1 hypothetical protein MSMEG_6352 [Mycobacterium smegmatis str. MC2 155]MTDARGTFEAFKNRDGEIPDAELDAFWALLRPAGIDFMLGEWKGGEFYTG
HKANGFMKKLNWFGKTFVSASEAKPLVCLDADGNKFSNTEAMGGEASLWL
EEFRGEVTASMVYDGRPVHDHFKVVDDNAVIGIMNGKGALDLSSGTPRHL
YFYLERI
118473210YP_891028.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMGGTAVLLAEDCAHPGTEQHPDRGDPDEHRGDPHGQRWSAGPAVAWHRHG
RHDTTTRCPPCQTVILTTVTPAKKRDISPKRGWLSPKQQRAWIAFMRVQL
RMSYEMNRQLQADSGLSLSDYDVLVALSDVGDKGMRVSDLAAQIGWERSR
LSHQLRRMEERGLTERCPSREDGRTSIVVLTAVGWRAIQEAAPGHVDLVR
SLFFDPLPENLLAPFTAALEHIHVNLNHNSSLPPEPR
118473209YP_888460.1 phosphoribosyl-ATP pyrophosphatase [Mycobacterium smegmatis str. MC2 1MKQFMLVKTFDALFAELSDKARTRPAGSGTVAALDAGVHGIGKKILEEAG
EVWLAAEHEGDEALAEEISQLLYWTQVLMVSRGLTLDDVYRKL
118473208YP_884843.1 ISMsm4- transposase [Mycobacterium smegmatis str. MC2 155]MSWVFFRHPGQGTRTMVDGSSLLLDLDGVVVESVQRLEDGTRLVQVLTAP
QWVGICPECGERSTRSKGWVQTGPRDVVVGPDRPILRWRKRKWLCPSTVC
TRKVFTESVPGIPARARVTPRAKATMATAVLDEDRSVAAVAGQYRCGWHT
VHDEVIATAEDALAGELAPVAVLGIDETRRGKAKWEHNPVLGRRVWVDRW
DTGLVDITGDQGLLGQVNGRTSAAVIDWLAGQDPDWRAAITHVAIDLSPA
YARVAREALPHAILIADRFHLVKKANDMVDAVRRRVTWTQRGRRGRKADV
EWINRRRLLRGSERLTADQRATLFAKLLSADPNQDIAAAWIAKELLRDLL
SCADRGGLRYEITTALDRFYRFCAACTVPEVIRLARTIETWQAPIIAALQ
TGLSNARTEGYNRIVKHVGRIAFGFRNPENQRRRVRWACTRRSRRVTPSR
HQRHC
118473207YP_886768.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MGEPMDRDALAEFLRRRREAIRPQDVGLPEGPRRRTAGLRREEVAQLTGM
SVDYYGRLEQARGPQPSPQMLRALARALRLTDDERDHLYRLAGHAVPDRG
GLSTHVRPALLFVLDRMRDAAAFVCTDTGIMLAQNAMAKLLMGDLTTAET
TVEASMIWQWFIDPVVREQFPDVEHDQHSRIMVADLRAAWARRRTEADMR
ELVDGLLARSPEFAELWSRHEVAVRRLQRKTFSTHVGPITLDCEVLAAAD
GQQLVVLTPPAGSSAADDLRLLTVIGDQALG
118473206YP_888555.1 glycine cleavage system aminomethyltransferase T [Mycobacterium smegmaMSDELLQGPLEDRHRELGAAFAEFGGWLMPVSYAGTVAEHNATRSTVGLF
DVSHLGKALVKGPGAAAYVNSALTNDLGKIGPGKAQYTLCCTESGGVIDD
LIAYYVSDDEIFLVPNAANTATVVEELQRHAPDGLTITNEHRSYAVLAVQ
GPKSAEVLDKLGLPTDMDYMGYADAEFDGVFVRVCRTGYTGEHGYELLPA
WDRAGVVFDALVAAVRAAGGEPAGLGARDTLRTEMGYPLHGHELSLDISP
LQARCGWAVGWKKDAFWGRDALLAEKADGPKRVLRGLKALGRGVLRADLA
VLDGDTRVGVTTSGTFSPTLKVGIALALIDTEYDIADGTTVTVDVRGRAV
ECEVVKPPFVTPSTR
118473205YP_884629.1 L-sorbosone dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRAWPGISAVVVTASVVLAGCGTEPQTTEPTAQPSRSSSQTTAEHPAGAA
ELTPVTVEVPEGLDDAPLDQPRQALVPDGWTLEVVARVPKARMAAWAPDG
ALLVSVPSTGEVLKVLPTQSTLLDGLDQPHGLFFAGPTLYVAESDQIDAY
DYADGAAVNRRTVIDGLPDAKSPDLRGAYAHALKSVVVGDDGAVYFSIGS
TGNISAEDRTADPPRATIMRVPPGGGPAEPFATGVRNGTGLAFAPDGSLW
TAVNNRDNVADPDGRVVQSYVDDHPPESVARLTPGRELGWPYCNPDGPPP
AKLIRDLQTNPDGAEMDCAALPPIEQTLGAHSAPLGMSFAELPQPFGQGA
LVGVHGSWNRDAPRAPEVSFFAWRDGTLGPQQTLVGGFQDDDGQRWGRPV
AAVTGPDGAVYITDDFAGAVYRLAPPP
118473204YP_887261.1 glyoxalase/bleomycin resistance protein/dioxygenase superfamily proteiMTVLDSPIPRFHLAMPVDDLDAARHFYGGVLGLPQGRSSERWIDWNLHGH
QVVTHLAPERARQVHNPVDGHDVPVPHFGLILTVDAFHALADRLRTAGAT
FVIEPYVRFEGETGEQWTMFLLDPAGNALEFKAFADDSQVFAV
118473203YP_890246.1 xylose repressor- ROK-family protein transcriptional regulator [MycobaMANGTQQNRAARVGTSNDDVRRRNLSSVLTLVHRRRSLSRADLTRHTGLS
RSTTKDLVEELVALGLVDESPAPSVSQVGRPSPIVRPSDRVLAVAVTPEV
DAVTVGLVSLGGAVLDVVRHPTAGIPTPSDTVAIAAEAIGDIRRNLRDEQ
ALTAVGMAVPGLVHGRASFVQLAPNLDWHDVEIGEMLSAATGLPVYAGND
ANVGAIAEHLFGSHHDVEDLIYVNGGPSGIGAGFVVAGDLLQGVAGYAGE
LGHTFVGGQRLCHCGSTGCLETEVTQAPLAALLDDLDGAAGDATSDCAGR
DELHRQARALAIALGTAINMLNPGLVVLGGFLRVFPAFAAAVLREELARR
TMAAPCSLVRIVPATLGPDTLMIGAAELAFAPVLADPGGVEAG
118473202YP_888112.1 hypothetical protein MSMEG_3820 [Mycobacterium smegmatis str. MC2 155]MHLLAGHRRKRHTRTWQDNLLGECQEFRRKYPVFRPNRCEPKDARVNVVS
RVDSLGLWVLSLDLFASTLSTTE
118473201YP_888253.1 pyruvate dehydrogenase [Mycobacterium smegmatis str. MC2 155]MITVADHIVSVLRISGVRRVYGLPGDSLNGFTDAIRRSGEISWEHVRHEE
TAAFAAAADAGLTGQLAVCAGSCGPGNLHLINGLFDAQRSRVPVLAIAAH
IPRSEIGSQYFQETHPQELFGECSVYCELVSTPEMAPRILAMAMRAAVED
NGVAVVVIPGEIFLQRIPEQPVRPISATRSVLCPDEASLQRAADMLNAAE
RVTILGGAGVAGAHDALVQLAATLQAPVVHALRGKEFIEYDNPFDVGMTG
LLGFASGYKAIKEADTLLMLGTDFPYQQFYPENATVIQVDVRGAHLGRRT
PIDLGLRGTVGDTLAALQPLLRPKHDREHLDRALRHYRKTRASLDALAVN
DRDRTPIRPEYLAGLIDRLAAADAVFTCDVGSPVVWAARYLSMNGRRRLL
GSFNHGTMANALPHAIGAQSAYPGRQVIALAGDGGLTMLFGELVTLIQNR
LPVKVIVFNNSSLNFVELEMKAAGIVTFGTDLQNPDFAAVATAMGIHGRK
VTEPADLEDVLKEAFAHDGPAVIDVHTARQELSIPPAITIEQAKGFSLYA
IRTILAGRSDELLDLITTNVARRILD
118473200YP_886852.1 site-specific tyrosine recombinase XerC [Mycobacterium smegmatis str. MESVLDQFDAYLGLERGHSDHTRRAYRGDLTALFDFVEQRTGERSLARVS
LPLLRSWLAEQSASGAARTTLARRTSSVKTFCAWALRRGLIGVDPAARLQ
VPKARRTLPAVLRRDQALDALDAVNSGAQEGDPIALRDRLIVELLYATGI
RVSELCGLDIDDIDTSRRVVRVLGKGNKQRTVPFGEPAHAALTAWLTEGR
PQLSIPESGPALLLGARGRRLDPRQARTVVHQTVSAVNGAPDIGPHGLRH
SAATHLLEGGADLRIVQELLGHTSLATTQLYTHVTVERLRAVHDQAHPRA
118473199YP_888429.1 acetaldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDKVKVAIIGSGNIGTDLMMKTLRSSSLEMAVLVGVDPRSDGLARAERLG
IATTSGGLDHFVTTPEFEDVAIVFDATSAAAHERHASILAQLNKQVVDLT
PAAVGPYVIPTVNMDRVVGEPNVNMVTCGGQATVPIVAAISGVTPVHYAE
IVASIASRSAGPGTRANIDEFTETTALALESVGGATQGKAIIVLNPAEPP
LIMRDTVLCLCDEADETEIEAAVERMVASVAEFVPGYRLKQKVQFQRYTR
NSPLRLPEQEADFTGLQVSVFLEVEGAAHYLPAYAGNLDIMTSAALRTAE
RMTELDAIRGK
118473198YP_890785.1 hypothetical protein MSMEG_6573 [Mycobacterium smegmatis str. MC2 155]MDDGVQDAVAALDAALNTLLTLPHSALTDAELLTICAGLQDARNRIPAVE
HRAIAALSQQTTPAAIGAKSWPLVLATRLGISSKEARRRCTDAAELGPRV
SMTGEALAPKREHIAAAQADGTLTPDHVAELFKFFTKCPDWVTYAEQCRL
EEKLVTGAIGADPETVRQAVDHAVFLLDQDGPAPTDNPPTKPFGITFGPQ
QPDGSYHLRGKVSAEFKATFDPIDEKLAAPGMCNPTDQTPCISGTPSQQQ
IDSDQRGAPERRHDAMLTAMRLLLAHKDLGQINGLPATLLVTTTLQELEK
AAGVAITAGGTKLSIPDLIRLASQALHYLAVYDEHTGIPLYLGRARRTAS
AGQRLAIWARDRGCTRPGCTANGYRCQAHHATTDYAKGGLTDADALALAC
GCDNRLVGEAPNKWTTRINNHGQCEWIPPDLLDRGQHRTNTYHHPETLLA
DINRDQKTDGDNREQHHTDTGADTGTVHVNGHGEKPAIPPELLDQGQQRT
APYHQAEVPPVNTRDTRSSTTTRDANRHNGNGDRNSAENRNGPSKNAAGD
DDEPR
118473197YP_884730.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPAYALVLSVLVTAPLLAPGYLLLRDAVSTPRSYVTDAALGLTEAAPRAL
PQDFAVALASSVLDGGVVVKALLLAGLAAAGWGAARLVGHVLFDAGLAGR
FTAATLAIWNPYVAERLLQGHWSLLVGYGCLPWVAVSVLRLRERASWTPV
APLVFWMALAGLTPTGLVLAATVALVCVAAPGDGWRRARVAGLGLGVAVA
AACPWLVAAFVSGAVSSSPDPGAGVRAFAARAEPGLATLGSLAGLGGIWN
GDAVPASRTSLFAVVATVVLLGVVAAGLPVVARRRAAVPLLVLAAGAVIM
PALMASAPGLVVVEALIDAVPGLGIVRDGQKWVALAMPGYALAAGAAPMM
LRRLRIPAAAAAAVCCAALIAVLPDLTWGVGNQMRAVRYPQSWAQVAATI
NADPRPVVALPADSIREFSWAGTVLDPLPRWLRADVLTTGDLLIGGRTVP
GEGARARAVQGLLRDGASPQQLAEAGVGWLVRETDSGITAQRIGGEAPSS
PHRGLLIAAHLVWLAALAGGALGLVAGRVGRVLSRRTWRHRPRPG
118473196YP_885734.1 50S ribosomal protein L1 [Mycobacterium smegmatis str. MC2 155]MSKNSKAYREAAEKVDRTKLYTPLEAAKLAKETSSKKQDATVEVAIRLGV
DPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEQAQAAGADIVGSDDL
IEKIQGGFLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVQDIKGGKINFRVDKQANLHFIIGKASFDETKLAENYGAALDEVLRAK
PSSSKGRYLKKVTVSTTTGPGIPVDPSVTRNFTEA
118473195YP_887821.1 hypothetical protein MSMEG_3518 [Mycobacterium smegmatis str. MC2 155]MTPNPGEARPELVVNDIAAVVATGRFDEALAWYGCIFGREPDLRPVAGVA
EWQLTATAWLQLITDEARAGRTAVRFGVTDLADTRAALAGRGLIAAAEPR
VIADLVAVLEITDPDGNEVSFVQELT
118473194YP_888724.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MAQPLSYTRDDVTFMSDGTSCAAWLYRPDGVNNPPIVVLAHGFAAFRELR
LDAYAARFAQAGYAALVFDYRHWGASDGQPRRILDIPKQQTDWRAAIAYA
RSLDNVDTTRLVGWGSSFGGGHVLTLAARDHEFAAAIVQVPHVSGPASAF
SQSPKLVARLIAAGLRDQIGAWFGGAPHRVTSIGRPGEFAMMTSPGAYEL
VEEMAGGEAAEHMRAQLEAENDVAARIALRVPLYSPGRHAAKITAPTLVQ
LATKDDVTPYAKARKIVARIPNGEVRSYDITHFEPYVDPHFEQIVTDQID
FLNRHVGAGTR
118473193YP_887671.1 RhtB family protein transporter [Mycobacterium smegmatis str. MC2 155]MISQMLPTVVTYAVLTASPGPGNMAIGAVAARHGRRPGLTYAAGLLAGGF
VWAVLAATGISTLLVAATGLLTALKILCAAVLFWLAWKSMRTAFRGKHLT
EARDRDDAPNWLVLARRGFLMQVSNPKAVITWTAVMAVGLHAGSRPAVLF
VTIGICEILGMTIFAAYALMFSIGVVARGYRRAYRWVEGALGIVFTAAGI
RLLMASRL
118473192YP_884631.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSYAVGVDINGASAIVTGGASGIGAASARLLAAKGAKVVIADLQADKGEA
LAKELGGAFVSVDVTETDQIIAAVDKAAELGPLRALVNSAGIGWAQRTIG
KDGEYASAHNLDVYKKVLAINLVGTFDCIRIAATAMSRNEPTETGERGAI
VNMTSVAAFDGQIGQAAYSSSKGGVVGLTLPVARDLSAVGIRVNTVAPGL
IDTPIYGEGEGSEAFKAKLGESVLFPHRLGKPEELASMVIELITNSYMNA
EVVRVDGGIRMPPK
118473191YP_885908.1 tRNA pseudouridine synthase A [Mycobacterium smegmatis str. MC2 155]MPAIESGGGHVRLRLDIAYDGTDFAGWAVQAGQRTVAGVIDEALTTVFRT
PVVTRVAGRTDTGVHATGQVAHVDVPAEALPHAYPRHTRPTDAEFTPLVR
RLAGFLPADVRVRDIVRAPAGFDARFSALRRHYVYRLTTAPYGPEPHETR
FVTPWTRPLDVDAMNAAAQELLGLNDFAAFCRYRAGATTIRDLQRLEWVR
NGFYINAYVTADAFCWNMVRSLVGALLKVGEGRRSPEWTAELLGATSRSS
EFPAAPARGLTLAAVDYPPDDELEARNVVTRDVRTIDQSRD
118473190YP_885819.1 50S ribosomal protein L3 [Mycobacterium smegmatis str. MC2 155]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
QLAYGEISPRKVIKPVAGQFAAAGVNPRRHVAELRLDDEAAVAEYEVGQE
LTAEIFSDGAYVDVTGTSKGKGFAGTMKRHGFRGQGAAHGAQAVHRRPGS
IGGCATPGRVFKGTRMSGRMGNDRVTTQNLKVHKVDAENGVLLIKGAIPG
RNGGLVVVRSAIKRGEK
118473189YP_888708.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRPARIVIVGSGFAGFECARRLSKQLKRHRSEAVVTLISPVDYLLYTPLL
PEVAGGATDPRFATVPLNDRLPEVQFIRAYVDSVDLSARSLRCRDQENMS
HELSWDRLVLTPGSISRLFDIPGLAEHGRGLKSTAQALFLRDHIIEQFEL
ARIDEDRERANARKTVVVVGSSYSGTELIAQLCAMASVAVHDFGFEPGDV
RLILVERSGRLMPEIGPALAVRAEHVLKRRGVRFLTGVTLSRVAADHVIL
SDGTRIGTYTVAWVAGVVASPLITATGLPTEKGRLKVGPDLQVPGFDGVF
AGGDAAAVPDVTNPGTITPPTAQHATRQGKILARNVAASLGYGSAREYRH
RDLGTVVDLGPGFAVANPLNIPLSGFLAKLVTRAYHLYAIPRNANRWAVA
LGYLTNVLFGRPLVSIGFAQPSWAQFSASEEFMTAPTATQPLDEQMYTDD
LRFQEASADRASAPGDRARKAT
118473188YP_890497.1 metallo-beta-lactamase superfamily protein [Mycobacterium smegmatis stMPDLLKIADSLYRLRIPGDRAHLLNCYLWQEPDGVTLIDTGWPGEAGLIA
EALAMLGLRRLHVKRVVLTHFHEDHTGAAAEIADWADVEVIAGAADAPFI
RGDEPGPLPVLTDAERTLRSDLTEPPVGPPCRVDTTVRDGDVLDFAGGAR
VVGAPGHTPGSIGLYLPAADAVLTGDAVAEFNGHVIVGVFNVDRAAAVAS
VQRLAETGAQVAGFGHGEVLLTDAAARIADAADPFA
118473187YP_887905.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMSPNALLECTDIHKSFGGVPVLKGISLQLEPGTVTALAGENGAGKSTLMK
IISGQYNADQGEVSVKGATLTPGNTRDAVRHGVAIVPQELASIEDMTVYE
NLFVGRELKRGPFLNRRAMIAEAKETLAVFDVGISPTARMGSLPVGLRQI
VEIVKAARTGAQVVMLDEPTSAISEREVEGLYKIVRRLRDHGVAMVYTTH
KMAEIRAIADRVVVLRDGGLILDKPIDDVSDDDIVTAMIGRELEALFPDR
PEPADETVLEVRDLQVEGASEPVSFSVRAGEIVGLAGLVGAGRTELLEAI
FGARRSTAGDVVVRGRSVKRNQPAAAITAGMAMVPEDRKLSGAVLSMSVL
DNGTLPRLSSFSIAGWLRGKSRTQAVSEVMSSVRLRSRGLGQEVGTLSGG
NQQKVVLARWLTGKVNVLLLDEPTRGVDVGARSEIYRIITEFAAQGMAVV
MASSDMPEVVGLSHRAFVMRGGAFVGELDREALDHPEVQESVFRLATALD
ARSDQTSQEITS
118473186YP_889057.1 carveol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGSAEGRVAGKVAFITGAARGQGRSHAVRLAEEGADIIAVDLCQDIDSIG
YSLATPEDLEETARYVEKAGRRIVTAQADVRDAAQLKEALERGVSELGKL
DIVVAQAGIAAMKGNPPLQAWTDGINTNLVGTINAIQVALPHLSEGASIV
ATASAAALMDAHNKPNPGADPGGMGYMVSKRMISEYVHYLATELTPLGIR
ANVIHPTNCNTDMLQSEPMYRSFRPDLEHPTRADAEPVFYVQQAMKVPWV
EPSDISNAVLWLASDESRFVTGMQLRVDAGGYLKWYDYHV
118473185YP_885045.1 hypothetical protein MSMEG_0635 [Mycobacterium smegmatis str. MC2 155]MAAVALACAPSAAAVENPWFARSVGTATQVISVVGVGGSKAKMDVYQRTA
AGWQPVGVGIEAWIGANGMAPQTHDGEMKTPMGIFTLDFAFGTAPNPGGG
LKYVQVGPDHWWDGDMKSPTYNTMQVCKKAQCPFDTDPRSGTENLNIPQY
RHAVVMGVNKARVPGNGGAFFVHNTDGGPTAGCVAIDDATLVQIIRWLRP
GALIAVAK
118473184YP_888110.1 hypothetical protein MSMEG_3819 [Mycobacterium smegmatis str. MC2 155]MLAGLLIGAQIAPATALADPPVEPAVDPAAPPQVEGQTGPLHNVTYRARI
DGVSRNATIAYKIDDSNVNTADPTMLPGRTFEATGVVTDPQLAGMTVRID
WPYSANLHCEILVDDQVIAQADTFVAPRLTRPKNDPGYGSLLCGANLADG
TGNVINTGPVEPVEPVAPAEPPPPPPAQNAA
118473183YP_889304.1 ABC transporter substrate-binding protein [Mycobacterium smegmatis strMRRILVPAVLVVLALIATGCGGQSGTPPIRVGAAPGAESALIGHLYAAAL
RYYGSPAEVVETDEGLGALDSSAVTVLPGFTGQLLVALDPGASARADEQV
YRDLLSALPEGVAAGDYTTSAQDKPALVATEATTRAWDGTDLAALRRHCA
QVRPGAVAGAQVPAAIGQCTPAKPVRFDDEDTLFAALDAGRINVAWSRTA
DPEIPSHLVVLADRTSLIRAENIVPLYRRNELDERQIRALNEIAGVLDTG
SLADMRRKVAEGADPGAVADEFLQANPLGH
118473182YP_889952.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKVLISGASIAGPVLAYWLSRHGFEVTVVERSPVLRKTGGHAVDLFRPAM
EISERMGVLPEIEAHATGTTSMVVHRPGTSRPARLDYLKVVGVISDRHIE
IMRDDLSEIYFRAGRDDVEYLFGDTITSISPDGDVTFEHHPPRRFDVVVG
ADGLHSGVRRLVFGDNVSENFLAGYLSVVSVPKSLARDGEMTSFLKPGHM
AAVYTADHLEDARAVFIFRPSRPLDYDHRDVERQKAQLRAAFEHIAPEVD
RWLDEVPRTPAFYFDAITQLEMTTWSRGRVTLVGDAGYCPGPAVGGSTSL
AVYGAYVLAAEMVRAGEDYPAAFDAYERTMLAPVVGSRKLARFNAKTVVP
ASGLGIRALVGVGQLISVLPVGLTRSLARLNDKGVRLYDTMPLPQWPARL
NG
118473181YP_887406.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMTTSHNTESTLSDPAVNTPLVPAVRMHDIVKTFPGTKACNGATLEVAPGE
VHCLLGENGAGKSTMMKILSGSYTPDSGTIVIDGVETSFSSPIDGVRAGI
NTIYQELDLVPDLTVAQNLFLGHEPKRGPFVARRKRDRLAQAAIERVGGS
FAPSDVVANLSVADQQLTAIAKALTTDARVVIMDEPSAALTDHDLAAVFR
VIRELTSAGKSVIYISHRLDEVKEIGDRATVMRDGATVGVFDIASVTKDE
LVEAMIGRGLQALPPRRSGPDGARTELLKVRRATIPGVLDVSDISVGRGE
IVGLAGLGGAGRSTLLATLFGDRTATLDLTLNGVRLDRLTPRGAVAAGIG
LVPEDRKSQGLFLEQSILRNAGIAALRPLRVNPMKAAEQLCMPALRRLGV
KFAGLDQPVGQLSGGNQQKVVLAKWMARGIDLLLLDEPTRGLDIGAKGDL
FEQVQALADSGVGVLMASSELSELTENCDLIWVMHEGRNIAAFDPRTTSA
TDIARCVVTGRHDND
118473180YP_889197.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473179YP_889209.1 homoserine dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSKKPIGVAVLGLGNVGSEVVRIIADSADDLAARIGAPLELRGVGVRRVA
DDRGVPTELLTDDIDALVSRDDVDIVVEVMGPVEPARKAILSALEQGKSV
VTANKALMAMSTGELAQAAEKAHVDLYFEAAVAGAIPVIRPLTQSLAGDT
VRRVAGIVNGTTNYILSEMDSTGADYTSALADASALGYAEADPTADVEGY
DAAAKAAILASIAFHTRVTADDVYREGITTVSAEDFASARALGCTIKLLA
ICERLTSDEGKDRVSARVYPALVPLTHPLAAVNGAFNAVVVEAEAAGRLM
FYGQGAGGAPTASAVMGDVVMAARNRVQGGRGPRESKYAKLPIAPIGFIP
TRYYVNMNVADRPGVLSAVAAEFAKREVSISEVRQEGMVDEVGKPCGARI
VVVTHSATDAALSETVEALADLDVVQNINSVLRLEGTNS
118473178YP_887295.1 histidyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MTEGSSPVAFQAPKGVPDYLPPDSAQFVAVRDGLLSAARRAGYGDIELPI
FEDTALFARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVIRAVIQH
RLDRGALPVKLCYSGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEV
IAVADAGFRSLGLSGFRLEITSLGDDTCRPAYRELLQEFLFKLDLDEETR
RRAEINPLRVLDDKRPHVREMTADAPLMLDHLSDSAKEHFETVQTYLDAL
GVPYVINPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMRQLGG
QDVSGIGFGLGVDRTLLALQAEGVTIEGAGGVEVFGVPLGAAAKLELAKL
AAKLRAGGARVDLAYGDRGLKGAMKAADRSGAKYALVAGDRDIEAGTVGL
KDLSTGDQIDVPADSVVAEVLSRLGR
118473177YP_886677.1 hypothetical protein MSMEG_2331 [Mycobacterium smegmatis str. MC2 155]MRISTVVGVLAAGVLIGGVAAPSAAAQSTCAELGGTVDADQICQVHTANA
TYRLDYTFSTTYPDQEAVVGYLSQTRDGFVNVSDMPGSRDQPYVLDARGS
SYSSAVAPGLPARTQSLVLEVFQDVGGAQPETWYKSFNYDLVKRAPITFD
TLFKPGSRPLDVIFPIVARELETQAGIVQSISQSAGMDPTHYQNFAITDD
SVIFFFDRGALVADSAGALQASVPRWAVASLLA
118473176YP_889314.1 malyl-CoA lyase [Mycobacterium smegmatis str. MC2 155]MENTYRPRRTCLSVPGSSAKMIEKAKTLPADQVFLDLEDAVAADAKAQAR
TQVAVALAEDGWAGQLRGVRVNDWTTPWTYSDVIEVVSTAGAHLDLIVLP
KVTDVSHVHALDLLLTQLEQTHGLPVGRIGIEPQIEDALGLTNVEAIAAG
PRVQALVLGPGDMAASLRMRTLEVGGQPDGYDIGDAHHHVLMRILIAARA
HGINAIDGPYVKVRDVEGFRRVAGRSAALGYDGKWVLHPDQIAAGNEIFA
PRQKDYDHAELILEAYEWHTSQAGGARGAVMLGDEMIDEASRKMALVIAA
KGRAAGLSRTGERFRPPA
118473175YP_888034.1 hypothetical protein MSMEG_3735 [Mycobacterium smegmatis str. MC2 155]MRSLLIFALVGLGAQLVDGALGMAFGVTASTLLVLSGVAAAQASAAVHLA
EVGTTLASGLSHWRFRNIDWGIVLKLGVPGAIGAFAGATVLSSLSTEDAA
PLMAAILLVIGMYVLLRFSLRTPPVFRSGATPHTAKFLTPLGLFGGFIDA
SGGGGWGPVTTSTLLSRGKTAPRTVIGSVSASEFLVAVSASLGFLVGLRA
EFLDNIPIVLGLAAGGVVAAPLAAWLVSRISPALLGTAVGGVIVLTNAQK
LVRYFGIHGGASTAIYTVIAVAWAGLVLVAWRTSRAPECVGADVDLEGLD
QADISVEAPADEPRVPTR
118473174YP_884556.1 mce associated membrane protein [Mycobacterium smegmatis str. MC2 155]MEGDAGASQLNPTDQQQEHTEPQIEQTTVEADARRPSRLGRGWMATVCAA
LVLVAAALGVGGYLALRSHLDSNVIARDEAEAMQAAKDCVTATQAPDTAA
MAAAQAKIIECATGDFGAQAVLYSGILLDAYQAANVQVQVSDMRAAVEKH
NDDGSMDLLVAVRVLVTNTEKANEEQGYRLRVKMARDEDGLYKVARLDQV
TS
118473173YP_885039.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MMDEIAAVRSIWSDLGLPGLIDVHTHFMPKNVMDKVWQYFDSQGPLIGRE
WPITYRADEQQRLATLREFGVRRFSSLVYPHKPDMAAWLNQWAREFARNT
PDCLSTATFYPEEQAGRYVAEAIDAGTQIFKAHIQVGAYDPNDPLLDEVW
GMVEDAAVPVVIHCGSGPAPGEYTGPERVEKLLARHPRLVLIIAHMGMPE
YSEFLDLAERFDGVRLDTTMAFTPFSEAMMPFPPADRARLYDLGERILFG
SDFPNIPYGYADALRHTVDLPGIDDTWRRNVLHDNAARLFGVASR
118473172YP_889454.1 hypothetical protein MSMEG_5208 [Mycobacterium smegmatis str. MC2 155]MADDDSPDAVESTDAEEAEEAAEDGTPDVKEPLSRVALGARVGIAVVVVL
AVLTGWLGYRAYQSYGVEQQREAFLQAGRQAATALTNVGWETADADVQRV
LDSASGTFFDDFQKRAESYLEVVKQVQSKSEGTITSSALESVDDNTAKVL
VSVTVKSTNAGVPEQAPQFWRMRLTVEENAGQAKVSDVEFIE
118473171YP_888393.1 alpha-methylacyl-CoA racemase [Mycobacterium smegmatis str. MC2 155]MTGTLPLAGIKVLDLSTLLPGPLATLMLAEAGADVIKLERPGRGDEMRTY
EPTFGEASANYAILNRGKRAYAVDFKDPAQRDRVLEIAADADIVMEQFRP
GVAERLGLSYDAMRERNPRIVYCSISGYGPTGQHASRAGHDLNYLAESGL
LGVVTDANGSPNLPVSVLADIAAGTYPAVMNVLLALRMAERTGEGAHLQV
SMTHNLQVLAYGYIATHQAAGTWPQPSAELLTGGSPRYQIYPAADGRYIA
CAALEEKFWQRLVTLVGLDKRFHDDVGQEQAVTAALTDIFASQPSSYWRE
LLAGEDVCTVVVNTWEEAVEAGHVNINSADRVCVPGDPDLSIPTLTTSVD
PTLRIPDNTRAYPSLAPLPDGHVVWA
118473170YP_885641.1 ISMsm7- transposase orfA [Mycobacterium smegmatis str. MC2 155]MPTPFPAEFRADVIAVARKGEAPLRQIAKDFGISEACLHRWLKIADREDG
RGQPASPADADDMAAQLREAHKRIKLLEQEAEVMRRAVGYLSRDANPK
118473169YP_890236.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNLSEAPKEIDGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVISD
YHERRLGETRDQLADLGLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDV
LVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGG
VIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSP
SIARHKFLEKTSSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYM
TGEVVSVSSQRA
118473168YP_891092.1 replicative DNA helicase [Mycobacterium smegmatis str. MC2 155]MDDLGHPDGPADIDGPPPSGDFGRQPPQDMAAEQAVLGGMLLSKDAIADV
LERLRPGDFYRPAHQSVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIG
GAPYLHTLISTVPTAANAGFYAGIVAEKALLRRLVEAGTRVVQYGYAGAD
GADVADIVDRAQAEIYDVTERRASEDFVPLEDLLQPTMDEIDAIASQGGI
ARGVPTGFTELDEVTNGLHAGQMIIIAARPGVGKALALDTPLPTPSGWTT
MGDVAVGDHLLGPDGEPTRVVADTDVMLGRPCYVVEFSDGTAIVADAQHQ
WPTEHGVRITANLRAGMHTVVSASGGRGGTALLAPAVQITAVRRRPSVPV
RCVEVDNPEHLYLAGPGMVPTHNSTLGLDFMRSCSIKHRMASVIFSLEMS
KSEIVMRLLSAEAKIKLGDMRSGRMTDDDWTRLARRMSEISEAPLYIDDS
PNLTMMEIRAKARRLAQKSDLRLIVVDYMQLMTSGKKYESRQQEVSDFSR
SLKLMAKELDVPVVAISQLNRGPEQRTDKRPQVSDLRESGCMTANTRILR
ADTGAEVTFGELMATGERPLVWSLDEHKRMVARPMTNVFPSGRKEVFTLR
MASGREVEATANHPFLTLDGWVPLGELKPGDRLATPRLVPEPVNTQRMHD
SEVVMLAHMIGDGSCVKRQPIRYASIDEGNLLAVETAAEHFGVTPIRDEY
AAAQVTTLRLPAPYRLTRGKRNPIAEWLDKLGLFGKRSYEKFVPAQVFAL
PNDQVALFLRHLWATDGSVRWDAKVGQGRVYYATTSRQLADDVVQLLLRV
GVYARIKRAKKAGYRDCWHVLIYGRENQKRFVAHVGVHGARGAAARDLLA
ELESVTQDTNLDTVPKEVWSQVKAALIERGMSHRAFAKAMGTQFCGSALW
KHAPSRSRLHRAASLLEDAALHDLATNDVFWDEIVEITSIGEHDVYDGTV
PGTHNFVAQGISAHNSLEQDADMVMLLHRPDAFDRDDPRGGEADIILGKH
RNGPTANITVAHQLHFSRFTNMAR
118473167YP_887621.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMAGSRGNIIDDIIADHREFESVFVEIESSDDPRTQPELVEHVISGIVRHA
VAEEQYVYPAARSVLPDGDEVADHELEEHAEAEEVMKAIEKTDPEDSRYG
ELVRRLIDDIRHHIEEEESGMLSKLRDACPPERLHELSEEFQRAKSLAPT
RPHPLAPDHPPANKILGPGAGLVDRLRDILSGRNS
118473166YP_887352.1 elongation factor P [Mycobacterium smegmatis str. MC2 155]MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVV
DKTYNAGVKVETATVDRRDATYLYRDGSDFVFMDSEDFEQHPLPESLVGR
LADFLLESMPVQIAFHDGTPLYLELPVSVELEVTHTEPGLQGDRSSAGTK
PATVETGAEIQVPLFINTGDRLKVDTRDGSYLGRVNA
118473165YP_887832.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium smegmatis str. MC2 1MLNSLGRGSRSGRGSVWKLFAAVGLAVAATAVPVNVASAAVSTPVEVAQV
EPAAGAVVGVAHPVTVRFAEPVTDRRSAERSLRIASTDTSAGRFRWPEAA
VMEWTPDEFWPAHSTISLSVGGVKTSFNTGAEVLGVADIDAHTFTVSVDG
EVLRKMPASMGKPKFPTPRGTFTALAKEPVVVMDSRTIGIPLSDPEGYKL
TVNHAVRVTWGGVYVHSAPWSVGSQGYANVSHGCINLSPDNAAWYYDMVS
VGDPIIVQA
118473164YP_887631.1 hypothetical protein MSMEG_3323 [Mycobacterium smegmatis str. MC2 155]MTLQAAENSQRMQIPSRTPRLRLKPKAPRIGFVDGAWWPRGNDLSAELPD
LLAVLSVRLGHVERVLYRLSDWQSAPRKLDAGGGPVRLDGDERQPISTIS
LLGPGFRRLDLLVVAVHTDASDAHATMMRAAHSSDETSVDQLLGIEPRVR
ITLDRASIAQQRWESEIPKSRSAQPNT
118473163YP_884854.1 hypothetical protein MSMEG_0441 [Mycobacterium smegmatis str. MC2 155]MDDNTLLTQLQTDVLAIQSYALGEDADLARAVPTCPGWTVADLLGHLWSI
ESWVRQILRTRELAEEPQPQDEPTQAVADFLDGIPDYLTAMRAVNADEPC
WGFGPKPRLAGFWIRRQAHEHAVHHADLQHALGADPVGLTPDFCADGVDE
VLAMFYPRQVRFGRTEPVAAPILFRTADTEHAWTVGGTEPSEPGQAEPVA
TVTASAEDLYLGLWKRRDLLETAKVEGDTAAVQQALNVALTP
118473162YP_885795.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSAPPTSMAGQMMRRRPVIGAPVAHGASDHLKRSIGTFQLTLFGVGATVG
TGIFLVLQEAVPEAGPAVLVSFVLAGVAAGLSALCYAEMASAVPVSGSTY
SYAYTTMGEFVAMGVAACLLLEYGVSMSATSIGWGGYLNQLLDDVFGFRI
PQALTSAPWGENPGIMNLTATLLIVMCGLLLIRGASESALVNTIMVIIKL
AVLALFVAVAFTAFTTDHFAGFWDKGFAGITAAAGSIFFTFIGLDAVSTA
GDEVKNPQKTMPRAILGALVVVASVYILVAFAGLGTQSADEFGSEEQSEA
GLAVILTNILHGQTWASTILSFGAVISIFSVTLVVMYGQTRILFAMGRDG
LLPSMFARVNSHTMTPINNTIVVALVTGTLAGFVPLDYLWDLVSIGTLVA
FIVVSAGVVLLRVREPDLPRSFKVPGYPVTPVLSIIACLFVLYGLPAVTW
LWFSVWVGAVLLFYLLWGRRHSALNDGGDGYIPGAAAGEDDVMTGHPEDR
A
118473161YP_890494.1 DNA polymerase III subunit epsilon [Mycobacterium smegmatis str. MC2 1MSRAPLSSTPQLWGRPADEPGSGWAVVDVETTGFRPGQARIVSVAALAVG
DDGSVEHSMSSLLNPGVDPGPTHVHGLTAEMLEGQPCFADVVDELIEVLR
GRTLVAHNAGFDYSFLAAEAELVGAELPIDTAMCTVELARRLELGTENLR
LETLAAHWGVTQMKPHDALDDALVLAQILKPTLARARDRKVWLPLRQLTR
KRWPNGHVTHDELRPLKVEASRLPCRYANPGPFVAGRPLVQGMRVALSAE
VVRTHEELLERVLHAGLAYSDMVDLQTSLVICNDPAPEQGKGYQAKELGV
PLVRDDEFMRLLDHVVGGADVETFVDTTADGDQYALF
118473160YP_885825.1 30S ribosomal protein S3 [Mycobacterium smegmatis str. MC2 155]MGQKINPHGFRLGITTEWKSRWYADKQYKDYVKEDVAIRKLLATGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQL
NILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPASDRPRRERPSGTRPRRSGSAGTTATSTEAG
RAATSDAPAAGTAAAAEAPAESTES
118473159YP_891060.1 MmgE/PrpD family protein [Mycobacterium smegmatis str. MC2 155]MGQVNTLTDPSAPEGPTGQLVNWVRTLEWDQVPEHVRVRAAHLLLDGIGC
ALVGAQLPWSRLATDAVLGIEGDGAVPVIGTGRTSTPVGAVLLNSTFIQG
FELDDFHPFAPLHSASLVVPALLATTAHLNRPVSGKELLMAAIVGFETGP
RIGRALGGTEMLSRGWHSGPVFGGIGTALACGRLRGLNGEQLEDAVGFAA
TQSAGLMSAQYEAMGKRMQHGFAARNGFYSAALAQSGYTGIDQVLERPYG
GFLAVYGEGHRPDASAITRGLGDEWETTAIMVKSWAVMGGLHGVVEAARI
LRNRLHGRTIEHIDIRVGDVVYHHGWWQPQRPLTAIGAQMNIGYAAAVTL
LDGVALPQQFTAERLDADDVWRLLARTHVELDESIDELPPTERFQTHLTL
TFSDGSTETASVMAPHGNPRDPVTNHEVVDKFARLVAPVMPADRAAAIQH
AFLGLPEVPDVAPLVELLSGPVGRVLD
118473158YP_886446.1 peptide chain release factor 2 [Mycobacterium smegmatis str. MC2 155]MDPDRQADIAALDTTLTTVERVLDVDGLRNRIEQLEKDASDPNLWDDQTR
AQKVTSDLSHAQNELRRVEGLRQRLDDLPVLYELAAEAGGPDEVAEADAE
LAKLREDIEAMEVRTLLSGEYDEREAVVTIRSGAGGVDAADWAEMLMRMY
IRWAEKHDYPVEIFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQGTHRLV
RISPFDNQSRRQTSFADVEVLPVVETTDHIEIPENDIRVDVYRSSGPGGQ
SVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVSAMRVLQAKLLERKRLE
ERAELDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPASVLDGD
IDGFLEAGIRWRNRKDDD
118473157YP_885591.1 hypothetical protein MSMEG_1199 [Mycobacterium smegmatis str. MC2 155]MRVDGRDIVVTGKLLQPMSRRTNDILRLTLAALFLATVVASSLITRYEWV
ALERSISEVVGVLTPTQSNLVYLAYSVAIVALPFVILVSLIFSRQWKLLG
AYAAAGLITMLSLSITGNGIAAPQWHFDLGDRLDSQLSQFLDDPRWIGML
AAVLTVSGPWLPQRLRRWWWGLLLAFVPIHLVVSAVVPARSLLGLAVGWF
VGALVVWVVGTPALEVPLDGAVRALMRRGFQVQSFTVVRPAGAGPLLLEA
ASQDPDAVAVVELYGPNQRSGGAFRQLWRKIRFRSDETAPLQTSMRRAVE
HRALMAIAIGDLGLASTSTMSVAALDRGWTLYAHNRKRGTPLDQCTDEAT
VGRVWNALRMLHDHQIAHGDLRSKEITVEDGAVLFGGFGNSEYGATDAQL
QSDIAQLLVTTTALYDAQSAVGAAIKAFGRDTVLTASRRLTKAAVPARVR
ATVPDAKAVMGQARDEVKHQTGADQIEAETITRFTRTQVIQLVLLIALVY
VAYPFISTVPTFFSELRTANWSWALMGLTVSALTYVGAAAALWACADGLV
SFRNLSIMQIANTFAATTTPAGVGGLALSTRFLQKGGLSTMRATAAVALQ
QSVQVIVHVILLIFFSTMAGARADLSHFVPSATILYLIAGLALGLVGAFL
AVPKLRRWLASAVRPKLEEVWEDLIKLAREPKRLILIVLGAAGTTLGAAL
ALWASVEAFGGDTSFVTVTVVTMIGGTLASAAPTPGGVGAVEAALIGGLA
AFGVPPAIGVPAVLLYRVLTCWLPVFVGWPVMRWLTKNDMI
118473156YP_884848.1 allophanate hydrolase subunit 2 [Mycobacterium smegmatis str. MC2 155]MGTTLEVLRTGPLALVEDLGRPGLAHMGVTRSGAADRRSHTLANRLVANP
GESATIEVTFGGFSARVCGGDVAIAVTGADTDPAVNGIPFGTNSIHHVHD
GQVISLGAPHSGLRSYLAVRGGIDVTPVLGSRSYDVMSAIGPSPLRPGDV
LPVGEHTDEFPELDQAPVAAIAEDVVELQVVPGPRDDWFVDPDILVRTNW
LVTNRSDRVGMRLVGMPLEYRNPDRQLPSEGATRGAIQVPPNGFPVILGP
DHPVTGGYPVIGVVTEEDIDKLGQVRPGQTVRLHWAYPRRPFET
118473155YP_885354.1 glutaredoxin [Mycobacterium smegmatis str. MC2 155]MTLLTRAGCHLCARAAEELTVLRDELGFTLVTTDVDALAAEGDNSLRAQY
GDLLPVVLLDGTEHSYWEVDAAQLRSDLGH
118473154YP_889478.1 hypothetical protein MSMEG_5232 [Mycobacterium smegmatis str. MC2 155]MVCVTVSPAVMCAVSANGSPSRRQQRLVCRCSGVKAASRIFVELPRWH
118473153YP_885409.1 hypothetical protein MSMEG_1008 [Mycobacterium smegmatis str. MC2 155]MFTAPAIRTSSASSSSSFASCFAAPLPRGLRAVAQEQTWDAFLARFAAIA
GPVTLRQWSCVDSRPTGQIGPREYQATLSIGDTVATSSVTAYGPVAALTE
ILHAHGITVETTSFHQLPTRGQTATFIEGSNGVHREWAMGLDTDPVQSAL
RAVIACANRLTAH
118473152YP_887471.1 hypothetical protein MSMEG_3156 [Mycobacterium smegmatis str. MC2 155]MLAAIQVADAAACALKAPPVVKAFDDLGVPHRIRWIFPPIKAASAVGLIA
AGRYPALGRLTTAMLALYFLLAVGAHVRAHDKPVNAIPAAGFLATYLALT
LRHPQGR
118473151YP_886389.1 hypothetical protein MSMEG_2027 [Mycobacterium smegmatis str. MC2 155]MTDAELSPTDWVREQTERILEQGTTDGVHVLDRPIVLFTTTGAKSGKKRY
VPLMRVEENGKYAMVASKGGDPKHPSWYFNVKANPTVSVQDGDKVLPDRT
ARELEGEEREHWWKLAVEAYPPYAEYQTKTDRLIPVFIVE
118473150YP_888246.1 hypothetical protein MSMEG_3957 [Mycobacterium smegmatis str. MC2 155]MCETLDDAALIAGIAGESRAESAAAARRFAFIAEFVDRRTADSEDTVVWW
ACDDWDAASAEVAAALNIGQRSASRLMRIAVALRDRLPLVAAQFAEGAVS
TRVVETLTWRTRLIDDTQTMAAVDAQLASRIAEFGAMTIAELEGAVDKVV
DSVDPAAVRRTRTAVRSRGVWFGHPDDETGITSVHARLTNVDAVALKNRV
GAMSSGQCPDDPRTKGQRLSDAMGVLGHYGDRLTCRCGDPECPAAGIDPR
AANTMVHVFAEPAAVHGPVDRYLDGDHESNPIPYFEPTPTPEPEPTPEPV
RKPPEPEPKPWTPQSAHPGRGGAVVLGGGVVPAPLVAQLIADGAKVKELT
VPDDICASYRPSVAMDCFVRMRDMTCRFPGCSRPADFCDVDHTTPWPTGV
THPSNTKCLCRIHHLLKTFWLGWSDRQLPDGTVIWTSPTGHVYTTVPASR
ALFPQWDTTTAALPPPPTPPPPMTPSEIAARAAMMPRRRRTRAAEEARRL
AAERARNEAYLAQRDRPPPDAHGPGMQ
118473149YP_888359.1 butyryl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MEFAYTARLAELKNRARTLAEKIMPFEDECERNNGLSAQSHASIKASVLE
AGLQAINTPSEYGGAGLSVLEQVVVQDELGKLTNALWDAVWRPANPLAHA
TAEQRERYLIPAARGDRRDAVAISEAGAGSDFSSATTTATPDGKGGYIIN
GQKWFVTVGDVADFLIVLAYIEPEHAPTMFLIDVATPGVKITDVPRYTHT
FVYEHPEFTFTDVHVGPEAVLGGVGAGLELTRDWFTEERLMIGARTIGAA
ERALTLAVEWAKDRVQGGQPLINRQLIQGMIADSVVDITTNRAYTHQVAW
EFDHADPTNADQRKTLHAKAATVKLAASEASNRVVDRCVQIFGGRGYIRD
YPVERLWRELRVDRIWEGTSEIQRLVIANETNKRGLSALLSFPSAGTDQ
118473148YP_887018.1 FAD-dependent thymidylate synthase [Mycobacterium smegmatis str. MC2 1MAEIAPLRVQLIAKTEFMAPPGVPWETDADGGEALTEFAGRACYQSWSKP
NPKTATNAGYISHIIDVGHFSVLEHASVSFYISGISRSATHELIRHRHFS
YSQLSQRYVPEHDSEVVVPPGFEDDPELVEIFTSAVDASRATYTELLKRL
EAKFADQPNAVLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIACLRELVTVAPAVFSDFVISTLADGSEVATSPLATEA
118473147YP_887865.1 hypothetical protein MSMEG_3562 [Mycobacterium smegmatis str. MC2 155]MSRIGDFPDDDVAGWIQRSPDIGTAMANYTHAVYTKGRLPMRVRELARMV
IALDNECVVCQNTRDGEGAAAGVDEELYVHAAEWRTWPGYSPAERVAAEF
AHRFATEHTALRDDENFWARAGEHFDPELLTDLALSCAMWLGMGRMLRTL
DIGQSCKITL
118473146YP_886244.1 S30AE family protein [Mycobacterium smegmatis str. MC2 155]MSSHSMDSSRTMVVEDDRESTAGTTPERPHAEVVVKGRNVEVPDHFRTYV
SEKLSRLERFDKTIYLFDVELDHERNRRQRKNCQHVEITARGRGPVVRGE
ACADSFYTAFESAVQKLEGRLRRAKDRRKIHYGDKTPVSLAEATAKDPLA
GLDVSREDGEARYNDGVAEHEPGRIVRIKDHPATPMTVDDALYEMELVGH
DFFLFHDKETDRPSVVYRRHAFDYGLIRLA
118473145YP_884861.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMSPPRLNLADFLCFSIYSANLAFGKAYKPLLDQRGITYTQYIAIVALYDQ
DHQTVSGLGEKLFLESNTLTPILKKLESLGYVTRRRDPDDERQVVVSLTE
AGRELREQSFELELASATGLTVDEMRTMQKGIAKLRDNLREHVRATR
118473144YP_885866.1 adenylate kinase [Mycobacterium smegmatis str. MC2 155]MRVVLLGPPGAGKGTQAEKLSEKLGIPQISTGDLFRKNIGDGTPLGLEAK
RYLDAGDLVPAELTNRLVEDRIDQPDAAEGFILDGYPRSVEQAGALKDML
AARNTKLDAVLEFQVSEDELLTRLKGRGRADDTDEVIRNRMKVYREETEP
LLEYYRDDLKTVNAVGALDEVFARALSALGQ
118473143YP_888633.1 D-beta-hydroxybutyrate dehydrogenase [Mycobacterium smegmatis str. MC2MTDFHGKTALVTGASAGLGAAVAKLLAARGASVFGIARDADRMAEVFTEV
PGGRYASVDISSSQGCDQAVEQCVEQFGQLDTLINVAGFHQMRHTVSVTD
EDWAKDLAVNLNGPFFLSRAALPHLLQAGGNIVNVASIAGVEGEVYSAGY
CAAKHGLVGLTRALAVEFTKERLRVNAVCPGGMLTAQTTEFSAPDNADWD
LIMRIAAPRGFMDVADVAKTIAFLASDDAAAVHGAVYIVDAGKTAG
118473142YP_885982.1 inosine 5-monophosphate dehydrogenase [Mycobacterium smegmatis str. MCMVEIGMGRTARRTYELEDVTIVPSRRTRSSKDVSTAWQLDAYRFEIPVIA
HPTDALVSPEFAIEMGRLGGLGVLNGEGLIGRHADVEEKIAQVVEVAAKE
PEPSAAIRLLQQLHAAPLDPDLLGAAVARIREAGVTTAVRVSPQNAQALT
PTLVAAGIDLLVIQGTIISAERVASDGEPLNLKTFISELDVPVVAGGVLD
HRTALHLMRTGAAGVIVGYGSTSGVTTSDEVLGISVPMATAIADAAAARR
EYLDETGGRYVHVLADGDIHSSGDLAKAIACGADAVVLGTPLATSAEALG
NGWFWPAAAAHPSLPRGALLQVALGERPSLEQVLTGPSDDPFGSLNLVGG
LRRSMAKAGYCDLKEFQKVGLTVGS
118473141YP_885612.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTGLVQALVGGILIGGLYVAISIGFSLSFGVLDVVDLAVGMWVVIGAFAA
IVVSEATGIDAFALLPAVFVVFGIVGWIIAPLIYRVRMSKYALPALMGLA
FTFGLATLIRGGLLTVFGYNPRTVPTSLFTGNVSVLGITAPMIRVAGFGF
AVIATALFLAFLFYTRTGLAIRATAQSKENAGLMGIDVRRISSLVYAIYT
GLTAMAGALLGAIYAMTPEVGLRYTLFAFFVVVLAGLGSVVGVMVAGLFL
GILQSLVTTYVGANYTLLVVFAVLFVALLLFPQGISRRGIA
118473140YP_889966.1 universal stress protein family protein [Mycobacterium smegmatis str. MSTSTAPVVVGIDGSDSAVNAARWAGALAEKLGAPLHILHALPTLGRNLT
ESAGAMVAAMMTYQQDCAEIFLKAAVDSVAAERPGLAITTSSLNEPADQA
LIEAGKQARLVVLGGKAVTPTAALLVGSTSLSVARHAECPVVAYRGEHLE
PGDGPIVVGIDDSPAAEHALAAALELADKLGAPLRAVRSMSLHVPAETGV
TVPFVIDWEGVEAAELVALTETVDKAASAHPNVEAKCYVEVASPAKALMK
HAGDAQLLVVGTRGRNALAGVLLGSTSLNLLHHSPVPVMICR
118473139YP_888719.1 hypothetical protein MSMEG_4443 [Mycobacterium smegmatis str. MC2 155]MQPTMYQICIRGCVTERFGSALEGMRLEAGATESMFVGEIRDQSQLYGLL
DRVRDLGLELVSVQQWSAAGPTGAIANGDGESVGLPNPYQEDAQ
118473138YP_889347.1 hypothetical protein MSMEG_5099 [Mycobacterium smegmatis str. MC2 155]MPRKTMSFRPNLLPLSRQARAGLMLKPRQSAASAWGPHRAIILGVSLIPL
LISACAPNDAPTPEDNTSTQSSSASLPMFVNWPKQVENFRFHWSAAEGTD
LQTGPAVALRAYVESYRLVGMMGGDVSVVYPGFLRATPENSPEAKERGDL
VQLQYVRPRTRAELERNGWTYREKQVFGYQPTHVLDLVPDGEGYRATVCL
GLYSVFEAADDGSGQYISVNADTETGRPRYPDGIEVWRVDLTDRNPRANQ
STAAPTTPQAGPLPAPVDDVFGPWFVTGFSANLWGPLGDVEDVDTPEVRA
QCADAMPDDAAARSAMSTGVHAAPPPHGDPVPGWPEHIQ
118473137YP_889729.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSIWTTAEREALRKTVRAFAEREVLPHAHEWERAGEIPRELHRKAAELGL
LGAGFPEDAGGSGGDGADPVVICEEMHYAGSPGGVYASLFTCGIAVPHMI
ASGDQRLIDTYVRPTLRGEKIGALAITEPGGGSDVGHLRTRADLDGDHYV
INGAKTYITSGVRADYVVTAARTGGPGAGGVSLIVVDKGTPGFEVTRKLD
KMGWRSSDTAELSYTDVRVPVANLVGSENTGFAQIAAAFVAERVGLATQA
YAGAQRCLDLTVEWCRNRDTFGRPLISRQAVQNTLAGMARRIDVARVYTR
HVVERQLAGETNLIAEVCFAKNTAVEAGEWVANQAVQLFGGMGYMAESEV
ERQYRDMRILGIGGGTTEILTSLAAKTLGFQS
118473136YP_885227.1 hypothetical protein MSMEG_0823 [Mycobacterium smegmatis str. MC2 155]MTTPPGPPPPPYGAHGYPPPPPLPYTNGTGPIPQPPKKPRRVWVLVAVVV
AVLAMLVAGAAVALYYVTEKDSTEASQVKVGDCLAEIPDSSRVLYVETVA
CDQPHKGEVFAVMQMPDGDFPGEGAVLEFTEKCGPALKEYAPAAADDKAI
RAMVLYPTADSWQRGDRTVTCIATSENSRTGKIG
118473135YP_885483.1 glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase subunit alpha [MTDSALERTTDTVAQTIPQVRAQVDCGEITPVGLVRRALARISHVEDKIQ
AFAAVFADEALAVAQESAPQAGPLWGIPVAVKDIYDVAGYRTGNGSLGAP
EHLALRDAEAVRRLRDAGAIILGKATTHEYAYGVTTPPTRNPWSLDRIPG
GSSGGTGAAIAAGVVAAGLGTDTGGSIRIPAALCGVTGHKPTFGLVSRSG
VSALSSTLDHTGPLGRTVDDTVALLEVIAGHDPADPYSSSAPVPDFRAEF
DRGLAGLTIGVAEPYFCDRLTPDVAAAFEEAIHTLERGGATITSVTFTDV
DLCPRVVDVVCGVEAAAWHAAQIGMAPEKFSPEVRDALRLGASYTGVEYL
EARRARCAVIAGMNALFDSGPDLLISPTIAMTAPPYGSTHVDLGGRTVGV
LDGVNALTVPANVTGMPALTVPAGFGSDGLPIGLQLMGRPGADATVLGAG
RAFERIAGFVDFTPNL
118473134YP_888256.1 TonB-dependent receptor [Mycobacterium smegmatis str. MC2 155]MYALVDLLRGSRKPLSAARIAEEFGVSKRTIERDIQSLQLAGVPIYADHG
VSGGYSILREHSLPPLNLTVPESLAVLTGLGLLETSPYGAAARRARAKIL
AISREDQLAPIDEALASMFVIDAPSPSEAAVSLIPEAIAARRVVRLEYTS
EDGETRTTRDVEAMGLLRGGDAWLFVGWCRLREGIRGFQLNRIRHLEITA
EVFSERDPEVLEADLSRWPTRRLG
118473133YP_890107.1 carbon monoxide dehydrogenase subunit G [Mycobacterium smegmatis str. MELNNEFRVAVPAAKTWEVLTDVRRVAPCLPGATLLDVDGDEFTGAVKVK
VGPITVSYKGEARFQEKDAGAQRVVLKASGKETRGNGTAAAVVTAQLKDE
GADSTLVVVTTDLQISGKAAQFGRGVLSDVASTLIDQFARSLEAELLGQA
GPAGQAAAGETPSDTAASGQPQQGAPINALALAKVMAVPMAKRFAPAIAA
VAAAGLIGYLAGRRRSKSQAGLRPEDLQAALLRLVS
118473132YP_886107.1 flavoprotein disulfide reductase [Mycobacterium smegmatis str. MC2 155MVTRIVILGGGPAGYEAALVAAARGPEVADVTVVDCDGIGGACVLWDCVP
SKSFIAATGVRTELRRAPRLGYSIDFEQAKVGLPLLNERVKALAAAQSRD
IADRLRSEGITLIAGRGELIDDVPGMAHHRIKVTGHDGTVQQLTADVVLI
ATGASPRVLPNAEPDGERILNWRQLYDLDTLPEHLVVVGSGVTGAEFVNA
YTELGVDVTVVASRDQILPHEDSDAAAVLEQVFAQRGVTLVKNARAESVT
RTGDGVLVTMTDGRTVDGSHALMTVGSVPNTSGLGLERVGIELGAGGYLT
VDRVSRTQVPGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEAVAPIRLR
TVAAAVFTRPEIAAVGVPQAKIDDGSVPARTLTLPLATNARAKMSSLTHG
FVKIFCRPATGVVIGGVVVAPIASELILPIALAVQNGIPVSELAQTFSVY
PSLSGSITEAARQLMQHDDLD
118473131YP_886335.1 sigma factor [Mycobacterium smegmatis str. MC2 155]MVRHADTPTDAQRAREQFLSTGALQPDAVASSVLNSWQRSRELHVHPDRV
ELPYVRDPDTDTPLMHAAAPVLRRMAEDLSDQSVSVVLTSADGLVLDRVA
ADTEFERVLDDVRLARGYSYAEEFAGTNGIGTALETGRPAFIRGSEHYVG
TLGGLACAGSPIREPVTRRILGVIDLTCRARQADPLLFVLAKSAGSQIED
RLRTMNNETETALLDAYLKQSRRYPGGVLAIGGDVVLMNRYLRQALDAAD
QTVLLDHAAELTRSSFTSTTVAHLPSGASVKISAAERIIVGVRSDSVVFH
VSVHVAESIPVRSSQHIPRLAGQSSSFRRSAQQVERCYRDREWVVIEGER
GSGRTYLGYSVVHFVTPERSIPVLHIDNFDTPESFVAAFESETDSADFAV
IVSDVDELPDEVLNPMAAIMQTRAGRGWIAATTSTERDSQLVDLLMLPFF
THTVTVPALRHRIEDLQELVPMILNELSRGEARMDGEAMRQLAKLPWPGN
IAQLRHVLTETVRRQRSGVIGVDKLPAECRSVTRRKLTPLEAMERDAIVR
SLLENDGNKADAAAALGMSRATIYRKIKDFGIA
118473130YP_891010.1 ribose transporter permease RbsC [Mycobacterium smegmatis str. MC2 155MAETRETVVTATAPATPPPPAAKRINLGTLLREPLVGPLVALVIAIIVFS
SISNSFLNPQNVSLILQQSVVVGILAVGQTLIILTAGIDLSIGAVAVFGT
IVMAQTAGAGGPFLALGATLLVCVAFGAINGGLVTTLRLPPFIVTLGTFT
AILAGTRLLAGSETYRVEPGPLTFLGTSFRIGSFSTTYGVVAMLLVYAVV
WYALSQTAWGKHVYAVGGNPQSADLLGVKSGRVLFSVYLVTGVIAAIAAW
AALGRIPNADPNAYQNANLETITAVVIGGTSLFGGRGGVGGTLVGMLIVA
VLRNGLTQAGVDSLYQNIATGILVIVAVAVDQFARRRSR
118473129YP_888139.1 para-nitrobenzyl esterase [Mycobacterium smegmatis str. MC2 155]MHERTVRAEISTGIIEGFTRDGVHRWRSIPYARAPIGPLRLRAPQPAEPW
PGVRYCHGFGFCAPQQRRYTLLGVGKYQPTSEDCLTLNVVAPEKPHDGPL
PVMFFVHGGGYVLGSSATPIYDGAALARRGCVYVSVNYRLGVLGAMELSS
LSTPEHPIDDNLFLRDLVLALQWVRDNIAVFGGDPDNVTIFGESAGAHAV
ATLLAVPAARGLFARVISESPASGMVSSADTAARLAGQYAGIIGHGGRDA
AEALKTLSPAQLGRALEELINRGMTDMPGAFPVGPTYGTEFLPTDPVEAM
AAGSAHRVPLIVGNNAEEGRLFTRFLPLLPTNEPMIEKLFADADPEHRER
ILSAYPGYPDRDVCVRLGGDFAFGSATWQVAEAHSRHAPTYVYRYDYAPR
ALRWSGLGATHAMELLAVFDTYRTRYGSMLTAMADRRSARRVSRDIQTRW
RDFSRAGVPGDGWPAYRHDERAVYVFDTRPRVEYDPDADRRLAWEGFSLA
QR
118473128YP_885750.1 50S ribosomal protein L10 [Mycobacterium smegmatis str. MC2 155]MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSATYT
VAKNTLVKRAASEAGIEGLDELFAGPTAIAFVKGEAVDAAKAIKKFAKDN
KALVIKGGYMDGKALSVADVEKIADLESREVLLAKLAGAMKGNLSKAAGL
FNAPASQVARLAAALQEKKAGEEAA
118473127YP_885810.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MLIVGAGSAGSVLAERLSADPSCQVTVVEAGPAPSDPRVAAQITDGVRLP
IGAASSVVRHYGSTLTEDPPRRTEIIRGSVVGGSGAVNGGYFCRGLPTDF
TAWAVPGWSWDDVLPHFRAIETDLDFATALHGSEGPIKVRRVHEFDGCTA
AFVDAVSAAGYGWIDDLNGSDADAALPPGVGAVPLNIDGGTRLGPGGAYL
QPALDRPNLHLRADTRVRRVLVEHDAAVGVECVDGEILYADRIVLSAGAI
GSAHLLLLSGIGPAGDLAAHGIAVAANLPVGTATVDHPEWVLPVAWTPTH
DLPPLEAVLTTADGIEIRPYTAGFSALVHGPEHDPAELPHLGVALMRPHS
RGRVRLASADPAVPPIIEHRYDTVAGDVDALRAGAELARELVSHAVKVGE
ASWSTSQHLAGTAPLSADGQGVLDPTCRVLGVERLWVVDGSIMPAITSRG
PHATIAMIGHRAAEFIAT
118473126YP_884764.1 virulence factor mce family protein [Mycobacterium smegmatis str. MC2 MIHRRTKIQLAIFCVIAVVFGTVMIFGYMRLPAHLFGIGLYTVNLDLDRT
GGLYPTGNVTYRGTEVGRVESVGLSENGGVRAVLKLKSGIDIPSDLRAEV
HSQSAIGEQYVELLPRSAAAPPLQDGDVIAAKDVFIPPDINSLLDAANTG
LQAIPQDNLKTAIDESYAAVGGLGPAISRLVRGSTALASDARKNLGSLTT
LIDLWQPVAESQIGTADSIEAWAANLAAVTGQLKQHNADVVGLIEQGAPA
AEEARRLFERVQPTLPILLANLVSINEVAVTYQPGIEQILVLLPQGIAQL
QGPNLANRDNKDTAHKGMFLAFNTNINLPPPCTTGFLPAQQRRPPSFEDY
PERPAGDLYCRTPQDSPFNARGARNIPCETVPGKRAPTVKLCESDENFVP
LNDGYNWKGDPNATLSGQSIPDLGPGQGESAPETSPAPPAPPVEGDPVPM
AIARYDPATGTYLGPDGQVYTQADLADNGSKEQTWQSMLTPHGMN
118473125YP_887537.1 TM2 domain-containing protein [Mycobacterium smegmatis str. MC2 155]MYGDPTAPYGRHPVTGEPFSDKSKIVAGLLQLIGLVGFVGFGRIYLGQTG
LGIAQLIVGLVTCGIGAFIWGIVDAILILTDKVRDPYGRPLRDGT
118473124YP_886369.1 sugar phosphate isomerase/epimerase [Mycobacterium smegmatis str. MC2 MNIENRDLLATCWTWAGNAAPARGTERSPIPMAERLDAVASAGWEGVGIV
YADLAEIASTTGLPTLRSMLDDHGIKHVELEFITNWWTTGEQRRESDAMR
DDLFEAAAVLGATTLKAAACLQAFGETSVDRERFASAFDELATRAGSHGL
RVAIEPMPMSNLPSIIDGVAFIKDVGNPHGGLCIDTWHVHRSGTDYRKLA
EIVPVEHVFVVELTDADAEVVGPLWEDAVDRRRIPGLGSIDVAQFVAEMH
RAGWRGHWGVEIISEEHRHWALDVAVNLTREKTLETIASADQLLDRAAGR
NAGVPQHI
118473123YP_886380.1 molybdate ABC transporter periplasmic molybdate-binding protein [MycobMIRVVSVVVGVFLLAGCTPAPANDDHLTVFAAASLKSVFTELGKRFEDAN
PGATVEFNFAGSSDLATQLTQGAPADVFASADAPNMNKVVDAGLVHGDPV
DFAANTLTIVTAPGNPKHITSFADLTKPGISVVVCAPQVPCGAATEKVEK
ATGVTLHPVSEESAVTDVLGKVTSGQADAGLVYVTDAKGAGAAVAAVAFG
ESADAVNTYPIATLKDSGDIETAQRFVDLVVSPEGQEVLSEAGFVAP
118473122YP_890870.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MRTVSVITGGAGGMGVATAKIVGKEHAVVLCDVRQDRLDTAATALAEVGI
TPTVVKCDVTDRHAVNRLFATTAGLGTLASVIHTAGVSPSMGDAEYVIRT
NAIGTATINEAFYAAAPRGSAIVNVASMAAHLLPEEMIPTGLFPQAMQAP
EVFLKDMLAACEIVPEEARSGIAYALSKSFVRWYSSSQAERFTGRGLRIV
SVSPGSVDTEMGRLEEKAGAGALVADAAVPRWGTPEEMAELFAFCASDRA
GYLTGTDILNDGGVVASMRERARVAAEQQQQ
118473121YP_889325.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTRSSVAVEIHGLTKSFGRTRALDGLDMTVPYGHIVGFLGPNGAGKSTTI
RVLLGLLRAERGTVRLLGGDPWHDAVELHRRIAYVPGDVMLWPNLTGMQA
IDFLCGLRGDGVDVRRRNQLIDRFELDPHKKARTYSKGNRQKVAIIAAFS
CEADLYILDEPTSGLDPLMEQAFQQCVTEVAGRGAAVLLSSHILAEVEKL
CDDVTIIRSGRTVRSGTLAELRHLMRTTVTVRTHSDGRVLRDVPYVHDFD
CRDGQLRFSVDRTDLEFVMEHLIDLGIDDLTVTPASLEDMFLREYQGAVP
118473120YP_890273.1 hypothetical protein MSMEG_6049 [Mycobacterium smegmatis str. MC2 155]MARPLPLTAALGALALISTLAGCSGEAERSTAEPIAEPLVATYDGGLYVL
DGTTLDVVADIPMEGFLRVNPAGDDAHVLVTTNEGFRLLDAKSGELTETT
FTASEPGHVVPHGERTALFADGSGEITIFDPHELADGKPEVTTLSSPKPH
HGVAVVLSDGSFIRTEGDPDERSGAVAFDSNQAEIARSAECPGIHGETVV
EGETVVFGCENGALTYSDRVFTKIAAPGDYGRIGTVKGHDDSAVALGDFK
VDPDAELERPNQFALIDTAGNRLQLVTLPPSVSYSFRSLARGPHAEALIL
GTDGKLYVIDPASGDTVKTIAVTEPWTEPDDWQQPRPTVFTRDHDVYVTD
PATRQLHLVDIESGAVTKTATLENAPNELSGAVGHEHS
118473119YP_887374.1 lipoprotein- nlpa family protein [Mycobacterium smegmatis str. MC2 155MSTPENIDGPPRSKTPLYAGIAAVVVVVLVVAGFLWLRGSGEKKLTVAAT
QVPHAEILEFIKNGQAKDAGLDFDIRVFDDYSLGNRWLAEGDIDANYFQH
KPYLDEQVADFGYQLHAFPGVHIEPYAAFSEKYRSANDLPDGAKISITDD
GSNQARALALLASKHLVTLPTDGPVNVHTIGNPKNLQFIEAAPDLQAKAV
PDVDLAILNGNYFLDAGYTLKDALIVESLENNQYANFLVSREDNQDDPDI
VKLNELLHSDATRDFIKERWPGGDVSPAF
118473118YP_888519.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSSIPAADDVLDPDEAVYDLPTVADILGIPVTKVHQQLRDGHLVAVRRNG
VIAVPKIFFDDAGHVVKSLPGLLVVLRDGGYRTNEILRWLFTPDESLTIT
RDGSTERLTNARPVDALHSHQAREVIRRAQAMAY
118473117YP_887241.1 hypothetical protein MSMEG_2922 [Mycobacterium smegmatis str. MC2 155]MTKFLDGYLESPLSGIAPWVVMAVLSTPGHFEEAVCAALGLTLLTMWINR
RRGGTLHALDFYGAAFFVVLAVIGLAVPADTVDWLQEWAGELSNIALAVF
VIATIVVRRPFTLPYAKEQAPQEHWDSPLFLRINYVISGVWAAAFTFSAV
VGFIGNAILHDPDNFWTGWVLQLGSIFFAVAFTGWYPDYATARFDEQTGE
SPETAETGASLVKLFDWLPMFVLIAGIFGWVTDALPDVVGIAMIVVGLAG
NALVSKLSGATEKV
118473116YP_891005.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MTDPRIDPTETTAMRRARGEAIVTQLSGGTRPASLDALDHEHPFLSHAVN
AFAVGEIFDRDVLDVRTRQLALVAAFATLGLTDFIKIHGAYALGAGATED
ELKEIAVLTLIPGGFPRAIQASQAISALLAERKDHAR
118473115YP_890192.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMPEHRFQVAVVTGGGGGIGRAVARGLASAGYCVAILGRCMEDLAEAARDH
AHIAPFCLDVGDAARSAAVFAEVERRMGPVDILVANAAVYPKVHFLDQSP
ADFEETFRTNVHGVANAVRAVLPGMLSRNAGRVIVLGSLADQSPLAGACS
YSASKGALHALVRGIAAEIDRVRYPNVLVNEFNPGQTRTAMSDGGQPPEA
VYPLIQALIDLPPGGAHGRMFVMDREVRSNERLSRAILRRAGIGPRLTRL
ERHG
118473114YP_891085.1 NADP oxidoreductase- coenzyme f420-dependent:6-phosphogluconate dehydrMKIVTIGRGMIGGGLARLWRDSGHDVDELGRDGGDASDADVLLVAVPGNE
ISSALAKVTGLDGKVAIDATNIMPQRHGEFPSYAHEVKSFTRGPVAKSFN
MNFGDLFDRVREQRVRPSNWYVADEDARGVTEQLISDAGYDPARVGDLSR
ARDFEDAVWLLMGVKPQGGVFYRFAVPGQL
118473113YP_887002.1 hypothetical protein MSMEG_2665 [Mycobacterium smegmatis str. MC2 155]MSDGARSLRIQLLIGFMCVALIVYFVMLGRAAFVFITSGEAAAVALGIAL
LAFPVIGVWVLIATLRAGLAHQRLGRLADEQGMDLDVSDLPRRPSGRIER
DAADALFVQVKAELEADPDNWVRWYRLARAYDYAGDRSRARDAMRTAVRM
QEGRR
118473112YP_885078.1 FAD dependent oxidoreductase [Mycobacterium smegmatis str. MC2 155]MDHEWECVVVGGGAAGLSAALVLARARRRTLLIDAGEPSNGVAPAIGGLL
GHDRRPPHELYAQGRRELAAYPTFTFREGCVVRGAPTAGGSVLDLDDGSQ
VTAKRVLLATGMQYCPPSLPGMDKLWGTTVFQCPFCHAWELRDQRLATLA
AGAEGVNTALMLRGWSDDVVLLTDGPSDLSSGDRSLLDNAKVTIDERRIA
ELLGQDGQLTAIAFSDGTRLERDGLLVEAPLRQRSELASQLGAQCAAGEL
ASDAIDVDEMHRTTVHSVFAAGDTCTEEPSVASAIAAGSQAAKIIVQSLF
ADEFGLPYPPGSN
118473111YP_886684.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118473110YP_887719.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMLTDTVDHVRHEWAKTYPHLDTSPIEVLGRVQRIASICNHRLDLDLARHG
VNRSEFSVLSALARAGRPLRASEVVSTTMLSGASITKIADSLVGRGLVVR
QKSERDGRVVLLAPTDAGRAVVDDEMPRRIAGDAQLIAGLTPAERETLSG
LLRKVCAALGD
118473109YP_884676.1 p40 protein [Mycobacterium smegmatis str. MC2 155]MTAHGRRSGGPYFDDLAVGQVFDTAPSMTLTEGAAAAHQAVIGDRLRLSL
DAELSSAVTGEPGPLAHPALVCDVAIGQSTLVTQRVKANLFYRGLAFHRF
PVIGDTLTTRTEVVGLKQNSNKPGRAPTGLAALRMTTTDHKDRLVLDFYR
CAMLPLSENGGDTGYSDDLSAIGADASPTPTAHWDADAYRARVPGPHLDD
LRDELAGAVLRSTADVVSSAPELARLTLNIAATHHDWRSGGRRLVYGGHT
IGLALAQATRLLPNLVTVLGWESCDHTGPVHEGDTVFSELHVESIEANVV
GLRSIVFAAGGPDGGADRQVLDWRFSALLF
118473108YP_890266.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTNVAVLSESELGSEAQRERRKRILDATLAIASKGGYEAVQMRAVAERAD
VAVGTLYRYFPSKVHLLVSALGREFERIDAKTDRAALAGGTPYQRLNFMV
GKLNRAMQRNPLLTEAMTRAFVFADASAAGEVDHVGKLMDSMFARAMSDG
EPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGTEE
QPKI
118473107YP_889295.1 D-2-hydroxyacid dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAEALTERLAHIVGAGHVSTDPDVLAARSVDHTGRYRGRACALVRPGTGD
QVAAVLRACRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLTTIGDVD
TVERRISVGAGVTLAAVQKTAAAAGLVFGVDLAARDSATVGGMASTNAGG
LRTVRYGNMGEQVLGLDIALPDGSVVHRHSQVRRDNTGYDLTSLFVGAEG
TLGVITALDLRLYPVPTHRATAVCGFADLDALVETGRRFRDLDGIAALEL
IDARAGRLAAEHLGVPVPVAGSWLLLIELAGDTDQTERLADALTDAQVCD
EPAVGVDIGAQQRLWNVRESLAEVVGLFGPPLKFDVSLPLSAIGGFAESA
GKLVAAHAPDAIPVLFGHIGEGNLHLNVLRCALDTEPALYAAMMALIADC
GGNVSSEHGVGTRKRDYVAMSRTPADIAAMRAVKAALDPRGYLNPAVLFA
Q
118473106YP_890326.1 cell division protein [Mycobacterium smegmatis str. MC2 155]MNRKNVIRTLTVIGVVLLLGWSFFYFSDDTRGYKPVDTTVALAQIRGDNV
NSAQIDDREQQVRLDLKSGNGDTENSDKIITKYPTGYGVTLFNALQDKGA
KTNTVVNQGSVFGTLLIYMLPLLLLVALFVMFSRMQTGGRMGFGFGKSRA
KQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLKVHSQGKP
IAPDADLDGLAKRTVGMSGADLANVINEAALLTARENGTVITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAVAVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSHEV
AQIIDDEVRKLIEAAHTEAWEILTEYRDVLDILAGELLEKETLHRAELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAMERGEPWPPPVPEPA
FKAAIAAANREAEKRNGTNGAPSNGAPAPAGPTQPDYGAPAGWHAPGWPP
PQQSQQPGYQPQQGYWYPPPHPSGWQQPQPYPYQPYPHPGQQGTSPEHGR
PSEQSGQDDGHTGDRSNPHG
118473105YP_884732.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MTTEQSAQAEHEVGGTRGFLPAVEGMRACAAMGVVLTHVAFQTGHTGGIS
GRIFGRFDLAVAVFFALSGFLLWRGHAAAARGLRPRPRTGHYLRSRIVRI
MPGYVVAVIVILLLLPEAKADLTVWLANLTLTQIYVPLTLTAGLTQMWSL
SVEVSFYLALPLLALLARRLPVRARIGVITAVAALSLLWVCIPFAGDTGH
NPWNWPPAFFSWFAAGMVLAELTVSPYGRVHRLARRRVLMAAIAVVAFAI
AASPLAGKEGLHPGSVGQVMLKTAMGAVVAGALLAPLVLDHPGTRHRILG
SAVMVTLGRWSYGLFVWHLAALAMVFPMLGEFLFNGRMLVVLILTLVFGF
ALAAVSYALVESPCREALRRWEYRHSRPVPPLDSSITEQPEPAPAAR
118473104YP_885298.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMTAADRWEPVQRLRTYEQVMAQIEQRIAAGQLQPGDHLPSERELAALLGV
SRPSLRESLRVLEALGVVEIRRGGGSEGGAALRSVPGTGLVSLLKLQLAL
SHFSWNDVLETRLALELWSAREAAYRSTDDDHRELGAILDQMDDPSIETG
DFNCLDAEFHVRISQSTGNALTAYFMGSLRTAIHHQMVEMYAALADWRET
AKTVRREHREILQALVDRDGPLAAQRMQAHICDFYDLKISGSELAGE
118473103YP_888694.1 glucose-1-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MIYERIRAVGGEFEGKKVVVVGGSAGMGRQAALDIVDRGGSAVVIGRSKR
RVDDTVADVKSRGGQAWGIAAELTDRAAVADVQTALSEHHGDATLMVNAA
GFFVPKPFLDYDAESYDSYLDLNYALFFLTQTVVAGMVAQTVGGSIVNIG
SMWAHQAIGATPSTAYSMQKAALHALTHNLAIELAGNGIRVNAVAPAVVK
TPLYEKFIPADEIDATLATFAPMHPLGRVGTPADVANAITFLLSDQADWI
TGAILNVDGGVMAGRN
118473102YP_887418.1 transketolase [Mycobacterium smegmatis str. MC2 155]MTTAEEITALTQPNHPDDWTDLDTLSVDTARVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRQMRHDPSDTHWLGRDRFILSCGHSSLTLYIQLYLGGFG
LELSDIESLRTWGSKTPGHPEFRHTKGVEITTGPLGQGLASAVGMAMAAR
YERGLFDPDAAPGTSPFDHYIYVVASDGDMEEGVTSEASSLAGTQQLGNL
IVIWDDNKISIEHNTDIAFSEDVVARYRAYGWHVQEVQGGENVVGIEQAL
EEARKVTDKPSFIALRTIIGYPAPNKMNTGGVHGSALGADEVAATKKILG
FDPEKNFEVRDEVIAHTRELVARGKKAHDEWQVSFDEWAEREPERKELLD
RLLAGKLPEGWDADLPHWDLDAKPVATRAASGAVLSAVGPKLPELWGGSA
DLAGSNNTTIKGANSFGPPSISTEDWNATWYGRTLHFGVREHAMGAILSG
IVLHGPTRAYGGTFLQFSDYMRPAVRLASLMDIDPIYVWTHDSIGLGEDG
PTHQPIEHLAALRAIPNLSVVRPGDPNETAYAWKSVLERGSSSGPVGMIL
TRQPIPVLEGTDPEGVARGGYVLGGTPEKNPDVVIIGTGSELQLAVGAQK
ILADKGITASVVSMPCVEWFESQPEEYRDSVLPPAVSARVAVEAAVAQSW
YKLVGDTGEIVSIEHYGESADDKTLFREFGFTPEAVAAAAERSLEN
118473101YP_886505.1 hypothetical protein MSMEG_2149 [Mycobacterium smegmatis str. MC2 155]MRFEIDTDDEHSWPPANSETLWVLPEPEARTYRVLSIPVLADGIAVNDTV
LGEFANDNLMFKGKITSGGHSTIRIFIDHQVEEGILTERIAAIISEVEAA
GCTVRRSGWDLIVAVDIPTLDAYEHVYDDCLIPRGEAGELAVESACMTFD
T
118473100YP_888062.1 macrolide ABC transporter ATP-binding protein [Mycobacterium smegmatisMAHLLGGEALHLEYPTGVVLDSVTVGVSEGDRIGIVGRNGDGKSTLMGLL
TGRITPHSGRVTRRGGLRVGALDQTDTLQPDRTVVWSLVGDRPEHEWAGD
AKVRDVMSGLVADIAFDATISTLSGGQRRRVQLAALLIGDWDVIALDEPT
NHLDIQGITWLTEHLKQRWARGAGGLLLITHDRWFLDEVATTTWEVHDRI
VEPFEGGYAAYVLQRVERDRQAAAAEAKRQNLLRKELAWLRRGAPARTSK
PKFRIDAANALISDVPPLRNSVELSRAAMARLGKDVIDLLDVSVTYDGRE
VLRDIEWRIAPGERTGILGANGAGKSTLLGLISGTVAPTTGRVKRGKTVK
LAILDQQSSELQAVEGDMVREVVGRLQTTYQIDGKDYTPAQLLERLGFAR
DQLSTRVGELSGGQRRRLQLMLVLLSEPNVLVLDEPTNDVDTDMLTATED
LLDSWPGTLIVVSHDRYLLERVTDQQYAILDGRLRHLPGGVDEYLKLAAQ
RADRPAPRPEAAPAEGLSGAELRNIEKEIASIDRSLAKFSDRIAAKHEEL
AAHDQSDHVGLGKLTAELRELENQVAELEARWMELSEKLE
118473099YP_885331.1 UDP-N-acetylenolpyruvoylglucosamine reductase [Mycobacterium smegmatisMASSHVAGVEIAEAVPLAPLTTLRIGPVARRMLTCTSTEQLIGVLRALTA
DDEPLLILAGGSNVVLADDLTDLTVVRIANTEITVDGDRVRAEAGALWDD
VVVTSLAHGLGGLECLSGIPGSAGATPVQNVGAYGAEVADTITRVRLLDR
RTGEDRWATTEELRFGYRTSVLKHSDAVIVLEVEFGLDAAGRSAPVRYRE
LATALGVEPGERTDPLRVRDAVLRLRTGKGMVVDPDPDHPDHDTWSVGSF
FTNPVVTHADFERVERIARDAGAGPVPNYPAPDGVKLAAGWLVERAGFGK
GYPGEGARARLSTKHALALTNRGQATTADVMALAGTVRAGVLDVFGIELT
PEPILLGCVLSVP
118473098YP_889990.1 cupin [Mycobacterium smegmatis str. MC2 155]MNSGNVKVSDLLITTPPPIAQGAHAMTQLVEIPPADDGVDPHRHSGPVFG
YVLEGRMLFELEGEAPREIVAGEAFWEPGGDVVHYQMKNLEAESWTRVLA
VCLCAPGVDMITMLTPEEIVERDALRHPDARQFAR
118473097YP_887602.1 hypothetical protein MSMEG_3291 [Mycobacterium smegmatis str. MC2 155]MCLFEVGLDAVHSPGAAAGALPECRTALRPVTLFSFGHRGCDVNHAPPAR
VVPDDWI
118473096YP_887746.1 cyclohexadienyl dehydratase [Mycobacterium smegmatis str. MC2 155]MRLRQATIFCAALLSLSTLAAGCTSGPTPDPSPLRHITESKTLRVCSTGD
YRPFTFRDPQGTWSGMDIDLADDMARRLGVEIDMVQTTWANLVGDLNDRC
DIAMGGISITLKRAQEAVYSAPYLRDGKAAIVRCADASRFRSLQDIDRPG
TRVVVNPGGTNEEFAKGNLKQATIIDHPDNNTIFGEISAGHADAMITDAS
EIRFQTAQDRTLCGVSTDRPFTFEQKAYLLPAAAIDTARWVDEWLNIVQH
DGTYDRISQKWLGRVVGP
118473095YP_885532.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MPAPDTIRPHSTSIRAAVFDGTISVEPVDLADPRPGEVRVKIAAAGVCHS
DLHVTTGAWDVPAPVVLGHEGSGVVTAVGEGVDDLEPGDHVVLSWVPGCG
ECRYCKAGRPAQCSLVASVVAVKGTLYDGTTRLSNERGTVHHYLGVSSYA
EQVVVPRNGAIKVRKDAPLEDIAIVGCAIATGVGAVRNTAGVEPGSTVAV
IGCGGVGLACVQGARLAGASRIVAVDVVAEKLELARKLGATDAVDASATD
DVVAAMREVLPDGYDYVFDAIGKIATTEQAIAALGLGGAAVIVGLPPQGE
RASFDPLTLAEADQRILGSNYGSAVPERDIPALVDEVMAGNLDLASMISG
RRPLEEAAAALDDLAAGHALRQLLIPSA
118473094YP_888508.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacterMIDMTIARIAEIVGGELADITPEQAAATHVTGTVEFDSRAVGPGGLFLAL
PGARSDGHDFAAAAVQSGAVAVLAARPVGVPAIVVRPDGGVDSASGALEH
DTDGSGAAVLAALARLAAAVANELAADGLKIIGVTGSSGKTSTKDLLAAV
LAPLGEVVAPPGSFNNELGHPWTVLRATRDTDFLVLEMSARHPGNIAALA
AIAPPSVAVVLNVGTAHLGEFGSREAIAKTKAELPQAVGPSGVVILNADD
IAVAAMAEQTDARVVRISRDPGSDIDVWAGPVTLDELARPRFTLHTRDGE
VDVNLAVHGDHQVSNALCAAAVALECGATPQQVADALAAAGPASRHRMQV
STRADGVTVINDAYNANPDSMRAGLKALAWMARQTAGGQPGGKRRSWAVL
GEMAELGDDAITEHDAIGRFAVRLDVSRLLVVGSGRAMNAMHHGAVMEGS
WGSESTMVADADAALTVLRDELQPGDVVLVKASNSVGLGALAEALVAGEG
HTEGRTPAR
118473093YP_889392.1 binding protein dependent transporter [Mycobacterium smegmatis str. MCMTSATTGFRRQQGHPRSVRDVRVGYLAVPALVFFVAFAVIPLVGVLLLSF
TQWDGIGAIQPAGLSSWQSVLTDPSLPHTIWVTFLLMALSWAVQTPASLL
IGAFLAGRQRYREWLAVFYFIPLLLSSAAIAITYKALLDPNFGLGVGLGI
PLLSQDWLGKDGLALGVVIFIVSWQFVPFHSLIYQGAIQQIPRSMYEAAQ
LDGAGRCRQFFSITLPQMRHTMVTSSTLMVIGSLTFFDLIFVLTGGGPGD
ATRVLALDMYRRGFQANLMGPASVIAVILVVVGLVIALVLRRLGGGAPSE
SRLDGA
118473092YP_890622.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MEPVYGTVIQLARLAWRLQGLKFTVTGVENLPVTGGAVVAINHTSYFDFT
FAGLPAYLQKQGRKVRFMAKKEVFDNKITGPIMRSLRHIEVDRHSGAPSF
EQACEYLKAGELVGVYPEATISRSFEIKELKSGAARMAIEADVPIIPHIV
WGAQRIWTKGRPKNLYRPKVPIFIAVGEPIAPTLPAPELTALLHSRMQHL
LEQVQDSYGPHPAGEFWVPHRLGGGAPSLAEANLMDAEEAAEKAARRAKQ
SGSGPAEPSGAPG
118473091YP_887858.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MTVIRAAITQVEWTGDEESMVARHEALARRAAEAGAQIICFQELFHGPYF
GIVQDAKYYEYAQAVPGPLTERFSVLAKDLGVVLILPVYEEEMPGVYYNT
AAVIDSDGKYLGKYRKNHIPNVDRFWEKFYFKPGNLGYPIFDTAVGKVGV
YICYDRHFPEGWREFGLAGAEIVFNPSATKPGLSNRLWELEQPAAAANNQ
YFVAANNRIGTESEEFGDDAVTFYGSSYFVDPRGNYVGEVASENAEEIVI
RDLDLAMVRAVRNDWQFYRDRRPESYETIPAR
118473090YP_884655.1 hypothetical protein MSMEG_0240 [Mycobacterium smegmatis str. MC2 155]MAPDVRDMRDARRKDMSPIQPPSNRSPGQRNQGPRPAAVRPRDPQAPARG
AARGPQRQFDDRPVEYWPTAAIRAALETDDLTVWQRIVAAIKRDPYGRTA
RQVEEVLETARPYGVSKALSEVLVRTRDHLEASERAEVAKQIQAMLRRSK
LAPPEFASRVGVSNEEFATYLEGSVSPRASLLLRMQRLSDRFAKIAAQRS
GK
118473089YP_889613.1 ectoine/hydroxyectoine ABC transporter permease EhuD [Mycobacterium smMNTERSLWNWDYAHEVLPGLVAAFFKFTLGITAASSLVAIVLGLVLVLGR
RSGARWISWPSYAVVEFIRSTPIPIQLFFVYFGLPVVGIRPSALVTGIAV
LGVHYACYMSEVYRAGIDAIPQGQWEACTALSLSPYRTWRAVVLPQVVRR
ILPSTGNQVIALFKETPFLIVIGVLEMVTVANQFGGQNYRYIEPITIAGL
IFLAASYPTSVLMRKLEIRVAR
118473088YP_887893.1 hypothetical protein MSMEG_3590 [Mycobacterium smegmatis str. MC2 155]MTVEGTTHTRISVTRRTARWDPDESVTVADAMDFWAFAAGAANVIMQLAR
PGVGHGVVESPVDSGNLLKHPWKRARTTFSYLAVAILGNDEDRAAFRTAV
DGAHRQVRSGPQSPVRYNAFDRDLQMWVAACLFVGLEDTYQLLRGAMTPE
QAEQFYASAATLGTTLQVSPDQWPATRAGFDDYWNAACGQVAVDDVVATY
LRDLVHLKMINPLLALPFRPLLAFLTTGFLAPVFREVLGLKWGRGRQRLF
EWLFLLVALGNRFLPIFVRQGTSYLLLADVRRRARAGLPLI
118473087YP_886752.1 pyruvate carboxylase [Mycobacterium smegmatis str. MC2 155]MISKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQ
IGEVGHPVRAYLSVDEIIRVAKHSGADAVYPGYGFLSENPDLAAKCAEAG
ITFVGPSAEVLQLTGNKARAIAAARAAGLPVLSSSEPSSSVDELMAAAAD
MEFPLFVKAVSGGGGRGMRRVTDRESLAEAIEAASREAESAFGDASVYLE
QAVLNPRHIEVQILADGAGNVMHLFERDCSVQRRHQKVVELAPAPNLSDE
LRQQICADAVAFARQIGYSCAGTVEFLLDERGHHVFIECNPRIQVEHTVT
EEITDVDLVSSQLRIAAGETLADLGLSQDRLVVRGAAMQCRITTEDPANG
FRPDTGRITAYRSPGGAGIRLDGGTNLGAEISAHFDSMLVKLTCRGRDFS
AAASRARRALAEFRIRGVSTNIPFLQAVIDDPDFRAGRVTTSFIDDRPHL
LTSRSPADRGTRILNYLADITVNKPHGERPSTVYPQDKLPPLDLQAPPPA
GSKQRLVELGPEGFAGWLRESKAVGVTDTTFRDAHQSLLATRVRTTGLLM
VAPYVARSMPQLLSIECWGGATYDVALRFLKEDPWERLAALRESVPNICL
QMLLRGRNTVGYTPYPELVTSAFVEEAAATGIDIFRIFDALNNVESMRPA
IDAVRETGSTIAEVAMCYTGDLSDPAENLYTLDYYLKLAEQIVEAGAHVL
AIKDMAGLLRAPAAHTLVSALRSRFDLPVHVHTHDTPGGQLATYLAAWSA
GADAVDGASAPMAGTTSQPALSSIVAAAAHTQYDTGLDLRAVCDLEPYWE
AVRKVYAPFESGLPGPTGRVYTHEIPGGQLSNLRQQAIALGLGDRFEEIE
ANYAAADRVLGRLVKVTPSSKVVGDLALALVGAGITAEEFAEDPAKYDIP
DSVIGFLRGELGDPPGGWPEPLRTKALQGRGPARPVEKLTADDEALLAQP
GPKRQAALNRLLFPGPTAEFEAHRETYGDTSSLSANQFFYGLRYGEEHRV
QLERGVELLIGLEAISEADERGMRTVMCIINGQLRPVLVRDRSIASEVPA
AEKADRNNADHIAAPFAGVVTVGVAEGDSVDAGQTIATIEAMKMEAAITA
PKAGTVARVAVAATAQVEGGDLLVVVS
118473086YP_889264.1 hypothetical protein MSMEG_5013 [Mycobacterium smegmatis str. MC2 155]MNGQWLPDPEGRYEYRWWDGQSWTDQVSHQGQLHRAPLGPPPGPGPAQAQ
PQPQGDGFAGISGELVDGRFSEKEATAIANQNRKMLRVRLGEPFMARQGS
MVAYQGNVDFAFEGGGASKFIKKALTGEGLPLMRCQGQGDVFLADRSFDV
HLLQLTNTALSVSGKNVLAFSSSLDWNIERVRGGSMVAGGLFNTMLRGTG
WVALTTDGPPVVLDASEAPTFADTNAVVAWSANLQTQLKMSFKAGALIGR
GSGEAMQVAFHGNGFVIVQPSEGVTYPVQ
118473085YP_889364.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MGMIRQVSTREVYRNNWLTLREDAIERPDGSDGIYAVVDKPTYALVIPHD
GERFHLVEQYRYPLGLRRWEFPQGTAPDRQDLEPHALAERELREETGLRA
AHLVKLGLLDVAAGMSSQRGWVFLATELTEGDHEREHEEQDMHSAWFTRA
EIEDMMRSGDITDAQSIAAWALLLLYERR
118473084YP_889705.1 AraC family transcriptional regulator [Mycobacterium smegmatis str. MCMASNMRTGAHFTPIGGAPGIERLQAGLRGEGFTPHRHDTYAIGMTLSGVQ
TFSYRGTKRVCLPGQWHVLHPDELHDGVPGTDDGFAYRIVYVDPALVFES
SDRRLPFVADPIVDGAKVPRALARYLQRDGTDDEDDDLAATDVVTVIADM
LSAHSSAGRVVPQRLDRAAITRVRESLMDNPSRRYRAADVERIAGMDRWS
VARQFRAAFGTSPSRFRTMRQLQLARSLIVGGAALAEAAHAAGFADQAHF
TRKFKAAYGLTPAAWSGAVRHKPPVTSSTDPLT
118473083YP_890016.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSSSITDTARPRLDQVDVRGPRFAAWVTTAVLIVALLVSGVSSAAAAVVL
AAQALVFAIGALGGPRRQPYGRLFATLVAPRLGPVTEREPVPPLKFAQLV
GFVFAAVGAVGFAFGISAIGLAATAFALVAAFLNAAFDICLGCQIYPLVA
RLRRTSEYA
118473082YP_890112.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MPYLLMRWFDMTGSDGDGGQARQIEYETLDEGRIARIWLNRPQAQNAQSR
TLLVQLDEAFARAEADDTVRVVILAARGKNFSAGHDLGSEEALAEREPGP
GQHPTFAGYGATVAGVAERTYRQEWHFYFENTKRWRDLRKITIAQVQGNA
ISAALMLIWACDLIVAADDARFSDVVAVRMGMPGVEYYAHPWEFGPRKAK
ELLLTGDSIDADEAYRLGMVSKVFGREELEDKTLEFARRIAERPTMAALL
VKDSVNAAADSMGFAEALHHAFHIHELGHAHWAAANENRWPVGMPPDVPD
WRTLGAPKLARRDTP
118473081YP_889034.1 hypothetical protein MSMEG_4777 [Mycobacterium smegmatis str. MC2 155]MSTQKALAPEISTWPDENPQLIGSRCDTCGSYVFPVQDHCPRCSSADTSE
VLLPRRGTVVAWTTQGFPPGAPYAGPTGKDFVPFGVGLVELADETGPVIR
VEGRLTENDPDKLEFGQQVELTMIPFTTDDEGNEVVTFAFQPV
118473080YP_884634.1 RNA polymerase factor sigma-70 [Mycobacterium smegmatis str. MC2 155]MSVILRKLTTVTVLAHKLDDDSPADAFLAEAQTYRRELLAHCYRMTGSLH
DAEDLVQETYLRAWKSYQGFQGRSSVRTWLYRIATNTCLTSLEGRSRRPL
PSGLGTPSSAPTDQITEHHEVPWLEPLPDGDDPADPSQIVGTRESVRLAF
VAALQHLSPRQRAVLVMREVLQWKASEVGEAIGASTAAVNSLLQRARAQL
EAVGPNEDDKIEAPDSPQAQATLDRYIAAFEAYDIDKLVELFTEEAIWEM
PPFDSWYQGPQAIGDLSRYKCPAEEPGDMRFLQTTANGQPAAAMYMLNRE
TGRHEAFQLHVLDITADGISHVVAFMGEGLFKKFGLPETL
118473079YP_884864.1 oxidoreductase- FAD-linked [Mycobacterium smegmatis str. MC2 155]MSDNSAVARIDEVAPGDVVTLGTGEPTCKVVHKEDTESGLLVTFEGDDGE
TFQREFAAGTPVTRTMESKWESSQSPTPNTSP
118473078YP_888750.1 hydrolase- alpha/beta hydrolase fold family protein [Mycobacterium smeMAETSYASCGDLSLAYQLFGDGPIPLVFVGPFVGHVELFWTVPEFKSFFD
QLASFCRVAIFDKAGTGLSDPVPKVRTLDDRAAEIEAVMDAVGFDDAVVL
AMSEGGPASILFAANRPGRVRTLVAYGSFATMAGCRWEDLDGDPVDIRAR
SVAEMGDEYAPTVEQVIHFQEQARAVRGQWGSGAAVRCAMPSMGSMRQLG
MFERLCASPGMARATFEAAFRIDVRPILPTIAAPTLVIHARDDPAVPVQC
SRYLADHISGARWLEVDGVDHAPWFTEADRVLTEIEEFVTGNHAAPHNSH
RALRTVLFTDIVASTQHAASNGDERWRAVLQRFGEVTEELSGRFGGVVVK
STGDGHLSTFEGPTHAIRYAEALRSDAETLGIQIRAAIHTGECELLGDDI
GGIAVHIAARILGQARAGEILVSRTVRDLVVGSGTSFADRGNVELRGVPG
TWQLLAVGDGAGGGSPAGSVEALLAAEPTPAARTATRRADRAVAAVAKRT
PWALRGVARLTMSATRR
118473077YP_888869.1 hypothetical protein MSMEG_4600 [Mycobacterium smegmatis str. MC2 155]MTGSVGHRVAKFARVERFAMTGCRAMVSPGGCGGERW
118473076YP_888908.1 2-oxoglutarate ferredoxin oxidoreductase subunit beta [Mycobacterium sMSLVPTADQPQKAKDFTSDQEVRWCPGCGDYVILNTIRNFLPELGLRREN
IAFVSGIGCSSRFPYYLETYGFHSIHGRAPTIATGLALARPDLSVWVVTG
DGDSLSIGGNHLIHALRRNINITILLFNNRIYGLTKGQYSPTSEVGKITK
STPMGSLDYPFNPVSLALGAEATFVGRALDSDRKGLSEVLRGAAEHRGAA
LVEIMQDCPIFNDGSFDALRKEGAEERLINLTHGEPITFGADGEYAVVKS
GYGLEIAKTAEVSADDIVVHDAQIDDPAYAFALSRLSEQNLDHMVMGIFR
KVSRPTYDDAARQQVATAIESRPHDTAALQSLLRGKDTWTVD
118473075YP_887561.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTEPPQVAEEVIEDLAGVHREINAAEGEILLQTHDLTVKFGGLVALDSVN
FGIRRGEILGLIGPNGAGKTTCFNAITGVYRPSSGSVTFDGAPLGRIKRH
QITRRGIARTFQNIRLFGEMTALENVMVGTDARHRTSVPGALIRSPRHFR
EERSAVERSAALLHFVGIAHRGEEKAKNLSYGDQRRLEIARALATEPKLL
CLDEPAAGFNPSEKAALIDLIRKIRDDGYTVLLIEHDMRLVMGVTDRIVV
LEFGRKIADGLPSQIREDPKVIAAYLGVPDDEIR
118473074YP_887169.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MKSVGIPKGTECCPDAFQWDRREDCEVRQILDRIADKWSLLIIALLDDGS
MRFTELKRMIDGISQRMLTVTLRQLERDGLVRRTVHPVVPPRVDYELTDL
GRTLHQTVQPLVRWTEEHQRDIAAARQRFDEAN
118473073YP_884504.1 phosphoenolpyruvate-protein phosphotransferase [Mycobacterium smegmatiMVPGVRYAPVIRPGRLPVIELPDTEVAEPDRAAEAGRFRAAATAVTERLR
ARADRATGAAAEVLGATATLAQDRAWLGAADKRIAAGAPAVRAVSEAVDQ
FIDMFTKMGGLMAERVTDLRDIRDRVVAELSGYPEPGVPLPELPSILCAT
DLAPADTAGLDPELVVGLATTLGGPTSHTAIIARQLGIPCVVAVSGLDDI
EAGRMVLLDGTAGTVTADPDPSEAATAVDAARRSAATARNWHGPGATGDG
HAVAIMANVADGAAARAARETPAEGIGLFRTELCFLNRDTEPTVAEQAAI
YGEVLDAFSGAKVVIRTLDAGSDKPLKFAGHPPEEANPALGVRGIRIAEA
NPGLLEHQLDAIADAAENTRSAPWVMAPMIATPDEAKRFAAQVRSRGLTP
GVMVEVPAAALLAEQILDHVDFLSIGTNDLAQYTMAADRMSAELAALTDP
WQPAVLALVGTAARAGAAADKPVGVCGEAAADPLLACVLVGLGVTSLSAA
AAAIPSVGAKLATVTVQQCREAARAVLATAGPAEARAAALGILT
118473072YP_890994.1 triosephosphate isomerase [Mycobacterium smegmatis str. MC2 155]MPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFI
IPSFTALTTVRDALGDDSPVLLGVQNAHWEDHGAWTGEVSVAQAKDAGAQ
IVEIGHSERREHFGETVETTRLKVAAALHHGLVPLLCIGESAENKQAGES
SRFILEQAAGALEGLTDEHLARVLIAYEPIWAIGENGRPATVEELRQPFD
DLAREYGCRTMGLLYGGSVNTDNAEDLLGIDHVTGLFIGRAAWQLPGYVR
ILEMAAAHPKAKA
118473071YP_891052.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MGTFVISGGTDGIGKAIAANRLKLGHEVVVIGRDTAKGQAFLDSAADIGA
VDRAHFVVADLSLVSQTRRAIDEIGNCISEIDGLVLCARHFRTTRAVTAE
GLEHTFALYYLSRFVLSHRLVGLLDAAEAPVILNVSGPGSGTDSIRWDDL
GGEHDYEPQRILAQGGQLNDLLGVGFARRRVSPKTRYVLVHPGVVNTGFS
GEYDAATADRIEQIRATAQPVEDAIVPILDIVDHPPAEPLTAVVEGRPID
VHGPAFDAALADRLYDQTTVLLGSLASAAMGVSPARLRQVLDAPVFGTVA
TIDPDGAPQQSVVWVGRDGDDVLFAVATGSRKERNLRRDPRVSILLSPPD
EPYTYAVIHGKATLHTEGGHQLRDALAVKYTGKTYAEGNADAAARYGDVA
MTVVRVTPERTVGRL
118473070YP_889282.1 uracil-DNA glycosylase [Mycobacterium smegmatis str. MC2 155]MGPIFGHSGRVSPQLLPHPRTGQLFPSPVPPGTGWPGDPATPSTPVAKTP
AQVRRLAASAKTLDDLDAMISVCRACPRLVAWREEVAVTKRKSFADQPYW
GRPATGFGPEAPRILIAGLAPAAQGANRTGRVFTGDRSGDFLFAALHRAG
LANQAVCVDAADGMRLIDTRMAAAVRCAPPGNAPEPAERATCAPWLAAEW
RLVGPSVAVIVALGGFAWRAALELIADRPKPAPKFGHGATATLTTAYGDV
TLLGCYHPSQQNTFTGRLTPDMLDDIFELAKQIGNERDGQ
118473069YP_888986.1 mycocerosic acid synthase [Mycobacterium smegmatis str. MC2 155]MTQNCVAPVAIIGMACRLPGAINSPQQLWEALLRGDDFVTEIPTGRWDAE
EYYDPEPGVPGRSVSKWGAFLDDPAAFDPEFFGITEREAAAIDPQHRLLL
ETAWEAVEHSGLNPAGLAGSATGVFMGLTHNDYAHLAADAKALEGPYGFT
GTSFSLASGRIAYALGVHGPAITVDTACSSSLSAIHMACRSLHDGESDVA
LAGGVSVLLEPRKAAGGSAAGMLSPTGHCHAFDTAADGFVSAEGCVVLTL
KRLDDAVADGDRILAVIRGTATNQDGRTVNIATPSADAQAKVYRMALKAA
GVEPGTVGLVEAHGTGTPVGDPLEFSSLAEVYGTDGPCALGSIKTNFGHT
QSAAGALGVMKAVLALQHNVIPQNLHFTRLPDQMAEIETGLFVPETITPW
PVREGQPRRAAVSAYGLSGTNVHAVLEQAPESPAETAAEAISPKAGNALV
FPVSASSADALRSTAQHLADWLLRSGDGNGRGPAIDLGDLAYTLARRRGF
RAARSAVLAGDRGTLVEGLRQIADGEAMPQQAVTNDDRGPVWVFSGQGSQ
WASMGAELLDREPAFAAAIAELEPLIAAESDFSVTEALTASETVTGIDRV
QPTIFAVQVALAAAMRSHGVVPGAVIGHSMGEVAASVVSGALSLEDGVKV
ICRRTRLMTRIAGSGAMAMVELPAQQVLSELASRGVDDVVLSVVASPQST
VVGGATASVRELIEMWESRGVMAREIAVDVASHSPQVDPILDDLIEALAD
LDPAEPEIPYYSATLYDPRDYADYDAYYWADNLRHTVRFSAAVQAALEDG
HRVFAELSPHPLLTHPVEQTARSLDMPLAVFAAMRRQQEMPHGLLGFVAD
LHSAGAAVDFSVLYPTGRLLDAPLPAWTHSTLLLDRELESSAPGVPSVSV
HPLLGSHVVLPQEPEEHLWQGDVGTEAHPWLSDHRVHQVAVLPGAAYCEM
ALAAVTPVLGDTGEVHDLKFHDMLLLDDATPVWVSAAVTAPGTAEFGVET
HQSGDRTQRATAVLRGDVDAERPAAHSIDALLAAHPNRVDGDELRAGFGT
VGIGHGAAFAGLSEAYVATAAEPTVVAAVALPGPLRSGQRGYTVHPALLD
ACFQSVIAHPEVQNIASGMLLPLGVRRLRAYGSTRNVRYCLSRIVKADSF
GVEADLELLDADGTVLLSAMGLQLGTGNSDKAEEERLLDERLLTIEWQQR
ELPRPEGSETVDAGSWLVILAGDDDENPRAAGVVSALIGAGMPTTTMAWS
HDADHDAQAAALTARLDEQPLAGVAVIVGDSETGTDAHDVGADARRGADH
VRHLVRIARTLADAVGEPPRLYVVTHRSQHVLDTDEPYLEHSGLRGLIRV
VGMEHPRLRATQIDVDDSTAHEALVRQLLSGSPEDETAWRDGQWYAARLC
PSPLRAAERRTAVADNASEGMRLVVRNPGDLESMELVTFERGTPGPGQIE
VAVKASSINFADVLVAFGRCPSFDGRLPELGSEFGGVVTAVGPGVTTHRV
GDRVGGVSANGCWSNFVTCEADLATKLPEGISEHEAAAVGLAYGTVWLGL
TELARMSAGDKILIHSATGGVGQAAIAVARAAGAEIYATAGSEKRRQLLR
DWGIEHVYDSRTTAFADQIRTDTDGYGVDIVLNSVTGPAQRAGLELLAFG
GRFVEIGKRDIYADTRLGLFPFRRNLSFYAVDLALMTVTHPQKIRDLLAT
VYRLIADGTLPLPEITHYPLEEAATAIRIMGGAQHTGKLVIDIPDTGQSQ
VVVPPEQVPVFRGDGAYVITGGLGGLGLFLAERMAAAGCGRIVVNSRSAP
STRSSEIIELIRATGADIVVECGDIAEPDTALRLVAAATQTGLPLRGVLH
AAAVVEDATLANITDELVEHDWAPKVYGAWNLHQAVQSGGPATSELDWFC
AFSSAAALVGSPGQGAYAAANSWLDAFMQWRRAQGLPATSIAWGAWGEIG
RGTAMAEGDNAIAPDEGAYAFEAILRHDRVYNGYAPVLGASWLTAFAQRS
PFAELFLADTQGASETRKLRSELAALPREEWPTHLRRLIAEQVGLLLRRT
VDPDRPLSEYGLDSLGHLELRTRIETETGVRVSAMDMTTIRGLAQRLCEM
LDTDDAVSAPS
118473068YP_887127.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MAPQSRGAYREAPGFGSIGEVSIDISLDPDTAFDTAPRPFHLAWCAQPPR
RASMFAHITPNWFASVMGTGIVATAAVTLPVQASGLRAFATAVWILAAAL
LVALTAAFTTHWMRHRHHAVGYANHPVMAQFYGAPAMALLTVGAGSLLLG
PAVIGESAAVRLGVALWVAGTGLGLAVAVVIPYRMITRCGREVAAVPAWM
MPVVPPMVSASTGALLLGHLGPGQAGETLLMACYAMFGLSLLVGFVTVTM
VYSRLMHGGLPEVQAIPTVWIVLGVIGQSITATNLLAAHASSVVTDTSVV
SALHAFGIVYGVVMGGFGAFVFCVAAALTVHAARRGLSFTLTWWSFTFPV
GTCVTGASALGAATGAVVFSGLAVLLYVALLVAWVTVAMHTVRGVASGRL
LAG
118473067YP_885560.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MSQRSYAGQSAEERRRLRRARLLDAAMDAMCANAWRAVTVDKLCASAGLN
KRYFYENFTHLDSVAAAVIDDIAADVRTAALTALAGAASRPLDEQAAVAM
DALVHILLDDPRRARVLLGGVASSPSLQQHREAVMRGLTKVLVTHARTVH
GVELETDPLSQVAPAFLVGGTADAILAFVDGRAKLSREQLVDSLATLWLI
TGNGATQTARARHEAL
118473066YP_888589.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium smeMVDSSSAAPSFPTLNHVAVTVRDLAVSGPWYRALIGADPVLDERTDAGFH
HIVWALPGGTLFGIHQHDKRAEAEQFTEFRVGLDHVSFGVGSRDDLQVWQ
NRLDELGIAHGGIVDAPYGSGLSFRDPDGIALEFFAGN
118473065YP_885594.1 hypothetical protein MSMEG_1202 [Mycobacterium smegmatis str. MC2 155]MRFSSGHWPGRGITAAPVAAHSFLNVLTRRETHRKAFPGKGVDMNPIVRR
VVATLTITAAPFLLVVGVATANTEPHQPVSQATHQVTHVSQN
118473064YP_886641.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAQGSDFAGKRCFVTGAASGIGRATALALAAAGAELYLTDRDADGLVQTV
ADARALGAEVPAHRALDISDYDQVREFAKDIHAAHGSMDVVMNIAGVSAW
GTVDRLSHQQWRSMVDINLMGPIHVIEEFIPPMIEARRGGHLVNVSSAAG
LVALPWHGAYSASKFGLRGVSEVLRFDLARHRIGVSVVVPGAVKTGLVQT
VEIAGVDREDPDVKKWVDRFAGHAISPEKAAAKILAGVRRNRFLIYTSAD
IRALYTFKRVAWWPYSVAMRQVNVLFTRALRSGTSPR
118473063YP_889143.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTASATQNVYFDPYDVAINADPYPTFARLREEAPLYYNEQFDFYALSRFS
DVNKALIDHETFSSARGAIVELIKADIEIPSGALIFEDPPIHTAHRKLLS
RMFTPRKINALEPEIRRFCAQSLDAVAGVERFDIIKDFGAIMPMRVISAL
LGIPEEDQEKIRDHGNAQMRTEAGKPMKAAEEGLVDGSIFEAYIDWRKDN
PSDDIMTELLNVEFTDEHGVTRNLTREELLIYINVVAGAGNETTTRLIGW
AAKTLAEHPDQRRQLVENPALIPQAIEEILRFEPPAPHVARYVTRDVEYH
GRTVPEGSVMMLLIGAAVRDSRQFPPDGEVFDINRAPRQHLAFSVGTHFC
LGSALARLEGRVALEEILKRFPEWDVDLASAELSPTSTVRGWDSLPVIVR
118473062YP_887345.1 shikimate 5-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MPGRRPAAPGEPRKAAVLGSPIAHSRSPQLHLAAYRALGLTDWTYERIEC
TAEQLPGLVEAAGPEWVGFSVTMPGKFAALQFADQRTDRAELVGSANTLV
RTEAGGWRADNTDVDGVAGALGTAGEAALVIGSGGTAPAAVVGLAEMGVQ
HITIVARNADKAAALVDLAGRCGAQGDWCDIAGPALTDAVAQASAAVSTI
PADAAAGYAPTLAAVPRLLDAIYNPWPTPLATAVQAAGGEVISGLQMLLN
QAYSQVELFTGRPAPKEAMRAALEEP
118473061YP_885804.1 hypothetical protein MSMEG_1421 [Mycobacterium smegmatis str. MC2 155]MPYICDLDHNCRDHTRRKGVHMEPNQHVEAETELVTETLVEEVSIDGMCG
VY
118473060YP_890782.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTTTPDDRPRTESPPTSPPTARAAARQLLMRLHFYAGVFVGPFILIAAVT
GLLYALIPQIDATVYRHELTVDHIGQHRLPLTDQIAAARAAHPEGTVASI
RPPAEPTETTQVQLSVDDVPPDYSRTVFVDPYTAEVRGALTTYGQWMPIR
AWFDDLHRNLHLGAFGRHYSELAASWMWVIALAGLALWLLQRRDKRSRLV
VPDRAATGRRKAMSWHAVIGVWVLAVLLALSVTGITWSRYGGETISTLQA
RLNSTAPSVDASAPAHHHGHGTAPTTLDGADAVLHTAEEVGLKGPMWLYP
PAEHGAVWTVSERKRDWPTRNDSIAVDAQTGAVTDRVDFADWPLLAKLTR
WTIDAHMGLLFGVVNQIILAVSMIGLITLIVQGYRMWWQRRPTRGSTWAV
GRPPRRGAIRRLPWWAVTAVAVTAVVIGWCLPLFGLSLAAFLVIDAATAY
MKRKQNENA
118473059YP_885885.1 antibiotic ABC transporter transmembrane protein [Mycobacterium smegmaMTRLWAALRLELTVQTRQKFLHAAVFSGLIWLAVLLPLPHSVRPVVEPYV
LIGDVAIIGFFFIGGAVFFEKQERTLGAIISTPLRFAEYLTAKLTVLAAI
SLFVAVVVATITHGLTYHAAALIGGVLLGTLLMLVVGFISSLPFASVSDW
AMATVIPLAVMLVPPILHYSGVWTHPVLYAAPMQGPMLLLGAAFDQSVLN
AWQIGYAVAYPLACLAGLWWAAHAMFDHYVVERSGVL
118473058YP_890978.1 hypothetical protein MSMEG_6770 [Mycobacterium smegmatis str. MC2 155]MTTNTATVLRDLFAAAEQSGFGEAFLDRLSDDVVFTATGTSPVAGKYHGK
AEYREKVLSRLHDRLATPVRPHVDQMIIDGEWAAVRFRTENVVGVNGTDA
GMQYCWVIRLTGDHITEVIGYYDTEKMVGLFA
118473057YP_889670.1 50S ribosomal protein L25 [Mycobacterium smegmatis str. MC2 155]MAKTANIPNKLTANVRTRTGKGASRQARRDGKVPAVLYGHGTDPQHLELN
ARDFAAVLRSHGTNAILTLDIEGTEQLALTKALDVHPIRRNIQHADLLVV
QRGEKVTVEVTVLVEGDATPGTLVTQDANTIEIEAEALSIPEQLTVSVEG
VEAGTQITAGQISLPEGVNLISDPELLVVNVVEAPSAEALEEEGAGETGA
AEAPAEEAPAEEPAE
118473056YP_890204.1 GlcNAc-PI de-N-acetylase [Mycobacterium smegmatis str. MC2 155]MNELFTGDLREIAVVGAHCDDIAIGMGGTLLTLANTVPGLRVTALVLSGG
GTERETEEAGALDAFCPGSDLQLTVLDVEDGKSPAHWERIKACVSEFRLS
CDPQLVFGPHRGDAHQDHRLLAELLPTEFRDHLVLGYEILKWEADTPRPS
IFHPLEASVAEEKARLLHKHYPSQAAHDWFDEQAFLGLARMRGVQCRHTY
AESFILEKATVRFGAHRTQPQY
118473055YP_890791.1 hypothetical protein MSMEG_6579 [Mycobacterium smegmatis str. MC2 155]MKFTGITTRRGLAGICASGLLGGMAAAVIAAPTASAAPDCSASGVANTVS
MATGAAKSYLDTHPGANQAVSTALTQPRDQAAATLRGYFTSNPQEYYDLR
GILSPIGDTQRTCNVTALSPELSAAYNEFMAG
118473054YP_885585.1 TROVE domain-containing protein [Mycobacterium smegmatis str. MC2 155]MDILKTIRLRQTPQAPAATPGQVRNAAGGYTFPVDDWARVHRFLTLGTDG
GTYYTADRELTRDNAEVVLRVAATDPVGLVNRIVEVSEAGRAPKANPALF
ALAIAASSEDVDGRRAALAALPRVARTATHLFLFAGYVEQFRGWGPTLRR
AVSRWYTERPVDALAYQLVKYRQRGGWSHRDMLRLARPSGVVDPARRMAF
NWAAGKGLGDYAEAPARLTDVELKVGQRTAVRPPVRAEVVPDELAIIADF
EDAQAASAAARWIEIIGRGHGLSWEMLPDAALAQPAVWEALIDRGMPQTA
LMRQLPRLTRLGVLSGAVGDTVAEQLADRDRLVKARVHPVNVLVAQRTYT
RGCGARGQAVWTPVAKISDALDAAFYAAYGAVRPAYKRTLLALDVSGSMG
SQVSGLPISCREAAAALAMVTAATEPAHRIIGFTAGRGGHAQRAVSELDI
SPRRRLDDVCRYTADLPFGATDCALPMMWALRRGVKVDTFHIYTDNETWY
GSIHPHQALAEYRHKMGIDARLVVVAMTASGNSIADPADPRQLDISGFDS
AVPTLLADFSRGDI
118473053YP_885357.1 uroporphyrinogen-III synthase [Mycobacterium smegmatis str. MC2 155]MGGADSLTKVGGADAAVAVVGAAEGSVGAAESPASDPQPRESSSRSRSRK
VKPGRITFVGSGPGDPGLLTTRAQAVLAHAELVFTDPDVPEAVLALVGTD
LPPAAGPAPAKKNDKADKATDKSDKSDKADKADDAKSDDPAVIPGGPEVR
PALGDPAEVAKTLASEARHGYNVVRLIAGDPLSVDAVITEINALAKTHLT
FEIVPGLPDTTAVPTYAGLPLGSSHTVADVRGDVDWAALAAAPGPLILHA
TASHLPDAARTLIEHGLVENTPAVVTANGTTCQQRSVETTLVGLTDKTVV
EKPAGSELLGPLTGPLVVTIGKTVANRAKLNWWESRALYGWTVLVPRTKD
QAGEMSERLVTHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVF
TSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATADKVRAFGINPELVP
SGEQSSLGLLDEFPPYDEVFDPVNRVLLPRADIATETLAEGLRERGWEIE
DVTAYRTVRAAPPPAHTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHAR
TIVACIGPKTAETAIEFGLRVDVQPETAAVGPLVEALAEHAARLRAEGAL
PPPRKKSRRR
118473052YP_888097.1 hypothetical protein MSMEG_3804 [Mycobacterium smegmatis str. MC2 155]MTDQPDPGPAPQPEETGYTEGGVPTFDAVREKIETRYGTAIGSSELAGET
PEGRRVEEQYEERQRAAAERLEQIRKSMREDEKS
118473051YP_888865.1 hypothetical protein MSMEG_4596 [Mycobacterium smegmatis str. MC2 155]MTTPKPEPEPNAIHAGQLGRILGLGAGSGDVSISTVLGVEYLGKTAEFFG
LSNWSSDRPDCGGVLLPSLPQGYDNSGFIDTRTHVHDGAKPGETDSRMMA
EQQATTFYTTTAAADFVTMAVTKWGKCANQVVTVNKPKSSENPREPYIVG
EPAMVDGILTVTATRQGPPEDPWQCQHSLTSRRNVVIDVAICAPTGSTQA
PLLARWSADRVPQ
118473050YP_887755.1 short-chain dehydrogenase/reductase [Mycobacterium smegmatis str. MC2 MTARSDQAVRHWFITGASGGLGHHLAECALRQGDRVTATVRRATALADLC
DAYGDRLTVEVLDLAEPHDIAPVIERTLLAGPVDIVVNNAGYVVVGAAEE
MTVEQIRDQIDVLLMAPMLITRAFLKPMREQGGGRIIQISSMGGQVAVPT
HSAYHAAKWGLEGFTESVSREVAEFGIRLTLVEPGGTRTGFASAMQYTVE
SEPYRQTAVGQTRRVLENADDTAFAGDPAKIAAVIYDSTRNPDPPLRLTL
GDDSYHAIRVGLTERLAALDESRELSASVAFTD
118473049YP_889298.1 hypothetical protein MSMEG_5048 [Mycobacterium smegmatis str. MC2 155]MVFGRSKSKNLPATVEGANGLSDDPGTAAKVLSHIIESSTRVQAPAVRAY
VERLRSQQPDATPAQIVSRLEKHYLAAVMASGAAVGSAAAFPGIGTLAAL
SAVAGETVVFLEATSVFVLAVAEVHGIPADHRERRRALVLSVLVGEDSKR
ALADLLGTGRTSGAWLSDGAATLPLPAVSQLNSRLVRYFVKRYTLKRGAM
AFGKLLPVGIGALIGGVGNRMMGKKIVANAAKAFGAPPPRWPATLHVLPS
AQT
118473048YP_887095.1 hypothetical protein MSMEG_2764 [Mycobacterium smegmatis str. MC2 155]MSDTRATTQTTRYRERLWVPWWWIPIAAGFAALIAFEVVMGVSSIPAWVP
YAVLLPVAAAVLLWFSKTEVRVVSSPDGDNELWVNAAHLPRSVIARSAEV
PKSAKSAALGRQLDPAAYVVHRAWVGPMVLVVLDDPDDPTPYWLVSTRHP
DRLLAALNA
118473047YP_889308.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MAEIVLDRVTKSYPDGAGGVRAAVKEFSMTIADGEFIILVGPSGCGKSTT
LNMIAGLEEITSGELRIGGERVNEKAPKDRDIAMVFQSYALYPHMTVRQN
IAFPLTLAKVPKAEIAAKVEETAKILDLSELLDRKPGQLSGGQRQRVAMG
RAIVRSPKAFLMDEPLSNLDAKLRVQMRAEISRLQDRLGTTTVYVTHDQT
EAMTLGDRVVVMLAGEVQQIGTPDELYSSPANLFVAGFIGSPAMNFFPAT
RTDVGVRLPFGEVTLTPHMLDLLDKQARPENIIVGIRPEHIEDSALLDGY
ARIRALTFSVRADIVESLGADKYVHFTTEGAGAESAQLAELAADSGAGTN
QFIARVSADSRVRTGEQIELAIDTTKLSIFDAATGLNLTRDITPTDPTEA
AGPDAG
118473046YP_888302.1 hypothetical protein MSMEG_4015 [Mycobacterium smegmatis str. MC2 155]MARQRDGFAAGPPGHRVDDEVDGLIQAVSATVVGSMRRARSDRQASSPCS
CGG
118473045YP_890450.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MAAAPGPDPTDGADQGGLEQVSRADRIASLTGVRAVAALTVMGTHAAYGT
GLLTHGYVGLLGARLEIGVAIFFVLSGLLLFRPWVRAVATGAQAPSVRRY
ARSRVRRIMPAYVVTVLLVFGIYELRSVEPNPGHTWTGLWRHLTLTQIYR
GDYYTSYLHQGLTQMWSLAVEVTFYAALPLLAYVLLVVLCRRHFRPWRLL
GGLAVLGAVSPLWLVASHAGRLPVSAGAWLPHYLVWFIGGMMLAVLATMG
VRCHAAAVLPVAVAGYLVVSTPIAGTTTAFTLTLGEDITKTMFYAVIATL
MVAPLALGSTGFYARVMASRPMVWLGEISYEIFLLHVVVMDLVMEFVLGW
HVYTGWAAGLFAATLAATIPVAWVLHRLTRPRR
118473044YP_887368.1 hypothetical protein MSMEG_3052 [Mycobacterium smegmatis str. MC2 155]MRGAHEEVSWRLLVTNAVNAFVNSVTGGSQPECARVRRSAR
118473043YP_889104.1 hypothetical protein MSMEG_4848 [Mycobacterium smegmatis str. MC2 155]MGVMPVTGMVSPTDPFPPPAQFRQRMLPFFSVVQSLSIAEHVL
118473042YP_884469.1 transcription factor WhiB family protein [Mycobacterium smegmatis str.MTALMTNGIPLGVCTSDPERWTSAPDAQAKVICRECPRRWLCAREACELP
RAEGLWAGIMVPESGRGRTFALKQLRSLAERNGYPVRKTKLIFPDAA
118473041YP_889831.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSKTLLGKVALATGGSRGLGAATAEALADRGADVAISYVASDAKAQAVVE
RLKAKGVRGLAVKSDQADVTAAKPLVDAVIDHFGRLDILVNNAAIAVQGK
TVDDPTLDAEEFDRQWHVNVLGTVAVTRAAAQKLSDGGRIVFIGTGFGTR
VAFPGVADYAGTKAAILGYAKGVGRDLGPRNITVNVVQPGIMPTDMASEA
AANLPDAVMDLHAIRRIATVEEVAASVCFLAGPDAGYITGTVLEVSGGYQ
I
118473040YP_888451.1 ribose transporter permease RbsC [Mycobacterium smegmatis str. MC2 155MTTTSAPLKPPESGPTNTSRPRGRVLGGPSLRQLAQLGPVVALVLLAAVF
AVSAPNFTSSANLTNVLQQVSITAIAAVGATVVILVAGIDLSVGSVVALT
GSIAALYLQHAILSTGASAAVAVLLSLVVGTACGFLNGVLITFCRVPAFI
ATLATLTALRGIALLVTNSYPISINNSAFTQIGIGKVGAVPIPVIIMAVT
FAVGYVILHRLKIGRRIYAVGGNREAARLSGIRVSRVLLFAFTFAGLCAG
VASVILTAKLSSGQPAGAVGFELDVIAAVVVGGTSLFGGRGRLAGTFLGA
LVIAVLGNGLTLMNVPFYWQQIVTGAVVVVAVVLDRVTRGGESGE
118473039YP_884694.1 hypothetical protein MSMEG_0278 [Mycobacterium smegmatis str. MC2 155]MRPCAGEQIPVGIGQRRGAQTAAHDRIGEPLTKLPDRHAERDPDVVLAWT
PEGSPREDEPHDVTVVGIHRPSLSV
118473038YP_889862.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMDKLLNLDGRIVVVSGAGGGGIGTTVTRMAAEAGATVVAVSRSQDNLDTH
VGPLADKGLSVVTVAADASTDDGIATVLDAVRRTDGRLYGLVNVAGGAAP
STWMPATRVSRADWRELFTANLETMFFMSQAVAAEIRDNGDPGSIVSVSS
ISGMNTAPFHIAYGTAKAAIVAATRTMAVELAAAGIRVNAVAPGVTETAA
SATYVDADPERDGRAIAMGRRGTPDEQAGAILFLLSDLSNYVTGQTLLVD
GGLNLRWTHLGADNTSLFLKDDNFRAAITQP
118473037YP_888066.1 ornithine carbamoyltransferase [Mycobacterium smegmatis str. MC2 155]MIRHFLRDDDLSPEEQAEVLTLAADLKKTPFSRRPLEGPRGVAVIFEKNS
TRTRFSFEMGIAQLGGHAIVVDGRSTQLGREETLEDTGAVLSRYVDAIVW
RTFAQERLTAMASGASVPIVNALSDEFHPCQVLADLQTLAERKGKLAGLR
MTYFGDGANNMAHSLMLGGVTAGVHVTIAAPDGFEPDPRFVDAARRRAAE
TGATVALTKDAKAGADGADVLVTDTWTSMGQENDGLDRVRPFRPFQVNAD
LLELADPAAVVLHCLPAHRGHEITDEVIDGPQSAVFDEAENRLHAQKALL
VWLLEKR
118473036YP_885519.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMDTDTSLPPRGRRDAILQVLRASPQPRAIAGIADELGVHPNTVRFHLEAL
ARAGRVEQVVGEAFGRGRPPVLYRASRRMDPSGPTNYRLLASILTGYVAR
HPDAAAVAADLGRSTSPGLVTTAPHGPSTRTQAVTELVDLLAELGFEPEP
ADGRRAREIRLRHCPFQNLAEEHGEVTCALHLGLMQGALRDLQAPVTVDR
LEPFVEPDLCVAHLAPR
118473035YP_889684.1 aminodeoxychorismate synthase component I [Mycobacterium smegmatis strMRIERFCTPDGQADAPSVLRSVAAAASAAGLAPPAALIGDWFGSRAVIAP
TVTALPAEPDAVFDVPQGSAEGAAVGGGWFGYLSYPDPGACESAPRIPVA
AGGWSDCVLRQDTEGQWWYESLAGAPLPAWLRDLAPTPSRPHTVDWVPPD
RGAHRRGVLACLEAIAAGEVYQACVCTRFTGRLDGSPSDFFADAVARTAP
ARAAYVAGDWGAVASLSPELFLSRRGSSVSSSPIKGTLPRHADPAGLRAS
VKDVAENVMIVDLVRNDLGRVARTGSVTVPELLAVKPAPGVWHLVSTVAA
EVEQCVPMGALLDAAFPPASVTGTPKGRARELLRAWEPGLRGIYCGTVGL
ASPVAGCELNVAIRTVEFGADGSAVLGVGGGITADSDPDREWEECLHKAA
SIVGPVTDQSLERSTAS
118473034YP_888966.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MSYVPERDAAGLPEELSAVDQLLHRGEANPRTRSGIMGVELLDTTPDWER
FRTRFDHASRKVVRLRQKVVMPTLPTAAPRWVVDPDFNLDYHVRRVRVPG
PGTLRQVLDLAEVAMQSPMDITRPLWSATLVEGLADGRAATILHLSHAVS
DAVGGVEMFASIYDLERDPEPDTPPPLPIPQDLSPGELMREGINRLPGSI
AGGVLGALGGAARAVTKVVRDPISAVSGVVDYAMSGTRVMAPAAEPSPLL
RRRSLASRSEAIDIPFGDFHRAAKAAGGSINDAYLAGVCGALRLYHDAKG
VPIDSLPMAVPVNLRAEDDPAGGNRFAGVNLSAPIGIEDAEQRIKSVRSQ
MTSLREERAIDVVGAIAPVLSLLPDTILESVAGSVVNSDVQASNVPIYPG
DTFLAGAKILRHYGLGPLPGVAMMVVLISRGGYITVTVRYDRAAITDGAL
FARCLQQGFDEVLALGGEVRCTPASFDPEPGTNIGGAQ
118473033YP_890873.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSTSQAIYKPLSMAISVAGGLLAGKVFSEIWQRVSRSDQEPPEPEDLSRS
TREAIIAAAIHGLIVGVIRAGLARAQAKGFQALTDEELDSA
118473032YP_887585.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGRVSIGDFAVMTHLSRKALRHYHEMGVLVPAHIDAHTGYRFYDTCQVD
HARIIRRFRELDMPIPDIKALLAAGDGATRNEIIAAHLRRMEEQLAQTRD
AVTELRELLDPVRVPAHIEVRHQPATEVWAVSAEVHSSQIGAWFAASVDT
LQRALSDSGVRIDGAMGGVYDRELFAGESGVATLYVPVPHTVPVPPTVQA
QTVPAQELAVLVHPGSQAGIDRSYGELGAYVYDHLISHQGPIRERYVGAP
ASNIVAFTATEIGWPILATSPSQPPVP
118473031YP_887105.1 diguanylate cyclase [Mycobacterium smegmatis str. MC2 155]MSPFDHYYARTAMLSAQGQRSRMRRIIGVTITALAFVPVLMLASPAGPAG
ALRYVPLGATACGVLMSVWWWRRKWPSRNQSWLVVGIGTVGIAVTLSSMS
DPTVGLLSSSVFSLVTTYSAFLHSRRVLVLSWIASGLTVGFLAIRVAFTS
IPMALSGALVSGLVIATTSMLCRMAIRLLDAGNVQHPNEIDRLTGLLNRE
AFEIQAATMLGSHSRHDDQYLVILAVGIDDMSLLSDMDGTHSTLHARVAV
AQALRETVRHRVPLAHVSDSEFLIADVFKTNDPSPLVERMRLAISTTPMR
LTASIGTVCSPLAPLASLPAEQVLQELIDVAMRAMNESRAAGGNQTISVN
YPTPTPNQE
118473030YP_890282.1 permease [Mycobacterium smegmatis str. MC2 155]MAMNLAVARWRPNSMQVLVFGIVGLALAGTTLRAFVADTPDVATAATVFC
GVFVQALPFLALGVVISGLIAVVVTPDRLARWLPRRTSAAIVVAGVGGAA
LPGCECGSVPVARRLFGDGAGAGTDKGTDKGTGKGHVGAAALTFMLAAPA
INPVVLVATAVAFPEHPQMVAARCAASLLTAIIMGAAWARFGNPAWITHR
LARPDHSAGSRWAAFTEAARHDFLSACSYLVVGAAAAAALHVLVPPWVYE
HVAGQIALGVITMAVLAVVLALCSEADAFVAASLTMLPLLPRLVFLVVGP
AVDIKLFAMQAGMFGRAFAIRFAPATFAVATLVATVVGLLILGPR
118473029YP_888248.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPFEPVQRPAGLSDLAYEQLRSRILDGDFPAEGRMSVVSIAEQLKMSRSP
VRAAVERLVTEGLLVVTAVGIELAQLDHVDLIDGLRVRSRLEGLAARLTT
DRLTDADLDRLRENLTQFDTAVRGGDTVAARKLDLEFHSTIRDRCGNGLL
IENLRRVQARVIVATYMTAWVPAHEVVIDEHRTILKAFEARDADAAEHAA
IEHLERLIERVVHHFGGPDGTVGTSFVRPLAHVPHIRGCDYWNIRWIHVD
DPACRIQNRLHAGCRSIDVKGGHHVGRSGRLATYAQRRCA
118473028YP_888559.1 hypothetical protein MSMEG_4282 [Mycobacterium smegmatis str. MC2 155]MGWFDRFRRGGSVRAGDPAADLQYMQRWVAEHTGVEAYVEPRTTVTDVTV
VLVAADGEWTRRRAGGERGARRLADRLKIPVYDVQKTGYPQRMRDHDARR
RIERKRAMRRELEES
118473027YP_890475.1 aspartate-semialdehyde dehydrogenase [Mycobacterium smegmatis str. MC2MVNIGVVGATGQVGQVMRNLLEQRNFPATSVRFFASPRSEGKKLTFRGQE
IEVENAETADPSGLDIALFSAGATMSRVQAPRFAEAGVIVVDNSSAFRKD
PDVPLVVSEVNFDRDVRGKKLAKGIIANPNCTTMAAMPVLKPLHEEAGLQ
RLIVSSYQAVSGSGIAGVEELAGQARAVIDGVEQLVHDGSALQYPAPNKY
VAPIAFNIVPLAGNYVDDGSGETDEDQKLRNESRKILGIPELLVSGTCVR
VPVFSGHSLSINAEFSQPISVERTKELLSAAAGVKLVDVPTPLAAAGIDD
CLVGRIRQDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLAADL
118473026YP_888002.1 peroxidase [Mycobacterium smegmatis str. MC2 155]MLDLDDIQHILLTRTPAITGRYEFLTFDTPAGGRAWLTALLDKVQSAADV
RASMDTSDRWVTLAFTWTGLRALGVPEESLSTFPDEFREGMAARASILGD
TGANAPEHWPGGLAGTDLHAIAILFSRNEEQCRKSISEHDRLLSRTNGVR
SLSHLDLNASPPFDHAHDHFGFRDRLSQPVMKYSGEEPTPGSGDALEPGE
FILGYPDESGPVAHLPQPVVLSRNGSFMAYRRLQEHVGVFREYLREHSDD
PAGEALLAAKFMGRWRSGAPLVLAPECDDPALGADPMRNNNFNYKDMDPF
GYACPLGSHARRLNPRDTAHYMNRRRMIRRGATYGPALPEGAPDDGVERG
IAAFIICADLVRQFEFAQNVWINDKTFHELGNEHDPICGTQDGTMDFTVP
KRPIRKVHKGLPAFTSVRGGAYFFLPGISALRYLAALKDEVTA
118473025YP_886534.1 RemK protein [Mycobacterium smegmatis str. MC2 155]MTEQRRLWWRHLLSVLLAPAMMTVFIPSAIAAVTDARAPDLSTAGGWLAA
AAGAVLIAIGLSFLVWTVVLFDRVGEGTLAIGSPVHLVLRGPYRHVRNPM
MTAVFCIQLGTAVATMSPWLFGWFALFCTATAIAIPVVEEPHLRRRFGAE
YEAYRRHVPRWIPRVTPWEPSPAH
118473024YP_884681.1 uracil DNA glycosylase superfamily protein [Mycobacterium smegmatis stMAGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMI
GEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFKFTR
AAGGKRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGN
DFRVTQHRGEVLHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDD
LRVAADVRP
118473023YP_886964.1 hypothetical protein MSMEG_2627 [Mycobacterium smegmatis str. MC2 155]MRQPHATDDRGLHVLVFGPLRALRLATALGCAAGTSECTCGTAALAGTAT
AATGATAETTGSRATAATGSAAAVVTTTAAATGTTALTCGTRATAGTRAG
TRSTATGCGRRTGRHVAGRRTGAATGTRARAGLRPRDRPVGRLLRRERVV
ADTRRARGRLGGRAGPGTGCGTGRRARAGRGARGGRRGCARGRRGGACTR
RGRLRSGRLGRRRLRGCRGGRLCGRGRGRGRSSRGLRGGRLGRRGLRGGR
RAGCRSAGLGGRGRRRAVTALATGLLIGLGGA
118473022YP_886490.1 acyl carrier protein [Mycobacterium smegmatis str. MC2 155]MQSTSPDAISAALTEILREDMNVDIRRVTRDSRLVDDVGLDSVAFAVGMV
AIEDKLGVALSEEDLLSCDTVGDLEAAILAKIPAEQSNQ
118473021YP_889029.1 long-chain-fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 15MTHPSWQTIPEMVLSAADRFGDAEAVVDHGDNPAGAAGPLRLTFVELADR
VRRAAGAFLAHGIGRGDRVAIWAPNSAEWMIAAFGALTAGGVVVPVNTRF
KAEEAADVIRRSGAKVVLRQQGFLGQDFEVPAGVPAIEIKSDFLASGEPA
VVGGLRGTDIADIVYTSGTTGRPKGVMMNHLQTLRLYAEWCDLADLREGD
RYLIVNPFFHTFGYKAGCIASLIRGATVLPVAVFDVDAIVELIATERVTM
LPGPPTLYHSLLGVPDKAKLATLRAGVTGAADIPVELIRRIHEELPFETV
ATGYGLTEAGTATLSRPGDSFTDIATTVGTACDGVEVNLADDGEVLVRGY
SVMQGYLDDPAATAEAIDADGWLHTGDLGEFTESGRLRIIGRKKDMFIVG
GFNAYPAEIEGFLLEHPDVAQVAVIGVDDDRMGQVGKAFVVLREPLDGTR
QCVTAEDLIAWSRERMAGYKVPRYVEFLEELPLNATGKVMKDHLKAREAL
SKR
118473020YP_889406.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MVRTRIEVQEQTQVGDALVRGLMRAQLGLALRLAAVVVSIVAAVVLFTTA
APELASLSVFGIRLNWLILAGLIYPLLYGVGRIYVRLAEQGERDFVRVVD
SEP
118473019YP_889726.1 DNA-binding response regulator [Mycobacterium smegmatis str. MC2 155]MAVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDAL
ILDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTVSDDSGDSQKMTFSDLTLDPVTREVTRGG
RQISLTRTEFSLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIG
YLRRKTEAEGEPRLIHTVRGVGYVLRETPP
118473018YP_887547.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLPHLWKATLVSGVLAVVLGVLVLAWPGITLLVAAICFGAYLLITGVAQV
IFAFSLHVSAGGRVLLFVSGAAALILAVLCFRSLQESILLLAIWIGVGFV
FRGVATAVSAISDPALPGRGWEIFFGVISLLAGVVMLAAPFESLATLAIV
VGVWLIVLGVFEVVSAFGIRSGVRKLGAALSTGSPSAPPVS
118473017YP_889922.1 hypothetical protein MSMEG_5689 [Mycobacterium smegmatis str. MC2 155]MTGAPEPNPDRTPVPPQLPRALLDPRPVIIAIALGWLVATIAAFTLPDLH
AWRPYTVAGLGVGVLGTSIFLWQRRAVRRGSRGAQSGLT
118473016YP_885834.1 sulfatase-modifying factor 1 [Mycobacterium smegmatis str. MC2 155]MLTELVEVPGGSFRMGSTSFYPEEAPVHTATVGDFAIERHPVTNAQFAEF
VEATGYVTVAERPLDPKLYPGVPEADLVPGSLVFRPTSGPVDLRDWRQWW
DWAPGACWHHPFGPRREFCRPDHPVVQVAYPDAVAYATWAGRRLPTEAEW
EYAARGGPKGGVGFLYAWGDEVCPDGQLMANTWQGKFPYRNDGALGWKGT
SPVGTFPPNRLGLVDMIGNVWEWTATKFSAHHRPGDESHVTCCPPPSGGD
PGVNQVLKGGSHLCAPEYCHRYRPAARSPQSQDSSTTHIGFRCVVS
118473015YP_889253.1 O-methyltransferase- family protein 3 [Mycobacterium smegmatis str. MCMTTTLTSDPVSTVLHGLLRAEQDGDAAAFAEVGEFPLDAAPAERAEVLKN
VYMSVSQTGGELLYLLARATGARTVVEYGTSFGVSTIYLASAVRDNGGGT
VITTELQPGKAAAAQRSFDTAGLGDLIDLRIGDARDTLVHVPRPVDLVLL
DGWPDLALPVLKVLEPHLRAGTLILVDDVNLDFGGRDLHGALLDHLATCG
HYRTLTLPIGDGIEACVRLSDGAKG
118473014YP_890436.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTTIDIDRDAAHDAAQNELNKPIYPRSSLTQQFLDWIDELLYRLAYEGST
VPGGWFTISVLAILVVVAVLVAVRMARRAMRTNRDAHTLFGRTELSAAEH
RQTADGYAAQENWAAAIRHRLRAVARHLEETGTLNPVPGRTATELARDAG
AALPALSGELAAAATTFNDVTYGEQPGTEDDYRRIADLDGRLLHAGHRAA
GSMPSIPADSGWTQVR
118473013YP_889494.1 acyl-[ACP] desaturase [Mycobacterium smegmatis str. MC2 155]MAQKPVPNALTLELEPVVAGEMRRHLDSEDLWYAHDYVPFDQGENFAFLG
GTDWDPSQVTLPKSITDALEILLITKDNLAGYHRELVEHFILEEQWGRFL
GRWTAEEHLHAVALRNYLVVTREIDPAANEDVRVEHVMKGYRADRFSQIE
TLVFMAFFERSHAVFCRNLQAQITEPVLASLMGRIATDEERHEEFFSNLV
SYVLDKHRDETVEAIAARAAGLDVIGADIAPYQDKVANVAEAGIFDKAAL
QKVISDRITAWGLAGEASLKDFVLA
118473012YP_889463.1 hypothetical protein MSMEG_5217 [Mycobacterium smegmatis str. MC2 155]MDSEGSTHTPDERDDQATGADQRRDAELKRREYFADERDQVADERERLAD
ERESDADERERLADEREGTAAAREQERLRRLSESAQRRRAGERRQEATIQ
REMDKTERMNLD
118473011YP_889431.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTSTDASAETVTRDYPSIDDVSVSLTDGVLAVTLNRPDSLNSLNRDMLDA
VADAMEVAATDPAVRVVRLGGAGRGFSSGAGISEEDQNAKGHDAAAVLDA
ANRAVAAIVALPKPVVAVVHGPAAGVGVSLALACDIVLASDQAFFLLAFT
KIGLMPDGGASALVAAAIGRIRAMRLALLADRLTATDAYDWGLISAVYPA
DEFDAAVDKVLAKLRNGPAVALRKTKQAINEATLTELDDAIAREREGQLE
LLVANDFREGAQAFQQNRRPEFTDQ
118473010YP_885959.1 DNA-binding/iron metalloprotein/AP endonuclease [Mycobacterium smegmatMIILAIESSCDETGVGIADLRDDGTVTLLADEVASSVDEHARFGGVVPEI
ASRAHLEALGPTMRRALDAAGIERPDVVAATIGPGLAGALLVGVAAAKAY
AAGWGVPFYGVNHLGGHLAADVYDHGPLPESVGLLVSGGHTHLLHVRSLG
EPIIELGSTVDDAAGEAYDKVARLLGLGYPGGRVLDELARTGDRDAIVFP
RGMTGPRDDPYTFSFSGLKTAVARYVEAHPEASHADVAAGFQESVADVLT
AKAVRAATDLGVSTLLIAGGVAANSRLRELAEERCAAAGLTLRVPRPRLC
TDNGAMIASFAAHLIAAGAQPSPLDAASDPGLPVVKGQVA
118473009YP_890090.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTTLHDVPRVSGGEEEHGHLEEFRTDPIGLMKRVRSECGDVGWFQLADKQ
VVLLSGAEANEFFFRSSDSELNQAEAYPFMTPIFGEGVVFDADPERRAEM
LHNTALRGEQMKGHAATIENEVRRMVESWGDEGEIDLLEFFAELTIYTST
ACLIGVKFRNQLDKRFADYYHLLERGTDPLCYVDPYLPIESFRIRDEARA
NLVELVQEVMNGRIANPPKDKSDRDLLDVLVSIKDEDGTPRFSANEVTGM
FISLMFAGHHTSSGTASWTLIELLRHPEFYAKVQAELDDLYADGQEISFH
ALRQIPNLDNALKETLRLHPPLIILMRVAQDEFEVAGRPIHKGQMVAASP
AISNRIPEDFPDPDTFDPDRYDKPRQEDLINRWTWIPFGAGKHRCVGAAF
AQMQIKAIFSVLLRDFEFEMAQPSESYRNDHSKMVVQLARPAKVRYRRRV
R
118473008YP_884927.1 sugar transporter sugar binding lipoprotein [Mycobacterium smegmatis sMIRRWLCLAVVTAVACLLTACGGGSSSSGPVEIAVWHGYQDTEGEAFKGL
IDQYNKEHPDVHVTDLYSSNDLVLQKVLTAVRGGSAPDVAYMFGSWSPNI
AKIPQVVDMSDVVSQSDWNWDDFYPAEREAATVGDKIVGIPALVDNLAIV
YNKKLFADAGIAPPTADWTWDDFRAAAAKLTDPAKGQYGWLIPADGSEDT
VWHYVPMLWEAGGDILTPDNEKAAFNSEAGVTALTMLQDMAVTDKSLYLD
TTNENGPKLMNSGKVGMLITGPWDLSQLSDIDYGVQVMPTFAGSSGAHQT
ISGPDNWVVFDNGDKRKQASIDFVKWLTAPEQVKAFSLQTGDLPTRSSVG
DDQAVRDQLDQKLPGSSVFVENLNNAKKARPAVEQYPAISEALGQAIVAV
MLGKEQPAAALNSAAEAADSALAGK
118473007YP_889813.1 hypothetical protein MSMEG_5578 [Mycobacterium smegmatis str. MC2 155]MCLIEPARITISAFLNALMLRRSMTSRQLRERSGKSDSLRFFSGSFRCAR
AHIRTAYEGIFMEVAARSRLLAGAAIIGAGALVAAPIQPVPDVIAAPVIQ
SATPAVEMTALVNPIELWSAVISQAIANTGAIANTVLENPIPIAHKVIDN
QLITADVLTSFVALFGEGFVASAGGVPAALQSAVEQILAGEIYSGVENYA
IAILTPVVEGALGALGQLDDISAVLQNPFLNAANVVGTVVSVPTLIGAGL
PILFEALSPILQVGLTAQGVYDGVTAGDLEAVANALISFPSDMAGTILNG
NPTIGNSGLLGSELGLIPSLLTVRQSIADAIQPPAVSTLVGAKMESAPEV
NSFTFTVDEDGELGEVTKSTTESGTTEGNGIQAIAAKSADAEDDATTGTG
TETEPEKSEKPVEKSKKPLVTLGNKFSPTTTAGDKARPGQRAEAALKSIG
NEVNKTVKKIGDGVKKALGVKGKKKADSKASSSSKDSAGSED
118473006YP_888959.1 hypothetical protein MSMEG_4698 [Mycobacterium smegmatis str. MC2 155]MSFTTPVHVRWSDIDMYQHINHATMVTILEEARIPFLREPFGPTIDTIGL
LIAEVNISYKGQLRLIDSPLQVTMWSKRVRAVDFTIGYEVRSVNAAPDSK
PSVIGETQLAAVHIEQQRLERLTPEQRAYLESHLR
118473005YP_890954.1 oxidoreductase- aldo/keto reductase [Mycobacterium smegmatis str. MC2 MADDLVISGVPFTHDPWMASQNRYDAMPYRRVGTSGLLLPAISLGLWYNF
GDNRPFDVQRAVLRHAFDRGITHFDLANNYGPPYGSAEENFGRMLRRDFK
PYRNELIISTKAGWDMWPGPYGQLGSRAYVLASLDESLDRMGIDHVDIFY
SHRIDPVTPLEETIGALDTAVRAGKARYVGVSSYSAAKTAEAAEIAKRLG
TPLVIHQPSYSLLNRWIEGGLTDELRKAGMGAIAFTALAQGLLTDRYLQK
PASDIDRATARPTFDDDLVTDQVREQLRGLAEIAKRRGQTLAQLALAWVL
RDPAVSSTLIGASSVEQLDENLGALDNLEFSDEELSQIDQYAKDSGIDLW
RQSSDV
118473004YP_888318.1 zinc-binding alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 1MGRCVGLFKGVKAVGVYEFGGPDALEVIDLPEPQAGPGEVRIRVYAAAVS
PTDVLLRTGGHAVRMAGRRPPFVPGMDAAGVIDQIGPGCDGRLHVGQRVI
AMVMFVGEHGGAYAEQVVVPAASVVPAPANADFAAASTLLMNAMTARLAL
DTLGLRAGETVAVTGAAGAVGGFAVELAKADGLRVIADAAERDVELLRGF
GADHVVERGAEVAARIRGLVPGGVPGLVDGSDQQGEVLGAVADGGMLVEL
RGWEGPGERGVRVVPVMVPDRITDTEGLTTLSRQAEMGVLTLRVAEVLPA
EQAPKAHRMLEAGGLRGRIVLDFS
118473003YP_889543.1 oxalyl-CoA decarboxylase [Mycobacterium smegmatis str. MC2 155]MNTAPLMTESVPGTSPVTDGAHVLVDALKLNGVETLYGVVGIPITDVARV
AQAQGLRYIGFRHESDAGHAAAAAGFLTKKPGFCLTVSAPGFLNGLVALA
NATTNCFPMVQISGSSDRHIVDLQRGDYEEMDQLAAAKPFVKAAFRVNRA
ADIGLAVARAIRTASSGRPGGVYLDIPAAVLGEVIDAGAAAASLRTVVDA
APEQLPPPRAVDRAVALLAAARRPLVVLGKGAAYAQADKTIRNFLESTGL
PFLPMSMAKGLLPDTHPQSVASARSMALRDADVVLLVGARLNWLLGHGEP
PQFSRDVKFIQVDIDPGELDSNAPIAAPLVGDIGSVIEALAERAQFIDAP
APWREQLAERKARNAESMAKRLAADPRPMRFHGALRAIRDVLRDRPDVYV
VNEGANALDLARNVIDMAVPRHRLDSGTWGVMGVGMGYAIAAAVEGSGPV
VAIEGDSAFGFSAMELETICRYRLPVVVVVLNNGGVYRGDGHNPASDDPS
PTTLMPAARHDRLIEAFGGTGHHVTTPAELGAALTEALASGGPALIDCVI
DPADGTESGHLTQLNPAVVGHHPATN
118473002YP_891128.1 thioredoxin [Mycobacterium smegmatis str. MC2 155]MSEDSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAA
EKGDQLTVAKIDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKA
ALLRELSDAL
118473001YP_887514.1 L-aspartate oxidase [Mycobacterium smegmatis str. MC2 155]MTGAGTFACGTSAYWQQRTDVVVIGTGVAGLVAALAAHRAGRRVTVLSKV
SETATFYAQGGIAVVLPAGVGSADDTIEAHVADTLAAGGGLCDAEAVRSI
VADGAKAITDLVADGALFDESAPGRWALTREGGHTRRRIIHAGGDATGAE
VQRTLNHAAAHLDIRHNHVALRILQDEAGVTGVLVHNDDGPGILHAPSVV
LATGGLGHLYAATTNPVGSTGDGIALALWAGVAVSDIEFVQFHPTMLFGA
AAGGRRPLITEALRGEGAVLIDAQGHPVTAGVHPMGDLAPRDVVAAAINA
RLAATGDPCVYLDARGVAGVADRFPTVTAACLAAGIDPAREPIPVVPGAH
YSCGGVVTDVYGRTALPGLFAAGEVARTGMHGANRLASNSLLEGLVVGSR
AGRAAAAHAEQAGSVRAVVPQQVRRDAVDRQVLQAAMSTHASVVRDAQGL
HRLAETLDAARAVVPSDRASFEDAALTSVARAVVRAATARTESRGSHHRG
DFPDTDPTQEVSMTVRIHDGDVAVDIPTAVC
118473000YP_887782.1 tena/thi-4 family protein [Mycobacterium smegmatis str. MC2 155]MIGQTPTTRAPFDCQDEHMHPNPLTFSARLWQQIETVYEEILAHPFLTGL
TDGTLDEKTFAHYVAQDVHYLRDYARALSIVAAKAPTLADTAMFARHAAE
VFDVELGLHGELLPELGLDAATLEAEPVGPTTQAYTSYLLATAYAGSFAD
GLAAVLPCYWIYARVGAELMQRGSSDPRYQRWIDSYGGEEFAATVAEVLA
LTDRLGATLGETEQATAQRHFVVTSRYEWMFFDAAHRREQWPV
118472999YP_888890.1 ribonuclease- Rne/Rng family protein [Mycobacterium smegmatis str. MC2MAEDAHTEDLSTQTPQQEGLPERLRVHSLARVLGTTSRRVLDALAEFDGR
QRSAHSTVDKADAERVRAALTESPAAETPPEEAPAAETPVADLVVVQAEQ
VEVVTVSEAGPAEPAEPAEPEAPAAEAEAEAETEVADEAETPEPTFRGAV
LVGDEPESRLILEHANIPPARETQTERPDYLPLFVAPQPVSFEPAVVDDE
DEDDDTETGAESDFDSGADSDSDDDQADRPRRRRRGRRGRGRGRGEQNDD
ATSDADTDSTEDQTDGDEQESGEDSDDSGDEDSTTTEGGTRRRRRRRRRK
SGSGDSDDAVSPDDPPNTVVHERAPRTERSDKSDDSEIQGISGSTRLEAK
RQRRRDGRDAGRRRPPILSEAEFLARREAVERTMIVRDKVRTEPPHEGAR
YTQIAVLEDGVVVEHFVTSAASASLVGNIYLGIVQNVLPSMEAAFVDIGR
GRNGVLYAGEVNWEAAGLGGQNRKIEQALKPGDYVVVQVSKDPVGHKGAR
LTTQVSLAGRYLVYVPGASSTGISRKLPDTERQRLKEILREVVPSDAGVI
IRTASEGVKEEDIRSDVERLQKRWSEIEAKAAEVTEKKAGAAVALYEEPD
VLVKVIRDLFNEDFSSLIVSGDEAWNTINSYVEAVAPDLMPRLTKYEPAG
PDAPDVFAVHRIDEQLAKAMDRKVWLPSGGTLVIDRTEAMTVVDVNTGKF
TGSGGNLEQTVTRNNLEAAEEIVRQLRLRDIGGIVVIDFIDMVLESNRDL
VLRRLTEALARDRTRHQVSEVTSLGLVQLTRKRLGTGLVEAFSTACTHCG
GRGIVLHGDPIDSASSNGGRKSDSSGGGGSGGGRRGKRGKKGAARTEEVH
VAKVPDHTPGEHPMFKAMAAANGKHEGDEDHEDHEDHETAEDTTAAEVRD
DTRDEHDADERAHVVTAAVGAAGDEDLDDSDEDSDLDSDEESDDESDEDE
IELDDDEDELDEDIEVIGDSDDSDDSDDSDEDDDSDDSDDDSDEDEDSDS
DEDEEPVREVYEPPVTAPRARVRRRAAARPAGPPSHD
118472998YP_890278.1 hypothetical protein MSMEG_6055 [Mycobacterium smegmatis str. MC2 155]MVTRCLLGGLTCATRRREHGVILMLQPCTADRRPIGPAKWIGPVATESDL
RAACDWITDGSWHSQTLSPRLRADVNLTRAARRN
118472997YP_885319.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAQQTPPATVKTDGRKRRWHQHKVERRNELVDGTLEAIRRRGSNVSMDEI
AAEIGVSKTVLYRYFVDKNDLTTAVMMRFAQTTLIPNMAAALSSNLDGFA
LTREIIRVYVETVAAEPEPYRFVMANNSASKSKAVADSEQIIARMLAVML
RRRMAEVGMDTGGVEAWAFHTVGGVQLATHSWMSNPRMTSDELIDYLTML
SWYALCGIVEVGGSLEKFNSQPHPSPIPPRHLLD
118472996YP_889336.1 long-chain-acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTDQKATRNSVGLLDLATRLPGFLMDAPVILRGVATGFTARPSAKTSIGK
VFQDRAAQYADRVFIKFGDERLTYKTANETVNRYAAVLAARGVGHGDVVG
VMLRNSPDAVLLMLAIVKCGAIAGMLNYHQRGDVLKHSIGLLSATAVVAE
PDFVDHIVESGADTTGLMTVEELRRLATTAPTTNPASASAVLAKDKAFYI
FTSGTTGLPKASVMTHYRWLRALAGFGGLGLRLRSNDTLYCCLPLYHNNA
LTVSVGSVLNSGASLALGKSFSASRFWDEVIDYGATAFVYIGEICGYLLN
QPPKPTDRAHKVRVIVGNGLRPAIWDEFIERFGISRVCEFYAASEGNTAF
VNVFNVSKSTGICPSPVAFVEYDPDTGEPVRGADGKLRKVKSGEPGLLLS
KVSSFQPFDGYTDSSATEKKLVRNAFKDGDVWFNTGDLMRSQGFGHAAFA
DRLGDTFRWKGENVATTEVEAAVASHHKIEECTVFGVEVPGAGGRAGMAA
VQLKDGEEFDGKALADAFYGHLPAYAVPLFVRVVPELAHTSTFKSQKVDL
RKQGYGPDVTDPVYVLAGRDEGYVPFYDEYPEEVTAGKRPKN
118472995YP_887484.1 isoleucyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MTAYPKPAAPNFPERELEVLDYWAKDDTFRASVERREGAEEYVFYDGPPF
ANGLPHYGHLLTGYVKDIVPRYRTMRGYKVERRFGWDTHGLPAELEVQRQ
LDITDKSQIEEMGIEKFNDACRASVLKYTNEWQAYVTRQARWVDFDNDYK
TLDLPFMESVIWAFKQLWDKGLAYEGNRVLPYCWNDETPLSSHELRMDDD
VYQSRQDPALTVGFRIDEGPLTDSYLLIWTTTPWTLPSNQAVAVGPDITY
VHVEGADGRRYLLAEARLGAYARELGEEPKVLATFTGRDLLGTHYVPPFP
YFMGSANAFQVLAGDFVSTEDGTGIVHMAPAYGEDDKATADAADIVAVTP
VDSKGRFDESVPDYVGQHVFEANPQIIRDLKNGDGSAGANGAVVLRHETY
EHSYPHCWRCRNPLIYRAVSSWFVRVTEFRDRMVELNQQITWYPEHVKDG
QFGKWLQGARDWSISRNRYWGTPIPVWKSDDPAYPRIDVYGSLDELERDF
GVRPDNLHRPFIDQLTRPNPDDPTGKSTMRRIEDVLDVWFDSGSMPYAQV
HYPFENREWFDGASGEEAHFPGDFIVEYIGQTRGWFYTLHVLATALFDKP
AFKTCVSHGIVLGNDGQKMSKSLRNYPDVSEVFDRDGSDAMRWFLMASPI
LRGGNLIVTEQGIREGVRQVLLPLWNAYSFLALYAPEKGTWRTDSKNVLD
RYILAKLAQLRDDLTSALDVCDISGACDELRQFAESLTNWYVRRSRSRFW
DEDPDAIDTLHTVLEVTCRLAAPLLPLATEVIWRGLTGERSVHLTDWPEA
DVLPKDPDLVAAMDQVREVCSVGSSLRKAKKLRVRLPLPKLTVAVQDPDS
LRPFADLIADELNVKAVELSDDVPAYGRFELAVNARVAGPRIGKDVQAAI
KAVKAGEGVVNPDGTLTAGPVVLQPEEYTSKLVAADPEWTAALPDGAGLV
VLDGTVTEELEAEGWAKDRIRELQELRKSTGLEVSDRISVRISVPAEHEQ
WARTHRDLIAGEILATSFEFAEVTDGAEIGDGVRVEIAKV
118472994YP_890725.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFQLTEEQTLLADTTRDLLSSYDTETRNKVIASDPGHKPEVWNQLAEIG
ILGLGFDEDSGGQLEIMVVLNEIGRRLAPEPVLHGALAPGAIIAERGTDA
QRALLDEVASGQRILAFAHLEPGVRDAAATPTVTATRDGDAWTLNGTKNP
VLAGDAANTLVVSAALPDGGAGLFLVDAGASGVSRKPFRTFDGARGAQIE
LSAAPAEPLGDATDASETISRALVRISAGLAAEALGAMEEALRLTTDYLK
SRKQFGVTLSKFQTLTQRAADMYVSLELARSMAFYASMSIADGEFDPVKA
ARAKLQIGRSGRHIAQESIQLHGGIGITAEYPVGHYAARLTAIEHTLGSA
QDQLRTLAGQLDSYEIVSL
118472993YP_889386.1 nitrate reductase subunit alpha [Mycobacterium smegmatis str. MC2 155]MEELLQRSGRFFTPGTFSSDLRTVSRQGGREGDVFYRDRWSHDKVVRSTH
GVNCTGSCSWKIYVKDGIITWETQETDYPSVGPDRPEYEPRGCPRGAAFS
WYTYSPTRVRYPYARGVLVEMYREARARLGDPVLAWADIQADPERRRRYQ
SARGKGGLVRVSWAEATEMIAAAHVHTIKTYGPDRIAGFSPIPAMSMVSH
AAGSRFVELIGGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDAAYL
MMWGSNVPVTRTPDAHWMAEVRYRGTKVVSVSPDYADNTKFADEWMPCAA
GTDGALAMAMGHVILSECFVQNEVPYFTDFARRFTDLPFLAKLEERDGAL
VPGKNLTAADLTPDVAAQENAAFKPALLDSASDSIAIPQGSLGFRFGESG
LGNWNLDLENLAPALTVAADTGETAEVTLPRFDTLDGHGDTMVRGVPVRR
VGEHLVCTVFDLMLAQYGVARPGLPGDWPTGFDDATRPYTPAWQEPITGV
AAAQAIRVAREFARNAEETRGRSMIIMGAGICQWFHGDATYRAVLALLLL
TGSMGRNGGGWAHYVGQEKCRPVTGWATMAMATDWSRPPRQMAGTSYWYA
HTDQWRYDGYQADALSSPVGRGRFRGRHTMDVLASAAAMGWSPFFPQFDR
SSLDVADEARAADQEIPAYVTAKLADGSLKLAVTDPDNPANWPRVLDVWR
ANLLGSSSKGNEYFLRHLLGTTSNLQAAPNGVRPSSVTCTDDIPEGKLDL
LMSIDFRMTSTTLLSDVVLPAATWYEKADLSSTDMHPYVHAFSPAVDPPW
ETRSDFEAFGAIARAFSTLAARHLGVRTDVVLGTLQHDTLGAMAYPSGTE
HDWRVTGETPVPGRTMGPLAVVERDYGAIAQKWAALGPLVEGLGVTTKGL
TTHPTREVAELGAKFGVMDSGAAQGRPAITTGERMADVILALSGTSNGRL
AVEGFAELERRTGRKLVHLALGSEERRITYADAQARPVPVITSPEWSGSE
TGGRRYAPFTVNIEELKPFHTLTGRMHFYVDHDWLEELGEQLPVYRPPLD
MARLFGESRLGAGPGADGAGGVGLTVRYLTPHSKWSIHSEYQDNLFMLSL
SRGGPTMWMSPGDADKIAVRDNDWVEAVNRNGVLVCRAIVSHRMPDGVVY
VYHAQERTIDVPLTETTGTRGGIHNSLTRLLIKPSHLAGGYAQHSYAFNY
LGPTGNQRDEVTVVRRRSQEVTYR
118472992YP_885274.1 aldehyde or xanthine dehydrogenase- molybdopterin binding subunit protMHPFAFTKAADERSALNAAASGGRYVAGGTTLVDLMRETVERPESLVDIN
ALPYRAIDVTRNGLRIGALVRMSELAAHPVVRTEYPVIAEALNLSASAQL
RNMASIGGNLMQRPRCLYFRDVTAACNRREPGSGCPAIGGRNRTHAILGT
SDQCVATHPSDLAVALTALDARVVLRDTDGENIVRLADFYRVPGTTPEQE
HNMRPGQLITAVEVPATPARRSGYLKVRDRTSYEFAICSAAVALDIQGST
IRSARVAAGGVGTVPWRLPAVERALAGRPATADAIRAAADLSAEGARPLS
ENGFKVELLKRTVARELETIAGVQ
118472991YP_889586.1 hypothetical protein MSMEG_5342 [Mycobacterium smegmatis str. MC2 155]MSAELPLPNYDEMALGDIQHKVRSLTKDQVEAILTYEAGHAARVPVLEIV
EARMRELEDGAEPSSGDPQRAPDTESTAGGSQVQESTAAEANTPLRHGVA
GQTPKRGRP
118472990YP_885474.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MVVMVKAVLFDFSGTLFRLEEDESWFEGMTVDEREVDGHVQAELMRRLTA
PTGRSVQMSDEQYHAWVNRDLAPHLHREAYLHVLRESGLADPHAESLYGR
VIDPDSWTAYPDTATVLKSLKQQDIKTAVVSNIAFDVRPAFTALGIDADV
DEFVLSYEVGAVKPDAAIFTTTLQRLGVAPQDALMVGDSEEADGGATAVG
CAFALVDPLPTTERPDGLIAAVSSVGIAT
118472989YP_887451.1 heme peroxidase superfamily protein [Mycobacterium smegmatis str. MC2 MQRITEPDLETETETDAARLRAACERDLGDPARWFPPPGYPDSLALCIVD
AIFSSGARHSMTEKVIGRYREHRRALGGDPDRDGAVELLGTFADVGGAQQ
WASQIGNRRPTSTAPDAPLRAAAVADAAEALVAMGISTADDLRSAAGAEQ
LEPVRTAWCGVPGQRSGVTWSNLLKLAGLPASAAGRLVVGYVTRELGPAS
PERVGDLIREVADLAGWDAGRLDHAIWRHEAGLRCQQAG
118472988YP_887003.1 multimeric flavodoxin WrbA [Mycobacterium smegmatis str. MC2 155]MSRTLLVVHQTPSPATRELLEAVLAGARDPDITGVDVVTRPALAATIPDM
LDADGYLFGTTANFGYMSGALKHFFDTVYYPVLDHVAGRPYGLWVHGNND
TVGAANAVDRIVTGLALTKAADTLEITGAVDAAVREAAYELGGTLAATLM
D
118472987YP_885926.1 PduO protein [Mycobacterium smegmatis str. MC2 155]MGALSLSTAQKVVDAAIEKANEIGQPMNIAVVDDGGHLVAFARMDGAIKA
SIDISIRKARTSILMNLPTSALMDVAQPGGELYGLEQLSGGLVLFGGGLL
LERDGEVIGAIGVSAGSVEQDVKVAEAGVAAL
118472986YP_887236.1 hypothetical protein MSMEG_2917 [Mycobacterium smegmatis str. MC2 155]MATTRRMAGVTSAVILTAALGLSTGTAAAAEEFTYQPLWPFASQTDADTW
LREGGPAGHAPWHADPSATALSFTRDYLGFTEIDRVTEVTEHADEAWVGV
GYVLPNDRPTTAATIHLARFGPAPGAPWEVVGSRDDVLTLTTPPYGSPVS
TVIDAGGAITGVDESLRLRVHQNGAEQMLGEHCCVAAGGEAAPWSATVST
TPPQPGALTLVVWTGGHVAEVEKFAVTGLLASGAP
118472985YP_889807.1 sugar ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MMTTDTATKTTAPAPTPGPRTKVKRRKFDPWGVVAWIVGLGFFFPVFWMV
LTAFKQEVDAYTVTPKFFFVPTLDEFRAVFSQGVGTSLLNSLFATTASTV
LVLVLGIPAAFALSLKPVRKTQDALFFFMSTKMLPIVAAIIPMYVIVSNI
GLLDNIWALIILYTAMNLPIAVWMMRSFFLEVPGELLEAASLDGASTWRS
MREVILPLVSPGIAATALICVIFAWNEFFFAVNLTAVQAQTMPVFLVGFI
AGEGLYWAKLCAASTMAALPVVLAGWVAQNKLVRGLSFGAIK
118472984YP_887825.1 dopamine receptor D4 [Mycobacterium smegmatis str. MC2 155]MRHKLIERTVVCLAAGGGVGLSVLLGAPAALADPEPSPPTPVVAEEGTPH
LASPDNLPPGTSEVPVGPPQGRTMSYLREIWHAMQTQDVSFNEALFLLTQ
RPLDPGTPPPAGLAPGPQPPAPAAPVVPPPAAPVAAPVAPAP
118472983YP_884686.1 hypothetical protein MSMEG_0271 [Mycobacterium smegmatis str. MC2 155]MVAPETERIRTQIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGEHALIV
EVSPALAIERVIDLALRAVPGVQPGILYVERQFGVLEIHSASLDEVRRAG
EAILAGTGNRAEDQLRPRVLFHDIITDITDQHAVILNRNRQASMILPGQS
LLVYEMTPALFAAVAANEAERVAPGLTVVDVQMIGAAGRLYIGGSTDEVT
VARDHITTVLSAIEGQEH
118472982YP_885541.1 mce related protein [Mycobacterium smegmatis str. MC2 155]MMAASPKRLRKVRLVAAFAMTVIVSGCATNGLADLPLPAPGVGSGGYRIT
AIFSNALNLPANAKVKLAGADIGEMDSMVARNYTAVTTLRIMEGVRLPEG
STAELRSATPLGDVFIAIKPPAPVEPGTPLLKDGDTIDLDATAAAATVES
VLSSAAILVNGGAVRNFTNLINGMGKATGDQGQAFGNLIRKTNNTLATLT
ARSEEISTAMTETSRLAQQISAKNQALSDVMAQARPATDTLAAHTTQIAD
LVTQIGDVSDQLRKFPSIAGADTSGRSVIADANTVAGAWNDVALAPDATL
YALNRLLPPFIKSMSSGAISLDASVDRLILGSTPDIGFAGDQGLHGPKRH
DWHQLVGTLKYTLLRLQERVVGQGPGVPQVPVIPSPTEPGEIIVEPGAAA
PPEDAPAPEPAPAAQAPAPLPAEAPR
118472981YP_889249.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKPISGKTTSILRRLAAAACVGAVTMAMTSCTSDERDIPSAGGTAEVGAT
NDINPQDVANLRQGGNLRLALPGFPSNFNTLHIDGNEASLGGLMRATLPR
AYRVGPDGSTTVNTDYFTSVELTSTDPQVVTYTINPEAVWTDGTPITWED
IAAQIHATSGKDKAFQIASLNGSDRVASVTRGVDDRQAVVTFAEPFSEWQ
GMFAGNTMLLPKSSTSDPEVFNKGQLNGPGPSAGPFMVSNVDRGAQRITL
TRNPKWWGEPPVLDSITYTVLDDAARIPALQNNALDATGVASLDELEIAR
RTPGISIRRAPSPSWYHFTFNGAPGSILADKALRQAVAKGIDRNIITTVA
QRGLADDPKPLNNHIFVAGQEGYQDNSEVVAFDPEKAKAELDALGWTLKP
GAQFREKDGKRLTIRDVLYDSQSTRQIATIAQNSLAQIGVELRIEAKPGS
GFFTDWIIPGNFDIAQFSWVGDAFSLCCLNQIYTTDADSNFGRISSPEVD
TKAIATMGELDPEKARTMANELDKLIWEEVFSLPLFQSPGNVAVRSNLAN
YGPAGIGDIDITKVGFMK
118472980YP_889665.1 bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosaMTASTEAAVVVLAAGAGTRMRSDTPKVLHTLAGRGMLAHVLHTVSEIDAR
HLVAVLGHDRERIAPEVARLSEELGRAIDVAVQDQQLGTGHAVNCGLTAL
PHDFAGMVVVTSGDVPLLDTATLTGLITSHGSGDAAATVLTTTLPDPTGY
GRILRTQDHEIIGIVEQADATESQRTICEVNTGVYAFDIADLRSALTRLR
SDNAQHELYLTDVVEILRQDHRTVRALHVDDSALVTGVNDRVQLSDLGKV
LNRRIVAAHQRAGVTIIDPGSTWIDIDVQIGQDTVVHPGTQLLGATRVGS
HCVIGPDTTLTHVTVGDGASVVRTHGSESVIGAGATVGPFTYLRPGTNLG
ADGKLGAFVETKNCTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDG
ENKSRTTIGSHVRTGSDTMFVAPVTVGDGAYTGAGTVLRDDVPPGALAVS
AGPQRNIEGWVAKKRPGSAADKAARKALGDES
118472979YP_887272.1 ethyl tert-butyl ether degradation EthD [Mycobacterium smegmatis str. MTMMLVHYVGNADSRFDRDYYMTEHVPLVERTWGPHGLRSAEVYFAAEAG
EADGVITICLCHFEDRDAMEKALSAPETAAVMDDVANFTDIAPVRTVMER
GVGGAT
118472978YP_886238.1 hypothetical protein MSMEG_1872 [Mycobacterium smegmatis str. MC2 155]MGQSLEVVTSELRSASAALADAGQRLQDGLSAVDLSVDQLLGSGWKGGAG
SAYSEQWDKWHNGAGQVIRGLQAMSESLKASADSYSATDQQAAGAVGSSF
QPGGGSPAGSAGASSASPAAATSAQQASSAQMDGGTEDLAAMMGLGEPAA
QLGGQLAEGAAQAAGQLTGGLTQAATAITQGVTGIVQAAQSESGAGATPV
ETGSTTAADPLVPVDEATPDTEDEHTDERDETERQSDEQEAETLEANGAG
GGAGTDSSSVSAPGEMAPPSPSPPTTGNSMRFGRLNDAQ
118472977YP_885430.1 hypothetical protein MSMEG_1031 [Mycobacterium smegmatis str. MC2 155]MIAAVATMMAVGCRGIGNAEKPDRTGRQQRNADVVRDAFARGVGDQNSFY
SILTDDVEWTVARAGWETTYSGREEFLRDGAGPILARLDGPIQADVRDLV
TEGDKLVAFWRGTATARDGQPYVNDYVWAMTLRDERVARVTAYLDFVVLD
ELLTRVTPADGATAHSAAARG
118472976YP_888392.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTIPDHVGVFGGGRMGTGIAHAFLVAGASVTVIEADAGAAEAAELRIIAS
LEKAEQLHTLPAPMQVVKQRLTVDADPDALHGCGLIVEAVPEVTELKAAV
LALIEGVAPHAVLATNTSSLSVDELATPLRQPTKFLGLHFFNPVPASQLV
EIVVGTKTADDVVATAHTWIKSLDKTAITVKDAPGFASSRLGVAIALEAM
RMVEDDVASVADIDAAMTLGYKHPMGPLRTTDIVGLDVRLAIAEHLAHEL
GPRFEPPAILRDKVAAGELGRKAGQGFYSW
118472975YP_884627.1 lyase [Mycobacterium smegmatis str. MC2 155]MSNDLTIHNTFVPHEDPEESLAFYRDALGFEVRLDVGHGTMRWITVGPPN
QPGTSIVLYPPTADPAITEEEGKVIREMMAKGTFASIVLATADVDATFER
LQATTAEIVQEPTDQPYGVRDCAVRDPAGTMIRIQERAL
118472974YP_888883.1 NAD-dependent deacetylase 1 [Mycobacterium smegmatis str. MC2 155]MDAPELVALLQGRRIVALTGAGMSTDSGIPDYRGPDSPPSNPMTIQQFTS
DPVFRQRYWARNHVGWRHMDETQPNAGHRALAAMEASGVVAGVITQNVDL
LHTKAGSREVINLHGTYAQVVCLNPDCGHTMSRAALAVMLEEANPGFLAR
AESVGGIAVAPDADAMITDTASFVVVDCPMCGGMLKPDIVYFGDSVPKTR
VEQAYSLVDSADALLVAGSSLTVFSGYRFVRHAAARGIPVGIVNRGPTRG
DDLAAVKVHSGCSEMLTLLAGELTRTYTASPG
118472973YP_886868.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMQESATASTTSTAPPARLRLVNGLRDAISHGVLKQGERLNERELCETYNV
SRTVVREGLRQLEGEGFVTIEANRGALVTKISYSDAEHLFEVRGALESLA
CSLFARRGTVEHKRALADCVADVARAMESGDLTEVLGAKDAFYAALLAGA
GNSELTTALRLLHARIRLLRRYSLSAENRQPASLAEITAICDAIIAGDIE
GARRAGEYHVAQASRAALPRIFQDLYGDST
118472972YP_884628.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPGEEQRLRDLKLLRRVRDRIDREYAQPLNVEALARGVNMSAGHLSRQFK
AAFGESPYSYLMTRRIERAMALLRRGDLSVTEVCFAVGCSSLGTFSTRFT
ELVGLPPSTYRDRAAAIQEGLPSCLEKYVTRPVRNREAPAVRLHLA
118472971YP_886650.1 hypothetical protein MSMEG_2302 [Mycobacterium smegmatis str. MC2 155]MDRQRRRWHQPPTPARWRDDALPAQERCCGRRGGRTVRPCGHPWPFVVDA
ITRAVCASPTAPVWRGTHDAIPRGQ
118472970YP_885451.1 hypothetical protein MSMEG_1053 [Mycobacterium smegmatis str. MC2 155]MFRRYLALMVAALLTGLLAGCENTDSWVQASPASGWAAQYADAANSSYKS
APGAQSLRAEWSRSAKGEVGAQVALGSAGYLAVNAQSAGGCSLMVWEADN
NGRQRWCTRLVQGGGWSGPLFDGFDNVYVGQPGAMLSFPPTQWIRWRKPV
IGMPTTPRLLADGQLLVVTHLGQVLVFDSHRGTVEGTPLDLVSGVDPTDS
ERGLADCPLARSRCPVAAAPAFSGQTNIVVLSLWQPGAEAPVLVGLNYRP
GQKPLLTQAWTSDAAGRGPLASPVLSADGQTVYVSGRDEQLWALNSADGT
VKWSVPLDYLAQTPPSVAPDGLIVAGGGPDAKLTAVRDEGDRGEIVWTRD
DVAPLTTSSRSGNVGYAVARQGGHGQALLVFDTGDGRTLQTHPLPEATGW
PVGVSIGHDGRVVTATSDGQVYGFSPA
118472969YP_886339.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MYEKDGQQYFIVDSHVHLWDGRASNLKNVHGKQFIDCFYDYHKNLSPEEA
LWDYDTYTYYGGDRLMKDLFTDGYVDHAIFQATLLSDFYVTGFGQTEEAF
ALTQRHPGKLTYNHAYDPRYGEAGLEQLRRDADRMGLQGVKLYTAEWHGD
SRGYKLDEPWSRRYLEEAIKLGIKNVHVHKGPTIRPLDRDAFDVADIDKV
ATDYLELNFVVEHVGLPRLEDFCWIATQESNVYGGLAVAIPFIHTRPRYF
AQIIGELLYWIGEDKILFASDYALWTPKWLIEKFVDFQIPEDMLGEYTQI
TTEQKRKVLGLNAASLYDIDVPAELRLPTPGQDTVEVAAGAKESVSI
118472968YP_889486.1 fumarate hydratase [Mycobacterium smegmatis str. MC2 155]MADTDVEYRIEHDTMGEVRVPKDALWRAQTQRAVENFPISFRGLERTQIR
ALGLLKAACAQVNKDLGLLDPEKADAIIAAAGEIAEGKHDDQFPIDVFQT
GSGTSSNMNTNEVIASIAAANGVTVHPNDHVNMSQSSNDTFPTATHIAAT
EAAVRHLIPALEVLHASLAAKAKQWRTVVKSGRTHLMDAVPVTLGQEFGG
YARQIEAGIERVKATLPRLGELAIGGTAVGTGLNAPEGFGAKVVEVLVNE
TGLAELRTAVDSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGSGP
LTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVACQVVGNDAAIAFGGA
SGAFELNVYIPMMARNLLESFTLLSNVSRLFAERCIDGLVANEERLRELA
ESSPSIVTPLNSAIGYEEAAKVAKQALAEKKTIRQTVIDRGLIGDKLSLE
ELDRRLDVLAMARVKDGE
118472967YP_886241.1 sensor histidine kinase MtrB [Mycobacterium smegmatis str. MC2 155]MGRALSLVWRRSLQLRVVTLTLGLSLAVILVLGFVLTSQITDRILEVKVK
AATEEVERARNTVSGIVGGEESRSLESSLQLARNTLVDRKADVRADMAGA
FDAVLVVPGDGPRAAAAAGPVAQIPEALRDFVKAGQVSYQYATVQTEGFS
GPALIVGSPTTSSVPNLELYLIFPLNNEESTIALVRGTMATGGVVLLGLL
AAIALVVARQIVQPVRSASRIAERFAEGHLTERMPVRGEDDMARLAVSFN
DMAESLSRQIQQLEEFGNLQRRFTSDVSHELRTPLTTVRMAADLIYDHSE
DLDPALRRSTELMVNELDRFETLLADLLEISRHDAGVAELSVESLDLRST
VRSALDNVGHLAADAGVELTLDMPEEDVIAEVDPRRVERILRNLIANAID
HAESKPVQIRMAADEDTVAVTVRDFGVGLRPGEEKLVFSRFWRSDPSRVR
RSGGTGLGLAISIEDARLHQGRLEAWGEPGKGACFRLTLPLVRGHKVTTS
PLPLKPASEQRPARRRSNKDREAAEESV
118472966YP_886349.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMADVGDLEFFVTLAAAGTMTEAARHWGVSVSVVSRRLKALEERLGTPLVH
RRARGLELTAEGQQYHVRGSEILQQLKDLESTLNPDPKDLTGSIRVISTV
GLGRVHIAPLLHDFRRRHRSVEISLELTSLPLSASVPGFDIAIQVGRVRD
SSLAIRQLLPNRRVVVASPDYLDAHGAPADLDDLKNHELLVVRENEGESI
WRFVKDGRETAIPVRGGLICNDGIAVTEWCLAGAGLAMRSIWHVAPYVRE
GRLVHVLPDVETPEADVVALFDAGVRTSPRVRTLLSFLRKQLAQRCIPLP
TRQAGAALHW
118472965YP_890554.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MTSLEGLDLDALDRHLRAEGIARAGDLRAELIAGGRSNLTFLVFDDASKW
VLRRPPLHGLTPSAHDMAREYRVVAALAGTPVPVARAVTMRNDDSVLGAP
FQMVDHVDGRVVRTAAELAALGDQTVIDNCIDALIKALSDLHAVDPYAVG
LGDFGKPDGYLERQVRRWGSQWEHVRLPDDARDDDVRRLHAALADAVPPQ
SGTSIVHGDYRIDNTVLDAEDATVVRAVLDWEMSTLGDPLSDAALMCVYR
NPMFGHIHTDAAWSSDLVPPADELADRYSKVSGRDLAHWDFYMALAYFKL
AIIAAGIDYRRREGADGPEQVGEAVAPMIAAGLAALG
118472964YP_886498.1 gp35 protein [Mycobacterium smegmatis str. MC2 155]MCQLAVRGPLRLLWEGPDGEFNPDFGPAKDIPDELQRQYRIAEAQGIPVE
WRVAEPKAAEAIERIVEREGYDDLITVTVVPPQ
118472963YP_887923.1 hypothetical protein MSMEG_3620 [Mycobacterium smegmatis str. MC2 155]MTIRLALQIPNFSYGTGVEELFPTVIAQAKEAEDAGFDTVFVMDHFYQLP
GIGEPEEPMLEAYTALGGLATATERVQLGTLVTGNTYRNPTLLAKAITTL
DVVSRGRAVLGLGTGWFELEHDQLGYEFGTFTQRFEKLDEALQIILPMLK
GERPTFSGKYYRTENALANPRFRDHIPLMIGGSGEKKTIPMAVRHFDHLN
VIAGFDELARKLDVIKKNCDEIDRDPATLETSVLLSAIIDENASLDAIPE
PFRQRSVVGTPEQIAEQVKTKVLDLGIDGVAINIPTWQLGYRPGDITAIG
EALKPLISG
118472962YP_889129.1 enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis str. MC2 155]MPDEIEVRAEGDIRVITLNRPEALNAVNDSLHEGLAHLWTRLSEDYDARA
AVITGAGRAFSAGGDFAYLQELGEDPKLRAKTILHGREIVLGMTRCRVPV
VAAVNGPAVGLGCSLVALSDIVYIAPQAYLADPHVQVGLVAADGGPITWP
LHISLLLAKEYALTGARIPAQRAVELGLANHLSDDPVAEAIEAAQKMAKL
PRQSLEATKRLLNLHMEQAVLATLDFGNTAEEQSFRTEDFKAIVAGLNAR
KN
118472961YP_889281.1 alkanal monooxygenase subunit alpha [Mycobacterium smegmatis str. MC2 MRLSVLDLVPVRTDQTTADALAATTHLAQTADRLGYHRFWVAEHHNMPAV
AATSPPVLIAHLAAHTSQLRLGSGGVMLPNHAPLAVAEQFALLEAAHPGR
IDLGIGRAPGSDPVTSLALRGAAGRDDRDIEAFPQYLDDVVALMGARGVR
VPLPRDLLRDNYILKATPNATSVPQLWLLGSSMYSAHLAAAKGLPYVFAH
HFSGHGTAEALAIYREEFQPSEAAPEPVTFLTVNAVVAETTEEAEALLLP
QLQMMARLRTGQPLNALDLVEDAQTTVLTPQGDAVVADGRRRAVVGSPTE
AAEQVRALAEEFDVDEVMINPVASAHRGADPRTATARDTTLELLAKELF
118472960YP_888873.1 hypothetical protein MSMEG_4606 [Mycobacterium smegmatis str. MC2 155]MASRAGCSRPSCCGCRPWIRTTGSRDRRPHAGSGNRSCGADLLQHGVGIT
VVDLFRPPRIRRRGAAERRARRLVRTPRTQATVSGAKAVGGFVKDNPLES
ALLVGGVALALTGVGGPAGAAAIAAATVNISSAAVDIAAAVMPDNQALGI
ASTCARRRVHGHPARRGQKGGRRGRRTRRRTTGQARRYVIDVAKAAPTPP
AQLADEIAAAGTAKPPVKPGVSPKVPNAPPAKTAEATPTAATHNASDAAP
SVGKAPEASPHAVPGGKTVGHCHQHAAIAEERQEEQEAPQETRQVTKSPC
TRSSPGLLEMGS
118472959YP_889516.1 cystathionine beta-synthase [Mycobacterium smegmatis str. MC2 155]MRIARHISELIGNTPLVQLNSVVPEGAGLVAAKIEYLNPGGSSKDRIALK
MIEAAEVSGELKPGGTIVEPTSGNTGVGLALVAQQRGYKCVFVCPDKVSE
DKRNVLRAYGAEVVVCPTAVPPDHPDSYYSVSNRLVTEIEGAWKPDQYSN
QMGPESHYETTGPEIWADTEGKITHFVAGVGTGGTITGTGRYLKEVSGGK
VKVIGADPEGSVYSGGTGRPYLVEGVGEDFWPTAYDPSVPDEIIAVSDAD
SFEMTRRLAREEALLVGGSCGMAVVAAIEVARKAGPDAVVVVLLPDGGRG
YLSKIFNDAWMSSYGFLRTRLDGSVEKTVGDVLRGKSGALPDLVHTHPSE
TVRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRAK
LADAVAEHMSPPLPLIGAGELVSTAAKTLRESDAVMVVEDGKPVGVLTRH
DLLGFLSEGGYRH
118472958YP_885800.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MNADHDPLTVLHQHDEPPVAPDPEFVARLRARLEAALTLPNRTEGVVMTG
TDTAIAELKSPSQAAPRPAVISYLTVADARAAIGFYVDALGARVLGDPIV
MDDGRIGHAELLLAGGVLYLADEFPEIGLKAPAPNAVSVSLMLSVPDTDA
ALARAAAHGARVQREPYEDHGTRNATFIDPSGHRWMLSGPVGVRVPVEAI
RHGDVGYVSVWVPDADRAAAFYGHVLGWTYDPATRQVTNTQEHIGIFSVA
GAPTMFCCYAVDDLDAARRAITAGGGTPGEVRESEFGTVLDATDPAGTAF
AVFEPVPGTPRPAVNGTGPGSLSYITYNVPDSAAFKEFYGHVLSWTFEPG
RIADGWGVQNCQPMSGMAGGSDRATTVPMWTVADIDAAVTRVREAGGTVI
SAPARQPYGLMAECTDDQGARFYLGEF
118472957YP_884559.1 mce associated membrane protein [Mycobacterium smegmatis str. MC2 155]MEDQPADSGDLTTPARRRRWGFPLRRRQAEPAEQSDATGEGTEPSTEAGN
ESDAETKPRPVGKRQRTALSTGEQTAEDQTEETAGAAAYEKPTETEESEV
SEPVAADEPADEDQPTQNIVFAPFRPAGKGLTYAAIAAATLFVAAGAFAG
ATVWPYLSDRALVDTKVQVAQTSADAITTLWTYTPENIDTLPDRASRFLS
NDFAAEYRQFIDSIVPSNKQAQITNNTQVVGTAVESISANEATAIVYTNS
VSTSPVTKNVPSLRYLSYRLTLVRSDGDWRITQMPALTQLDLSPQL
118472956YP_888902.1 hypothetical protein MSMEG_4639 [Mycobacterium smegmatis str. MC2 155]MRPALELTSVPPWTITATVPDADTSGRAWTIIAIGHAEDVITRWEGQLGD
HRNSVEVHRVDTDEQARAVIDAAVATAVVGWRLMTAGPAHLNLRVRAHAL
AHGIADDEITIASTEVAHRDVFCTHCRAVTTAAVEIDGLVGCTGCGRKLV
VHYHVSRRAGAFLGYMVDAEQQVVTP
118472955YP_887265.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MTVAGLVFAALAAVLHVYIFVMESLTWTSARTRATFGTTAEEAEATKELA
YNQGFYNLFLAIVTAVGIGSIVLGHNAVGVALVLAGVGSMLAAALVLLVS
SPDKARAALTQGAFPLLAVVFVVLGLLL
118472954YP_887909.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MGPDELFQRAVIARRYYLEGRTRVQIAEEFGISRFKVARMLDEALGSGMV
EIKIHNPGSIDVELSTALQRRYGLQHAYAVMTSPDSDPRGTDTVGADDRV
ASVAKAMAELLQSILRDGDVIGVDCGRTLAHIADHITELPHCDVVQLTGM
AGAITHNGVDLVRRISEVSGGQTWPLYAPLVVSDARTAASLASSQQIQDT
IAQHAKVTCAIVSVGAWVEGASQVYSSLTTTEVEALEAAGVCAESCALLL
DAEGNRLPGLDDRRMGIDEATLREIPTVIAIATGPEKIAATRAVLRSGMV
SSLVTDVEIAAAVLDDNADEEGAKRT
118472953YP_888688.1 hypothetical protein MSMEG_4413 [Mycobacterium smegmatis str. MC2 155]MLENLDRVRLARAVAGGAVLAGVAAAIAGCGGTGSNEPSTTTTTTTITTT
TTTQPSTPSVPPPAPTEKGINPTGGNLYTPTVHAPPARTAIPGNRENVG
118472952YP_884809.1 hypothetical protein MSMEG_0396 [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
DPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQM
DGVGTSIIGRPRPLSRHRRADDLYTLNCEEPV
118472951YP_884716.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MDPALAELAADLPAHALLTDPDQIEGYRRDAAADPLAGRPRAVVRATCTA
DVQSVMRWATRHRVAVVPRGAGSGLSGGASAVDGCVVLSTERMRAIRIDP
ATRVAVVQPGALNAEVKQAAAEHSLWYPPDPASVDISSIGGNAATNAGGL
CCVKYGVTTDYVLGMQVVLADGTAVTLGGPRLKDVAGLSLTKLFVGSEGI
LGVITEVTLRLIPAQASPSTVVAMFDTVQDAANAVVAITASVRPAMLELM
DHASINAVEDYGRMGLDRSAQALLLVQSDAPGDAASEVAHIVEACEKSGA
SEVFATDDPAEGAGFTAARRLVAPALMQLGTVLLEDVTVPIPTLPALLAG
INRISAECDVLICVVAHAGDGNTHPVVVFDPDDAESQARAERAFSEVMDL
AIAMGGTITGEHGVGRLKRDWLPKQLGDDVMWVTRRVKDALDPLGILNPG
AVLRP
118472950YP_889619.1 hypothetical protein MSMEG_5376 [Mycobacterium smegmatis str. MC2 155]MRAPRQVAEFNKRFTNPAARAITPWLPYLGTLEHVGRKSGKCYRTPLLVF
ETHDGYAILVGYGPQTDWLKNVLAGGQTVLHKRGRAIALGNPRVVSKAEA
AALVAPRSRWLYRVFPYDEATLLLTHGGSAG
118472949YP_890949.1 ANTAR domain-containing protein [Mycobacterium smegmatis str. MC2 155]MGESRNHELAMRMADLARAVASPRSLADVLTGVTTAAKELIPGVDTAGVL
LIGPGNTFESLAALDELPHALDELQMRFDEGPCRQAALADLVVRTEDFRA
EQRWPRYSPASVELGVLSGLSFKLYTADRTAGALNLFGFSPMNWDEDAVT
TGTVLAAHAASAIVASRQEEQLKTALLSRDRIGQAKGIIMERYKVDDVQA
FEMMRQLSQHSNTRLVDIAGQIIESR
118472948YP_886266.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium smegmatis str. MC2 MGLGAGLFGGLVTASAVLTGALTAPAPSPQIALVDNTEALTSSDGSLADG
QAFSPFDLQQPAIAKLDPRLLAAVQNAANAAAAEGITMTVTSGWRSPAFQ
QTLLDNAVQTYGSLAAAREYVQTPTASRHVTGEAVDIGGTGADQWLITNG
PRFGLCQIYANESWHFELVADPLGNCPPLLPDAAG
118472947YP_885833.1 arylsulfatase [Mycobacterium smegmatis str. MC2 155]MAAEFNGKIELDIRDSEPDWGPFAAPTAAEGAPNVLYVVWDDIGIATWDC
FGGLVEMPAMSRIAEHGVRLSQFHTTALCSPTRAALLTGRNPTTVGMATI
EEFTDGFPNCSGRIPFETALLPEVLAENGYNTYCIGKWHLTPLEESNLAS
TKRHWPCSRGFERFYGFMGGETDQWYPDLTYDNHPVDPPATPEEGYHLSK
DLADKTIEFIRDAKVVASDKPWFTYLCPGAGHAPHHVFKEWADRYKGRFD
MGYERYREIVLENQKRMGLVPPDTELSPVNPYSEVTGPDGQPWPAQDTVR
PWDSLSDDEKALFCRMAEVFAGFLSYTDAQIGRVLDYLEESGQIDNTIIV
VISDNGASGEGGPNGSVNETKFFNGYIDTAEEGLKFIDKLGGPQTYNHYP
IGWAMAFNTPYKLFKRYASHEGGIADPAIISWPKGIAARGEVRDNYVNVC
DVTPTVYDMLGITPPATVRGVPQKPLDGVSFKAALADPDAPTGKETQFYA
MLGTRGIWHKGWFANTVHAATPSGWGHFADDRWELFHIDADRSQCHDLAA
EHPDRLEELKALWFSEADKYNGLPLGDLSILETTTRWRPYLTGERTSYTY
YPHTAEVGMGAVVELRGQSFKVLAEVTVDSAEAQGVIFKHGGAHGGHVLF
IADGHLHYVYNFLGEREQVLSAPDPVPLGHHIFGVRYERTGTVPNSHTPV
GVATLFVDGGAVADLADVQTHPAIFALAGGGIAVGRNTGSGVSRSYRVPF
PFTGGEIAQVTVDLSGEPYEDLVTRRATAFARD
118472946YP_884998.1 L-rhamnose 1-epimerase [Mycobacterium smegmatis str. MC2 155]MQRVCFVLQLRPERMDEYLTAHEQVWPEMLEALSEAGWHNYSLFVRESDG
LVVGYLETDDFASAQKRMAETDVNARWQANMAEFFVSDGSNPDQLMTPLF
EYFHLA
118472945YP_888443.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTRTVLIAGSSRGIGAAAARREAANGSRVILHGRSDSPALKELSVELGAP
AYHCDGQDADSVQELVDAALATHGRIDALICTLGSVLATDALSGSTDAWI
DEYRSNVLGPVNFIRAVAPSMLANGGGRIVTVSSIRGRDNLASPEVTGYS
AAKAALENVTVSFAKALAPSVTVNAVAPGFVLTDMSETWSDEVRKEVATN
LLGRAARPEEIAGLLCFLVSDGASFITGQTVLADGGLDAR
118472944YP_889932.1 ThiS family protein [Mycobacterium smegmatis str. MC2 155]MTVRYFAAAAAAAGIETESLEIATGTSVAELVERLGARNPELARVLKRCS
YLCDEVAVRDMAKPLVTPQTVDVLPPFAGG
118472943YP_884443.1 hypothetical protein MSMEG_0023 [Mycobacterium smegmatis str. MC2 155]MPARADVRLAPRQRLTRGLKYTAVGPVDITRGVLGIGADTAQATAAELRR
RYASGKLQRQLAAAAEAVAALPETIQEAVQEVVSPPKKRRRRPLLIAAVA
VTVLGGGAAAFSIVRRRSRPQEPPTLAPSVEVAPKP
118472942YP_890487.1 ScnB protein [Mycobacterium smegmatis str. MC2 155]MPEEPTTLKRIVERNQIWPVMAAKYGVENPVPPWKSSLDGLCDALDHSEC
GPQVLNFKDRRDEEDALAATVYADVPYPENQLLALAHSLLARGVIDEAEL
QQRIASVRARLEA
118472941YP_890853.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MAKTFIGPRLRRLREEHGLTQVALARALGLSTSYINQLENDQRPVTVPVL
LSLSERFDLPTHYFTPDSDARLVSDLRDILVDSAATQAQIEELVARMPAV
GQTLVTLHRRLFDATTELEAMHTRASADAPVPLQQPMPFEEVRDFFYDRK
NHVAELDQAAEGVFDRRGLRIGGLDAQLAELLSDELGINVVIDDGQVLSA
NGKRIYRPDHATLYVARWLHPGQRAFQIATQYALLTQAELIAELVADADD
LSTEAREVARIGLANYYAGALLLPYRMFLAAAEELRYDIDRLARRFEVGF
ETVCHRLSTLQRPDARGVPFIFVRTDNAGNISKRQSATAFHFSRVGGNCP
LWVVHQAFAQPGQFVTQVAQMPDGRSYFWIARTTAPSQSSYLGPTKSFAI
GLGCDLAHAHRLIYSAGIDLADEAAAVPIGAGCKVCERPACPQRAFPYIG
RPVKVDPHASSDLPYPTVNDPR
118472940YP_888581.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MDAPGAEHDVDALVRQRLRELRTERGLTLEDVASRAQIDVSTLSRLESGK
RRLALDHLPRLATALSVTTDDLLRAPEAEDPRVRGTATTRDNITYWPLTR
HGPANGLHAYKIRISEQRNTPPAELPVHEGRDWMYVLSGKLRLILGEQDF
TVGPGEAVEFSTWTPHWFGVVDGPVEAVTIFGLHGEQVHLHS
118472939YP_887694.1 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogeMHSDPSHIDLLGPATFTSRDRRPIGFPPLRCSRHKISWKEPSEMKTKAAV
SLGVNRPFEIMELELDGPKEGEVLLKNVAAGLCHSDLHLTDGDMPPRYPI
VGGHEGSAIVEDVGPGVTKVKPGDHVVCSYIPNCGTCRYCATGRSNLCDM
GATILDGRFPDGTFRFHKDGVDYGSLCLLGSFAERTTVSQHSVVKVDEWI
PLETAVLVGCGVPAGWGGPVYNNGIRPGDTAVIYGIGGLGINAIQGAVMA
GARYVVAVDPVEFKRDMALKFGATHAFATAEEAHEAVREITWGQMADGAL
IFVGTPDEKVVSDAFNVIGKGGTVSLASLADPAKLTVHVSGMEMTLMEKT
IKGCLFGSSNPQYDIVRLLRLYDEGKLKLDELITTRYRLEDINQGYDDLR
AGVNIRGVIIHDPEA
118472938YP_886821.1 hypothetical protein MSMEG_2482 [Mycobacterium smegmatis str. MC2 155]MANLLYTYVDIADRKDIDAAVGLLGNARVRFPDNGFETIDDARPFFTRLW
ASSTAHRHDVGNLRVEPGAGSYWRAYAHYTRWLFTPGPVLHTLGEYALDI
DARTWSITALAVTRTWMRAESG
118472937YP_890749.1 carboxymuconolactone decarboxylase [Mycobacterium smegmatis str. MC2 1MLPPLPAEDWDDAARDALASVVPPERRDADGVGNALGVLVRHPELARHFL
QFNNYLQRDSLLPERIRELVILRTAYRAGCVYEWGHHAAMGLLAGLTVDD
VESARSGSAADEFDQTVLDATDELVAGAQLSPETWTRLGRWLDDRQRMDL
MFTVGGYLTLAMALNTFEVQLEEGAGRPEFYAPVGTAR
118472936YP_885815.1 acetylcholinesterase [Mycobacterium smegmatis str. MC2 155]MRRARQVSALLFGLVIVLNAAVVGCRAAEAPVATDPVVVHTASGTVRGLV
AEGHRLFAGIPYAAPPVGSLRFAAPEPAASWPGERDATRPGPRCVQDPDA
DLEHGDNSGEDCLTLNVWTPPVGKDLRPVMVWIHGGGFVNGSSDVYDASR
LASRGDIVVVTVNYRLGTLGFLAHPALEAPGEVGNYGIADQQAALRWVRD
NIAAFGGDPQRVTLAGESAGGTSVCDHLVAPGSAGLFDAVVLMSAPCQVQ
ADLPTAEQRSVAYAAEAGCPDPASAGDCLRALPVDRLRKPVWYFNIGSDQ
MTTPVTGTAMLPRAPLRSLGEAPDVPVLIGTTRDEFTLFVALRYLRQDQR
FTPEEYPELLRQTFGADADAVGAHYPLERYGGAAQAYSAAVTDSAFSCVA
EQMADELPGTVYAYEFADRDAPAPEVMRTLPFPVGASHSLELRYLFDVGG
APPLNPRQQALADQMIGYWSQFVRTGDPAAEDQPEWPAYSASESSGRQWM
SLRPDGSRMASDFGEEHQCPFWVGLKEK
118472935YP_890921.1 hydroxyquinol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MSVAGLHEENSAEVVVDSFRDTPDERLKTVLNSLVEHLHAFIKDVEPTHA
EWERGVEFLTAVGHMCDETRQEFVLLSDVLGVSMLVDAINNRRSESATDT
TVLGPFHMVSSPARDLGANISLDSVGEPCVFAGQVRSVDGAPLAGARVDV
WQANGAGFYDVQQPDLQPERNLRGVFVADDEGRFWLRTVVPRYYPIPDDG
PVGRLLAATKRHPYRPAHIHVIADADGHAQVTTHVFVEDSPYLDSDTVFG
VKQSLIRPVVVVDDPVRAERYRVPNPFRFIEFDVVLDPVTA
118472934YP_890879.1 sulfate/thiosulfate import ATP-binding protein CysA [Mycobacterium smeMPSAVQIESATKVYGSTKALDNVSLHIDPGQMVALLGPSGCGKTSLLRAI
AGLNPLDRGAIRIGESDVTMVPARLRPIGMVFQHYALFPNMTVAENISFP
LTINKQRRAERAQRVGELLELIGMTALADRYPNQLSGGQQQRVALARALA
PEPDVLLLDEPLAALDAAIRNDLRDEIRRIQHRVGTTAVFVTHDQSEAMA
VADRVAVMDRGRILEVAAPPEIYERPTSRFAATFVGSRNALELPVDADRV
VRWGTAFSVAAPDAANGKALAVFRPEDVRLTAHQGVAGTVDVVVFLGATS
RVYVTVEGEAGDHTVHVDLPSRAAANFVPGQRVGVVVAPEKVRVFAS
118472933YP_886896.1 hypothetical protein MSMEG_2559 [Mycobacterium smegmatis str. MC2 155]MRVEVNLARCTGHGICETIAEDVFEVQDDGTVLIHGNERPEHDRDRMRQA
VVQCPAAALRIED
118472932YP_885537.1 mce related protein [Mycobacterium smegmatis str. MC2 155]MGNSIELDGRGPSERQLLACGLAVLVVAGLISTVLLVKATGRLDPYVRVV
AALINVGDGLPQRSDVKYHGVLVGMVEDVTPAAHGEPNYVHINLNPEYAS
SIPSTVTARVVPSNVFAVSSVQLVDRDGGAGPAISAGAQIPEDTELPTVL
FQTTISKLRDILAATGRGREDRTVGVLAAVNAATEGRRTELLTSGAQLNR
LIDEVDSIVATDPSAPTTVSTLIEATRGLQQTAPELVDALHTAVRPMQTL
VEQRSQLDSLISAGMNTLDTTRTALNNHTDRLVKITSELTPVVGNLADTS
HHWLPAFVKLNNLSDKFFDEVWRPERNVGNMRMNLSFTPSYTYTRADCPQ
YGELKGPSCFTAPLVVTRPALPDQMLPRNYQPPKDLAPPPGTVVGENGNL
VAVGPPLINPNPSLADPNPPLPPWMAPAPPVPGTANSALPVTPPPGVNQS
PLAPVAPKPGSPPPPPPAPGPLPAEAAPASFGGNVGPVGSEQERVTLSVI
TGQPASTATQLLLGPVARGTTVSLAEPTAGEEPR
118472931YP_886558.1 carveol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAERLTGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPSVPYD
SATPEDLAETTRLVEATGRRILAARADTRDLEALRDVVGKGVAEFGRLDV
IVANAGITVPEPWNETTPESFRDVMDINVTGTWNTVMAGAQHIIDGGRGG
SIILISSAAGIKMQPFMVHYTASKHAVAGMARAFAAELGKHRIRVNSLHP
GAVNTPMGTGDMLAALTRANDTNPGLMQMVTPFLPDYIAEPEDIADAAVW
LASDESRFVTASRVAVDLGSTQF
118472930YP_884682.1 esterase [Mycobacterium smegmatis str. MC2 155]MTSSVSTIDARPDLSVGKQIMHRRRSAESFALAAGCRAFVRNAVRVWAMQ
PNLAWPLGSIDRMVGLLPHRVDAKIRSVQLPDCAAELVCANGVSADRAIL
YLHGGAFMTCGINTHRSLVARLSREADAAVLNVGYRMLPKYGLAEAIDDA
VAGLRWLQEQGYTSDQIVIAGDSAGGYLALATALQLSSRGEVPAAGIAAI
SPLTDLDPASKLEHPNARKCAMFTGAALAGFAKYLHRCERRPVSRREAAA
FVNPVTADLTKLPPVTVHVSADESLYSDSELLAGRLAEAQVPCELHVWHG
QVHDFPLAADILPEGRRALRYVGDFVKQTTGTRLANVS
118472929YP_890913.1 shikimate 5-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTDPTGRTRLLGVVGDPVAQVRAPELWGTVFRELGVDAVCVPFHVRPTDL
EAFLDGARRWRNLDGLLITVPHKAAAMRFATELSDRARQVGAVNCLKVGE
SGGWVADMLDGVGFVTAFEGGIGPVGGRRALVVGCGGAGSAIALALADAG
ASAVDVSDVDGARANELADRVSATGVLSRPVAALGRGYDLIVNASPAGMR
STDPLPVDLDGVGGDAAVADVITEPAVTPLIKEATQRGCAVQVGSQMTDA
QVGGMADFFGYTAAFADPLR
118472928YP_884765.1 hypothetical protein MSMEG_0352 [Mycobacterium smegmatis str. MC2 155]MAVDVDTARHELTQPGQADDQETDEKSGVDTDSREPTSAQVRGVRGALVI
GVLLLAIVGGATGWLVWQTQRAEQDQRMNEMLLQAGREAAVNLTTMDFEH
IREDIQRVLDGSTGTFYDEFEQRAPAFEEVVTKTQSKTEGTVTEAGIESV
SADSARVLVAVSVKTSNIAAPEQRPRLWRMRIDVQRVGDVAKVTNVGFVA
118472927YP_888067.1 acetylornithine aminotransferase [Mycobacterium smegmatis str. MC2 155MTLQSRWEAVMMNNYGTPPLSLVSGEGAVVTDADGREYLDLLGGIAVNLL
GHRHPAVIEAVTTQLDTLGHTSNLYATEPGIALAEALVGQLGTQARVFFC
NSGTEANEVAFKITRLTGKTKIVAAEGAFHGRTMGSLALTGQPSKQAPFE
PLPGNVMHVPYGDVAALEAAVDDQTAAVFLEPIMGEGGVVVPPAGYLVAA
REITSKHGALLVLDEVQTGVGRTGAFFAHQHDGIVPDVVTMAKGLGGGLP
IGACLAVGATGDLLTPGLHGSTFGGNPVCTAAGLAVLKTLAAEDLVARAG
VLGKTLSHGIEELGHPLVDKVRGKGLLQGIVLTVPSAKAVETAARDAGFL
VNAAAPEVVRLAPPLIITEGQIEAFITALPAVLDTAAEDS
118472926YP_886615.1 hydrogenase-2- large subunit [Mycobacterium smegmatis str. MC2 155]MTELDLFVSPLGRVEGDLDVRVTINDGVVTSAWTEAAMFRGFEIILRGKD
PQAGLIVCPRICGICGGSHLYKSAYALDTAWRTHMPPNATLIRNICQACE
TLQSIPRYFYALFAIDLTNKNYAKSKLYDEAVRRFAPYVGTSYQPGVVLS
AKPVEVYAIFGGQWPHSSFMVPGGVMSAPTLSDVTRAIAILEHWNDNWLE
KQWLGCSVDRWLENKTWNDVLAWVDENESQYNSDCGFFIRYCLDVGLDKY
GQGVGNYLATGTYFEPSLYENPTIEGRNAALIGRSGVFADGRYFEFDQAN
VTEDVTHSFYEGNRPLHPFEGETIPVNPEDGRRQGKYSWAKSPRYAVPGL
GNVPLETGPLARRMAASAPDAETHQDDDPLFADIYNAIGPSVMVRQLARM
HEGPKYYKWVRQWLDDLELKESFYTKPVEYAEGKGFGSTEAARGALSDWI
VIEDSKIKNYQVVTPTAWNIGPRDASEVLGPIEQALVGSPIVDAEDPVEL
GHVARSFDSCLVCTVHAYDGKTGKELNRFVINGMV
118472925YP_886867.1 hypothetical protein MSMEG_2530 [Mycobacterium smegmatis str. MC2 155]MPDTDNAPGESEALEYVNQMARARGYVLPYHKLMARADLDVLKAANGLVS
AAYTRQRRLDKATKELIFITSLTVLKASPGHIAGHIRVALDLGVSPEEVL
EAIEIALPEAGVVAFQHGFEVWADVVGATGIEPTVEVHGSAG
118472924YP_885247.1 monovalent cation/H+ antiporter subunit F [Mycobacterium smegmatis strMNWVWGIAAVMLTAAAAITMFRLLAGPSTLDRLVALDTLVAVTLCSIGTW
AAFSLDTTVTYSMTALALISFVGSVSVARFRVPDTDEPLPPRRRKP
118472923YP_885148.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MTPAQLRAFSAVVRLGSVRAAAEELGVSDAGVSMHVAQLRKELDDPLFTR
TASGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAF
AEHAAPGLIELFSSRADDLSVELSVHPARQFGHLITSRAVDIALGPAAPA
DPNLVVRAFLKYQIITVTTPDNALLERGVTPASLREQPWQLGPSGGNADG
EIAAMLRALAIPEARQRIFQSDAAALEEVRRVGGVTPTIGFAVAKDLAGG
RLAQVKGPGLQVGGEWFATTLPASARQPAVSELLRFITTPRCTQAMIRGS
GVGVSRFRPKVHVTLWS
118472922YP_885050.1 oligopeptide transport ATP-binding protein OppD [Mycobacterium smegmatMSALLQVNDLRVSFTTDGGVVRAVDGVSFDLKRGEILAVVGESGSGKSVT
AQTLIGLTRASNSAITGAIDFDGRDINSLDDGALREIRGEHIAMVFQDPM
TSLNPVYRVGDQIIEMIRAHRDVSKAEARDKAVELLRAVGIPHPEQRVSD
YPHEFSGGMRQRVMIAMALALEPEVLIADEPTTALDVTVQAQILRLVDRL
NQERELAVVLITHDLGVVAEVADRVVVMYAGQIVEDGTLDEIFYDPQHPY
TWGLLGSLPRVEDTNQERLQQIPGQPPSLLNPPTGCRFAARCAHAFSKCT
QPPPLEDRKGDGHLDRCWLTPEEKRTLR
118472921YP_886714.1 acetolactate synthase 1 catalytic subunit [Mycobacterium smegmatis strMSAPTTRPPHTAAAPANGAPASTSDQPQPKRVAPEQLTGAQAVVRSLEEI
GVDTIFGIPGGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYAHATGK
VGVMMATSGPGATNLITPLADAQMDSIPVVAITGQVGRSLIGTDAFQEAD
ITGMTMPITKHNFLVRNGDDIPRVIAEAFHIARSGRPGAVLVDIPKDILQ
GQCTFSWPPKIDLPGYKPTTKPHNRQIREAAKLIAQARKPVLYVGGGVIR
GEATAELLELAELTGIPVVTTLMARGAFPDSHRQNMGMPGMHGTVAAVAA
LQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNRHADVP
IVGDVKAVIAELVQSLRKTGTTAEALQLDSWWEYLSGIRSTYPLSYGPQS
DGSLSPEFVIEKLGQIAGPDAVYVAGVGQHQMWAAQFIKYENPKTWLNSG
GLGTMGFAVPAAMGAKFARPEAEVWAIDGDGCFQMTNQELATCALEGAPI
KVALINNGNLGMVRQWQTLFYDERYSQTNLSTHSRRIPDFVKLAEALGCV
GLRCERAEDVEDVINQARAINDRPVVIDFIVGADAQVWPMVAAGTGNDEI
MAARDIRPLFDDNEEGHA
118472920YP_889940.1 cupin [Mycobacterium smegmatis str. MC2 155]MLVMEKMSLTALARQQLAAARTASAGRSAHTVYGGHEHNLRQTLIALVDG
TGLDEHESPGEATLQVIEGRVKLANSEASWEGSPGDLLVIPRTRHSLHAL
ADSVVLLTVVKAVGPHA
118472919YP_890405.1 NTP pyrophosphohydrolase [Mycobacterium smegmatis str. MC2 155]MSSTPEGLVPDAAPPWLRPLLDNVGHVPNAYRRRVPPEVLASIVEANHQA
AETGSRRDAAVLVLFSGPPDAPAGVLPDDADLLVTVRASTLRHHAGQAAF
PGGATDPGDTGPVATAFREATEETGVDTSRLHPLATLDKMFIPPSGFHVV
PVLAYSPDPGPVTVVDEAETAAVSRVPVRAFINPENRLMVYREGNTSRFA
GPAFLLNEMLVWGFTGQVISAMLDVAGWAKPWNTDDVRGLEEAMALVGRA
SSYGEAHRGTGI
118472918YP_884450.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKAEFST
DAEFVERFRAEARTVAMLNHPGIASVYDYGETELDGEGRTAYLVMELING
EPLNSVLKRTGRLSLRHALDMLEQTGRALQVAHTAGLVHRDVKPGNILIT
PTGQVKLTDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDV
YSLGVVGYESVSGKRPFTGDGALTVAMKHIKETPPPLPADLPPNVRELIE
ITLVKNPGMRYKSGGPFADAVAAVRAGRRPPRPNQAPTLGRAAPAAVPSA
AQARASADLTGRAPVTAARARPTATAAHRTPPPRRTFSSGQRALLWAAGV
LGALAIVIAILIVLNAQDRKDREQSPPPTVTDTVTETTPYEETPAAMPDL
MIMLRAAQPEPPPSEQIQR
118472917YP_889424.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLQRIATTAIAAPRRILVVAALVMIAAGIFGIPVANKLSAGGFQDPTAES
ARATQLLADKFHRGDMQLVIAVTAEAPGGRADGGRAREVGTEIVSELKAS
PYVTEVTSAWTAPPSAAAALVSKDARTGLIVAGLNGGENGAQQHAKELTD
QFVRDHDGVRVRAGGEAMIYVQINGQSEKDLLMMESIAIPLSFVVLVWVF
GGLLAAALPLAVGGFAILGSLAVLRLFTMVTDVSIFALNLTVAMGLALAI
DYTLLIISRFRDELAEGADRETALVRTMMTAGRTVLFSAMTVALSMVAMV
LFPMYFLKSFAYAGIAVVALAATAAIVLTPAAIVLLGDRLDAYDVRRFFR
RVFGRPEPEPKPVEQGFWYRTAKAAMRRAVPIGVGIIALLVLLGVPFTGI
KWGFPDDRVLPQSASARQIGDEMRTNFAVDSATSVTVVLPDATTVAPAEI
DRYAARLSQVADVSSVSAPGGTDVQGRHVGPPSAATGIGDGSAFLTVGSD
APLFSDASEAQLDALHAVAAHAEVQFTGVAQVNRDSSQAITSRLPLVLGI
IAGITFVLLFLLTGSVVLPLKALVLNVLSLSAAFGALVWIFQDGHLGALG
TTPTGTLVANLPVLLFCIAFGLSMDYEVFLVSRIREFWLQSDQSRAANEE
SVALGLAHTGRVITAAALLMSISFAALIAAQVAFMRMFGLGLTLAVLVDA
TLVRMLLVPAFMRVMGRWNWWAPAPLARLHERIGFSESGLPPDPKPQPAS
VGMTQSG
118472916YP_887311.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTANPEQMLFTSTAQAFLEKEAPLSRVRQLHDEDTSFDAQWWGRAAELGW
AGLLVPEDLGGGSVSGDGVADLALIAEQAGRTVAPGPLHPVSAVLAGLVE
APQGHEETIETLIAGETIASWATYEPKRPFAPTAPTVTATRTATGYRIDG
VKDRVEAGDQAGLLLVVALLDGQPRQFLVATDATGVTVTAQKSLDLVKRY
ARVEFDGVAVEESAVVGAAEQTPAIIERQRQIALVLQCAETVGILDAVLA
MTNQWLLDRNSFGRPLASYQALKHRFADMKMWFEAARATTTGAVAAVGAR
SKRAAFLVSVAKAYVGERAPVMLQDCVQLHGGIGVTWEHDLHLYLRRASL
NRAMFGAPEDHHRAVFELSRRSQPEEARA
118472915YP_885297.1 dihydrodipicolinate reductase [Mycobacterium smegmatis str. MC2 155]MNLYSLLQQRTEASGPVRVGVIGAGKFASMFLTQAVNSPSLHVVGVADIN
VSKAKAALHRTGWPADRYAAGSLDEALRTGATAVTDNADALLAHPGIEVI
LEITGNPLVGTYHAVTAIDNGKHVVMVNVEADCMVGPILQRRAAAAGVIY
AMAYGDQPALICELVDWCRTVGFDVVAAGKGTKYLPEYNYSTPETVWNYY
GFTDEQLASGDYNPQMFNSFLDGTKSAIEMAAVANATGLLPQEQGLLFPP
ASKDDLPTVLRENRFPGGSLMRRGTVEIASSMYRDGQEVPDNLRWGVYVT
FEAVTDYAVQCFAEYGVHTDETGRYGSLYRPYHMIGLELAVSIASAVLRN
EATGSPTGFRGDVMTTAKRDLKAGEKLDGEGGFTVFGKLAPAEISLDRNA
LPLGLAHGATLVRDIAKDETISWDDVRVDESQFAVKIRRQLESEFRSEHI
AATA
118472914YP_888978.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMSSVTRRSQAKSDRRSQLIAAAERLVAERGYLAVRLEDIGAAVGVSGPAI
YRHFPNKEAMLVELLVGISTRLLDGAREVVETHDDPAKALDALVDFHLDF
AFDESDLIRIQDRDLAHLPDTAKRQVRRAQRQYVEIWVSVLTRLRRDLPE
EEARVMAHATFGLLNSTPHSVKPAVTKAQSSTAQSRGVLRRMTVAALTAT
G
118472913YP_886316.1 hypothetical protein MSMEG_1950 [Mycobacterium smegmatis str. MC2 155]MTQHSKSDQARKSFIDSVKGTAKEVVGAVTGNDSLTAEGQLEKTQAKERR
EAGRAAAVADAEARQARAEEAQAQADGAQKRAAVAAEAAVVENDVRAQQD
AQKREAEAAARRDAERQKTQADIDAQREVQLADAAERSDVAVARQEAAEA
AADHQDAVKESADVRARADRMRQEADKLTEEADLPGDEK
118472912YP_889400.1 hypothetical protein MSMEG_5154 [Mycobacterium smegmatis str. MC2 155]MAKTHLNCPCGEAIVGTDEDDLVEKAQAHLAESHPGREYDREMILFMAY
118472911YP_885597.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMKETPQKSNIAVKVGAPPGERHGSTADEVRSHYDLSNEFFRLWQDPTQTY
SCAYFERDDMTLEEAQMAKVDLALGKLGLQPGMTLLDIGCGWGSTIMRAV
EKYDVNVIGLTLSHNQRAHIEQRFAESDSPRRKEVRLQPWEDFDEPVDRI
VSIGAFEHFGFEKYADYFKKTFELMPDDGVMLLHTIVSTSKEEVEEMGLP
TTMSLMRFFRFIVTEIYPGGRIPLIAMVEDRATEAGFTVTRKQRLRPHYV
RTLDTWAANLEAKKDQAIEITSEEVYERYLKYLKGCADLFRDGYTDVCQF
TCEKSVA
118472910YP_885709.1 Asp/Glu racemase [Mycobacterium smegmatis str. MC2 155]MTRIGMIVPSSNTALEPATTRLLTDRPDVTVHYTRIPVRAITLDGGGAAF
DADTMVAAARLLADAEVDCIVWNGTAGSWLGLEHDRRCCDAITEATGIPA
TTSTLAILRACVDFGISALACATPYTRDVVDAISREYARHDVGIVSHAEW
ELTDNLSFAKASSAEVAELLAAAAKNGDPAPQGVALICTNVDGTTVLREV
EQSLGIPVIDSIAATLWWALELTGSDARIPAAGLLLEQGPLRHRVKEIVT
ELRVRTGCDRTTARIDDADLGLHVDLCAAESCAPGVRSIQHDPSLDQRKL
ETVSWLEQHRKVLVQPAFTEAPYPPQALREVYGVSAQVLGPVERGDEMAA
WLSAHSIGERAWTGDDLAAMADAQEKLHALLNNK
118472909YP_884680.1 arginine decarboxylase [Mycobacterium smegmatis str. MC2 155]MDQTETPLLDALNEYHASNRYGYSPPGHRQGRGVDDRVLRVLGREPFLSD
VLANGGLDDRRSSNGYLQKAEDLMAEAVGADTAWFSTCGSSLSVKAAMMA
VAGGDGSLLLSRDSHKSVVAGLIFSGVMPRWITPRWDADRHLSHPPSPEE
VEETWRRYPDAAGALIVSPSPYGTCADLAGIADVCHARGKPLIVDEAWGA
HLPFHENLPTWAMNAGADVCVVSVHKMGAGFEQGSAFHLQGDLIDQDRLS
ACADLLMTTSPNVLVYSAIDGWRRQMVEHGHRLFGAALDLADDTRRRIEE
IDDVEVLDEELLGAQASHDLDRLQILIDVSATGTSGYQAADWLRENCQVD
VGMSDHRRILATMSVADGSDTAGRLLHALSLWRKAADDFAPPPPIDLPSP
AELQLTTKTSPRDAFFAEVEQIPVEHAVGRIAAEQITPYPPGIPAVVPGE
RLNEAVLDYLVTGVQAGMNLPDPADPQMGSIRVMA
118472908YP_886951.1 ElaA protein [Mycobacterium smegmatis str. MC2 155]MTVSLRRSWAKDLDAPTLYELLKLRVEVFVVEQATPYPELDGRDLLAETR
HFWLEGPDGEVISTLRLMEEHPGGEKVFRIGRVCTKRSARGQGHVARLMQ
AALAEVGDYPCHINAQTYLEDMYGKHGFVRDGEEFLDDGIPHIPMVRPGT
RAEAEQP
118472907YP_884569.1 2-dehydropantoate 2-reductase [Mycobacterium smegmatis str. MC2 155]MRIAVVGAGAIGAYWGAAMHRGGAEVHLIARNAHLHAMREHGVRVLSDRG
DFVAHPNATDDPHEIGPVDYVFLGLKAHSYPSCGPLIEPLLGEHTAVLAA
QNGVPWWYFHELQGPYRGRRIEAVDPGGATSAVLAPERAIGCVVYPATTI
EAPGVIRHLEGTRFSIGEPSGEISQRCIALSEAMIAGGLKAPVEADLRSD
IWIKLMGNVAFNPLSALTRATMVEICQNPYTRQVVVQLMEETLDIASRLG
AKPDISIEKRLRGAENVGHHKTSMLQDLEAGKQLELDAIVTAVVEMADLT
GAPAPTLRTVHAATDLLARTAVPAAVPQEQALKPALR
118472906YP_886622.1 hypothetical protein MSMEG_2270 [Mycobacterium smegmatis str. MC2 155]MQTDEQVGFHWATPHGRPTTLRHLVAADDEPARLAATHLSALDDTLIDTA
GRFGQVLGGGRRPSADEWETLAELYRCLDRSCLEYAEAIAEINVAPDVRA
GKIIGTAVLVSILARQALGLLGPVPLDGELDEPTLGVVGGYGELVQADPD
KPWKGGRWVVRTETGSRLPLTLSMLLFDSSGVNKDAARREHRDLIRAVIA
AASAPQADPLDVASALDWLLYDWLMAHRTDPDSAEIGMVGDTATQNDCAA
VIVAAAAASVRARACVDPGLALT
118472905YP_885955.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MAGLAAVGTVAGVSIARSLTLRVSKEDPYAGEDFELLDADRSSVITTDDG
VPLAVREVGPKDAKLTVVFAHGFCLRMSAFHFQRARLAEQWGDQVRMVFY
DQRGHGRSGEAPPDTYTVEQLGRDLESVLAVTAPRGPVVLVGHSMGGMTV
LSHARQFPQRYPARIVGAALISSAAEGVDRSPLGEILRNPALEAVRFSAR
YAPKLVHRTRGAARSLIAPILQAGSFGDEQVSPSVAAFAADMMHGTPIPT
LVEFLHALEVHDETAALDVLAGVPTLIACGDRDLLTPVEYSREMAERLPK
SELVVVGGAGHLVQLEEPEVINDALIRLVERATPSKLVALARRVRNRVRP
HG
118472904YP_890776.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTTAEAPRRRSEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTI
YRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTR
RGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQ
AAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
118472903YP_888104.1 universal stress protein family protein [Mycobacterium smegmatis str. MSAYQTVVVGTDGSDSSLRAVDRAGQIAAASNAKLIIATAYFPQSEDSRA
ADVLKDEGYKMAGNAPIYAILREANDRAKAAGATDIEERPVVGAPVDALV
ELADEVKADLLVVGNVGLSTIAGRLLGSVPANVARRSKTDVLIVHTS
118472902YP_888767.1 hypothetical protein MSMEG_4495 [Mycobacterium smegmatis str. MC2 155]MTGLLPLIGVITLVVFGGLFAAIDAALSTVSIARIDELVRDERPGAARLA
TVVAERPRYINLVVLLRIICEVTATVLLASILDGLLGVSWGLVTAAAIMV
VTSFVAMGVGPRTVGRQNAYSIALMSAIPLQALSVLLTPISRLLVLLGNA
LTPGRGFRNGPFASEIELREVVDLAQQRGVVADEERRMIQSVFELGDTAA
REVMVPRTEMVWIEADKTAGQATSLAVRSGHSRIPVIGENVDDIVGVVYL
KDLVQQTYYSTNGGRDTTVAQVMRPAVFVPDSKPLDELLSEMQRDRNHMA
LLVDEYGATAGLVTIEDVLEEIVGEIADEYDTDEVAPVDEIDDHIYRVSA
RLPIEDLAELYELELDEDLDVDTVGGLMAFELGRVPLPGAEVTWEGLRLR
AEGGPDHRGRVRINTVLVCPTEPVEPELHTVPGDENSGRTRRGDRGDRSR
GGEKDE
118472901YP_888563.1 lipoyl synthase [Mycobacterium smegmatis str. MC2 155]MTVVPEGRKLLRLEVRNAQTPIERKPPWIKTRAKMGPEYTELKGLVRREG
LHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPADLDR
DEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAETVRYIKRLNPNT
GVELLIPDFNGNPEQLEEVFESRPEVLAHNVETVPRIFKRIRPAFRYDRS
LAVITAARNFGLVTKSNLILGMGETIDEVRTALRDLHDAGCDIITITQYL
RPSPRHHPVERWVHPDEFVELSAYAEGLGFAGVLAGPLVRSSYRAGKLYA
QAARVRFADQPPVS
118472900YP_885849.1 50S ribosomal protein L5 [Mycobacterium smegmatis str. MC2 155]MTTTEKALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDA
ARDAKLINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRG
DRMWEFLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDV
DSIDRPRGMDITVVTTATNDAEGRALLRALGFPFKEN
118472899YP_890338.1 glucarate dehydratase [Mycobacterium smegmatis str. MC2 155]MTAHGTTPVVTEMTVIQVAGHDSMLLNLSGAHGPYFTRNLVKLTDSDGNT
GVGEVPGGEAIRRTLTDATPLVVGRSIGEYHATLAAIRGAFADRDSGGRG
AQTFDLRVTVHAVTAVESALLDLMGKHLGVPVAALLGDGQQRNRVQALGY
LFFVGDRNRTDLPYRAPDDEPAGADEWQRIRHDEALSPEAVVRLAEAARA
RYGFRDFKLKGGVLPAAEEAKAVTALAERFPDARITLDPNGGWLLRDAIV
TCRQLTDVLAYAEDPVGPEGTFSGREVMAEFKRATGLPTATNMIATDWRE
LGHAIRAGAVDIPLADPHFWTMSGSVRVAAICDAWGLTWGSHSNNHFDVS
LAMFTHVAAAAPGDITAIDTHWIWQDGQRITKQPFEIVDGYLDVPTAPGL
GVELDDDRVAAAHELYLAEGLGARDDSVAMQYLIPGWTFDPKRPALQRK
118472898YP_887526.1 phosphoribosyl-AMP cyclohydrolase [Mycobacterium smegmatis str. MC2 15MSLDPAIAARLKRNADGLFAAVTQERGTGKVLMVAWMDDDALARTLQTRE
ATYFSRSRGEQWVKGATSGHTQKVHSVRLDCDGDTVLLEVDQVGGACHTG
DHTCFDADLLLGPDE
118472897YP_888514.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPLSDHEQRMLDQIESALYAEDPKFASSVRGGTLRAPSARRRIYGAGLFV
LGLAMLVTGVAVKALMIGGFPILSVIGFIVMFGGVVFAITGPRVAGGVDK
SSAPSGPTRQRKQRGGGSFTNRMEDRFRRRFDN
118472896YP_885966.1 hypothetical protein MSMEG_1588 [Mycobacterium smegmatis str. MC2 155]MAGVVACLAPALAVPAAATLDPIPGEGFFLVGTDIAPGLYTTGGSESPFA
VWINDVPTQDSMCMWFTYSTPDANKDNVVATNMSVGPMNANINSTVKAFE
THNCQPWTRVT
118472895YP_886056.1 hypothetical protein MSMEG_1680 [Mycobacterium smegmatis str. MC2 155]MTFSLIAHDTSTEAFGIVICSSSPAVASRCAYARAGVGVVATQNVTNPAL
GPLTLDSLEAGFDAPTALKATLAQERFPDYRQVTVVDAGGRTAVHSGAKN
LGVHTHLEDDHAVAAGNLLADETVISQLLNGYTTSSAETFEDRLLDGLRA
ALAAGGEAGPVRSAGMIVVEDVSWPVTDLRVDFADDPIGDLAALWQVWQP
QKKDYRVRGIDPTRAPSYGVPGDR
118472894YP_885182.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium smegmaMVAELKLGYKASAEQFAPRELVELAVLAESAGMDSATVSDHFQPWRHEGG
HAPFSLAWMTAVGERTKNLVLGTSVLTPTFRYNPAVIAQAFATMGCLYPG
RIFLGVGTGEALNEIATGYAGEWPEFKERFARLRESVRLMRELWLGDRVD
FDGEYYRTKGASIYDVPEGGIPVYIAAGGPVVAKYAGRAGDGFICTSGKG
EELYAEKLIPAVKEGAAAADRDADAIDRMIEIKISYDTDPELALENTRFW
APLSLTAEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAVEKVGQ
YVKWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLA
118472893YP_888656.1 amidase [Mycobacterium smegmatis str. MC2 155]MDHITFVPTVDQMNYTFGGADPVMRIKPGTVLTLWTEDAYGGRITSVDSV
AGTALDTEDLNPQTGPFFIEGAEPGDTLAVHLVDLTPARTWGASTLIPFF
GGLTSIPVSPTLQEPLPERTWIYEYDPATHTVGFAARGSDFEVALPANPM
LGTVGVAPARREVRTSLVPDAFGGNMDTPEMTAGATCYLRVNVEGALFSL
GDGHYRQGEGEACGTAVEGAMNVTAIVELIKGGGPAWPRLETDTHLMAIG
SGRPLEEAWRASQVEMITWLGELYGLDKYDAYQLLTQIALNPIANVVDAN
YSTLTKIDKRLLPPAPAYGGIHAELRSAGRALGTISY
118472892YP_886147.1 cytochrome P450 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSDGGHQLRGAQALATLVDLGFPAIASGVIARRPPVLGLLERMQADERAG
RRMHRLRSEFGRGPVELVIPGRRIVVVTDPEDVAAVLVQAPEPFHPANRE
KRKALQWFQPHGVLISQGPIREQRRTVNEAALDSGAAMHRLAESFAAKVA
AEADTLVARTLPGQRLDADEFMTAWWRLVRRLTLGERARDDHAITDQLAR
LRRAGNWSFLSLPHYRARSRFLSHLYRYAEDPEPGTLVGALADVPAGGAV
DPVGQIPQWLFAFDAAGMALLRALAVLATHPLQRDRALEDAGEPNRPLLR
PYLRGCLLESVRLWPTTPAILRDTTEDTHWREGAERFTVAKGAGLLIVAP
AFHRDDQVLPFAHDFVPEIWIDGRAQLYPQLVPFSAGPAECPGRNLVLFT
TSTLAANLLNRLHFDVRSEPRPVPGEPLPMTFNHAGIEFSLRPARRAVTA
ATVDPAT
118472891YP_888538.1 ubiquinol-cytochrome C reductase cytochrome C subunit [Mycobacterium sMTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALL
RTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMR
GEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGD
VARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGP
QNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMW
IIGMVAAIGVAMWIGSRA
118472890YP_886723.1 hypothetical protein MSMEG_2381 [Mycobacterium smegmatis str. MC2 155]MLTGVSLICAPVCALVLAPTAAWAAEPEWSNLDARRYDAPIPRAGTLIAA
VPLDPALSVAGAERAYRILYSTVDQHDSPAVSTAAVFVPRGQAPEGGWPV
IAWAHGTVGLGDDCAPSAQPRSARDNEYLTHWLDQGYAVVGSDYAGLGTP
GLMSYLNSVATAHSVVDSVIAMHEMDLPLSPEWAIVGQSQGGGAAVNSAR
WATEFSRGTGLDYRGVVATGTPFNVESIVKQAGPDMALPPNLGPAANSYT
GYILAGFREARPDIDVDSVLTPAGLDAVAKAETLCKPQLDAALAGMTPTD
FFRAPLARLPGVDAALDAYMGTPTSGYDRPIFLGVGMQDRDVPPNLTLQL
DEALRANGQDVTLKVYPDEDHSGTVLASVPDSTPFLRAAFDRG
118472889YP_890589.1 LacI family transcriptional regulator [Mycobacterium smegmatis str. MCMSAEVPSRRQRSTRVSAADVARAVGVSPATVSYVMNGRAGVSEQTRARIL
EVAEALGHISSARADRLRSHQTRVIGLILTDIANPFYTEIAAGTIDAARA
RGYEVFLAHTQEDPQTLRSIVDTMIARQVDGVVITVLHPDDGEVIRSLRS
ARIPLVQLSRRIQRVDADFVGIDDRAAASEMMEHVVTHGYQDIVTVVGPR
TSSASAAREEGFIRTAEAHGIRTVSSQRISTYLSERGGYEAVEQVLARKS
LPRVIVCGSDVIALGAISALRERSLNVPDDVAVTGFDGLYPGPLVELTTI
NQPRREMAEQSIELLTRRIEGAGGSYQSVLRAHQLRIGTTCGCPRMRPHL
AA
118472888YP_885716.1 exodeoxyribonuclease V subunit alpha [Mycobacterium smegmatis str. MC2MSLLEAFAEILEPADVHVAQRLTVLADEPDASVELAVALAVRALRGGSVC
VDLRSVAGQVELPDLPWPDPDAWLAALAASPLLGQPPVLRLFGDLLYLDR
YWLEEQQVCDDVLALVSARPGGAVPDVSRLFGAGFEEQRAAAKVALSQGL
TVLTGGPGTGKTTTVARLLALLAEQAALAGKPSPRIALAAPTGKAAARLQ
EAVQLEIDQLDLIERRRLTGLHATTLHRLLGPRPDTSSRFRHHRANRLPH
DVIVVDETSMVSLTMMARLLEAVRPQTRLVLVGDPDQLASVEAGAVLADL
VEGLGSRGVAELKTSHRFGESIGALASAIRTGDADAALAVLAAGGEHIEW
VHEDPVEQLREVVVPHAMRLRQAAILGDQREALATLDEHRLLCAHRRGPA
GVDHWNRQVQRWLGEETGEPLWGSWYVGRPILVTANDYGLKLYNGDTGVV
VATPDGMRAVIGDAGTFATGRLTDVETMHAMTIHKSQGSQADEVTVLLPS
EDSRLLTRELFYTAVTRAKTRVRVVGAEAEVRAAIERQAVRATGLRKRLR
PAGV
118472887YP_886948.1 mycothione reductase [Mycobacterium smegmatis str. MC2 155]MEHYDLAIIGTGSGNSIVDDRYAGKKVAICEQGTFGGTCLNVGCIPTKMF
VYAAEVAHSVRTSARYGVDAHIDKVRWPDIVERVFGRIDPIAAGGEDYRR
SDPNITVYSSHTRFGPKTDDGRYTLRTESGEEFTSDQVVIAAGSRTYIPP
AVVDCGVKYHTSDDIMRIPELPTDLVIIGGGFVSAEFAHVFSALGVHVTI
VVRGDGLLTHCDETICHRFNEIAATKWDIRTHENVIGSHQDGDRIVLELD
DGKTVAADTLLVATGRVPNGDLLDAELAGVEVDEDGRVIVDQYQRTTARG
VFALGDVSSDYQLKHVANHEARVVKENLLRDWDDTASLVASDHRFVPSAV
FTDPQVATVGLTEAEARAAGHDIVVKVQNYGDTAYGWAMEDTTGIAKLIG
ERGTGKLLGAHILGHQASSIIQPLIQAMSLGQTAQEIARGQYWIHPALPE
VIENALLGLQE
118472886YP_885464.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MPDRDDVAPTLRDLLNSHLGVVAAQNLTDDLSAELDRTITWAHTTELRDP
SRYLRGGELVCTVGISLQTPDDCEAFVAALCESGAAGLCFGTGDAHDAVP
DALVAACTRRRLPLLIAPPNVLFATVSRYVADFQVGGELAVARATNTLVP
ELLASARRRESPRQLLDRAGEVLGCYFLLEPGAPADTGGPAAHTVTIDGL
GTLVWVGSGTPPDDAVLDVIVRFVHAAQGERDIEAALARERVGQLLSLVE
RRMLLPDALNQLLDWPGLAAREVACSAWPAGAGALLSMAFPTALVGDAPE
VCLVLTDPATSATADLPAIAAELSLPSGHSATAPLAELGSAITQARIALD
LARQHGGSIGPDQLSTFDSLLEGLPLSRLTPFKQQLIDPLAESDHERGTQ
HVRTLRVFLATNGSLIDTARELFLHTNTVRHRLARIHEITGRNPLHFEDQ
AAFAIGLRASDRHSRMTRRPN
118472885YP_884866.1 shikimate kinase [Mycobacterium smegmatis str. MC2 155]MATPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIEKMSAGHA
LDDDDRYPWLEAIGKWLAEHPAGGVMSCSALKRTYRDQLRQHCPDIEFLH
LEGSMETIGRRQASRPGHFMPASLLESQFKTLEPLAPDECGVAIDVDQSI
DDIIESYVSATQSHTPEEDR
118472884YP_884438.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MISDEPVTPPVLPVATARRSGAWLIADLRGRRTALAAVVTVGLAAAAASV
VPIYLLGMLVDRVEHGDGTRGLVALGTVIALAAVAGGLGTGLSTYLTSRL
GEQMLADLRERVLERALNLPATLIEESGRGDLLSRVGPDVAVVARTVAQV
LPVILNGFFLGVVTLVGMTTLDWRLGLAGALAIPAYIAGLHWYLPRSAPM
YADERIAIANRAQVTVESIQGARTIDAYEIHDRHLADIDRASGRARDISI
AVFTFFTRLVGRVNRAEFIGLAATLVVGFLLVRSGETTVGQVTAAALMFH
RLFNPVGELMYNFDEIQSASASLARLVGVIDLDAPGPDARRTAPARPHGA
DISVENVSFGYGTGPEVVHGVSLHVPAGTRCALVGTTGAGKTTLAAIVAG
LLTPTSGHARIGGVPVTEIADLRRWVATITQEVHVFSGPLIDDLRLVAPQ
ASVDDVWTALETVGASTWVRALDDGLDTVVGEHGHELTAAQAQHVAMARL
VLADPEVVVLDEATAEAGSAHAAELEDAASAATAGRTTLIVAHRLTQAAQ
ADQVAVMADGRIVENGTHAELIALGGRYARLWQAWIRHN
118472883YP_884952.1 hypothetical protein MSMEG_0541 [Mycobacterium smegmatis str. MC2 155]MYCSAACRQKAHRARTARRVDALRSLRSGRNEVRRPVGIRSDIAQSIARA
REQIAESRRLCRVSAERLQRLEDLQRELAKPREVRATTPMSYAKWAR
118472882YP_887654.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMTLTAAVAQFAPSEDKAANLDTIVDLLRQAADQNADLVVLPEYAVFTVPT
MDDRFVRTAEALDGSSVTRLAQAGAELGLTVIAGINESAGNGKIHNTLVG
IQGGEIAAVYRKVHLYDAFGYKESDRVIAADPAIPQLLRVNGFTIGMQTC
YDLRFPETSRALVDAGADVIALPAEWVPGPLKEYHWNTLLRARAIENTVY
VVAADQIAPAGSGNSVILDPMGIPLAALGEAAGIGVARLERSRLESVRTI
NPALALRRFRVQPEA
118472881YP_885380.1 class V aminotransferase [Mycobacterium smegmatis str. MC2 155]MMRAAFGAEFVGAEGFLNSATYGLPPQFLVDALDTHIRQWQSGTLDAASF
DEPVRRARAGYAALTGVPTESVVLAGSTSAALGLVAASVPDGSRVAVVTG
EFTSTSFPFAAQAGRGVTVTEVAPDRLPDAAVEHDVVVGSLVQSADGALL
DLAGVREAVAGTETRVVLDVTQAAGWKHLDLGWVDVTVASAYKWLLAPRG
TAWMSLSDSVAERMTPHAANWYAGDRPWDSIYGLPLRLSGEARRFDVSPA
WFAALGAGLTLPWLASLDPVAVEAHAVGLANRLRHELELAPQDSAIVSIP
ITGAEERLRQAGIRAAVRAGAVRVGFHLYNTEDDLERLLHALGDNR
118472880YP_890781.1 hypothetical protein MSMEG_6569 [Mycobacterium smegmatis str. MC2 155]MRNSAVVFAVAALTLAGCTPQHEEHTMAQTVTFADPWASAADTGMTAVFG
TLQNTGHHDAHIVSATSPVAEMVELHEVAADANGVKTMRPKEAGFAVPAG
GEHELAPGGDHIMLMDLTAPLQPGADVEVTVMFDDGSSLPVQAQVRDFPG
GKENYQPAKPHDHG
118472879YP_889468.1 GTP-dependent nucleic acid-binding protein EngD [Mycobacterium smegmatMSLNLGIVGLPNVGKSTLFNALTRNDVLAANYPFATIEPNEGVVPLPDPR
LDKLAELFGSEKTVPAPVTFVDIAGIVKGASEGAGLGNKFLANIRECDAI
CQVVRVFNDDDVVHVDGRVDPRSDIEVIETELILADMQTLEKAVPRLEKE
ARNNKERKPVLEAAVAAQAVLDSGKTLFAGAAAAGIDVTLLRELNLMTTK
PFLYVFNADESVLTDEARQAELREMVAPADAVFLDAKIEAELLELDDESA
AELLESIGQTERGLDALARAGFHTLKLQTYLTAGPKEARAWTIHQGDTAP
KAAGVIHSDFEKGFIKAEVVSFDDLVEAGSMAAAKAAGKVRMEGKDYVMA
DGDVVEFRHGGTSGSGKK
118472878YP_885169.1 antibiotic transporter [Mycobacterium smegmatis str. MC2 155]MSWLAVLVVIISGGLMGVLSGGDSASQSPVAVPSDAESARADALRADFPG
GDQAPAILVVTRADGAELGPDDIDAAAEARHRMSDAPGPPMVVSDDGKAA
ISTVPLDATLSGFALTDEVKELRANAAEGLPGDLRAEVTGGPAFGADIAN
SFAGANVTLLAVTAIVVALLLIVTYRSPILWLVPLLVIAFADRVGSVVGT
AVASGLGMNPDGSTGGITSVLVFGAGTNYALLLISRYREELGRTENHRDA
LQASVRAAAPAIIASNATVVLALLTLLFATAPSNRSLGVQAASGLVVAAV
FVLIVLPPLLALCGKRLFWPFIPKVGATALTESGVWHRIADTVARRPARV
VVVSVAGLALLCTALLTTPIGLTQTEQFRVQAESVSGFETVSAHFPSGLT
DPTRVIASTDKAAAVQRAITDTEGVVSASPAGESPTGLTQWSVVLGADPA
SDEAFETIDALRGSVQHADADAVVGGSDAQARDAAAAAQRDRAVVIPAIL
VVVLAVLYILLRSAFAPLLLVGVTVLSSLAALGLGGWASVHIFGFPALDN
GTPLFAFLFLVALGVDYTIFLVTRAREETPQYGNREGIVRAVSATGAVIT
SAGVVLAAVFCVLGVLPLIVLTQLGIIVGLGILLDTFLVRTVIIPALFTW
IGPKIWWPGLRAEP
118472877YP_891066.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPRWEHGSEDRLKQAATELFEERGFQNTTAVEIAKRARVTTRTFFRYFAD
KQAVVFADAERLRAALIQQLGNTADAGQPLRSVTAVLAGFDWESLGSRES
QRRRDRMIASNPELLERDLMKQHEMAEAFSGVLRERGVEPYAAELAARVG
IDVFRTAYRRWLAADEGDAELSALVEAVMTALNSIAPAPRGSET
118472876YP_886083.1 phosphatase YfbT [Mycobacterium smegmatis str. MC2 155]MTSHKTFPIAGILFDSDGVLVDSHEAAATAWNHWARTWAPGFDFHRDAQH
GRRLSDVVAELVGDGDSALATKVLTELEIEMATEVPAMAGAVDLLSSSPA
DRWAVVTSGAREMAAARLLSAGLPTPRVLVSADDVTAGKPAPEPYLTGAH
LLGLEPRVCAVFEDAHLGILAARAANVGFVVGVGAQTIGEDVDVSVADLS
GITFDGSHLVIEADAVLTR
118472875YP_888105.1 acyl-CoA thioesterase [Mycobacterium smegmatis str. MC2 155]MPLPQLADVLATLDITDCGHDMFVATQIDNEAHHIIGGHISAQALMAASR
TAAGRVPNSLHVYLLRAGDARYPVEMQVMNMRDGGMLSTRRVIARQGDEV
LLEALVSLSDTADTVDYHQPMPDVPAPEDLPSVGELLSDYADELDGFWVK
PQWIERRYVDAPPRLALDQPEPPERTRMWWRPAESIPNDPVLNCCVLTYA
SGTSLLETTVTMRRTTQATAFSALIDHTVWFQRPADLSDWVLSDQVSLSG
IHGRGLASGTMYNRSGELVCSATQEIYFGRGRI
118472874YP_885698.1 peptidase S15 [Mycobacterium smegmatis str. MC2 155]MIIERDVAVPCDDGLILRADVFRPDDGEPAPVIMTLGPYGKGVEYSDGYA
PQWNWLITTYPEVLPGSSRSYMAWETVDPEIWVPWGYAVVRVDSRGAGRS
PGVLDMLSPREVRDYHDAIEWAARQPWSTGKVGLNGISYYAINQWLLAAQ
QPPSLAAMIPWEGAGDFYRDWARHGGIVSNGFLEAWYPRQVVSVQHGNPD
GRMDRWQGERATGPEDLSADELALNRNDPLPEILKRPLDDEFYRDRSPDW
SKVTVPFLSAANWAGFGLHPRGNFEAFTQAASAQKWLEAHPGRHEEWFYL
TQGMALQKEFLDHFLKGEDNGWDTRPPVLLHIRRPFTDEVEVRTHSAWPL
ENTQWTEVHLDAADMALNFAPVDTEHSVTFDAAGEPLTFLTGPLTAETEL
TGPLSARLFVSSSTVDADLFVTVQAFAPDGREVEFQGTIDPHTPLAQGWL
RASHRKLDVARSLPYRPYHSHDELQPLDPGTIYQLDIEIWPTCIVLPAEY
RIALQISGHDFEREEPKDGNEAWVSRGSGPWLHTHPEDRPASIYTGRTTI
HTGGSTPSTLLLPVIPS
118472873YP_884475.1 hypothetical protein MSMEG_0057 [Mycobacterium smegmatis str. MC2 155]MTAPFTAETGDAHIDDVVGVEVTIDGMLVIADKLGLTDFPPSMGIRLNIP
QPDLRKVVWEQVERDLSAQGVLDVYGNPHPEVAAMVDTLARADRTLECRW
WRRDAGGKMIRFVVCRKGGRHVVAARDNDLLVLQRVAPQIGLAGMVMTVL
GEGSPANVEPLTGVADRLAQCRTAEELTGYGIPPTSARAYASIISEPDGW
VEIVANERHPGGTTSQVDVAAGVLDAKQGRIVSIPRRVNGELYGSFLSGT
KDNLERALEGLVEFLPSKTWFDKTDADNAYQH
118472872YP_885201.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSALAALDAERIKLSTTRSPLWSVVGAAVLSFAIAALQGWSAYGYTPLPP
GKAALGVAVFGVPVLMVLASMTMTGEYRTGLIRTTFMATPNRSVVLAAKA
IVCAAFSSVAAIVMVLGAVLVARLFTDPLIAVDLSPTNPATWQVAGSFAL
YAALAAILGVAVGALVRFSAGAVAVLLLWPLVAEPLLANMPGNGAQIGPW
LPFVHMYRFLDVDWLFPSYAMPWGPVGSLIYFVVLVVVVFVAAVVALNRR
DA
118472871YP_890557.1 metallo-beta-lactamase [Mycobacterium smegmatis str. MC2 155]MESNPPSAVVEAAHREHLTTLPFGDRRDFDDADRGFIAALEPCVITADDG
RLVWDNDSYRFLDSEQAPASVHPSLWRQSRLCAKQGLYEVVDGIYQVRGL
DLSNITFVEGDSGVIVIDPLISTETAAAALALYRAHRGDRRVTAVIYTHS
HVDHFGGVLGVTTQADVDAGRVVVIAPEHFTTHAVQENVYAGTAMARRAA
YMYGAALARGPLGQVGCGLGQVPSTGEVALIVPTLDIRETGEIHSIDGVD
IEFQMAPGTEAPAEMHFYFPKFRALCMAENATHNLHNLLTLRGALVRDPH
GWAGYLTEAIDSFADRTDVVFASHHWPTWGRDNIVEYLSLQRDLYAYLHD
QTLRLINQGHTGIEIAEQFELPPALQAAWHTHGYYGSVSHNVKAVYQRYM
GWFDGNPGRLWQHPPEALGPRYVDAMGGIDRVVELARRAFDSGDYRWAAT
LLDHAVFTDEHHRGARALYAEVLEQLAYGAENAVWRNFFLGGATELRDGK
FGTPTAPSSPTLLAQLTPEQIFDAVAINVNGPRAWDLDLAIDVTFADTGD
TYRLTLRNGVLVHRRTEPDPSSAHASVTVADRMRLLTFFIGDTAMPGLQV
TGAPDVLQSFLRVLDRPDPNFSIVTP
118472870YP_890813.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MKIGLSINYAGGFKDIAAEVADLERAGLDIVFVPEAYSFDAVSGLGYLAA
RTDRVQLASGILQLYTRTPTLTAMTAAGLDYVSDGRFILGLGASGPQVIE
GFHGVRYDAPIARTREVVEICRRVWRRERLQYEGKHYTVPLPADQGTGLG
KALKLINQPVRERIPVLLAALGPKNVELAAEIAEGWQPIFFLPEKAATVW
GDALKAGKTKRDPALGELNVYAGPVLAIGDNVEPLREFVKPHLALYIGGM
GAKGKNFYHSLATSYGYGAEADRIQELYLAGEKDAAAKAVPDELVRDVNL
IGSAGFVRERIAAYREAGVTTLNVVPIGETAADRVRLIEQLRELV
118472869YP_890941.1 carbon-nitrogen hydrolase [Mycobacterium smegmatis str. MC2 155]MRTVDVAVVQEPAVAGDVAANVRRAVAALAKHPGADLVVFPELFLCGYRL
DVVADAAIEMIPEPGPVADLCAAAAAHDTAVVTGFAERSGDLVYNSLLCI
DRTGAVAGVYRKTHLFGAECEAFATGDRLEVIEVDGLRVGPMICFDVEFP
EIARTLALSGVDLFVVSSANMFPYHHDHRVACLSRALENRTPLVYSNLIG
AEAGLTFVGGSRVVDAGGELLVECGGEVSVARCRVTPATATSTEDDVDYL
RHRRPELYRLK
118472868YP_889760.1 peptidase [Mycobacterium smegmatis str. MC2 155]MPLPQPISVEDFFRPPVRAAAKISPDGTRIAYLAPWQNRLNIWVENVDGS
ETRCVTADENRSIYIYEWTGDSRWLLYMQDTGGDEYFHVYRADPDDPAAT
AVDLTPFPGVRTSFELLKGRPGKVMVQLNKRTSTLMDAAELDIATGELTE
LAQNPGTVTNWQAGPNGDLFTSTQTAEGDIEIARWDSAAKTLRTIATYDG
ADYPLGIHPISVSPDGTGLWFGSNKGTDRTRLVRLDVATGEETEVDSHPS
FDLATQVMLPFPLILSEATGELIGARYYGERQVIHALDPQFAAVLEGVSR
LNSGDIGSLSSDSSGARWVVSFFSDRDPGVTYFYDHATGQSRKLFRPHPH
LDPDTLAPMTPVTIPARDGLDLPSYLTLPVGIPQENLPMVLLVHGGPWAR
DCWYYQPEVQLLANRGYAVLQVNFRGSTGFGKAFTKAAIGEFAGKMHDDL
IDAVDWAVKQGYADRDRVAIFGGSYGGYAALVGVTFTPDVFAAAIDYVGI
SSLANFMRTLPDVARPFLANNWHRYVGDHDDPVQEADMLARSPITRVDQI
RAPLLVIQGANDTRVVQAESDNLVEALRARGVEVEYMVKDDEGHGFVNPE
NRIDLFHAVERFLAEHL
118472867YP_884872.1 two-component system response regulator [Mycobacterium smegmatis str. MKVVVADDSVLLREGLIRLLTEGGHEVAAAVGDGPALVQAVDTHRPDVSV
VDVRMPPSHTDEGLRAAVEARRRVPRSPILVLSQYVEVSYADDLLADGAG
AIGYLLKDRVMALTQFLDAVQRVASGGTVLDPDVVAQLLVRRRRDDPLRQ
LSDRELQVLGLMAEGRSNTNIARTLVVSDGAVEKHIGNIFAKLALPPDSE
QHRRVLAVLAYLRG
118472866YP_885140.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium smegmatis strMGGTATMAKPPLSMKPTGWFQVAWSDEVGVGDVRAMKYFGQEMVAWRSES
GQVTVMNAYCEHLGAHLGFGGTVVGEVIQCPFHGWQWNAEGRNVCIPYQD
RPNRGRRMPTYPVAERNEAIYIWHDVLGREPFFDAPDVFASFADGSSADG
YYPQQRLYRQALELHPQYVLENGVDFAHFKYVHQTPIVPVFTRHDFAEPW
SYVDFTITFEGDENQTIDDVNSGVQAINGGLGIAVTKSWGMIDNRTISAV
TPVDESTCDVRFMVYIGRTPGRDDERSATKAAEFGEEVIRQFTQDIHIWS
HQRYSDPPALATAEYEGFTAIRKWAMQFYPDGRGGSAADLNRRGSAADLA
SIDQKGTTT
118472865YP_886657.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MRRGSRSHSGGPGVKVDARSERWREHRKKVRSEIVDAAFRAIDRLGPELS
LREIAEEAGTAKPKIYRHFTDKSDLFQAIGERLRDMLWSAIFPSINLASD
PAREVIRRSVEQYVRLVDEHPNVLRFLIQGRFAEQSESTMRALNEGRGIT
LAMADMFSHELREMELDGAAIELAAFATFGAAASATDWWLGSKEDSPRRM
PADEFVNHLTTIMVGSINGTCELLGIRIDPDLPLHEGVQRRERAS
118472864YP_886647.1 glutaredoxin [Mycobacterium smegmatis str. MC2 155]MTVTVYTKPACVQCNATYKALDKLGIAYETVDITVDSEARDYVMALGYLQ
APVVVAGNEHWSGFRPDRIKALSAATISA
118472863YP_890562.1 hypothetical protein MSMEG_6345 [Mycobacterium smegmatis str. MC2 155]MELLRHVVVYLHLIGFAVMVGAWVAEAAARRFEITRVMDYGILLSLLTGL
ALAAPWPAGIELNYPKIGIKLVILVALGAVLGIGRARQRRTGQPVMPLFV
AAGVLPLLAAGIAVLW
118472862YP_887148.1 hypothetical protein MSMEG_2820 [Mycobacterium smegmatis str. MC2 155]MGFQNRAGPALGDAPMTLPPPPNTPPPNGASPPPPFGGSGPYPQSLHQPW
PQQPSPRRSGTWKWVLAIVALLAVVGVTAAVTVAVTGEPTGGGLPSASTP
QAVPSDSEIASAEDSGGVSVITDDPTCAPQRPIVSTLAAKTNAGWDKRDP
EVPASDWTPEIRAQYNEVAAAMRDAADQFVQLAKLTPHRVMREIYEQFIA
YARAYAASVPNYTPGDDYSARFAVGAAEAISRICAAIDYGSAGARAPLVK
VSEPPAEIAPVGDANAPVRFLSEPNAVCRDWNLALMQFQDETAEWRNTDP
KIPAGEWTPEQKRLNVEVAPVMRRFATQLRSLGNSSGNPVLADFANLSAQ
YRSALEKALPTYVPADDYLAGVSARLNGMVNSACQAVSA
118472861YP_886858.1 amidase [Mycobacterium smegmatis str. MC2 155]MVHAFSNDALGDHDAVGLVGELAAGRVSSADLIEAAIARVEAVNPTLKGL
AYAAFERAHARGAAPSPYGGFFDGVPTFVKDNVDVEGMPTMHGTDAWEPR
AVRAHGDFARAYLSTGLIALGKTRLSEYGFSASCEHPRLGPVRNPWNPEY
TAGASSSGSAAFVAAGVVPIAHANDGGGSIRIPAACNGLVGLKPSRGRLP
QDKYFRAMPLRIVSDGVVTRSVRDTAAFYREMERVYRNPKLPPIGDVHRP
GKQRLRIAVCTQSIVRDAAPEVRDLTLKTAALLEELGHRVTPIGNPIPNH
FKDDFLDYWAFLAFASVRGGRRTAGPSFDRDRLDNLTLGLDRRAARRLYR
LPLAIARLARSGRITQRLSNSYDVVLMPTLAEPTLPLGRLDPTADYEQIL
QRLVDWVAFTPLQNATGDPAISLPLAQTTAGMPVGMMFSSTIGREARLLE
LAYELEEARPWARIQDVTATKQPRKRAAKKATKTTE
118472860YP_889507.1 mycothiol conjugate amidase Mca [Mycobacterium smegmatis str. MC2 155]MSELRLMAVHAHPDDESSKGAATTARYAAEGARVMVVTLTGGERGDILNP
AMDLPEVHGRIAEVRRDEMAKAAEILGVEHHWLGFVDSGLPEGDPLPPLP
DGCFALVPLEEPVKRLVRVIREFRPHVMTTYDENGGYPHPDHIRCHQVSV
AAYEAAADHLLYPDAGEPWAVQKLYYNHGFLRQRMQLLQEEFAKNGQEGP
FAKWLEHWDPDNDVFANRVTTRVHCAEYFHQRDDALRAHATQIDPKGDFF
HAPIEWQQRLWPTEEFELARARVPVTLPEDDLFKGVEP
118472859YP_888138.1 tyramine oxidase [Mycobacterium smegmatis str. MC2 155]MWLRDRVDYPLDPLSADEFTAVAAILRREHGVGEGWRIASVELAEPSKAE
LAAYDEGGPAPARRAAVICLDRSANATYKGFVSLTDDRVESFTHIPGVQA
NFTVDEFAECDQILRSHPDVIAALARRGITDMDNVFMDTWTYGAAVAPPE
YTDRRIGWSDTWYKSTAGANPYAHPVSGLHCVIDLNAMEVLRVEDDGTNE
RPDVMGEYVPRHIPERIRAASTREPLKPLEITQPHGPSFTLDGNLLQWQN
WSLRIGFNHREGMTLHTVRYRDGAVNRSVAHRLSFAEMVVPYRDPSVDHY
RRTAFDIGEWGLGFMTTSLDLGCDCLGEIRYLDAVLHNSKGEPYTITNAI
CIHEEDNAVLWKHVDHDAGAEVRRMRRLTLSFHVTVANYEYLVYWRLYQD
GNIECEVRATGIMVTTPLPAGADAHPNGALVDERTYAPYHQHFLIARLDL
DIDGPDNTVYMTESYAAPIGPDNPYGLSVVVRNEALRTEADGIQDVNFAT
QRAWKVVNTNVVNGLGTHPSYKLVPTGAIPPMLDPESPVLQRANVIGHTL
WVTPNHPDERWPAGEFVNQSVRDTGLGEWTKANRSIDNADVVLWYVFGIH
HITRPEDWPVMPVDIVSFWLKPYGFFDRNPALDVPATPPGACAHPHTKAA
HH
118472858YP_888817.1 methyltransferase small subunit [Mycobacterium smegmatis str. MC2 155]MSEHDRARWDAAYTDRPLGAGLPDGPAGPPRAFAGHVDEFPTAGSALDVA
CGSGENSVWLARRGLHVWGIDVSPVAITQATQFAARNGVAQRCRFDVVDL
DDGLPDGPPVDVVLCHRFRDPRLYEALRARLAPGGLLAICVLSEVGAEAG
RFRAPAGELRAHFGALQVIAENERDGEAWLLAR
118472857YP_885011.1 dehydrogenase [Mycobacterium smegmatis str. MC2 155]MNIDLTGKTALVTGSTQGIGLAIAETLARSGARVAINGRTASRVDETVAQ
LGDLDVVGVAADVATQKGTEALLEQLPSVDILVNNLGIFGAEPAREITDE
QWRKYFDVNVLAAVRLIRSYLPGMIEKGWGRAIQIASDSAIVIPEEMIHY
GVSKTALLAVSRGFAKDAAGTGVTVNSVIAGPTHTAGVEDFVYQLVDKSL
PWDEAQREFMRKHRPQSLLQRLIEPEEIANMVAYLASPLASATTGGALRV
DGGYVDAILP
118472856YP_885803.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSEGSRAGRRRSTTQDHIAGVAIDLFAARGFDAVSVDDVAAAAGISRRTL
FRYYASKSAIPWGDFDSHLQHLQNLLRTLSSEVSLGDALREALLTFNTYA
DHEMAEHRQRMRVILETEELQAYSMTMYAGWRTVIAEYVADRLGMSTTDL
MPQTVAWLMLGVALSAYENWLADESVSLRGAIAAAFEVARPGLDALQPAH
118472855YP_889701.1 RarD protein [Mycobacterium smegmatis str. MC2 155]MSGHQPGHPVRGVAASLGASALFGLIFYISGVVDAPSEMVFGCRILVTFG
CYAVLLLHPTARAALAAYWAALRAARWNPALLAGLSLLVGLQLWLFIWGP
MHGHALSISLGYLLLPIVLVLAGRFVLSAHVTTAQWVAVAIAGVAVASKI
SLSPDVSWTTFAVCLGYPLYFVIRRRAGLDGPAAFGVEMAVLGPVAIALV
ALADTSGVSPSGYAGVAAVAFAGAAGMAAFLAASRLLTLPVFGLLGYSEP
VLLVGVAILLGERIQAPDLVVYAMLAVALAILATDGFRTARRAGTTVHSR
SRQPEDCVTTTG
118472854YP_888121.1 esterase [Mycobacterium smegmatis str. MC2 155]MPIDPIAQKMLDDAKASGRPNAHLLPVPTARENFENTFAALQKPDVHRVT
DVAIETRDGAVIPGRLYVPAEGDDLPLTVYYHGGGWLLGSVDSHDAATRL
LAKASGSAVLSVGYRLAPESRFPTAVNDAIDAVEWARAFGATLGVDTSRL
AVAGDSAGGNLAAAVALHYRDAGEPVIRHQLLVYPVTTTDLTKGMDPEYD
GVMLERDELQWHQDNYLPGPDAASDPRVNVLGADLHGLPEATVILAECDP
IRPQGELYLQALKDAGVPVESHLTPGQVHGFFGLDEIFPAATAAMTFAGQ
RLASALAVAGQSTR
118472853YP_884814.1 non-ribosomal peptide synthase [Mycobacterium smegmatis str. MC2 155]MESLPLTVNGKLNTRALPAPEYQDADQYRAPANAVEELLTGIYAQVLGVE
RVGVDDSFFDLGGDSISSMQVVARARAAGLVCRPRDIFVEQTVSRLAQVV
TLADGESGVADTGVGPVVATPIMRWLYSLDGPIDEFNQTVVLQVPAEVTE
ADVIAVLQAVLDHHAMLRLRVADAENGDLTVPEPGSVDACDCLCTVGELT
ADTLAAVRAQLNPATGSMLTAAWVPETRQLALMIHHLAVDAVSWRILLED
LNIAWAQHRSGQPVVLPTPGTSFGRWSRLLDQHARTADVLATADVWRTVA
AAPAALPAPQPDTDVYANAGQLSASLDVETTGQLLGDVPAAFHAGVQDIL
LIAFGLAWSEYLGSEQGSIGIDVEGHGRTEELFGDADLSRTVGWFTSKYP
VALDFDRNTGGISWEQVVNGDAALGAVIKKAKEQLRSVPDGLTYGLLRYL
NPDVELDNPDPTIGFNYLGRLGAGAADLSDDLWRLDPDAVSLTAAGGRVN
TPLGHTVELNAGTMDTEAGPQLQATWTWAPSALDEEQIQKVSKLWSDALA
GICAHVRSGGGGLTPSDVAPARLSQQQIDDLTAQFDMVDVLPLTPLQHGL
LFHTGLSQDSEDLYAVQLDISVSGRLDVERMRDAVQTVITRRPNVVAHFY
EDFGEPVQILPANPELAWQYVDLSGRSDIDAQIAQISAAERAAVCRLGDQ
PPFRAAVLRTGEETYRFVLTNHHIVLDGWSKPILLQEIFVSYFGQRLPAP
VPYRRFVSWLAEQDNDAARAAWRGVFSGFETPTLVGTPGLALGRRAVESF
QVSAETTQALGELARSCHTTVSTVLQGAWAQVLMWLTGQPDVAFGTAVSG
RPTDVPGADSMVGLLINTVPVRATITPETTVASLMNQLQGAYTDTLDHQH
LALNEIHRATGHDQLFDTVFVYENYPIDTAALLGVQELSITDFTNREYNH
YPLSVQAVPGHELGLRVEYDTNVFDRQRIKRLVNRLQRVLVAMTADMREK
S
118472852YP_887977.1 hypothetical protein MSMEG_3674 [Mycobacterium smegmatis str. MC2 155]MKKLVVLGGGLVVAGSVALLGAGIATSQPTSASINVVGEPYMKALQILKS
QGLKATFGGSRGSALPQAECLVDSQKINSSGKVILMLDCTEAAAQQAQDT
AVSGGPRVGSNGVTTVTPTPVVPIAGAPGAGTPPPA
118472851YP_889880.1 hypothetical protein MSMEG_5646 [Mycobacterium smegmatis str. MC2 155]MQHNTFLRHARSAVKRPIAWIHTRASLTPQERHNLRMSNTPVAVLTASLG
GGSHTAR
118472850YP_889896.1 sensor-type histidine kinase PrrB [Mycobacterium smegmatis str. MC2 15MSMLTRIFRRTPSLRTRVAFATAIGAAIVVVIVGTIVWIGITNDRKERLD
RRLDEAAGFAIPFLPRGLDQIPRSPNDQDAVITVRQTGAVTSNSTVVLPE
LPAGYADTYIDGVRWRVRTVEIPAPGPMWVAVGATYDATIADTNNLHRRV
LVICVFAVGAATVLGWVLAAFAVRPLKRLAEQTREIEAGDEAPDVEVRGA
TEAVEIAEAVNGMLKRIWKEQDRTKSALASARDFASVSAHELRTPLTAMR
TNLEVLSTLDLPDEQRKEVVNDVIRTQSRIEATLGALERLAQGELSTTDD
HVTVDITELLDRAAHDAMRIYPDLEVSLAPSPTVIIVGLPTGLRLSVDNA
IANAVKHGGATRVQLSAVSSREGVEIAIDDNGVGVPEGERALVFDRFARG
STASRSGSGLGLALVAQQAELHGGTATLAESPLGGARLLLRLPGPR
118472849YP_887896.1 hypothetical protein MSMEG_3593 [Mycobacterium smegmatis str. MC2 155]MIRIGTSGWSYDHWRDVLYPPGTPSSARLSRYTQVFDTVELNASYYRWPR
DTAFANWRSQLPDGFTMSVKAHRGLTHFRRLRSPEPWIERFERCWEVLDG
CAEALLVQPHPALERDDALLDEFLTLVPDHIPVAVELRHASWHDPAVYAL
LRRHGAAYVVMSGPGLVCEPVATSDLVYIRLHGPPQEAIYSGSYPADQLR
WWAEHILLWHRDGHRVVVYFNNDLGGHAVRNARTLKELVAHE
118472848YP_890892.1 agarase [Mycobacterium smegmatis str. MC2 155]MRFTLDHSAGRWRFRGPDGDPFLSIGVVHADDTNLRYPHNMGIFTARYGA
SRRRWLREGLVPEMTSWGFNTLGWTSEYVSGSGLATDGGAVDLGHSEGLP
ADDVAALGIPYTLSLRVAEIEHWNGHPAYRDPRGPAFAQWCDHLARITCR
PDDPNLLGYFLVDVPFWGRHPTGAGYPPGELAAIADAYYRTATEAIRRHD
PHHLILGDRYGTRHPVPDAVLDAAAPYVDVLSVQTFPGPGADRLHAALEI
IGRWHVRTGRPVLIADTGNWCPTVMRPDRTGWASDQRDRGAGYAAAAEAF
TARPWCLGWHWCGWLENPHRGFGLKDPWDEPYTDLTEVVRQTNLRLSTGG
TPRSPTTPAAGRGG
118472847YP_889163.1 endo-type 6-aminohexanoate oligomer hydrolase [Mycobacterium smegmatisMGSITDVAGILVGHHHRLDPDAVLGSGWASGTTVVLTPPGTVGAVDGRGG
APGTRETDLLDPCNTVRHVDAVVLTGGSAYGLAAADGVMTWLEEQGRGVA
MEGGVVPIVPAAVIFDLPVGAWGARPTAQFGYEAAASAGTEFALGTVGAG
VGARVGVLKGGVGTASMTLENGVTVGAVVVVNAAGDAVDPATGLPWMAEY
VEEFGLIPPPADRLTGYADLRTELSPLNTTIAVVATDAELSPAACKRVAV
ASHDGLARTLRPCHTPLDGDTVFALATGRVAVPPDPKTPTAMSPETRLVT
QVGAAAADCLARAVLVGVLAAESVAGIPTYRDMLPGAFE
118472846YP_887990.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MSVSFDLSTVFSTVAAAVPDQTFVVWRDRRLTYAQFDAHVDGFAHFLVSA
GLGVHTERAALAGHESGQDHLGIYLRNGNEYLEAMIGSYRARVAPFNVSY
RYVEEELLYLLTDSNARALVYNAEFAPRVAAIRDRLPNLAVLIQVADDSG
NELLPGAVDYEAILGTPEPEGGMPVPSGDDLYILYTGGTTGMPKGVLWRQ
HDIFLSSMGGRPFGAENFLSSYEELADKARASAGAMSMLMIPPFMHGAAQ
WASYTAITMGGKLVIPDDVVRLRPDAALRLAERERVMSIPVVGDAIARPL
IDEIEGGNYDLSGLVTISNGGAPLSPTVRSRILAALPHLLLLDAVGASES
GAQMSAYTTSGAETQPATFTPQPDTAVVSEDLTRVLGPGEGGGWLARRDL
IPLGYLGDAEKTARTFPTVDGVRWSVPGDRANVLPDGRIQLLGRDSVTIN
SGGEKIFVEEVERAIAAHPAVYDVVVVGRPSERWGSEVVAIVQFAEGASA
TDDELVEVCERSIARYKIPKAFIRSPEIVRSPAGKADYRWAKQIATEAVS
T
118472845YP_884533.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MNIHHRYATIDGQRIFYRAAGPADAPPIVLLHGFPTSSFMFRDLIPLLAR
NHRVIAPDHLGFGFSDAPSADEFDYTFDALADLTEGLLTHLGIVRYAIYV
QDYGAPIGWRLALRHPEAISAIVTQNGNGYVEGFVDGFWSTVWDYHREQT
PQTEAAIRTALDPESVKWQYVTGVADESLVSPDTWNHDAAQLARPGNDVI
QLKLFADYATNPPLYPTLHEYLRTSGVPVLAVWGRNDPIFGPDGARAFEK
DATDAEIHLLDGGHFLLETHVDEVAGLIDSFLDRKVS
118472844YP_891077.1 endoribonuclease L-PSP family protein [Mycobacterium smegmatis str. MCMSNKQTGTQSVEALLDARVVVTDGLVFVSGLSAADPGVGIPPQAAVSPEF
PYYGADIQKQTTYLLEKLQQLLAEAGTSLEKVVKTQVFIADCRLFDAFDQ
VWKRFFPVPPPRTTVGVGAEEMPVPGALVVVDVIAAADGVTVTHVDSPTL
PKPLANYTPCVAAGDWLFLAGQLPTEFGDTGLAPAATVSPHFPHHVSALT
AQAEFTIGICETLLSDAGSDWDNTVRVHVFLKNMADAPLFDELWREKFDG
NPPPYLIVGVEELLTGGAQIEIDVIAVRAGTSQPATRFAVVDVEIGQEGY
RPFEVRDAVRAAFDAAIAQPGAVEPVKVHAFLPAPADIYGFGRALPSTFI
ERAAITTSTSVGGTRAALEIVYRVEA
118472843YP_886454.1 serine esterase- cutinase [Mycobacterium smegmatis str. MC2 155]MLSRRIGAWALMAAGIALVVPARLPVASAAECPDAEVVFARGTDEPAGLG
RVGTAFVDALRKQAAGLEIDAYAVDYKAGKLQLSGGDGAKDAIAHIKSTV
SSCSNTKIVLGGYSQGASVVNIAAGNQLGGITWADPLPAQYANNVAAIVT
FGDIATRTGEALSTRSNLFGSKAIDLCNPSDPICHAGQGNEWSGHTDGYV
PVYTTQAAVFAAAKLRAGSGRSVPGYGTVPEYGPGYGPGYGSGNGQGYGP
LYGPATPGYDPESPTHGPPPGYVPAPPGYVPETPGYELPGPSAAEPSAEV
GLVSAVG
118472842YP_884837.1 Hsp20/alpha crystallin family protein [Mycobacterium smegmatis str. MCMSTLMKTPAVWTRPAWQLDNWVRDFFGPADDWFKGFTPAAEVTRDGEDAV
VSVELPGVDVGKDVNVEVDRGRLVIHGERRDERSEESDGRTYSEVRYGSF
RREFKLPAHVTGDAVTASYDAGVLKVRVAGAYAGEQPQRIAIESR
118472841YP_885945.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MMRTGIFLSYAGGFKEAADQVVELEKVGVDIALVAEAYSFDAISQLGYLA
AKTSTIELGTGVVPIYTRTPSLLAMTAAGVDYVSDGRFRLGIGTSGPQVV
EGFHGVPFDAPLGRTREVVEICRQVWRRENVDFDGRYYQLPLPAERGTGL
GKSLHLINHPVRERIPITIAALGPKNVELTAEIAEGWQPVFYFPEKADDV
WGDALRAGAAKRDPDLDPLDVVVSASLAIGDDVDDRLAWAKPQLALYIGG
MGARGKNFYHNLATRYGYGEVADQIQDLYLAGKKAEAIAAVPDDLVRNVS
LVGPRGFVKERLAAYAESGVTTLLVHPLATDTAEAVRFCEELVALTR
118472840YP_888854.1 ribokinase [Mycobacterium smegmatis str. MC2 155]MGAARVCVVGSINADLTFTVANLPRPGQTVLASSLASAPGGKGGNQAVAA
ARAGAATSLVAAVGDDAAAESLRAHLRANGVDEDAVVSLAGPSGSAAIVV
DAAGENHIVVAPGANALLDVDAPAARAAIGSADVVLLQLEISPTTAIAAA
QQARDAGALVMLNASPVGTAAHHLLALSHLTDVVVVNETEAAEWHWPVRH
LVITRGARGASYVSDDERFDVPALRVRAVDTTGAGDVFAGVLAAGWPAGH
EHALQRACAAGALATLVRGAGDCAPSAADIDAVLTP
118472839YP_890521.1 ATP-dependent DNA ligase [Mycobacterium smegmatis str. MC2 155]MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRK
ERPMTRYFPELVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAA
SRVAMLAEQTPAAFIAFDLLALGDDDYTGRPFSERRAALETALADAGPTF
HLTPATTDLPTAQRWFHEFEGAGLDGVIAKPLDLTYQPDKRVMFKVKHQR
TADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIGAFPMATRRAL
FTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVT
SCRV
118472838YP_890897.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MITARGLAQVESLGLSLLAGAQGADREIAWAHANELRDPTPYLAGGELVM
TTGINIGAGAGEQRDYVARLSAAGIAALAVDTGTTLQEVPAAVLAAGDEL
GLPVLEVPASTPFIAIARVVIDAVKADELSAVQRMVDQQQVLARATLRGG
IPAVVNALAECLSATVVVADIEGRILATRGAADQQLVEVLEASRRAGARA
QAGVVADADGYVTVQTLRAAQPVRGHLAVRTEQPMSNSQRLLVAHAVSLI
SIELEKPARVVDAEDRLRSAVTRDILSGTGTTDSAVLRYLGFQPDDEVVV
LLLTGFTPLLTAQDDLGQRLAPAGSYLMTSTGDEFAIIVHAARRRRVYAA
VEEFGRVTGRTVRGGASQPVRLADAVVGAEQARIAAHSNSRRNITEFTEV
KVFGTLLGGRSTAELRVLAQPIEPLLAGGDELIDALTAFLRHNGQLEAAA
SELQIHRHTMRNRMRRISDLLADDLGTADTRAQLWLAIRAWQLLVSRERP
GLS
118472837YP_884828.1 NADH-FMN oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSATDLSPTSLREAFGHFPSGVIAIAAEVDGTRVGLAASTFVPVSLEPPL
VAFCVQNSSTTWPKLKDLPSLGISVLGEAHDTAARTLAAKTGDRFAGLET
ESRDSGAVFIHGTAVWLESAIEQLVPAGDHTIVVLRVSDIVVNDDVAPIV
FHRSSFRKLGA
118472836YP_887874.1 thioesterase [Mycobacterium smegmatis str. MC2 155]MAGFTHVEGLSSADVQRLRATYEPLAQSVRELVDATIRSEVDADDVAAAK
AHIEAATELLRARQIDGPFGVRITSDGDRMPWGNPAIGIRNAIAPPLRMV
RDDDGVMSTDFHLGAAYEGPPGHVHGGIVAMVLDHVLGEVAANDPLTPRF
TGTLTIRYLRATPLGDLRAEGWITRTDGIKTFAVGHVRDAAGITAEAEGV
FIPPKWARG
118472835YP_887287.1 hypothetical protein MSMEG_2968 [Mycobacterium smegmatis str. MC2 155]MDVMELMNTTTVVAAGTGRAVVLDKGDRVRVIDVEGAQVGDVFAFAAGDP
DEYLSASHTRTVTGRLFPAVGEHFVTNRRRPILRLVADTSPGVHDMLIAA
CDRERYRLLGAPEHRSCADNLREALAGIGVGVGVVPQPVNIFMNIPVTDG
GHLSWLPAVSRAGDAVTFEADMDCVVVVSACPMDLNAINGERVTDLALEL
IPTSKEVNA
118472834YP_885838.1 hypothetical protein MSMEG_1456 [Mycobacterium smegmatis str. MC2 155]MTAPPIDSGRMTVRGLLDESLMAGSRIVAGEDLLDEELTWVLPLNEVLSQ
HDRLDAVAVYARPESLTARASTLSALAARGATTLLVDGVAPPDLGGLPAG
LVVVELGIPVGFAALNRLLAERALSQEVHVMRYSTHVHATLAGLFHRGAG
LQILVREVSNLARNPAVALDARGHVVAHHGLPPEAVAALADSVSRMLAAD
LPASERRHDGHDTRTQQVTGPEDSRWTCVASAIRLGKSFEGWVAVLVPTL
APDHADGPSKHDLARHEVLTEQATAIIGSEMLRQRSVDEAEERARGDFVQ
ALVHGSFSSEHDMRARAEHHDIELDARFGVFVAPGVLPRGPDSPTTPMVR
LARYAAGVAAHPSVHAYVTVIGDVLVVVRTLRGEDAAAMRSEMAEYAEAM
SGELQRRRGLPAPVAYGRPALGAGEVRESYREARVALGIARRLHRTGATS
YQQLRGFTVLAQVAETEDSRQLVRDVLGPLRSSPDLLETLEAYLSEGGNI
NATARTLNVHRNTMLAKLDRISRMLGMDVRDPEHQFTVWLAIRLDLLDEV
HSAVEREASFR
118472833YP_888732.1 agmatinase [Mycobacterium smegmatis str. MC2 155]MTATSTPIGPVDASKVPRFAGPATFARLPRLDQVTKADVVIAGVPFDTGV
SYRPGARFGPTHVRESSRLLRPYNPGLDVSPFEVVQVADAGDIAVNPFNI
HEAIETIEGAARDITADGKKLVTIGGDHTIALPLLRAAAAKHGPVALVHF
DAHLDTWDTYFGAEYTHGTPFRRAVEEGILDTEALSHVGTRGPLYGKKDL
EDDRRFGFGIVTSSDVYYQGVREVVDKLRQRVGNRPVYLSIDIDVLDPAH
APGTGTPEAGGMTSRELLEILRGFRGLNLVGADVVEVAPAYDHAEMTGVA
AAHVAYDLVSLLALGPDEA
118472832YP_885136.1 oleandomycin glycosyltransferase [Mycobacterium smegmatis str. MC2 155MFPRAGLHICVVAASAPSHMYPHLPVVRELVERGHRVSYVVGAHRAELVR
DTGADVIGCTSVLPGAPGGPESWDDDGDPVRGMQLFLDEAIHVLPQLHAA
LDDDRPDLVLYDIGGMAGPVAADQWGVPAAQLSPSEVAWDGYHEDMAEVL
GPLLNSPSGQAYRRTFDDWLARSHTSLTFDEVTGAPHRCLVLIPRVMQRH
ADRVGDRYRFVGPCIDPRREDPGDWTPPAGDGPLALLAFGTSYTDRADVY
RHVITALDGLGWRLVLATGRGELGGLGTVPDWVQLRDTVPQPAVLRVADA
FFTHAGMGSCTEGLWYGVPMVAMPQAVDQPDNAARLQGIGAGVHLQAHLP
EPAEIRQALLYVTSDPRVRLRLNGIREEIRAHGGPAHAADAVEDVAAGRW
118472831YP_885156.1 hypothetical protein MSMEG_0751 [Mycobacterium smegmatis str. MC2 155]MTAPLLLRGVDLAALAVALVDRLRAAGVAVSAVGPSTLVAAMHVVAPVRR
SQLYWAARLTLVSRAEDLPAFDGVFDAVFSDAVLGVDPPNLKRSQAPPGI
PGQQYANGADSGESGDELPWTTRPASITAAAHPPAGSAIPDRAPSWLAGR
TDESFDQFDQDDLHRLGTWLQGAEAHWPRRRTLRHRRHPSGRRIDLRETI
RASRTTGWEPVRLARTRRRTRPRRVVLVCDVSGSMQPYAVVYLHLMRAAA
VSRRGAAHPEVFAFATTLTRLTAALSHRSPEVAVTRANAKVHDRYGGTRL
GRSIAALLAAPHGNLLRGAVVVIASDGWDADAPEVLRHAMSRLRRRAHLV
VWLNPRAAAPGYEPLAGAMAAALPYCDHFLPAHTLTGLRELFDVLGA
118472830YP_887077.1 thymidylate synthase [Mycobacterium smegmatis str. MC2 155]MAIDVTVLRVFTDSDGKFGNPLGVVDNSTVDPADRQRIAKELGYSETIFI
DLPGPDSHTAHARIFTPASELPFAGHPTVGAAWYLRDIGRPIKTLQVPAG
IVQVTYDGDLAAISARSEWAPEFAIYDLPSAEELMSADPDDYDDDVQHYL
WTWSDKNEGVLRSRMFATNLGIREDEATGAAAVRITDYLSRDLTIVQGKG
SVIRTRWSPEGWVQVAGRVVNDGTRQLEL
118472829YP_886955.1 uroporphyrin-III C-methyltransferase [Mycobacterium smegmatis str. MC2MTEDAYLVGLRLSGKKVVVVGGGTVAQRRLPLLLANGADVHVITRAATPV
VEALQKDDPGITLELRDFRPGDLEGAWYVIAATDDPVVNAAIAAEADERR
IFCVRADIAREGSAVTPATFEHDGLSVGVLAGGEHRRSAAIRSAIHEALQ
QGLVTEDMPGELTSGVALVGGGPGDPELITVRGRRLLARADVVVADRLAP
QELLAELGPHVEVIDAAKIPYGRAMAQEAINAVLIERARAGKFVVRLKGG
DPFVFARGYEEVLACSEAGIPVTVVPGVTSAIAVPALAGVPVTHRGMTHE
FVVVSGHVAPGHPESLVNWDALAAMRGTIVLLMAVERIEQFAKVLLEGGR
PADTPVLVVQHGTTMAQRTLHATLADAPERIRSEGIRPPAIIVIGPVAGF
AG
118472828YP_885780.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MHWIAVGRIAVSCVIALPMALAVGLPTAGAKNGDTHITGQGVERTLDCNN
ATLFVTGTGNHINAMGTCWAVTVQGSSNVVVAENVINDITVYGYDQTVFY
KNGQPAVIDRGRELQMTNVIDRVPA
118472827YP_890215.1 hypothetical protein MSMEG_5989 [Mycobacterium smegmatis str. MC2 155]MGIMPDSSPFGSQTVMGPAWPNVDEEQLTAAAASYEKLATTISGNIVPQQ
TNQLMKLTEVWQGAGSLAASGEATTMIAGHEANAAQAQAIAAQLTQMAAA
VVKTKMAVNAAAQEVQHEVEALQALPFGNKQELIESRIKMGLSQNIATVT
ASTTELASALGTTANIPQMTTPPTAQAQQAVQKGADQGAQMAMQMASQLP
QMLGQLPQMLGQVPQQLAQPLQQLTQPLQQLTSMLGSVGKGGTGAGPSPF
SAFSNHPLAGGSGPSSGAGLVKAAGMPGGGGGVGAQTPVLSKLVGTAPVS
VDPGATAGGAVVGGVAPVAAGAMGGGMGGPMGMMGGPRGGGGGGTAASLA
VPAPLEHEIDEVDDDDDW
118472826YP_887048.1 hypothetical protein MSMEG_2714 [Mycobacterium smegmatis str. MC2 155]MEAVGWAAVVVVAAVVVAGVVVGVRSIPDAQRYLKMRRM
118472825YP_889962.1 hydantoin racemase [Mycobacterium smegmatis str. MC2 155]MIRIWVVNPNTTASMTEGIGRCANAVAGPGTEITAVTSRSGPPSIESHYD
EAMSVPGLLDAIASGEQAGADGYVVACFGDPGLDAAREVATGPVIGIAEA
AMHTASHLGRGFSVVTTLARTTGRAAELAERYGMQRFCLGIHACEIPVLD
LETDPTAQKVVTEACRDAVERDGSDAIVLGCAGMAEMCRAISAEVGVPVV
DGVTAATLTVQSLVTMGLTTGKRGEYAPPPPKQYL
118472824YP_890114.1 hypothetical protein MSMEG_5888 [Mycobacterium smegmatis str. MC2 155]MSALALVPAPAASAACHNGEEEDTYTMVCTPFMVPNSPGAFSGIPGNPDL
PAVNLPGGGGAIPCTGHNAGECIGLAEEDAAEGPMAQPRSIISASP
118472823YP_885830.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMTVPGTDQDLLQIGEVAARTELSVKTIRHYDEVGLVVPSARSAGGFRLYT
TDDVRRLMAIRRMKPLGFTLDEMGRLLDALAVLDKPAATAAERATAAEVV
SDCHTRAQEACDRLTRHLAYARELTEQLAKVRG
118472822YP_886133.1 short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis str. MDIDGTTAVVTGGGSGIGAALAEAFAAAGARVVVADLDEPGAAATAARIE
SAGGNAVAVRADASATADIEALTRTEFGPVDIYVANAGIIGASGLGTDEE
WDRILAVNLRAHIRAADVLVPQWISRGRGYFVSVASAAGLLSQIGAAGYA
VTKHAAVGFAEWLAITYGDDGVGVSCVCPLGVDTPLLHAVRNSAETDALV
GAESIVQSGDVITPQDVATVTVEAVQAGRFLVLPHPHVLDLYRRKGSDYD
RWIAGMRRYQRSLRGTAVPGT
118472821YP_889683.1 RNA polymerase sigma-70 factor protein [Mycobacterium smegmatis str. MMNNPSAGNSTEHAERFTALRPLLFTIAYEILGTATESDDVLQESYLRWAE
VDLATVTDTKAYLAKLVTRQSLNALRARSRLREEYVGPWLPEPLLVAEDA
SSDVVLAESVSMAMLVVLETLTPDERAVFVLHDVFGFSHDEIASTIGKSA
AAVRQMAHRARNHVQARRKRFEPVDPQVSMEITQRFFTAASTGDIDALME
LLAPDVVWTADSAGKRSAARRPVSGADAVARLVSGLVRLGGEGARVEPAM
YNNAPALKLYLGDSFEGVITIEIVDGRITHFYAMRNPDKLAGVDIPRVIS
R
118472820YP_889014.1 4'-phosphopantetheinyl transferase [Mycobacterium smegmatis str. MC2 1MAIVGVGIDLVSIPDFAEQVDRPGTVFAETFTPGERRDAADKSSSAARHL
AARWAAKEAVIKAWSSSRFSKRPALPEGIHRDIEVVTDMWGRPKVRLSGE
IAKHLEDVTIHVSLTHEDQTAAAVAIIEEP
118472819YP_885405.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118472818YP_885576.1 serine esterase- cutinase [Mycobacterium smegmatis str. MC2 155]MRLAGLVAVAAAATSGMQIAAMPSAMAAPCPDAEVIFARGTTELPGLGPT
GDAFVEALRPQLGDKTLGVYAVDYPATTAFSTAVQGIADARARILANAAN
CPDTKMVLGGFSQGAAVMGFVTSSAVPDGVSPTEVPAPMPPEIADHVAAV
ALFGKPSPRFMRVLNDPPVVVGPYYASKAIDLCVENDLVCDPKGSSFAVH
NQYQEFGLVTQAATFVAQKLQADWAAEEATDEESTDEATPAPRTPPTRTP
SPLSAPVGATPPVQQIASTPAPVGTGPLPGPAVPPPPTAPLA
118472817YP_885341.1 hypothetical protein MSMEG_0938 [Mycobacterium smegmatis str. MC2 155]MTRVHPGEVELDFAREWVEFYDPDDADHLIAADMTWLLSRWTCVFGTPAC
QGTVEGRPDDGCCSHGAFLSDDDDRARLDDAVKQLTDEDWQFREKGLGKK
GYLEDDEYDGKPNLRTRKYKGACIFLNRPGFPTGIGCALHSKALKLGVEP
WTMKPDVCWQLPIRRSQDWVERPDGTQILKTVITEYDRRGWGEGGADLHW
YCTGDPNAHVGSRPVWESYAPELTALLGEKAYAELAAICKRRSRLGLVAV
HPATRLAESGTSGPQR
118472816YP_886305.1 6-O-methylguanine DNA methyltransferase [Mycobacterium smegmatis str. MARVTEEQVEAVRALVAAIPPGTVSTYGDIAEVAGLSSPRIVGWIMRTDS
SDLPWHRVVPASGRPAPHLATRQLERLRAEGVLATDGRVPLREYRHIF
118472815YP_890484.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MSDDVPLLRNRSGTARERDPQAPVEELEFEAAIGRNVRQLRQQHGLTVAE
MAARVGISKAMMSKIENAQTSCSLSTLALLAKGLDVPVTSLFRGADVERP
AAFVKAGTGPEIVRNGTKQGHEYQLLSSLRGEHKRLECLHVTLTEKSQTY
PLFQHPGTEFIYMLEGVMDYSHSRSVYRLQPGDSLQIDGEGAHGPVDLVE
LPIRFLSVIAFPDSQV
118472814YP_889875.1 glycoside hydrolase family protein [Mycobacterium smegmatis str. MC2 1MSGNDILAPADVDDPLRIVLVAPPYFDIPPKGYGGTEAVVADLADTLTAR
GHHVTVLGAGAPGTAARFQPLWERTLPDRLGQPYPEIMHALKVRKAIERI
AATEGVDIVHDHTFAGPLNAPFYRKLGLPTVVTVHGPIDEDLYPYYRELG
DDIGLIAISDRQRELAPDLNWVGRVHNALRIDDWPFNTVKKDYALFLGRY
APYKGAHLALEAGHAAGMPLVLAGKCSEPPEIAYFDEQVKPLLTDSDHVF
GMADAQAKRKLLAEARCLVFPIQWEEPFGMVMIEAMACGTPVVALRGGAV
PEVIVDGVTGVICDVPEELPAAMEKATHLDPAACRRHVAAHFGVGRFGAG
YEQIYRNVLRQRTRMTLREVLTEPPGVAERASA
118472813YP_888124.1 30S ribosomal protein S1 [Mycobacterium smegmatis str. MC2 155]MPSPSVTSPQVAVNDIGSAEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGDEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELSERHVEVPDQVVQVGDDAMVKVID
IDLERRRISLSLKQANEDYTEEFDPSKYGMADSYDEQGNYIFPEGFDPET
NEWLEGFDKQREEWEARYAEAERRHKMHTAQMEKFAAAEAEAANAPVSNG
SSRSEESSGGTLASDAQLAALREKLAGNA
118472812YP_887474.1 methylmalonyl-CoA mutase [Mycobacterium smegmatis str. MC2 155]MTATTGSEIRSFADVPLEGETPAAAATPEARDAQVSAAASAHGYAPDQLT
WTTPEGIDVKPVYIAADRDEAVEAGYPLDSFPGAPPFIRGPYPTMYVNQP
WTIRQYAGFSTAAESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQ
GDVGMAGVAIDSILDMRQLFDGIDLSTVSVSMTMNGAVLPILALYVVAAE
EQGVPPEKLAGTIQNDILKEFMVRNTYIYPPKESMRIISDIFAYTSAKMP
KFNSISISGYHIQEAGATADLELAYTLADGVEYIKAGLDAGLDIDKFAPR
LSFFWGIGMNFFMEVAKLRAGRLLWSELVSEFEPKSEKSLSLRTHSQTSG
WSLTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTDFSARIA
RNTQLLLQQESGTTRPIDPWGGSYYVEWLTHQLAERARAHIKEVAEHGGM
AQAISEGIPKLRIEEAAARTQARIDSGAQPVIGVNKYQVDEDTEIEVLKV
ENSRVRAEQIAKLQQLRAERDEAATQAALDELTRAAAASGPAGEDGLGNN
LLALAIDAARAKATVGEISDALEKVYGRHQAEIRTISGVYRDEVGKGSNI
ASATELVNKFAEADGRRPRILVAKMGQDGHDRGQKVIATAFADIGFDVDV
GSLFSTPEEVARQAADNDVHVVGVSSLAAGHLTLVPALRDALAEVGRPDI
MIVVGGVIPPGDFDELYAAGATAIFPPGTVIADAAIGLLHKLAERLGYEL
S
118472811YP_888463.1 dTDP-glucose-46-dehydratase [Mycobacterium smegmatis str. MC2 155]MTILVTGATGNIGRRIVDRLVELVANDIRALTKIPAKANLPAGVSVFTGY
LGANSPAPRR
118472810YP_887161.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MDATGTGPSVGVMTRPRLILNAFTMNTATHVAYGAWRNPETRSVEFDQLD
PWVELVKLLERGKFDSIFFADVVGLYDDYRGGWETYLREGLQIPNHDPSA
IVSALALSTEHLGLVITSSVLQDHPFSFARKISTLDHASKGRIGWNVVTS
ALQNSARNFGLPEREEHDERYQWAEEYTEVVYKLWEGSWDDGALLRDRER
GIHADPDKVHKIHHIGKRYRVEGPHLSFPSPQRTPVLFQAGTSTAGRAFA
ARHAEGVFINAASPKGARVVIDDTRDRAVAAGRRREDIKFFQGLSFVVGS
TEVEARARAAELDEYLSVDALIAHRSGGIGVDLGGLDHHTPIGDLAPTVQ
GTRSTIEALIAAAPPGTNPTIADLVRQQQESTRIVGTPEQIADALEEWQD
AGVDGLNIRYITTPGSFADFIDHVVPELQSRGLAQTEYAPGTLREKLFGN
GPHLPERHPARHWRGRFREADVAARAVSESV
118472809YP_886922.1 hypothetical protein MSMEG_2585 [Mycobacterium smegmatis str. MC2 155]MTGTNEQSVDMRVSDADRNGTLRRLHNAVALGLIDIDEFEERSALVSQAR
LHSDLAALVGDLPGPGAIVTSAADRVELRGVLGSLKRQGEWTVPTRLALV
RRMGSVDLDLTRARFAGPIVVIEIDMKFGSLDMRLPDGASASIDDVEVIV
GSATDRRRDAPADGTPHVILTGRVVCGSVEIRGPRKGLFGRTKTL
118472808YP_887902.1 hypothetical protein MSMEG_3600 [Mycobacterium smegmatis str. MC2 155]MHVAGQVGSLQRGVDREQRDALGLGRGDLRAERIRLHRNDDDGVHALVDQ
RVDLAGLGGHVVVGRVPHQLDVVGLGVGVHPLLALGDERAHVVHRDADAL
GVAVGRGVARAARGQAQSDGPGGGNRADLRRDVHECLSTCGGGSGIRAAS
GRGCPRRRCRRFRGSC
118472807YP_887642.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMNTPGDSAGAPNPGTSTSIRSMNSVLSTLRIFEEVATRQPIGVSDLSRVT
GIPKSTVQRCLVTLKQAGWLKVVDTAQTRWGVTARALSLGLRGAGEQDLR
QLADPVIKRLAADTGETVHLALRDGNESVIIGRADTTKDVRVILELGTRL
PLQATSAGVAMLARLAPAEVAEVLSHEVDQVEGASVPSTDQLRREIEMTA
VRGYALNVSSWYRPHVCSVGVAVTDSMDRPIAGIAISIPEMRYDAANEAT
LAELANAAAAEINGLIRSA
118472806YP_885406.1 methyltransferase type 11 [Mycobacterium smegmatis str. MC2 155]MGVVTVDRELEAKHRALWALGNYGAIAAHIVAPLGPVLVEACGIGPGDRV
LDIAAGTGNASIPAALAGAQVTASDLCPQLVDEGAHESAERGVDITWKEA
NAEALPFSDGEFDVVMSCIGVMFAPHHDQSARELLRVTRSGGRIGLISWT
PEGFIGQLFATMKPFVPAPPPGVSPPPLWGNADHVRTLLGDGIEDFETQR
RSLTVDMFADGAAFRDFFKANYGPTIAAYRAVGDDAERTAALDEAIALLG
DRYLDSGAMQWEYLVVTAHKR
118472805YP_890012.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MDLLLLTVDPHPESVLPSLSLLAHTVRTAPTEVSSLLETGSADVAIVDAR
TDLAAARGLCRLLGTTGTSVPVVAVINEGGLVAVNHEWGLDEILLPSTGP
AEIDARLRLLVGRRGGNANQENVGKITLGELVIDEGTYTARLRGKPLDLT
YKEFELLKYLAQHAGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYEALIGTVRNVGYKAVRPSRGKPPAADASGEDVPDGPDEGFGDDVDV
DGPLAGRLTSQ
118472804YP_889050.1 virulence factor [Mycobacterium smegmatis str. MC2 155]MTRNVGPGPAHRSETDSSAAPVAARPGRSFGARGHARPLAGLATVVVVGL
IIALAVTLFRGDFTKTEPVTLISDRVGLVMNPDAKVKMRGVQVGTVGRIE
TLPDGRAALHLDMDPGQLRLIPGNVTADIASSTVFGAKFVDLVPPGKPEG
TLQPGQVLQGEHVTVEVNTVFQQLTRVLDKIDPAKLNETLGAISAAFGGR
GEKMGQTVSDFEALLEKLEPSLPNLNRDIESMAVVSGAYGDAAPDLLKTI
ENTNRISDSIVDEQQNLDAFLVSSIGLADVGNDVIGGNREALSTTLDLLA
PTTDLLNEYAPGLNCALEGMAWVKNQPPQSDPGVLVNVAFTLGIERYRYP
QNLPKVAAKGGPHCMGLPHIGFGQRSKYLVTDTNANPWQYGNQGILLNSD
GLKQLLFGPLDGPPRNTAQIGMPG
118472803YP_890610.1 hypothetical protein MSMEG_6397 [Mycobacterium smegmatis str. MC2 155]MRPRPPDRVELTAAILSDRRSIISGTVSGTGDIGDVVHYNASSVSGGTFR
RSGRKV
118472802YP_884911.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MSEVVDDRPGSDAPPGSEKLRGNLGIPAIVLMVVAAAAPLSTIGGNVPIG
MALGDTTGIPVAFVVAGVIFLLFSASFVAMSKYVTDAGAFYAYIQRGLGR
AAGTGAAVLALPAYMCTLLGVSAYDGVILGGLIERFGGPQIPWWILTALV
LAAVAWLGYRDIDLSAKVLGVFLVSEVAILVVLDLVIVLRGGEQGITGDS
FTPQGLAGGVGIALLYALWGFVGVEATSVFRDEAKDPDRTVPRATYWAVG
IVASFYAFSSWALIEGNGGHDAIQVAKDDPDNFMVNTAQQYLGMLGRDLT
TLFWFVSVFACALAFHNITARYAFVLGQNNVFPKQLGKVHHRFGAPSNAS
LAVTVASFVIMAILAGLGLDPVLQIFGPLGGVGVLALAILWLLTTISVVI
FFRRRGGATRIVVLASAATLALGAGLVLIVSNLPLVVGGSPTLAVILGIA
PVVVFGIGMVLSRRATGTLSEAKSE
118472801YP_887900.1 hypothetical protein MSMEG_3597 [Mycobacterium smegmatis str. MC2 155]MDQTQSGRQPAAGRASGDGRGAELRAVEPHHRLHAQHARAVVAGPQVRPG
PGVRDTVAARAAQPHPRQLRDAVLRAAELTGTDRGRQGDGARQGRPGAGH
QQAALGTVLSGVGGQRLPQDPDTVVPVAPPAEPADHRRGAEVGAAARTRS
TLTRKKRPATEVR
118472800YP_887277.1 hypothetical protein MSMEG_2958 [Mycobacterium smegmatis str. MC2 155]MTDYETRGGRLTMPRSRGAASGLLLVVLGIYGALIPFVGPYLDFAFTPDQ
PWAWTTARGWLEVLPGAATALGGFLLLTSGNRLSAMLGGWLAVLGGAWFV
VGRALAGPLGLGNPGSPVAVTDAKRVTLELAYFGGLGALIILLAAMALGR
LSVRSVRDVAYARRPLAGDRAETRYDDRVDAPADTHVVDAPTSQIPAQPV
AATATPTTSMPASQHPESMRAPRRRRFGGLFGRRHTTAH
118472799YP_889790.1 ANTAR domain-containing protein [Mycobacterium smegmatis str. MC2 155]MSVSQNEAISQQISNLIRDVHTRRATDVDAVLGELTESAVEYVAGAQYAG
ITIAGRDGKVRTAAATGEYPEILDEIQQRVENGPCLAAAWEQHVIRIDDM
ESEQRWPAYCRQALLETPIRSVVAFQLYADNQTMGALNFYSETAGAFDAE
AVESGLIIATHAALMWSLMRRDEQFRSALASRDLIGQAKGMLMERYRIDA
GQAFEVLKKLSQGANTPLVDVAREIVTTAERPADVSTQ
118472798YP_890002.1 cytospin-A [Mycobacterium smegmatis str. MC2 155]MFSGSTVYSCSDRGDSSGANVVMCMVTGWRSTSARAVTISHTYRPLTVPA
RAISSSRHKVRNATLVTPAMGASTTGLCNAIDPICSADRAGSRAVRLTKK
KTRRAGSSFPASRPSCARARGDAPWRPRTCRRRPRALRRAGRGRRAGARP
HR
118472797YP_886658.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MTAADQQPIRTRALVIGTGFSGLGMAIELQRRGVDFLILEKADEIGGTWR
DNTYPGCACDIPSHMYSFSFEPKADWKHMWSFQPEIQDYLLGVTAKYGLR
RHIHFNSHVDRAHWDDEELRWHVFTKTGQEYIAQFLVSGAGGLHIPQIPD
IEGRESFAGAAFHSAQWDHSVDLRGKRVAVIGTGASAIQIVPEIVKDVAE
LHLYQRTPAWVMPRVNNAFPQWLRNVFSYVPGTRALLRAAIYWIHEGVGF
AMTKEPRLLKIGEWMGRYNINRSIKDPELRRKLTPSYRAGCKRILNSDTY
YRGIADPKTQVITEGIARMTPTGIVTNDGVEHPVDIVVYATGFHVTDSYT
YVDIKGAGGEDLVDRWNREGIQAHRGVAVAGMPNLFFLLGPNTALGHNSV
VFMIEQQIRYVGQAIAAVDKAGAAALAPTRRAQDAFNAELQRDLSGTVFN
TGGCKSWYLDEHGVNRTLWSGMTWQYWKALRRLDPSEFEFLDQRVLARS
118472796YP_887607.1 ECF-family protein sigma factor H [Mycobacterium smegmatis str. MC2 15MIREEFPGERRPDFQDEVKPLLGDLHRRAYAYVRDTSDAEDLVQETLLRA
YRAFDRLGDDYQLMPWLLAIMRNTWISRYRAAQRRPAEALVGEFLDTYAE
TASRGASGETWSAEDVAMRNMSDPAVVAALSKLPESLRLTMYYTAIVGMS
CREVSTLMDIPKGTVMSRLHRGRHQMRRALSHHRS
118472795YP_890473.1 hypothetical protein MSMEG_6254 [Mycobacterium smegmatis str. MC2 155]MSETPSDHPTTPVGTPAETPTATSGPVAPPPVAPPPAAVPVAPAEAPRRH
SRVVQAAAWVGIVAGVVFIVAVVFGTGFVLGKNSGPGHHHRGHDRPEIMM
FHRGGPPPMMPGMGPGHMRPGGGMFGPGGAPAERGEFRGPQAPDRSETPT
TAPARP
118472794YP_884516.1 hypothetical protein MSMEG_0101 [Mycobacterium smegmatis str. MC2 155]MNDNATWTLSASDGELLLHTGVTGTAARVGHRLTIAMRSWEATVFWEGDG
AGAEPVKAELTIDIDSLEVVGSEGGMTPLSGAEKTLIRNNALKLLRARRF
PQARFVSSDIERDGDIVRMHGAFELFGKVRDHVLEVRIDDGVISGQTVVR
HSDYGIKQYSMLIGAMKVADDVRVTFTATHRAAR
118472793YP_889721.1 porin [Mycobacterium smegmatis str. MC2 155]MKAISRVLIAMISALAAAVAGLFVSAGTSHAGLDNELSLVDGQDRTLTVQ
QWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIG
FPWSLGVGINFSYTTPNILIDDGDITGPPFGLESVITPNLFPGVSISADL
GNGPGIQEVATFSVDVSGPAGGVAVSNAHGTVTGAAGGVLLRPFARLIAS
TGDSVTTYGEPWNMN
118472792YP_890144.1 P450 heme-thiolate protein [Mycobacterium smegmatis str. MC2 155]MTQMLTRPDVDLVNGMFYADGGAREAYRWMRANEPVFRDRNGLAAATTYQ
AVLDAERNPELFSSTGGIRPDQPGMPYMIDMDDPQHLLRRKLVNAGFTRK
RVMDKVDSIGRLCDTLIDAVCERGECDFVRDIAAPLPMAVIGDMLGVLPT
ERDMLLKWSDDLVCGLSSHVDEAAIQKLMDTFAAYTEFTKDVITKRRAEP
TDDLFSVLVNSEVEGQRMSDDEIVFETLLILIGGDETTRHTLSGGTEQLL
RHRDQWDALVADVDLLPGAIEEMLRWTSPVKNMCRTLTADTVFHGTELRA
GEKIMLMFESANFDESVFGDPDNFRIDRNPNSHVAFGFGTHFCLGNQLAR
LELRLMTERVLRRLPDLRLADDAPVPLRPANFVSGPESMPVVFTPSAPVL
A
118472791YP_886593.1 coniferyl aldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155MSTIDQRAEKHSRQGGAADVLAAQRRSFLDDGPPDIALRRNRIDRLLAMV
LDNAEDFVTATASDYGTRSRSAAFFAEILGMISVIEHTRSNLPRWMRSTR
LMRAARLAGLRAEVVPSPVGVVGVIGPWNFPVQLTVLPAAAAFAAGNRVM
IKMSEVTPRTAEAMADLAPRYFDQRELAVITGGPELAAEFSALPFDHLFF
TGSPAIGAVVGRAAAANLVPVTLELGGKNPVVVAPGADITRAATRIAQAR
MVNGGQVCVCPDYVFVPDRHVDEFVEVARGTLRRMFPTITDNPDYCSSVN
RSNFDRVVGLIADARARGARVESIVPVGEVLPDPVTRKIPPTIIRDVDDR
MRINDEEVFGPVLAVRGYSSLASTIDYINSRPSPLVAYWFGPDDADFRHF
VDHTRSGGVARNDFAAHMIPSSAPFGGVGRSGMGAYHGKAGFDAFSHHRT
VVGTDLPFSITGRAALPFTGSMRVSADLALWRARSRTKNRLRKFR
118472790YP_884691.1 aldehyde-alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSEVIQDRRSAVDTARAGHMLERARWAAAAYGEYDAATVEGIVAAVAEAA
HAHAERFAADAVAETGMGVVADKVRKNRACSRGIVEYYRGHDYISPRVDP
DRKIVELPRPAGVVLALTPTTNPVATVYFKTILALMTRNAVVVAPHPRAA
RCSAEAARVLAEAAVAAGAPDGVVQVIDEPSIPLVQALMADERTDVIVAT
GGTAVVRAAYSSGNPALGVGPGNVPVLVDASADVAAAAQRIVDSKAFDNS
VLCTNESVLIAEDAVADKLRAALTRAGAHILDEDGARRLRAYMFADGHLN
TDVVGRDAAWIAGQAGLRVTPKTRVLIAPFDHVIAEEMLAHEKLSPVLGM
TTVADAARGIRAARAVVRIGGAGHSAAIHSENPAVITDFAAQVPVLRVSV
NVGNSTGSAGLDTNLAPSMTIGTGFVGRSSIGENLQPHNLVNWTRIAYNS
DPGVVMGNFTGIDPWRAPAGPVPAYPRASNDRDGAVIQAAPQRSYQSPSR
TTDVNLDALRAELRALVVEELAQLIKR
118472789YP_886196.1 dTDP-4-dehydrorhamnose reductase [Mycobacterium smegmatis str. MC2 155MDLINGMGTSPGYWRTPREPGNDHRRARLDVMAQRIVITGAGGMVGRVLA
DQAAAKGHTVLALTSSQCDITDEDAVRRFVANGDVVINCAAYTQVDKAED
EPERAHAVNAVGPGNLAKACAAVDAGLIHISTDYVFGAVDRDTPYEVDDE
TGPVNIYGRTKLAGEQAVLAAKPDAYVVRTAWVYRGGDGSDFVATMRRLA
AGDGAIDVVADQVGSPTYTGDLVGALLQIVDGGVEPGILHAANAGVASRF
DQARATFEAVGADPERVRPCGSDRHPRPAPRPSYTVLSSQRSAQAGLTPL
RDWREALQDAVAAVVGATTDGPLPSTP
118472788YP_890017.1 thiosulfate sulfurtransferase [Mycobacterium smegmatis str. MC2 155]MARSDVLVSTDWAESNLKAPKTVFVEVDEDTSAYDTGHIEGAVKLDWKTD
LQDPIRRDFVDAQQFSKLLSERGIANDDTVILYGGNNNWFAAYAYWYFKL
YGHQDVKLLDGGRKKWELDARPLSAEKVERPQTSYTAKEPDNSIRAFRDE
VIAAIGTKNLVDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSK
AANEDGTFKSDEELAKLYAEAGLDGEKETIAYCRIGERSSHTWFVLQELL
GHKNVKNYDGSWTEYGSLVGAPIELGS
118472787YP_885658.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MDNAEYQDSSGRTLGDYPRPSVAVDAAVLTVGPDAGLSVLQVRRAQGRGW
ALPGTFLHPGETLADAVNRALATKANVHGLRPRQLHVFDDPKRDDRGWVL
SVAHVAVVPLDFVASRFPESTRLVPAHAPGRLVYDHADIIALAVGDVRTR
YETAPDPDHLLGDEFTLRDLRLIHEAVTGHALQRDTFRRSMESQLVATGA
TVSRGRGRPAELFRRRDTAGRR
118472786YP_890227.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MTITSTTVEPGIVSVTVNYPPVNAVPSRGWFELADAITAAGRDPQTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCFAAFKAVYECEVPVVTA
VNGFCVGGGIGLVGNSDVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRLFFTAATVDAATLHHFGSVHEVVPREDLDEAALRVARDIATKDTRV
IRAAKEALNFIDVQRVNASYRMEQGFTFELNLSGVSDEHRDAFAGTEKRA
K
118472785YP_884505.1 chromosome condensation protein [Mycobacterium smegmatis str. MC2 155]MPAITADTLTLPRIAAPSAADTERPVRSITTGPRGYEGEGFPVVRAFAGV
SAADLDPFVHMDQMGEVEYEPGEPRGTDWHPHRGFETVTYMIDGRFAHQD
SHGGGGLITDGATQWMTAGSGILHIETPPAELVESGGVFHGIQLWVNLPR
KDKFASPRYQAIEGGQVKLLSSSDGGALVRIIAGEIGGEQGPGSTYTPIT
MAHSTIEPGAQLNLPWNRDFNALVYVLSGRGSVGPVGHPIRQGQLAVFGP
GDRITITADASQDSNRPALEVLLLGGKPIREPVFHYGPFVMNSKSELIQA
LEDYQAGRFGQIPANALMPHRPLD
118472784YP_887181.1 hypothetical protein MSMEG_2861 [Mycobacterium smegmatis str. MC2 155]MMRVSRVSIVMATAAATCFGVATSAPAAAENDWGLNGTYVATSNGEWARK
NDVFYEQASLRSTWTISTQCSYPGECTGTVHSEWGWTAPIYQKSGIWYVK
HTIPDWVPCPDGTAAPGLQVFRFKPMTPNGAMNDPKSTTLVGEDITTGES
GACGVNKPVYITMPFKLVKT
118472783YP_890570.1 hypothetical protein MSMEG_6355 [Mycobacterium smegmatis str. MC2 155]MGLATAAGLMLGTAGVAAADDVIVYDGATGIPWSWPTEGACISDGPNMHL
ENVGEDNLYQYWYCLQHDDGLWYLHNSDQPTHEE
118472782YP_890808.1 hypothetical protein MSMEG_6596 [Mycobacterium smegmatis str. MC2 155]MGSRFVPLNTIALELVPPNIERGASYAVEEAHKVLAIAAETGIEGRIRHV
MIPGMIDEDDDRPIEMKPKMDVLEYWNIIRPELPGLRGLCTQVTSFLGEE
ALRERLTALSGAGFDGISFVGVPRTMKDGEGEGVAPTDALSIYADLVPNR
GAILIPTREGEQGRFNFKCDQGATYGMTQLLYSDAIVGFLTEFAKTTEHR
PEILLSFGFVPKMEAKVGLINWLIQDPGNPAVAAEQEFVSHLAEQDPAEK
RRLMVDLYKRVIDGVGQLGFPLSVHYEVAYGVSRPAFETLAEMLEYWSPD
QG
118472781YP_891132.1 Soj family protein [Mycobacterium smegmatis str. MC2 155]MGSGQNKGQGVVQKPNVSRETWDSATSTWVTDAAMDTPIAAEAEQATRVL
HSSARRQLPRPERQRVFTIANQKGGVGKTTTAVNVAAALALQGLRTLVID
LDPQGNASTALSIEHRPGTPSSYEVLIGEIPVEEALQQSPHNERLYCIPA
TIDLAGAEIELVSMVAREGRLRTALAELKNHNFDYVFIDCPPSLGLLTIN
ALVAAPEVLIPIQCEYYALEGVGQLLRNIEMVKAHLNPELSVSTVILTMY
DGRTKLADQVAEDVREHFGDKVLRTVIPRSVKVSEAPGYGMTILNYDPGS
RGALSYLDASREIAERGAPPRQQ
118472780YP_884777.1 hypothetical protein MSMEG_0364 [Mycobacterium smegmatis str. MC2 155]MGSPLKVAPGQLRSAAAEEVALGAAVAALGVGDLLSAAVAALPRLQSGKA
CGHAAVIVDAAVKAAADEVAAHADKLSAAAAAYEGTDGEQAHRLIRTMD
118472779YP_890614.1 phosphoribose diphosphate:decaprenyl-phosphate phosphoribosyltransferaMDATHMSEEAQPTAGPPKNLVSGLIKAVRPRQWIKNLLVLAAPLAAVGSG
IEYDYADVAAKVSVAFVVFCLAASSIYLINDARDVEADRAHPTKRFRPIA
AGVVPEWMAYSLAGLLAVASLVISWWLTANLAIVMAVYIAVQLAYCFGLK
HQAVLDICIVSSGFLIRAIAGGVAADIPLSQWFLLVMAFGSLFMAAGKRY
AELQLAERTGAKIRKSLESYTSSYLRFVWTLSATAMVVCYGLWAFSRDRA
NDLMTLDAQDASWYAVTMIPFTIAILRYAVDIDGGIAGEPEEIALKDRVL
QILFLAWIGTIGAAIYFS
118472778YP_885471.1 naphthoate synthase [Mycobacterium smegmatis str. MC2 155]MSSQAASDNPFDPAMWERVPGFDDLTDITYHRHVLDGARQPTVRVAFDRP
EVRNAFRPHTVDELYRVLDHARMSSDVGVILLTGNGPSPKDGGWAFCSGG
DQRIRGRTGYQYASGETAETVDPARAGRLHILEVQRLIRFMPKVVICLVN
GWAAGGGHSLHVTCDLTLASREHARFKQTDADVGSFDGGFGSAYLARQTG
QKFAREIFFLGRAYDAQTMHQMGAVNEVVDHADLEKAGLQYAAEINGKSP
QAIRMLKFAFNLIDDGLVGQQVFAGEATRLAYMTDEAVEGRDAFLEKRDP
DWSRFPRYF
118472777YP_886103.1 transposase IS116/IS110/IS902 [Mycobacterium smegmatis str. MC2 155]MAAHCEDSEQVVVGIETDNGLWVQALHAVGYRVYGINPLSASRYRDRHCV
SGAKSDAGDAKILADLVRTDRHNHRQLADDSSAVHAIKVLARTHQSLVWA
RTRHSNALRAGLSQYYPAALAAFPDIDGRDALAVLQRAPDPSAGATLSLS
KISSALKVAGRQRSIDARAREIQTALRSPQLHTSDQVVAALSASTTATVA
VLLVLNTQISELQTQLTDHFETHPDADIYLSLPGLGVILGARVLGEFGDD
PNRYTDAKSRKNYAATSQITVASGRRRAVIARHIKNRHLADAIDMWAYSS
LRASPGARTFYDQHRAAGDTHHQALRALGNRFIGILHGCLRHHTHYNEHT
AWARGIVNTCGSGCFRRPPFRRADRRLRAMLAG
118472776YP_884526.1 NAD(P) transhydrogenase subunit alpha [Mycobacterium smegmatis str. MCMIIGIPRESQPGETRVAATPQTVGQILKLGYSVVVESGAGAAASFSDAAY
ADAGAQIGSADAVWSADVVMKVNAPSEGEIAALRDGATLISLISPALRPD
LVEQLGTRNITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHAFS
RFFTGQVTAAGKVPPAKVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEV
ADQVASLGGEYLAVDDSGEVAEVSKTGYAKEMGEDYKAREAALYAEQCKD
VDIIITTALIPGRPAPRIITAEMVASMKAGSVIVDMAAANGGNVEGTVKD
QAIVTDNGVTIIGYTDLAGRLPAQSSQLYGTNLVNLLKLLTPEKDGKVVL
DFDDVVQRSITVVRDGEITWPPPPVQVSAAPAAQPAAAAPGVKEEKQPMS
TGRRLAVAFAAAAVLFALIALSPAALQVHLVVFALAIVIGYYVIGNVHHA
LHTPLMSVTNAISGIIVVGALLQIGHHNTAITALAFVAILLASINVFGGF
AVTRRMLAMFSRS
118472775YP_890100.1 hypothetical protein MSMEG_5873 [Mycobacterium smegmatis str. MC2 155]MNLGKTLVQVATAPVRIGIAIADAGLGIAGETLTAVQRTVTDSNPLTSRS
SLAQMLGLDDAVERANRLARLMDDDAPLGRALAPDGPVNRLLRPGGLVDQ
LTAEGGLLDRLTAENGPVTRAVAPGGLVDQITMEGGLLDRLTTDDGALSR
VIAPGGLADQLLAHDGLIERVLREDGVADRLLAEGGLLDTLTDPDGPLLK
LADVADTLNRLAPGLEALAPTIDALHDAVITLSQVVNPLSNIADRIPLPR
RYGRRSTTPTPVVSQRIVDADE
118472774YP_886171.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MELRHLRYFLVVVEEGSLGRAAARLHVAQPSLGRQMTDLEHQLGQRLFER
AARGMRMTPAARALVAHAREIIRLADASREVVASGVPRERVSLGVGPTVD
ADWLLAVVEAAKAQSPHLTLRIDEMLSGELVNGVASGELDVAVSSRRPGD
QLQSVLLWTEPFGLAISPSGRLKGLDGVAHGDVDHARVLAFAREQTPPEH
NEAIREIQTESPRVRWEFARFSTSAYANARAVDADAILCGEAAARRLPAT
WRWLPLGRLRTEMHAWLTWRPGSGDGVLQLVELIKGIAPPSGARLGSRAP
MT
118472773YP_885989.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMKYTPGWQPTPVDWASTRGRILLAASQLFAARGYFGTSTRDIADAVSIRQ
PSLFHHFTAKQEIFRTLVELDLGPSIDRVRQRLAEESTWAEKLHLTVACD
VREILAQPFDARGLYQDAVLAMPEFDEERRGIDLFHDLVETLIRSGTDAG
EFVDFEASFVLRAANGVMFETLREQGGPAGRMRVQRPLQAADFVLRAVMV
DPTDLPRIRAVTENRLVKGVLPAGR
118472772YP_887083.1 RNA polymerase sigma factor SigB [Mycobacterium smegmatis str. MC2 155MANATTSRVDTDLDAQSPAADLVRVYLNGIGKTALLNAADEVELAKRIEA
GLYAQHLLDTKKRLGEARKRDLQAVVRDGEAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAEESGIPVEK
INDLLEHSRDPVSLDMPVGTDEEAPLGDFIEDSEAMSAENAVISELLHTD
IRYVLATLDEREQQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERE
VMAKLRNGERADRLRSYAS
118472771YP_888963.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MASDVRAVWPVLVGVGLLAGAVAAGIGALALADALTATGLPNPGPVTTYG
LPFVRAAGEIAAVIAVGSFLFAAFLVAPQENGVLDVAGYRALRLGSAASA
VWTVCAAMLVPLTISDVSGQPVLEHLSPVDVWSATSLVDIAGAWRWTAIL
AAAVTIASLPVLRWGWTPVLFAGSLVTLVPLALTGHSSSGGAHDLATNSL
FIHLVAGAVWAGGLLALLAHAMRGRAGEGAATALAARRFSALALWCFIAM
GVSGVINALVRMSPADLFRTSYGWLIVGKIVALVVLGALGFLQRRSAVSA
LQADPTARGPLIRLALTEGAIFGVTFGIAVGLGRTPPPPIKRIPSAAEVA
IGYDFAGPPTVARVLFDWRFDLLFGTAAIVGALVYLAALYRLRHRGDAWP
VGRTVAWLLGCATLLFTTSSGLGRYMPAMFSMHMIAHMLLSMLVPILLVL
GAPVTMALRALPAAGRGQPPGPREWLLAALHSKISQFFTNPVIATVMFVV
GFYGLYFGGIFDAAVSNHAAHVMMNVHFLLSGYLFYWVVIGIDPTPRPIP
HLGKIGMVFASLPLHAFFGVVMMGMKTVLGEPFYRSLQLSWHTDLLGDQK
LGGGVAWAAGEVPLVIVMLALLIQWRRSDDRTAKRLDRAADRDDDADLAA
YNRMLAHLARRDNPPQ
118472770YP_887491.1 RarD protein [Mycobacterium smegmatis str. MC2 155]MSGSNRTGVLYGAGAYIWWGLCPGFFLLLLPAGPLEVVAHRIVWSTVFLM
LVLAFARRLGDLRRLSLRTWLQLLAASALISINWGTYIFAVTSGHVVDAA
LGYFINPLVSVALGVIIFRERINRWQAVSLALAVIAVAVLTVEVGEPPYI
AVVLAVSFGVYGLVKKVVQADPRVSVAVETLLALPVAGGYVIVLEVLGRG
HFIAESPWHPVLMVLSGVVTAVPLLLFAAAAQRLTMVMMGLLFYLNPALQ
MLWGVFIGHEPMPLGRWIGFALIWTALAVMTIGTLRNRRSDAVADAAQTQ
PTLP
118472769YP_887930.1 urease subunit gamma [Mycobacterium smegmatis str. MC2 155]MRLTPHEQDRLLISYAAELARRRRARGLRLNHPEAVAVITDHLLEGARDG
RTVAELMVSGRSVLTRDDVMDGVPEMLHDVQVEATFPDGTKLVTVHQPIA
118472768YP_887738.1 peptidyl-prolyl cis-trans isomerase domain-containing protein [MycobacMSSSVAIAACAASLAMTLAACGSDSDTASSSTSPAGSSTVAELVTSSSTE
TAAPAASTCPTAAPQDAAAPEWTLSGATGSVEVTGSTDAAAPVINVNGPF
SVTETQVKTLQPGEGPVVADNATVLVCYMGVNGRDGTVFDSSYERGAPVD
FPLNGVVAGFQKAIAGQTVGSTVAVAMTSEDGYPNGQPAAGIEPGDSLIF
AIKILDAAS
118472767YP_888480.1 hypothetical protein MSMEG_4202 [Mycobacterium smegmatis str. MC2 155]MTAQIAPLVFDAEGHPDPMTLTDLEQRLPGLTDLVIFSHGWNNDEAAATL
LYDRWFRLLAPHLDPARNVGFVGVRWPSTLWRDEPIPDFPATPAGGAEGA
AALGGAREVAADSDAGNPALDPQELAELKQLFPTAEQQLDTLAALLAQPP
DVDAVPDLFEALQDFHKATPDGFDDGETEDTQDGPGMVADDQDPAELFNT
FADQLLSAGVQFGDDGTGAAGLGDFAGKLWRGAKEALRQLSYWKMKNRAG
VVGKNGLGPVIDKLARSAPGLRIHLVGHSFGARLVCYALAGMSGAQPSPV
KSVTLLQGAFSRFSFIDRLPFRDGAGALAGLLGRVDGPLTVCFSRHDRAL
STFYPLASAAVGDDAAGLDDPLFRWRAMGSHGAFRSESLGLGAVGAQYPF
EAGKILNLDASEVVKADAGPSGAHSDIFHDELAWVVATAGGLN
118472766YP_886691.1 phytoene dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSRAIPGPTDHVVVVGAGLSGLSAALHLAGRGRRVTVVEREPWPGGRAGR
IDTGGYRIDTGPTVLTMPDILDDVFAAVGESVGDRLQLLPVDPAYRAQFA
DGSALEVHSDADRMAAAIADLAGPSEAAGYRRLRDWLTRLYRIEIDGFIG
ANFDSPLSLLTPQLAQLAAIGGFGKWDHMVRRHLRDPRLQRVFTFQSLYA
GVSPQRALAAYAVIAYMDTISGVFFPKGGVRAVPDALAAAGADAGVRFHY
GATVNCLERSADRVTAVHTDTGERIPCDAVVLTTELPRTYELLGRTPRRP
RPWRASPSAVVVHVGCRRIDRPVAHHNILFGDAWHDTFTDIIDDGRLMRD
PSLLVTRPTRGDPALAPAGRDLLYLLAPTPNLSSTAIDWETEGPAYAQRV
VDTVAERLLPELRDDAQVLQVVTPADWARQGMVAGTPFALAHTFSQTGPF
RPGNTVRGVANAVLAGSSTVPGVGVPTALLSGRLAADRVTGTVRRTRTHH
DINSVTAATADRKARMP
118472765YP_888680.1 ECF sigma factor RpoE1 [Mycobacterium smegmatis str. MC2 155]MTSQHTAGTEPAPAANDTELSARFVNETLPYMSQLRSRARRLTRNPVDAE
DLVQETMLRAYTGFGTFREGTNLRAWLLHIMTNTYISGLRRARRRPSEYL
CDHTSDHQMAAQDRRSQSAELDALDALPNIELAGALATLPEQFRLAIYYR
DVVGLRYREIAEIMACSEGTIMSRLYRGRRRLRLLLAAGAT
118472764YP_890478.1 ammonium transporter [Mycobacterium smegmatis str. MC2 155]MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAVV
GLLWVLFGFSMVFGTSYGGFVGSFTEFAGLTDLLEPMTTVDGLPVSLFAV
FQALFAAITVALISGAVADRMKFGAWMVFAAFWAVLVYFPVAHWVFAFDG
TVTEDSVGGWIANRLGAVDFAGGTAVHINAGAAALALAIVLGKSAMFGRR
KPHNVPLTLLGAGMLWAGWYAFNGGSALSAGNSAAIVMVTTFVATCAAVL
AWIAVEKVKTGHVTGVGAASGAITGLVAITPACGAVTPIGAMFVGGIAGA
VCVYAVGLKDTFGYDDSLDVVGVHLVGGLIGTLLIGFFASEGMPNGVNGL
FYGGGIDQLWKQAVAAGAVMIYSFVLAYVIAFAIKKTMGIRISPDEEEKG
IDAKFHRDAAYELEFA
118472763YP_890425.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MGSAERFQRLLGDRYELRGVLGRGGMAEVRDGWDTRLARPVAIKLLYPAL
AADADLRARFEREARAAAALTHPHVVAVHDCGEHAGTPYIVMERLSGATL
ADEIAAGPLPQERVAELLDQILSALIAAHAAGIVHRDIKPGNILIGHTGQ
AKLADFGIAKTDGVPHTQAGQILGTMAYLSPQRVTGQPAGFADDLYAVGV
VGYEALTGRRPFDRDNPAAMVRAILDDVPVPIASVRSDVAPGLIHVIDMA
MAREVAFRYPDAATMRAALTGAEPPTQRVGRRQTKVLAAPLPPIPPPPVL
PSPRHWRTRLILAVLGIVSTLILVLVLALARGSSGLTSPTSTPTATTVPP
ATSAVVPPPVPSTPVPAAVPEEPRGPGRGPGPGPGPGKGKGHEKGHGPKG
PKGPPHP
118472762YP_888492.1 phosphoribosyltransferase [Mycobacterium smegmatis str. MC2 155]MSAWSVRHDAIRTFQDRREAGRVLAQRLSSYRDDPDVLVLGLARGGVPVA
WEVAAHLRAPLDVFLVRKLGVPQWQELAMGAVASGGGVVLNEKLMDRLGI
SDDDMAETLRRETIELERREQAYRGDREPLQVAGRTVILVDDGIATGASM
MAAVRAVRGARRVVVAVPVGPPGVCRELAAEADDVVCASMPQDFEAVGQA
FADFHQVSDDEVRELLATPTTDPVR
118472761YP_885413.1 alkaline phosphatase [Mycobacterium smegmatis str. MC2 155]MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGG
ARRIDGDQTDTERSAINGGKARNVILLVGDGMGDSEITMARNYEKGAGGS
FDGLDALPLSGQYTTYALNKDGKPNYVTDSAASATGWTTGTKTYNGALGI
DIKGNPQKTILELAKAQGFATGDVTTSEIQDATSASLFSHISERDCYGPV
QTAADCAADALENGGPGSVTEQLLTTRPDLTLGGGAETFSQTANGGEYKG
KTLEAQAKERGFQIVRTASELDAVTAADQDNPVIGLFADGNMPVRWSGPP
AVRHGYLQPAAKCTDNPERGSEVPRLAAMTQKAIDLLKNGKAGQDKGFYL
QVEGASIDKKDHDADPCGQIGETVDFDEAVQTALNFAREDGNTLVVVTAD
HGHSSQIVEALSEDDLRDIAEDTKQPVERVRDTMYPGLTRKLVTADDAEM
TVSYGTSADVDVESETHTGTQVRVAAFGPRAANVVGLTDQTDLFFTMTDA
LGLDRGEEPAH
118472760YP_890335.1 inorganic pyrophosphatase [Mycobacterium smegmatis str. MC2 155]MEFDVVIEIPKGSRNKYEVDHETGRVKLDRYLYTPMGYPTDYGFFENTLG
EDGDPLDALVLLTESVFPGCVVEARPVAMFKMTDEAGGDDKLLCVPAGDP
RWDHIQDVGDISQFELDAIKHFFVHYKDLEPGKFVKTADWEGRAEAEAEL
QRSVERFKSSGH
118472759YP_885688.1 guanine deaminase [Mycobacterium smegmatis str. MC2 155]MTTYRGHLIHIGGAPRLADAAQCLVSEPDGAIVVDDTGRITYSGPFDRRP
SGDAVVDVRPAFLLPGFVDAHIHFPQTYCTDSYGGGQLLDWLSRCIFPAE
VKLADPAYAQRVAQDFCRRRISVGTTTALVFGSAFPHAQDALFRESIRTG
LRTISGRGIQTVGPPSAEPLLTDEATAISLVTEEIVRWHAADTGDPATAL
VHAAVVPRFALSVTTQTLHALGELYDSVRDRGVYFHTHLNENVDEVAAVR
ETYGVQSYLDTYDSIGKTLLGPRSVLAHAVHCTRDELARMADTGTSIAHC
PSSQLFLGSGVMPWRATVGSGVNVALGTDVSAGDEWLIPRVLNDCFKVHM
SEPGDQAVALHPAELLFTATLAGARALALEDRIGNLDAGKEADFVVVDAR
RQELLVESLSQIDEYDRAAQLFTLLMGMREEAVSQVYVKGRKLN
118472758YP_884921.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MSIKRTDRMREVLSLLRERGEVTSQVLCTELRISAATLRRDLSELEEQGL
LVRTHGGARAVDPSDSEIPVRLRDHRMVAIKRRIAQHAAALVPPGQQAVA
LTGGITTGEVARALRGRPQITIVTNSLTIAADCAVDAHMKVIMTGGVVRS
KSLEAVGPMSEHAFQVITVGTAVLGADGMSAGIGATTFDEGEARTAIAMA
SNAQRVVVAVDGSKIGKVTLAKMVPLDQIDHLVTDSTADHAELDRITAAG
VQVHVVDVSDG
118472757YP_888541.1 hypothetical protein MSMEG_4264 [Mycobacterium smegmatis str. MC2 155]MTSPFAELNTTDRILAGACAVAWLAALGAGVAALVALVDLGRGHTQAVES
TETPWLLYTVIGISVLVIAAAIPLLLRARAQADSRPPARSQGPRREPVAP
RRVGYTAPTYRQDAVATAFVEKVWLRFVLSVTCALGVATAVIGLGTYLLA
TDHSTAAWCAYGLAGLVTLGMIALPIIAIRELDRSAA
118472756YP_886897.1 hypothetical protein MSMEG_2560 [Mycobacterium smegmatis str. MC2 155]MSDSYYELLDAADTLGERFAATDMVRGTWSAAIQHAAPASALLVRALEHC
EPRAETRLARVAIDLMGGVPSEGDLWVRAEVQRPGKQIELVGAEMLATGP
DGEPRTVARASGWRMLTLDTSTLQHTGVSPLRPLENARSHDMAKNWEPNY
VHSIDWRWLTVPLAPGPGESWLRPTVDLVKGEAMTPLQRLFAVADDANGI
GSKLDIRKWTFLNTDLVVHVHRIPEGEWIGIRAETSYGPDGIGTTVGTLF
DFSGAVGAIQQSVLVRPRPPRS
118472755YP_890982.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MSTSLVHTDVADGVFTLTLDAPDTGNALDVAMTNAVANALERANAMPDVH
CVLIRSSGRHFCTGGNVKDMARGTDLMAGTAAEVQHRLRAGLHRITRALH
GLEVPSVAAVNGAAVGAGFDLALMCDVRIAAQSARFAESFLRLGLVSGIG
GAWFLTRIVGVAKAMELTLTSEFITAETAHELRIVSRVVPDEDLDQECLA
LAHTVAANPPQALRMAKRLVRESAESGLPAALEMAASMQAILLCGDEHRS
RVQQFLAARN
118472754YP_885217.1 hypothetical protein MSMEG_0813 [Mycobacterium smegmatis str. MC2 155]MSYRAVYLGIAGAIVLAIGLYLMSMTVYLDDFDRYGMQIPCGTAFSEHLV
QAEAAGAEYVDKCGSALMTRRLWTMPVVAVGALALIAVLLRAATSSAHES
LIPKRDSH
118472753YP_889409.1 glycine/betaine ABC transporter periplasmic protein [Mycobacterium smeMTRPIRVGHIALSFHDAAAEQVELVLRSAGHEIERRSAPHELMFDAIGRG
EVDLLVAAWLPWSHGRYFDPIADHVRMVTVLYEPYPIWGVPEYVPAQVAS
IPDLLAAPAADHMERLIQGMAPGAGISEMSPRAIETYGLDDAGYHFAHGT
EDECIGRFVDAVAQRRWVVIPFWHPQALHKRFRIRRLQDPRLVLGATDNA
TLLVRKDSESLIGAAALADLARLHLGNTMLDELDEAVRKRSTTPYTDYSG
118472752YP_886213.1 hypothetical protein MSMEG_1844 [Mycobacterium smegmatis str. MC2 155]MERMMPDWESIFVPAAPPAESVVRGTVTFLVLLVLIRAVGQRESGGLGLT
DVLIIVLVAQAAGPALSPAHATLTDGIVVVVTVLFWSVAVDGIAYRFPGF
ARLAKARPKLLIADGELNTHVMRREFMSRDEIYSHLRLHGIEDMNRVRRA
YLEPNGMISVLVDSPTRGDDDTGH
118472751YP_889780.1 hypothetical protein MSMEG_5543 [Mycobacterium smegmatis str. MC2 155]MAMAEPAPPPCVNADGTPCSDIGTAGPGGATGQIPGGPGGTAGPGGASGA
IPGGPGGAAGPDGATGSIPGGPAGTAGPDGATGVIPGGPGGTAGPGGASG
CIPNVGCATIPAP
118472750YP_887725.1 inner membrane metabolite transporter YdfJ [Mycobacterium smegmatis stMADQHPSAEAARGSDDPEYARNLKRATLAASVGSALEYYDFALYSLASAL
IFGEIFFPALGASAGTVASLATLAIGFVARPVGGLFFGALGDRLGRKWVL
MLTIALMGGSSTLIGVLPTGEQVGALAPILLVVLRIAQGFGAGAEQAGAT
TLMAEYSPVRRRGFYSALPFVGIMLGTLLASAVFVGLGQVPDDALLGWVW
RIPFLASIFLIGVAVLIRLRLKESPTFVTLEKRDQVSQKPFRELLQSSRP
TVWRGIGLRMAENGGSYIYQTLSITYVSALGVQKSVGPLAVAIGAVIGFF
VIPFAGSLSDRFGRMRVYRVGAVIQLVLAAVAWPLLSLGNPVLTVVVIAI
AYGVGVNVMLGAQCAALPELFGSRHRYIGVAVSREFSAIIAGGIAPFVGA
LLLSWFNNSWVPLAAYVIILTLITLYATLRTPETRARDLTLLTNADGDSE
SEIAARPEPLAQSYRNDAAAVVGR
118472749YP_885135.1 hypothetical protein MSMEG_0729 [Mycobacterium smegmatis str. MC2 155]MTGIWSSVLTELIPLAMVVALSPLSIIPAVLVLQTPRPRPTGLAFLGGWL
VGMAALTALFIEVSNLFGRLDKPPVWASWLRIVLGTALIIFGVYRWLNRS
KAAHTPKWMQSMGKLTPPRAGVTGVVLTIVNPKVLFICAAAGLAIGSAGL
GQPQVWAAAIWFVVFASSTVALPILAYAVSGSKLDPTLARLGEWMERQHA
VLVAVILVVIGLLVLYKGLHAL
118472748YP_890042.1 hypothetical protein MSMEG_5814 [Mycobacterium smegmatis str. MC2 155]MTTPDTERLERGKRAFADVMTFPAPDDFSPAMTHLLDFVFAEVWQRPALT
RRQRRFVTLPCVAAADAEGPLRDHVYAALNSGDISIVEMRETVLHFAVYG
GWPKASRFNSAVDEQWARIHDERGLAVPAPEPLLPLTTPSDPEERLAVGE
QSFKDINCLPYAPMRDNPFQGAGILNFVFGEMWLRPGLGMKERRLITVAC
VAFQDAPYPILSHVYAALKSRDVSFAEMDELALHFAAHYGWPKASHLNQV
IDDQKRRVSDEWAAEPQVAS
118472747YP_888221.1 hypothetical protein MSMEG_3932 [Mycobacterium smegmatis str. MC2 155]MTKLPERSRARSLFPEMSDFFAGLPSWASIRPVFGDHIIRIEDEMKDGGY
ELRAEVPGIDPAKDIDITVRDGVLTIKAERTEKKETNGRSEFAYGSFMRS
VTLPPGADEDAIKAGYDKGILTISVPVTEPEAAAEKRVAVETVSP
118472746YP_885565.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMSNQIAATDLAACCPPGALLREPLSAAEAADMSVKLKALADPVRLQLFSA
VASREGGEACVCDIAAGVEVSQPTVSHHLKVLRDAGLLTSQRRASWVYYA
VVPDALASLAVLLGADLRAEVTA
118472745YP_888669.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMELRHLTYFLAVAEELNFARAAENLRIAPSPLSRAIRELEKELRAPLFDR
GTRHVALTTAGVALVPKAQEILSQVAALRQVTSHSARTRAELTMGVRAVP
DTLRRTLIDDVFHAVDAEATVEIVARRTEDQYRALLRGEFDFGVTVGLPD
DPRIDYLEMMTETYGIAVPDIEPYRSMEIVRPEDISALTMIRHDQEHVLD
GFEPYYRSAAQSTSVTNDIVGEMHALVAAGRHCCFAVLNPDAPWTRLVSG
DGVVIRKLTAQPYVTTCLTWLARRSGEDDLGAYIARATERFAEPLRL
118472744YP_891039.1 Fatty acid desaturase [Mycobacterium smegmatis str. MC2 155]MVITAPSPLHRLSEQDLEKLAKEFDAIHDEVFAELGERDRHYIKTVISVQ
RQIIVAGRVLLLASRSRTAWVLGTACLSMAKILENMELGHNILHGQWDWM
NDPDVHSSVWDWDTASSAKAWKHSHNYIHHTYTNILGKDKDLGYEIMRID
PHQKWRPGNLGQPLYNLLLMLLFEWGVAVHDTDIEGLIRGQKTFADLKDD
FKEIGVKARQQIVKDYLGWPMISAGAFALAQLALRGRLPRPPHSRLGNRL
RRITGNRRVGTVAGLLDRHVAGVESTYLRTLAANALANVIRNVWAHAIIF
CGHFPDQTWTFTEEEVENETRGGWYVRQLLGAANIEGSPLFHIISGNLGY
QVEHHLFPDMPSSRYAEIAPKVKDICERYELPYNSGPFGHQWFTVQRTIF
RLAFPGGTPRPKPGPYRSPDREHAPKGPSEAARFRGRVPAEHPDAGPEHA
SGGVAVQLPPRGND
118472743YP_884529.1 taurine transporter permease TauC [Mycobacterium smegmatis str. MC2 15MSVFVDIVPGSETDSPRPAAPSNRGRAILTKALLPLLSVAVFFAVWQAVA
VAGIWNQTFVPYPSAVWRAFIDLSTTHDGVRGYAGYLLVEHLYMTLRRVV
AGVVIGVVLGVLLGLLMGSVGWLRSVLEPWLTFLRALPPLAYFFLLVIWL
GIDEAPKITLLALAALPPAAVATTAAVVAAPVGLQEAARALGATRAQVIR
DVVVPSALPETFTGIRLAVGMAYSSVVAAELFNGIPGVGGLVKDASNYNN
TPVVLVGIFAIGFSGLVIDGLLRAVERRAVPWIGKV
118472742YP_885246.1 monovalent cation/H+ antiporter subunit G [Mycobacterium smegmatis strMNIPDIITGVLILGGSTLALTAAIGIVRFPDTLSRMHAATKPQVLGLLLV
IAGAMIRLRGNADVGMLVLAGVFTIITAPVIANRVGQLAYREQNIRDDLL
TRDEMAELGETDPHRRR
118472741YP_885582.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MALSQGAKIAGYTVERMLGSGGMGEVYLAQHPRLPRHDALKVLRANISAD
PAYVERFNKEADLAAKLWHPHIVGIHDRGKHRNRLWISMDFVDGTDASRL
LHDRYPDGMPVPEVLDIVKAVAAALDYAHGRGLLHRDVKPANILISDGDH
GERRILLGDFGVARDLGDSAGNGLTATNMTVGTAAYAAPEQLMGLELDGR
ADQYSLAATAYHLLTGGPLFENSNPAVVIGQHLNAPPPALGDSRPELAPL
DAALSRALAKNPDDRFATCTDFANALEHPQNHAATMTAPVPSPNDVPTML
APVAVPYPSGPAAPPPPNGSRYRRVALAAAAAAVVVAVVAAAALLIKPTE
EAPSAEPFSIAGTLQLPPDVVKTNGLPSGFMCAGTSDYGDIGPETPITVE
NESGELLAKGAIESSSKGGNGCFLKFRVDDVPSGARFYRVHVAQRAEMSY
TEEEAKAGIQFLLGTVHDEPTPTTTAPPAKASPPPTATRTVTVTPKAEDT
SLQRLRALANNDRPYVAAILADQWVPQISSKRAGLVADGVTWDNARILDQ
HMRMRATYPDVRLLWSGDWSTYDGRDFWVTIVGLTSDNPGEILAWCSSAG
FDRDNCAAKVVSTWRPIAGSTKYN
118472740YP_890527.1 hypothetical protein MSMEG_6308 [Mycobacterium smegmatis str. MC2 155]MNPDPNAHNARRSRPHHLRTLVARAVGIETARSTGPV
118472739YP_887203.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MLASTRSHALGDIPRRSARRCPDKVAIIDGDVTLTFAEFEHHVDRAAAAL
QDNGFGVGDRVAVLAHNCWQYAVLAFATARAGVVLVPVNFMLTAEEICYI
LGHSRAGGFLVEADLVPTAEAAMRLGGSVTTTAALVLPGQGLPAGWTDFD
RWLQTDSPAPAPYVADDQMIRLMYTSGTESHPKGAMHSTRSLMGNYISSI
IAGSMEGTDIEIHSLPLYHCAQMDNFFITDIYLGATSIILPRPEPELVLR
TIEKYGVTNYFAPPTVWISLLRSPVFDQVDLTSLRKGYYGASAMPVEILA
EMRERLPNLRLWNFYGQTEMAPLASALGPDEQDAHAGAAGRPVINVETAI
LDDDNRPVPPGEVGEIAHRSPHLMLGYLDDEAKTAEAFRGGWFHSGDLGY
YDEHGLLHVVDRKKDMIKTGGENVASREVEEAVYRHPAVEEVAVFGLPHP
TWVEAVVAAVVTRDGAELTEDELLTHCRSCLAGFKTPKQVFFVESLPKNP
SGKLLKRVLRERFARTTTDAI
118472738YP_887152.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118472737YP_888789.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMPFSGYPVAMSTTRPAIAPKSAHQAVSLPPAQRLLNTASELFAGQGIRAV
GIDLILREAGVAKASLYSTYGSKDALVIAYLTNLDHADRNRWEQTVAGVE
DPVQRVLTFFDLASRNAARRDFRGCLYANAATEYPGVELEPVRAHRAWLR
STLAGLLKQAGVGSPVALARRIQLLYDGALLGSKLERSTKPITAARDLVE
ELIELGRR
118472736YP_885276.1 hypothetical protein MSMEG_0873 [Mycobacterium smegmatis str. MC2 155]MLFSPGAPREAYFVGFEHLADLTGEERARWFIAHDNFFIWGTSESRCITT
VSGCRR
118472735YP_886542.1 allophanate hydrolase [Mycobacterium smegmatis str. MC2 155]MTGKIDEIYRRIEQSGRSEVFIHLRPRDQVEADHASATSGPLAGLVLAVK
DNVDVAGLPTTAACPGYSFVPDTDAPVVAVLKAAGAVVIGKTNLDQFATG
LVGTRSPYGPVRNAQRPEYISGGSSSGSAVAVALGFADIAIGTDTAGSGR
VPAGLQGIVGIKPTLGVVPNTGVVPACASYDCVTIFAADLPTAQAAMGVM
ATAEPHRAWPADLMLAAPPAPRVAVPAQVPELDVAWQAAFTEAVQRAQAA
GFETVPIDMTPFFAAADLLYNGALVAERWDAVGEFIESAGPGAGLDPTVS
AIISAAGRHSAADLLRDRRRVEHLRDEAFAALAGCDALLVPTAPEHPRIA
DVAADPIGVNARMGRFTNFCNLFDMCAIAIPAGTTSDGAQFGITLLAPAF
GDAVVADLAARFLAVPAAASWAEAATEVTEIAVFGAHLRGQPLEHELTGR
GARWGGPVVTAPHYRLFALDTEPPKPGLVRVDSDGSAIEGERWVLSPAAL
GEFLAELPAPMLLGKVELSDGRWVTGFGCDHAAPAHGRDITEFGGWLRAQ
SALSAR
118472734YP_884613.1 nudix hydrolase [Mycobacterium smegmatis str. MC2 155]MPSDHDASDLIRRQALTLLAVAQNGLTFAHDPFDRQRYTQVRRAAEELMT
LIADGDIEQLRAAFSVDTGYMTPKVSVRGAIFNSEEELLLVQERADRLWT
LPGGWCDVLETPAQAVAKEVREEAGLIVDVDKLVAVLYHDRHRPSRQPAP
LFHVHKLFFLCHERGRVPADLTGTSAIDWFALDRLPPLAPSVDEAQLRMM
HTHWRHPELPTVFD
118472733YP_887422.1 hypothetical protein MSMEG_3107 [Mycobacterium smegmatis str. MC2 155]MFHPRVVLASCPALPEGDGDDDGLVAALRHRGLHARWLSWDDPETLDADV
VILRATWDYTERLPEFLSWTRSVRNLLNAPEIVEWNTDKRYLGDLARLGV
PVVPTAFFAVGEEVQIPAGPGGRLDGEIVVKPAVGAGSAGALRFSDRVGA
LAHAVALQGQGKAVLVQPYDPRIADGETALVFLGGEESHAFTKGPLLPPP
GQSPAFDPSGTYAEETLWPADPDEQVWRVGRLAVWAVTRLFDIEPEDLLY
ARVDVIGGRDDPRLLELELVEPSLGFRQLAADARAGAEREFALGVERALQ
RFGLGPLSHRST
118472732YP_886698.1 hypothetical protein MSMEG_2355 [Mycobacterium smegmatis str. MC2 155]MLVMSMRAASVLIAADEATSRPDRGAKRYTLLLTTDPDLIDAAQRLRHDV
FTSEPGYALAGSTDGRDADRFDEYCDHLLVRDERSGELVGCYRMLPPPGA
IAAGGLYTATEFDVTALDVLRPSLVEMGRAVVRQDHRNGAVVLLMWAGIL
AYLDHAGYDHVTGCVSVPVAGAAGEAPGAQIRGVRDFVRRRHAAPYTVHP
YRPVVLDGRTLDDIAPPERVTVPALMRGYLRLGAQVCGEPAHDPVFGVGD
FPALLDKRQADVRYLRRLRSASAAAHMTDGAA
118472731YP_888545.1 cytochrome C oxidase subunit 2 [Mycobacterium smegmatis str. MC2 155]MTPRGFRVVALSIVLGGSALLLSGCSWSDALALGWPTGITPEAKLNRELW
IGSVIASFAVGAIVWGLIFWTSAFHRKKATDTELPRQFGYNMPLELTLTV
IPFLIISVLFYFTVVVQERMMHKDPNPEVVIDVTAFQWNWKFGYQKIAFA
DGSFDYDGADPERKEAMTSRPEGKDEHGIEKVGPIRGMTPEDRTYLNFDK
IETLGTSSEIPVLVLPAGKRIEFVLNSADVIHGFWVPEFLFKRDVLPEPK
ANNSDNVFQVSEIQQTGAFVGRCTEMCGTFHAMMNFEVRVVEPNDFKAYI
DQRNAGKTNAEALAAINQPPLAITTEPFESRRGELVPQASK
118472730YP_886466.1 hypothetical protein MSMEG_2108 [Mycobacterium smegmatis str. MC2 155]MTDLIVRKMRFAFADHHVPFLWNEANPAFSSMANAVSFLAIAFEKMIGHM
ITEAMPHITDPEIAEEAQAFVRQEGQHSMAHRQHAKGLIKSYPALKETLA
EVVKAFDDLTADTPLKYRLAYTADLEATFTPVFKLMLDHDDTLFAPGDDR
VASLFLWHFVEEVEHRSSALIIYDAVVDDPWYRMRVAPSVFKHVWGVLRL
ACEGFNKHVPVSERGVDAMSMFGMQARRKKLMQRLPFLAAPDDGPIANAF
GHLPVRDMLVALVGVVRSQIPGHDPAHEKLPALADEWFARYETGYDVTQW
YTAGEKADVANV
118472729YP_889379.1 hypothetical protein MSMEG_5133 [Mycobacterium smegmatis str. MC2 155]MVNVGHNGDVAKIWVRTHSVILAGSRADHENERAPSR
118472728YP_884820.1 hypothetical protein MSMEG_0407 [Mycobacterium smegmatis str. MC2 155]MRRIAVWGTGNMGSTAIRSAVAFPGLELAAVITSSQDKVGRDAAMFAGLA
EPTGVTATDDVDSALGACDAVAYMASGDIRPEEAIADIERCLRSGKHVVT
PALYSLYDPRSAPEHWVERLTDAATAGNATLLVSGVDPGWANDALAVTAA
GLCTRIRSIRCQEIFDYSTYDQPYAVRVLCGFGTPMGPDDPVPMMLLPTI
PTMVWGGNVRMIGRGLGLQIDDITEKVERLPLAQACENVLGRFETGTQGA
FRVQVIGWADGVERVVIDHITRIDPACAPDWPQPDQGAGDHRVLIDGDPQ
LSIVVRADVPGGTRADGGNTTAANRLLGAIAWLAEQKPGIYDGLDVPLHP
PLSAEAEATRWA
118472727YP_888315.1 hypothetical protein MSMEG_4029 [Mycobacterium smegmatis str. MC2 155]MAAPAPRVDEPAPLALANTLWIDRHGVHDALADKDYVQAWIRAVGKRLDV
RPAPGSTDGLRLEAVGRLIEVRDAFRRLAAEATGDSRDLVASPVPDVATA
VSLINAASAAETVWPELRFQRRRGLARQDAWSGDAFAEAVITVIARQAIE
LATSPRWEMLRACEAPACAYFFIKEHRREWCSALCGNRARVARHAQRQHN
R
118472726YP_887715.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMARPRDDSITEAVVDATRQLCGEIGYRNLTMEALAARAGTTKPAIRRRWP
SLRHVVVDAMTRDNVSMAVPDTGSTRSDLIVLVEELRVSMGDVMLGRILP
ALVVDLSDDGDLRRRFLDSVWRPRRERADRILRRGVERGELRADLDFELA
QDLLAATVIYRFLFAHADLDPALSEHIVDYVLRGIAAGPTESS
118472725YP_885165.1 adenylosuccinate synthetase [Mycobacterium smegmatis str. MC2 155]MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
FALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELKGLEDRGVDTSNLLIS
ADAHLLMPYHVAIDKVVERWAGSKKIGTTGRGIGPCYQDKIARIGIRVAD
VLDEQVLAEKIEAALEFKNQVLVKIYNRKALEPAEVLENLLEQAEGFKHR
IADARLLLNQALENDEAVLLEGSQGTLLDVDHGTYPFVTSSNPTAGGAAV
GSGIGPTRITTVLGILKAYTTRVGSGPFPTELFDEHGAYLAKTGGEVGVT
TGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLETVPVCVGYTVD
GKRVDEMPMTQSDIARAEPVYEELPGWWEDISGAREFEDLPAKARDYVLR
LEELAGAYVSCIGVGPGRDQTIVRRDVLAAR
118472724YP_889356.1 hypothetical protein MSMEG_5108 [Mycobacterium smegmatis str. MC2 155]MTTIGSPTRYRILQIALVAVGVAMILLYPLAVVWPSGWAWHSGPPHESNY
FMMIVGLYVTLGAFLINAARHPEANVSLIWFAVCSSVVHAVIMAVQSFGS
GHHMGHLWGDVPALLVAAIILAVLMKAPGRQT
118472723YP_885189.1 acetate kinase [Mycobacterium smegmatis str. MC2 155]MTVLVVNSGSSSLKYAVVRPASGEFLADGIIEEIGSGAVPDHDAALRAAF
DELAAAGLHLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLA
PLHNPPAIKGIEVARKLLPDLPHIAVFDTAFFHDLPAPASTYAIDRELAE
TWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAG
GKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNR
RSGVLGLGGASDFRKLRELIESGDEHAKLAYDVYIHRLRKYIGAYMAVLG
RTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSAKSDEPRLIST
PDSRVTVLVVPTNEELAIARACVGVV
118472722YP_887271.1 transporter [Mycobacterium smegmatis str. MC2 155]MSIPNDHLVDVAIRQEHRAQHRFRTLLGAGVGNTLEWYDWSVYAIFAPFF
AHQFFVGDGGTGAMLSTLAVFAVGFLMRPVGGFLFGWLADRRGRRFSMTT
SMLLMAAGSLVIGVAPVQADVGIWAAVILIVARLAQGLAHGGEIAASYTY
IAEVAPPARRGLWSTSLYVSVTAGIVLASVIGAAASSILGADALAQWAWR
LPFLLGGLLGVVGLYLRRSLPETEAFLAEDTGPAQQPATTRDVIRGLRSH
KASLARMVGFSLASTVVVYTWAIGISGFAISTRGVPAGAALWATVAANLV
FMATLPLWGKLSDRYGRRPVFITYSIAFMVLSFPLLAAIDDSPVRLFLIV
SVALFFLGAFVGIMPAYFAELFPTHVRASGIGVPYSFTVAVFGGTAPYIA
TWLASHHLEWIFALYSVVLAAIGLVTTLLSPETRGRNLL
118472721YP_886204.1 phosphomannomutase [Mycobacterium smegmatis str. MC2 155]MSRPAAAVHGVIKAYDVRGLVGSELDESFVADVGGAFARLVRGEGARQVV
IGHDMRSSSPALAAAFADGVTTQGLDVVRIGLASTDQLYFASGLLECPGA
MFTASHNPAAYNGIKLCRAGAKPVGKDTGLAAISEEVIGGVPAHDGPRGG
ITDRDVLADYGEFLRSLVDLSGSRPLRIAVDAGNGMAGHTTPAVLGPIPG
ATILPLYFELDGTFPNHEANPLDPANLVDLQRFVVESGADIGLAFDGDAD
RCFVVDELGRPVSPSAVTALVAGRELTREIGATIIHNLITSRAVPELVTE
RGGTPVRARVGHSYIKALMAETSAIFGGEHSAHYYFRDFWGADSGMLAAL
HVLAALGEQDRPLSEIMADYQRYEASGEINFTVSDASACVDAVLTSYGTA
IHSIDHLDGVTVDLGDDCWFNLRSSNTEPLLRLNVEARTTEEVDAVVDRI
ADVIRATNEPGSVNGAVNEAAT
118472720YP_889737.1 hypothetical protein MSMEG_5499 [Mycobacterium smegmatis str. MC2 155]MRSTQRYLITGFALALAPFGTVVVDPPPARADCTSSGYATVCAQGEVRGT
DGVPRAATPVVPYPCEYDWYCGTDVDLDIGWDPGRPDRPNRPNRPGGGGG
IGPR
118472719YP_888979.1 peptidase S9- prolyl oligopeptidase [Mycobacterium smegmatis str. MC2 MNYGASLSPDATAFAHLVDDGGFPRAVQRFLRGWRASSSRDVELPVVGPV
LRVLHSADGHWLACEVAPEGATRSQIWVVTTDPDDRDARRIDSWPDGTEG
TAELIGWDGTKVAAILTGDDGVGSSCLIDPGTGETTVLDRRSSGRLVDSW
QGASLIRVGPRGYRELIMLWGQREIALLPYDPGSTTDYGVILDDHSPRRV
RSGLDGETVTLMEPHKYFQADGESHTTEGTTEGYVRALIRSENGASHARL
LEVTVTADGVSYHVVAERPGYELDEFVVSDDLSTVAMLWNVDGRSELQIL
EYADETLSEPIPLPGMVASQLSISAGGSMVAMTVQGPSLPPTVELVDPRT
REWERIDREPSGGPVTGTPTLEMITARDGLELNSWLYWPHTEPIGAMLFL
HGGPEGQARPEYNEFYPQLLEAGIAVLTPNVRGSGGFGRAFMHADDKERR
FAAIDDVADCVQYLVDKGLAPADKIACTGWSYGGYLTLAALTFHPELFAA
GISICGMSDLNTFYRNTEPWIAAAAYPKYGHPVADRDLLEKLSPLPRAHA
LTAPLLLVHGANDTNVPPSESLQMYDALHDLGRPVELLMFADDGHEIIKR
ENRAVLVDAMERWLVKAFTA
118472718YP_890158.1 hypothetical protein MSMEG_5932 [Mycobacterium smegmatis str. MC2 155]MYSQPLVDAIAEAERLVAAAPFIESEADLTEGLQYLAGCVSGCLHLAFDY
DRDHPFLQSGTGPFTKMGLDNPDTLYFGTRVQPGHEYVVTGKRGTTTDLS
FQVLGGEYTDDNVPASQAAFDDRELDIAEDGTFEWRITPTSPSQLVIREV
YNDWSAQRGHLAIARTDTAGTAPPPLTKELIEKRYAVAGKQLVQRVKTWL
QFPQWFYNNLPVNTMVAPRLTPGGLATQYSSVGHFDLRPDQAMVITLPVT
DAPYLGFQLGSLWYISLDYINHQTSLNGTQAQEDPDGKIRIVVSDANPGV
TNWCETLGHRKGYLQFRWQRLSRALTEADGPTVEVVDIDQVPEKLPYHES
NKISEADWRARIALRQQQIQNRMVG
118472717YP_885632.1 hypothetical protein MSMEG_1241 [Mycobacterium smegmatis str. MC2 155]MSVAHLGKAVEELCTSAVHELLLVAPFIKEPVLSHLLSRVGSDEVEVTCV
TRWHPHEIAAGVSDLSVWRHFRHLPRRRLFLRQDLHAKYYRGDGECLVGS
ANITAAAFGYSATPNLELLVPARLGDSGLEMFEERLFLGAIEVDDRVFSD
VSCLVEKFDGAAKPPINATSFVESLSADLGPVEDLATWTPLLRRPEDLYL
VYSQDADDLSKAEIDAATRDLAVLRVVPGLDKPDFEAMVGHALLLTPIVQ
RLDRFVYKSRRFGEVRDFLAAFEINERRWQTLLRWLNYYLEDRYSYTRPH
FTEVICRKNLNL
118472716YP_889930.1 hypothetical protein MSMEG_5697 [Mycobacterium smegmatis str. MC2 155]MRVLLNIIWLIFGGLWLALGYLLAALICFILIVTIPFGFASLRIASYALW
PFGRTIVEKPGPRPGALVGNVIWVILFGIWLAIGHVASAIAMAITIIGIP
LALANLKMIPVSLVPLGKEIVPVDQFNNLNTERVIT
118472715YP_890252.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMADAPASRRPSADDLLVLLAVGRTGRYTTAADELGINHTTISRRIAALEE
ALGGRVLTRGAGGWELTDLGRDALAAAETVEAAVTSLAADRRRQLEGVVR
ISATDGFSAYIAAPAAAQVQREHPRIAVELVATTRRASQQRTSLDLEIVV
GAPQVRRAEAIRLGDYCLGLYGARDYLAEHGTPESVADLERYPLVYFIDS
MLQVDDLDLAPAFAPAMHESVTSTNVFVHVEATRASAGIGLLPCFMADRH
DDLVRVLPETVSVRLSYWLVARAETLRRPVVAVVVDAIRDRMADQRDVLL
GVR
118472714YP_886472.1 hypothetical protein MSMEG_2113 [Mycobacterium smegmatis str. MC2 155]MAGETGHVRQGSRACPAQPHQHRDRRSGVPGDLRLRRTATESRSGGVVVR
SDCEQSLKEVPVALQGDAEILGRGILPLRPLLVEP
118472713YP_887780.1 peptidase- M48 family protein [Mycobacterium smegmatis str. MC2 155]MTRPPATQPPQRTTFPGISSRAWEHPADRTALTALRRLKGFDQVLKVLSG
MLRERQHRLLYLASSARVGPRQFADLDELLDDCARVLDAPSRPEMFVTQS
PVANAYTIGMDEPFIVITSGMYDLMSHDEMRFVIGHELGHALSGHAVYRT
MLMHLMRIASTFGFVPIGGWALRAIVAALMEWERKSELSGDRAGLLCGQD
LDTAIRVELKLAAGARLDKLDSQAFLAQAREYERAGDMRDGLLKLLNLEL
KTHPFSVLRAAALTQWVDTGGYGAVMAGDYPRREDDDKAALRDDIGEAAR
HYRDGFDQSDDPLIRGIRDGLGGIVDGVGQAATSAADSVGRKISEWRRSA
QRDARRDDRRDGPEPDSGSDDAG
118472712YP_885773.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAHDLSLLASSGTHAVTNQVPPLEDYNPATSPVLTEALIREGGEWGLDEV
HALGALSGSRQAQRWGELADRNRPILHTHDRYGHRIDEVEYDPAYHELMS
VAVSYGLHAAPWADDRPGAHVVRAAKTSVWTPEPGHICPISMTYAVVPAL
RFNPELAKIYEPLLTSRVYDPELKIPTTKLGITAGMSMTEKQGGSDVRAG
TTQATPNGDGSYTLTGHKWFTSAPMCDIFLVLAQAPGGLSCFFLPRILPD
GRRNRMFLQRLKDKLGNHANASSEVEYDGATAWLVGEEGRGVPTIIEMVN
LTRLDCTLGSATSMRNGLSRAVHHAQHRKAFGAYLIDQPLMRNVLADLAI
EAEAATMLAMRMAGATDKAVHGDEREKLLRRIGLAAGKYWVCKRATPHAA
EAMECLGGNGYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRPE
CVEVLFDELGQTAGHDERLDAHVATLQRDLGELETIQYRARKVAEDISLA
LQGSLLVRHGHPAVAEAFLASRLGGQWGSAFGTLPTGLDLAPIIERALVK
G
118472711YP_890115.1 hypothetical protein MSMEG_5889 [Mycobacterium smegmatis str. MC2 155]MATFPYSLRRLILAGGFVVAAAAAPAITVFAVPDSAMPTAACPGGEEEDL
YTGVCVPHTVPNSGGSFSPIPGNPNLPAVNLPGGGGSIPCTGNNTGQCIG
LAEEAQSQAPAVTPESSVGSSPTVHGSIG
118472710YP_886688.1 methylesterase [Mycobacterium smegmatis str. MC2 155]MKIGDRWPKDWPLQLISSPRWSEQRPTYGEAKPAIIEAALRRSQRRPTGN
WYVLGANREIRADRPFGTTIGGIEVVAWRDRQGHLRVGPRSCPHLGADLA
TGVVDDGSLICRWHGLPLTGKTCEFGWAPLPSHDDGVLAWVRLDELGGED
PLTVPVVPTRPAGETLHALTRLVGVCEPSDIIANRLDPWHGNWFHPYSFT
RLEVLSTPTEEDDRFLLSVTFRLGRLGVPVVAEFTCPSARTIVMRIVDGE
GAGSIVETHATPLGPGTDGRPRTAVVEAVVAQSDRAGFRHARRAAALITP
LMRHAANRLWRDDLVYAERRYQIRHHQRDHRRTTGQGP
118472709YP_889628.1 hypothetical protein MSMEG_5387 [Mycobacterium smegmatis str. MC2 155]MIALTIVLAVFVGIALGMLGGGGSILTVPLLAYVAGMDAKQAVTTSLLVV
GVTSAVSAVSHARAGRVQWRAGLSFGAAGMAGAYAGGVLGRFIPGTALLI
AFAVVMVAAAIPMLRGRRAPEATTAHGLPVVRVVSLGLAVGGLTGMIGAG
GGFLVVPALTLLGGLPMPAAVGTSLIVIALNSFSGLAGHLTGLQIDWALA
AAVTGAAVAGCLIGTRLITKINADALRKAFGWFVLAMSSVILAQEIHPFV
GLAAASLTVIAASMTMVCARFSRCPLRRVTRLSMARPAVA
118472708YP_884454.1 FHA domain-containing protein [Mycobacterium smegmatis str. MC2 155]MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGLALRGS
LLPNRQRRHVARQLVVTEGALAGTRITLGNQPVLIGRADDSTLVLTDDYA
STRHARLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVKVPIGAPVRIGKTV
IELRP
118472707YP_886403.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MANEPAVEDVSHLQLSSRDVSTVPVALADWLSTVLPAGAEPRVTVEDGVD
SNGMSSETLLLTAEWTEDGAPVQQRLVARVAPAPGDVPVFSSYRLDHQFE
LMRQIGELTDVPVPRVRWLESTGSVLGTPFFLMDRVDGIVPPDVMPYTFG
GNWFADAPADRRRLLQDGTVAVLAKLHSIPDALNRFGFLLDVDPPGDTPL
RRHFAWLKDWYEFAVTDIGRSPLVEHALAWLEDNFPSDVAAGEPVLAWGD
SRIGNVLYEDFEPVAVLDWEMATVGPRELDVSWIIFAHMVFQELAGLAGL
PGLPDVLREDDVRATYTRLTGAQLGDLRWFYIYSGVIWCCVFMRTGARRV
RFGEIEKPEDVESLFYHASLLRRLIEEA
118472706YP_886495.1 permease of the major facilitator superfamily protein [Mycobacterium sMSSCPAEGDCSAPEKPKLPGEVWVLIVANAVIALGYGVVAPVLPQYARHF
GVSISAATFVITAFALMRLCFAPATGMLIQRLGERRIYVNGLVIVALSTG
ACAFAQTYWQLLLFRSLGGIGSTMFFVSALGLMIRISPEDARGRVAGMFS
SAFLVGSVGGPVLGSLTAGLGLSAPFLIYGAALLVAAAVVFISLRHSSLA
APAPDDGPKVTVRTALRNGAYRAALVSNLATGWSAFGLRIALVPLFIAEV
FHRGPGIAGLALATFAIGNVGAVIPSGYLSDRVGRRVLLIIGLTAAGVAT
AVVGLTDGLTPFLVSALVAGFATGIFTAPQQAAVADIIGNKARGGTAVAT
FQMMADVGSIGGSLLVGLIAQYLSFAWAFGISGGMLLLAALCWTFAPETR
PRPSAEHTPARPLGPEAGGEVP
118472705YP_886298.1 hypothetical protein MSMEG_1933 [Mycobacterium smegmatis str. MC2 155]MVKVSRSWPSSSAGCRRPTSAACRNSAWPDRSYCVQVAIIVLLAWFTRTL
PAASVIEQLS
118472704YP_884769.1 acetyltransferase [Mycobacterium smegmatis str. MC2 155]MPDAHHYELTVDGEHAGVLAYVDIGDQRVFHHTEVDDKFSGQGLAGELVS
AGLSDAKAAGKRIVAVCPYVAKYVSRHHDFDDVLDPVTPEAKAAVGGG
118472703YP_886094.1 IS1137- transposase orfA [Mycobacterium smegmatis str. MC2 155]MQMVADLRSETVSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGSRAGQ
TSEESEVLRKLRRENAELKRANAILKAASVFFAAELDRPSQ
118472702YP_887531.1 anthranilate synthase component I [Mycobacterium smegmatis str. MC2 15MQTTANHSSRSTQTGTRAHGAALAETTSREDFRALATEHRVVPVIRKVLA
DSETPLSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPSALTVRDN
AAAWLGTAPEGAPSGGDPLDALRATLDLLKTEAMAGLPPLSSGLVGFFAY
DMVRRLERLPELAVDDLGLPDMLLLLATDIAAVDHHEGTITLIANAVNWN
GTDERVDWAYDDAVARLDVMTKALGQPLTSAVATFSRPAPDHRAQRTMEE
YTEIVDKLVGDIEAGEAFQVVPSQRFEMDTAADPLDVYRILRVTNPSPYM
YLLNIPDADGGLDFSIVGSSPEALVTVKDGRATTHPIAGTRWRGATEEED
VLLEKELLADEKERAEHLMLVDLGRNDLGRVCRPGTVRVDDYSHIERYSH
VMHLVSTVTGELAEDKTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTR
RGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADSNGPYE
YTEAANKARAVLNAIAAAATLAEP
118472701YP_886630.1 membrane-bound oxidoreductase [Mycobacterium smegmatis str. MC2 155]MSERVRRTPPLAGLAAAAVALGVAGIVAVPFGPAADSRTAVGSAVIDLTP
GPVKEWAITTFGTADKLLLTVLIIAIIATLAAVTAPLETRRRPVGSIVIG
LAGVLGCVAVLSRPGAGWVAILPTVIGAVCGIAALRLLTSDRFRDEQAVA
EDRADQRADRYADDHADDTVDPGRRWSLVALGLLTTGVVTGAAGAVLSRL
ASSVAGDRDAFTLPRAARAAAPIPPDVQPAGVSLPSFITPTPKFYRIDTA
LTVPQLTRDEWQLRIHGMTDREVTYRFEDLDRFEVVEKVVTLTCVSNFVG
GDLISNATWTGYRVRDLLEEAGVSTDSDMALSTSIDGFTAGSPIEALTDD
RDALLAIGMNGEPLPAAHGYPARLVVPGLYGYVSATKWVVDLELTRFDRA
EAYWTKLGWSAHGPIKTQSRIDVPREGQQVPRGPVRFGGVAWAQHRGIRA
VEVKIDGPSDPGEWQQAQLGAAYSDDTWRLWSVDWTAADPGEHTITVRAT
DNTGETQTPDLADPVPDGATGWHYVTFDVT
118472700YP_885253.1 hypothetical protein MSMEG_0850 [Mycobacterium smegmatis str. MC2 155]MGEVVIGGEALAKGLVTRNDLRHHYRRLFPGVYVRGEPTLRDRTVGAWLW
SGRRGVLAGVAASALHGSAWVDPDVPIELIWRNGRPPAGLIVRNETLAAD
EVMRVAGLPVTTPARTAFDLARHLPRDEAVARIDALAWTRRVTVDDVAAL
IERYPAARGIRAARAVLRLVDAGADSPRETWLRLRLTDAGLPPDSTQIPV
VDERGRIVAILDMGWERHLVAVNYDGVFHQSDRKRYVRDLKTLRALEDRG
WIVIRVVAEDDIADVITRVAAAPWLAPRLH
118472699YP_889040.1 hypothetical protein MSMEG_4783 [Mycobacterium smegmatis str. MC2 155]MTVIAAAATVLAGLLTAPPAAAGPQTCNDAFCVPGINPHAVLGAPCSNTT
YYVFGVDARNNWGRLVFCGSPRRYEPRWFRSPPMAGIRDENSSCLGELNM
VAQAPDGLFLTCVPMNGETLWRRGDA
118472698YP_890221.1 P450 heme-thiolate protein [Mycobacterium smegmatis str. MC2 155]MPTPNIPSDFDFLDATLNLERLPVEELAELRKSEPIHWVDVPGGTGGFGD
KGYWLVTKHADVKEVSRRSDVFGSSPDGAIPVWPQDMTREAVDLQRAVLL
NMDAPQHTRLRKIISRGFTPRAIGRLEDELRSRAQKIAQTAAAQGAGDFV
EQVSCELPLQAIAELLGVPQDDRDKLFRWSNEMTAGEDPEYADVDPAMSS
FELISYAMKMAEERAVNPTEDIVTKLIEADIDGEKLSDDEFGFFVVMLAV
AGNETTRNSITHGMIAFAQNPDQWELYKKERPETAADEIVRWATPVSAFQ
RTALEDVELGGVQIKKGQRVVMSYRSANFDEEVFEDPHTFNILRSPNPHV
GFGGTGAHYCIGANLARMTINLIFNAIADNMPDLKPIGAPERLKSGWLNG
IKHWQVDYTGAGKASVSGAPGTCPVAH
118472697YP_886442.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGLQKHKRTATDIGLALITPIVGQEWLDRYGLRDPLNRGLKYGVKQVFST
AGATTRQFKRIQGIGKAPTRLKASGADLFDLTPDDDQKMIVETVNEFAAE
ILRPAAEEADEAATYPPDLIAKAAELGITAVNVPEDFEGIAEHRSTVTNA
LVAEALAYGDMGLALPILAPGGVASALTHWGSADQQATYLKEYAGDNVPQ
SSVVIAEPHALFDPTELKTTAVRTPSGYRLSGVKSLVPAAADAELFIVAA
QFNGKPALFIVEASSKGLSVKADRSMGLRAAALGQIELDNVTVPLSARLG
EDGATDQDYSEAIALARLGWAALAVGTSHAVLDYVVPYVKERHAFGEPIA
HRQSVAFMCANIAIELDGLRLITWRGAARAEQGLPFAREAALARKLGADK
GMQIGLDGVQLLGGHGYTKEHPVERWYRDLRAIGIAEGVVVI
118472696YP_888893.1 valyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MTASPENRADALPKSWDPGAVEAELYQGWVDAGYFTADPASDKPPYSIVL
PPPNVTGSLHMGHALDHTLMDVLTRRKRMQGYEVLWLPGMDHAGIATQTV
VEKQLAADGKTKEDLGREEFVAKVWDWKRESGGTIGGQMRRLGDGVDWSR
DRFTMDEGLSRAVRTIFKRLFDAGLIYQAERLVNWSPVLETAISDLEVKY
EDVEGELVSFRYGSMNDDEPHIVVATTRVETMLGDTAIAVHPDDERYRHL
VGKTLPHPFVDRDMVIVADTHVDPEFGTGAVKVTPAHDPNDFEIGMRHGL
PMPTIMDTKGRIADTGTQFDGMDRFEARVKVREALAAQGRIVAEKRPYLH
SVGHSERSGEPIEPRLSLQWWVKVESLAKAAGDAVRNGDTVIHPPSLEPR
WFAWVDNMHDWCISRQLWWGHRIPIWHGPDGETVCVGPDETPPEGWEQDP
DVLDTWFSSALWPFSTMGWPDHTPELAKFYPTSVLVTGYDILFFWVARMM
MFGTFVGDDPAVTLEGARGRQVPFENVFLHGLIRDEFGRKMSKSRGNGID
PLDWVEKFGADALRFTLARGASPGGDLSIGEDHARASRNFATKLFNATRF
ALMNGAAPAPLPAASELTDADRWILGRLEEVRAEVDSAFDNYEFNRACEA
LYHFAWDEFCDWYVELAKVQLGQEEVHTARTTAVLAAVLDTLLKLLHPVM
PFVTETLWKTLTGGESVVVATWPEPSGFAPDTVATQRITDMQKLITEVRR
FRSDQGLADRQKVPARLTDVEAAGLTAQLPAVAALAWLTEAGDGFSPSAS
VEVRLSQGTVVVEVDTSGTVDVEAERRRLEKDLGGRPEGTGHHHGQTRQR
GLPVQGARPGGRQDPGQASPGQ
118472695YP_884554.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MRLLKGFPKMRNWTRVGRRTAVLAAVALVLTSCGQWRGIANVPLPGGPGT
ESGSMTLYVQMPETLALNANSRVRVRDVFVGRVRKIELINWVPTLTVDVE
PGIKLPKNTLAKIGQTSLLGSQHVELNPPEDPSSELLRDGDTIPLAQSSA
YPTIERTLAGISGILTGGGIPNIEVIQTEVFNILNGRADQIREFLNQLDT
FTDELNQQREEITRAIDSTNRLLNIVSQRNDTLDRVLTEFPPLIQHFAET
RDLFADAVTALGRLSAAADETLSGSNANLHTNLQNLQRPLKQLGRAAPYL
VGALKLILTVPFNIDNIPKAIRGDYINVSLKLDLTLSSVDNAFLSGTGVS
GMLRALEQAWGRDPATMIPDVRFTPNPHDAPGGPLVERGE
118472694YP_884606.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MRVLDLVVIVVYLVAIAWFGLRASGRQKTSKDYFVGEGKLPWWTVSFSVV
ATETSVLTVISVPGGAYSGQAFGNVELALGYVVGRVVVAVVLIPLYKRGG
FVSAYQYLGTRFGLKLQGLASVTFVFTRLLAEGVRLFASAIPIKLLLDEF
GVHADYRTIIVVVTAITVVYTYLGGIKAVVWTDAVQMTLYLGGAILAIIV
LWGHVGSTGVADALHAGKFDVFDTNFSLAHIATSTFALPTAIIGGAIFAM
ASHGSDQLIVQRILATRTLRDSQKAMIASGVFITFQFAAFSLVGALLWSY
NGGRTFQELGLASSDNLYPNFILHGLPVVVSGLLVASILGAAMGSLSAAL
NSMSSSSVSDFINSFLSRSPSEQSLLRLGRLMTLVWAVLMAVFACGFSAN
TGNVYLTGLAIAGYTYGALLGAFLLGRLVRRANQFDAVVSFVVTVVVMTY
IVRYVKIDVTASGETVPSAIAAQWLVPIGVLITLLVGGVMSRFHRPPEVA
ALPDHDDESATVPTVAGRN
118472693YP_888096.1 lipoprotein LpqH [Mycobacterium smegmatis str. MC2 155]MNRVIAGTMGLLAAGTILVGCSDDKPQATPSPAAADVKTGGNTQVKVDGK
DLPGLDLNSVTCVKEGGRINVGSAAIGGQQGLGVVMTDEASPKVESLGLV
YDGSALAVSENMGVKVGSAKVEVDGDTYTITGEAAGADMQNPMAGMISKP
FTITVSCS
118472692YP_885973.1 hypothetical protein MSMEG_1593 [Mycobacterium smegmatis str. MC2 155]MLCATWAGRMHEGAPMNRLPVPLLQSGVLQRLSCTSTVGTLFCARGALSP
RLRR
118472691YP_886068.1 ECF-family protein RNA polymerase sigma factor [Mycobacterium smegmatiMDPAPSSASDPAWTELSEAEAVFTRVRPRLFGVAYRMTGTVAEAEDAVQE
AWLRWQDTDRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPEP
VDTTADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIA
ETVGVSVPNARQLVSRARRRVTTRRAAPVATAEQDRLLRAFVTAARSGDL
DALEEILAEDVVSHTDGNGARNAAQIPVVGRTTVAKFVRAFRNRLWPGAS
LRWITANGHSAVLVVHDDSPAAFLTVAASADGIHRLLWVLAPEKLAGIAQ
AQGR
118472690YP_886217.1 selenocysteine-specific translation elongation factor [Mycobacterium sMFVVATAGHVDHGKSTLVHRLTGMWPDRLAEEQRRGLTIDLGFAWTTLEG
RDIAFVDVPGHERFVGNMLAGVGPVPATMFVVAATEGWMPQSEEHLAALE
ALGVRHTLVVISKADLADPARAIAQVRDRIPDARVVLGTDLGSVQAELVA
LVDRLPAPATDSDVRLWVDRSFTVRGAGTVVTGTLAAGTIRVGDQLERDG
RLVTVRGLQSLGRDRDAVSAVARVAVNLRGVERESLRRGDAVRTPGAWLD
TSEVDVVLRSAGKLHQKLTLHIGSASVPVHVRPLGDVGARLRLTRALPLR
IGDIGLLRDPGAHRIVAGVEVLDVRPAPLRRRGDARARAAALATGRVTPP
VCARAKDLRAMGFEVVGERIGDWVVSPEWWAERRRLALAAVEQWAAEHDI
AAGMPFETLRQRVGLPAVELVPALLDGTGLQLRDGLVQRPGVALPPRVDK
AVQTVREWLAAEPFRAPEAAELAELNLGPKELAAAVRAGRFVRVADGVVL
GPDAFDRAAEVLVGLPQPFTVAEAKRALNTTRRVAVPLLEQLDARGVTTR
ADDGTRTVRVSRAGDTGQAD
118472689YP_889867.1 feruloyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MNLFGLLDQTAARHGDRGAVFCGERELYTWTQLRDRAARLGSTLTEPGTR
VAVASENRPEIIEIMFGVWAAECVYVPINYKLHPREMADILADSGAALVF
ASPKIAPGLFEVTDVPVEVVGTDAYTQRFESEPVPAPLTDPAELAWLFYT
SGTTGKSKGAMLSHRNLMAMTVAHLADFDAPDEFCSLVHGAPMSHGSGLY
IPPYVLRGARQVIPESGAFEPDEFLDLCDHHPGCSAFLAPTMVQRLIQTG
RPRPANLRTVVYGGGPMYVDSLKKALAAYGQIFVQLYGQGEAPMTITGLR
RDDHLDADDATLGSVGYPRSGVQVAVLRSDGTPADIGEIGEIVCRGDVVM
SGYWNNPEATAATLKDGWLHTGDMGSFDARGHLTLRDRSKDVVISGGSNI
YPREVEEVLLEHPDVVEAGVVGAPDAEWGEIVVAFVVTNGTPVDAAALDA
HLLERIARFKRPKRYEFIDALPKNSYGKVLKRELRERVTG
118472688YP_888117.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTVAAQTGQAPTKSLAYTFTGGDAVVTGAASGIGAATAAMLMSAGIRTIR
LDIRTPEPDPGFGADLQVCCAADVRDPDLLTTLRGQGAPVDTVSYVVNCA
GVIDDTGFAGVSREHWLRCLEINLMGAYNVLDAFTPVLRQNPPAAIVNVT
SIEAARVIALSNPDPTPQYAASKAGLRMLTETSARALAADGIRVNSVAPG
FVATPMAAAHGNTATLPPSLAPRVPAGRFARPAEIAWATAFLLCDQATYI
TGSELRADGGFQLT
118472687YP_888072.1 phenylalanyl-tRNA synthetase subunit alpha [Mycobacterium smegmatis stMVRTQGGETAGEQPSDLSEEALTKAVSAARHAFDAAGDLDALARAKTEHL
GDRAPIALARQALASLPKADRADAGKRVNVARAEAQRAYDERLAVLRAER
DAAVLVAERIDVTLPSTRQPLGARHPITILAENIADTFVAMGWELAEGPE
VETEQFNFDALNFPPDHPARSEQDTFQIAPDGSRQVLRTHTSPVQIRALL
ERDLPVYIISIGRTFRTDELDSTHTPVFHQVEGLAVDKGLTMAHLRGTLD
AFARAQFGPEGRTRFRPHFFPFTEPSAEVDIWFPGKKGGPGWVEWGGCGM
VNPNVLRACGIDPEVYSGFAFGMGLERTLQFRNGIPDMRDMVEGDVRFSL
PFGVGA
118472686YP_890534.1 lipoprotein LpqH [Mycobacterium smegmatis str. MC2 155]MKRGFLVAVGSAALVVAGLSGCSSDDKSAEASEASPTANATVDSTASPGT
SVAAGDATATTGTGTARVVIDGAEHPIEGSVVCATVAGNVSVTVGQGTSA
VTATLSEGDQPAVSAVALGNIDGVSLGYTPGVPGGSAEATKDGNKYTIKG
SATGADMANPMAGAVTKPFELEITCP
118472685YP_888917.1 aldo/keto reductase [Mycobacterium smegmatis str. MC2 155]MTLDQYVTLGRSGLRVSPFALGAMTFGEDFGAVGTSVENSERILSAYLDR
GGNFIDTANFYTNGHSEKILGDFFARTPGRRQHVVLASKFFGNMFPGDPN
GGGAGRSSVLHQLHDTLRRLQTDYLDVYWLHNWDRNTPIEETMRTLDDLV
RAGTVRYIGFSNTPAWVTAQAQTMAMLRGWTPLIALQVEYSLLARTVESE
VAPFAQDQGIALVPWSPLKNGFLSGKYRRDSAAVDSARAAFVGGGPSESD
FDVIEAVAGIADELETSSAAVALAWLRARPGTVVPIIGARRMEHLESNVE
ALGVELTSEQLKLLDEVSAPVLSYPAEVNGEVRASLQFAGTTVDGETSTV
FPALLAGDARY
118472684YP_887638.1 hypothetical protein MSMEG_3330 [Mycobacterium smegmatis str. MC2 155]MSVGKKIAHKAESAKGTVKKLFGRAIGNTRLRTEGRADQFKGNTKQAGAK
VKDAFKH
118472683YP_886994.1 peptidase- M16 family protein [Mycobacterium smegmatis str. MC2 155]MTETRLETSQVRRTTLPGGLRVVTEYLPYVRSASVGVWVGVGSRDEGRSV
AGAAHFLEHLLFKSTPTRTAVDIAQTVDAVGGELNAFTAREHTCYYAHVL
DSDLELAVDLVADVVLRGRCAAEDVEVERDVVLEEIAMRDDDPEDTLGDV
FLSAMFGDHPVGRPVIGSIESISEMTRAQLHSFHVRRYTPDRMVLAVAGN
VDHDEVVALAREHFGRRLVQGRDAVPPRKGSGRVPGRPSLRVVERDGEQT
HVSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQEIRETRGLAYSVYS
TVDTFSDSGALSIYAGCLPERFEEVVRVTTDVLETVARDGISENECRIAK
GSLRGGLVLGLEDSASRMHRIGRAELNYGEHRSIEQTLAQIDAVTLDEVN
AVARQLLTRDYGAAVLGPDTAKVALPQRLQDIAS
118472682YP_885172.1 phosphoribosylglycinamide formyltransferase 2 [Mycobacterium smegmatisMSESIEGALTDDAAADESAGAGPDDTDVTDDSVADTAPEDTAPDPDDTEP
GDRAAADQETDTDPEPQPVVGPDAADHRPTVMLLGGGALSRELALAFQNL
GGVVVAVDRYDAPAHGVADRTAVVDLNDADELSAVIAREKPQYVVAAESG
VIAADALIAAAERGDSEVLPTPRSIRLSQNREGLRRLASDELGLPTVPFW
FAGSVEELTAVAEHAGYPLVVKPVTGSLRDGQSVLLRPDDIEPAWKRATT
AGHFAHSRVLAESVVEVDFEVTMLTIRTTGPTGPGVQFCEPIGHRRSDNG
VLESWQPQQMPPAALDSAKSIAARIVNSLGGRGVFGVELLVQGEDVYFSD
VRVRPHDSGLVTLRSQRLSEFELHARAILGLACDTIMISPGAAEVTYAGA
EAAPSVDVTAVLGEALATSESDVRLFGRAEESDDGRRLGVALATAPDVIV
ARDRARRVGTALRRLW
118472681YP_890925.1 oxidoreductase- Gfo/Idh/MocA family protein [Mycobacterium smegmatis sMVGHALRIGIIGAGVMGTKHAEYVAREQDATVVAVADPFSRTLAGKLGVP
HFDSYHDLLAASGAEAVIIANPNSAHVETTLAAIEARIPALLEKPVAVTA
AEAAHLVAAVRDSDTVVLVGHHRRHHPAVSKARNLIASGVIGRLVAVNGM
WLTKKSDDYFEQRWRRETGAGVMLINLVHDLDLARYLCGEITTVQAVSSN
ALRGFEVEDTAAVIVGFDNGAIGTFILSDSAVAPWGWDQATQDDPQFPCN
PDIPAWSIAGTTGSLTFPQLARFYHQGESDWYQPLSRRYESTDAGDSYTR
QLQHFIAVARGDAAPLVTVEDAAASLTVIEVAQRAAKCGHRLDVPMVSAP
TGKTTE
118472680YP_886522.1 hypothetical protein MSMEG_2168 [Mycobacterium smegmatis str. MC2 155]MSDTRTMCMRALAVACALTGLLVISSTACSGGRAVVADSVGAESVLRDVD
FVQGPMIMVRPSWLR
118472679YP_885580.1 hypothetical protein MSMEG_1188 [Mycobacterium smegmatis str. MC2 155]MDVVLGVAVTGRVARLAMIGAPANGGQLLDQYALDLSDDGLAELAETIIG
TYQAVTESGNQVAATRLCLPDPAEADTLRMTVANAGVPNVDVVAEAEAAA
ALARSAGADAALLVADDDTASLTVIGEAPEGPSTSTLASVPIGTAGVAAA
CATVLQQAAGEAPTRVMLVGQRLDLDSVAAELRSMAPVEVPPDAGFAIAR
GAAQSAEGFAPAGAATQMAPALDATQMAPAATDATQLAPSVDATQLAPAA
DATQPAPAAADATQMAPAASDATVATPTDAAGQVGPELAYSQEPEAEPWA
EYDEMPMDPLSEFVPEQAEEAGYTTVIAPPPPRMLLVGSALTFVAVSFAT
LAVTVAINVRPAADVRAQPVTPTQSDTVPGRYLPPVPHEPDPVALPVTVL
TPPPAQPVAPNTRTGNNTQPAPQAPPAPQAPPPAAPAPQPPAPQAPAPVP
IPVPLPPVIVVPPLTPPWTPPWATPTSPTTPPTSTSTPTTTPPTTPSTTP
PTTTAPPTSTTTAPPTTSTTTAPTTTTVPTTTAPPTSSVPTTTSAPTTTY
TPPVEEEPTYTPPVEEPTYTAPVEQPSTTVYPDTPSWGDDSSSSGGSSGG
SRGGSSGSSSDDSSSGGSYGGGSDDSPVTTIFDSP
118472678YP_890661.1 hypothetical protein MSMEG_6448 [Mycobacterium smegmatis str. MC2 155]MSSVVLCIPVREHLRFRPEDCIGCWQPEISFEEAMSSCWVMSEQAHDLGD
DGMARCGALLASHCGDTNDLFGKFVLCQLDDLWRQFDSKYLATGERGGGD
HCGRIRRRHEKETLRFGGVVDVG
118472677YP_887912.1 hypothetical protein MSMEG_3610 [Mycobacterium smegmatis str. MC2 155]MRVPGGHGAEPRPQRTDPVAVLIGCLPRRDPQRLLEHRIHERRAVQLDPV
LGVTGHGDVVVATRGHGHGVVLTCPVRAHPARPQTTAGPPRLCTRDQHHL
GTSGLQIQARVIDQGLRHVATDTRVPRPRPGGADATCEQQARVPVPPRQQ
VDHAHRVHGLQHTWIRGVPGGLGHQVHRFGGRVLVVLTDLAVPDQHGRSI
HGHRTYSTTRRAGEVSRPLIQATSFSTQPSTASTSVSTYIRSTNASG
118472676YP_889469.1 hypothetical protein MSMEG_5223 [Mycobacterium smegmatis str. MC2 155]MPWWGAVLAAVTATAIGFAFDAGAGSRELSGVFGFCYVVGCLAAVLAVRQ
SGVFTAVIQPPLILFFAVPGSYFLFHGGEINGLKDLAINCGYPLIERFPL
MLFTSAAVLLIGLGRWYVGLTSRDTGDTESATPSTRKRASDEAPNAVVAS
ITSKLSSLLFRKPATDRSASRQRARQSTRRDRAERAGTGAAPRKRTGERP
PRRRPAAAAAADAKEPTRNGRPTKRTAPPRARRPRDPELDPTLDAPERPR
RPRSARTEPPVVPPAEPRRRVRTQPREPREPRKQPPGDRLGPYERPQRRR
RFDDYRPFEDPFDAPMEPPFEPRTNGHPGRSTHHPVSRVRYRGGEDEDHR
SEYRTRPRPPARGRHSRD
118472675YP_888911.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MAHRYKVREIAQQCGLSEATVDRVLNNRPGVRENTRAEVRQAIADLDKQR
AQLRLNGRRFLIDVVMQTPRRFSDAFRTAVEAELPAFAPALLRARFHLWE
SGSTAQMVDTLARIKSSHGVVLKAADEPEVVEAVDRLVAAGVPVVTYTTD
VPTSARCAYVGIDNHGAGATAAYLIEQWLGADPADVLITLSRTVFRGEGE
REVGFRSGLRASGRTVVEVTDSDGIDATNERLVLQALERNPSVGAVYSPG
GGNTATVAAFDRLGRHCKVFIAHDLDVDNRRLLRDGRISAVLHNDLRADA
RLAMRLILQQHGALPAEPVRPAPIQVVTPYNLPM
118472674YP_890732.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium smegmatis str. MC2 15MAVRDHGDPGDAPSVPPPLTPVADVVRPSAAEEARTIAASTNVGTLATLT
TEGDPWASFVTYGLLGGAPVLCVSDMAEHGRNLAHDPRASIAIVAPSAES
DPLASARVTLAGVAERPEGDELAAARAAHLDAVAAAKYYIDYSDFSVWVL
RVQRVRWVGGYGRMDSTTGEAYAAAEADPVTPRAAGAIAHLNADHADSLL
AMARNLGGYPDTGEAVCTGADRYGLDLRVTTERGVAYTRVGYAAPISSFD
QLRAATVELAQRAKQS
118472673YP_889745.1 hypothetical protein MSMEG_5507 [Mycobacterium smegmatis str. MC2 155]MAVRPLVTTGAALISAGALVAATPALFVPKDEIAIAAPSMATAPKQLTVD
QVDLLALSLQGLYQAFFQGYGGYANPGTEEVTTYERNPDGTLVLDANGDP
IPITTEEPVFGDCTATGAVCLSGFPGAAYYLSDELLPLGDVDNIFFESGI
EPFFQIAAQTIAAEVDALDPTGRLTLERRVADFFEGGATQLVGNTLLDNL
SEGTVAYGLTNSFFFGYGENAGVVAALTYVVDAIAQGTADPVPNPINPLG
PGVSSATVETQLVSKQAIEQKVVEGEDPASTNILTRSRFSVPVSGEALGF
KSDANTTPVLEKDGLGEETTSDGVAPAVNVTSPQSAALGQAPETPATAPE
EPSAPAAEVKEETESTGATANTKDGNKFTPGVILSPGGRKSSSANGWEKL
EQDVKKGINTLGKIFNKGKTSKPATSSTTDNAGEGGEGGGDE
118472672YP_888186.1 hypothetical protein MSMEG_3896 [Mycobacterium smegmatis str. MC2 155]MAQEQTKRGGGGGEDDDLPGASAAGQERREKLTEETDDLLDEIDDVLEEN
AEDFVRAYVQKGGQ
118472671YP_884687.1 propanediol utilization protein PduA [Mycobacterium smegmatis str. MC2MSSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGE
VGAVKAATEAGAETASQVGELVSVHVIPRPHSELGAHFSVSSK
118472670YP_888292.1 CdaR family transcriptional regulator [Mycobacterium smegmatis str. MCMQHTGAPEHGVGSVGPTLAEIGAAIGAQIAAPPYDPTVAVQSVMDAERAS
DAASLDGALVVLDWAPHRPNGPLPNLLTRLEPLLAKRPAAVVITPSRPVN
PPRPVVAHARRHGVALLWVMEAAPVDDVRAQIDKLMQMAHTTRAARKGVT
VPADLLGAADDLSRLLDELGGALDATVRLLDRPTNGAGTAGFPVVSGGRS
AWLEIRRDSALTPEETELVELLIPVMRLHLRLRDTEHDETTAEAARNLKT
ILGEDLVAREATLRRSRRLSMFPRHPLVCLVIEPFGVAVTMAGIQQLRSD
LEPLARRTDRDAITIVHEGAVVMMVNAAVGLDIMSRGLYRAVRTPLVIGA
SDEVTAPRSYPGAFRQAQRAVAVGRRVGGVNRVTRYRDLGILGLLYQLPE
HARRGFVTETLGSVADDTPDALDQRRILRTLRATDCNITESARKLFIHPN
TLRARINRIESITGQFLNDPAKRMNIFTALAMFSLDSNPEGE
118472669YP_890364.1 hypothetical protein MSMEG_6143 [Mycobacterium smegmatis str. MC2 155]MNWVARTAAALIALQLVVRAVLAFGGYFYWDDLILVGRAGTQSLLSPSFL
FDDHDGHVMPAAFLVSGVITRLAPFSWVWPALSLVVLQLLVSLALLRALW
VILGWRPVLLVPLTFALFTPLAVPGFAWWAAALNSLPMLAALAWVAGEAV
LLVRTGRVRHAVIGALVYFGGLLFFEKAAVIPFVAFAVVALLGYVTSEFD
LASGLAEVWRRGLRLWVACLALTAAWIGVYLTVVDQKRWSFDLAMTGDLL
SRSITHGIVPGLAGGPWQWQRWAPASPWATPPVTVMVLGWIVLVAAVAVV
LLRKQRIWPVLAVAAGYAVACQVPIYLMRSSRFTALELAQTLRYLPDLVM
VLALLTAVGFCAPNRESPWLSASRARSVVVVGVAVLFVASSLYSTWTFLR
VWRDSPVPAYLDNARASLASTSDAPLLEQEVDPLILQRVAYPENLASHMF
ALTSPRPEFASATTDLRMFDRTGTLVPALVTWVRTILPGPQPNCGHLVQT
EEPVVMPLDGPLLPADWTAEINYLANSDGSLTMALSEGPDVKVPVRPGLN
RVFVRLPGAGDAITVRANTSALSVCISPGPVGFLAPK
118472668YP_888181.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MSLRSAPVDGFRLAFDRHGIRGGPPVVLLHGWPGTRRDHRHVVPLLTDVA
DVIVPDLRGFGGSDKHAVSVQHFYSASAQAASIVGLVNELGLTGVVLAGY
DVGSRVAQGVARMHPHLVKALVLSPPLPGVGDRVLSPHAIHEYWYQAFHQ
LPIAERMIDGNPDAVREYVRHFWDHWSGPGFRLAEDELDRLVADYALPGS
FTASLGWYRAGAGTVAQSLAELPPDRAVKIHPTTDVLWPQHDPLFPLEWA
DRLEHYFVDVRLHTAEHAGHFTPLECPDEFAALIRGALGRAPN
118472667YP_887803.1 hypothetical protein MSMEG_3499 [Mycobacterium smegmatis str. MC2 155]MFALATLMALVQQVSGTPYVSGGDSPSGTDCSGLASWVSNVATGRPAFGD
RFHTGNQEQALLARGFKYGTQPGALVIGWNSGHTAVTLPDGTPVSSGEGG
GVKIGGGGAYQPQFNHHMYLPAEEVQPDAGLPVGAPPPPEASLPPLPPPP
ADPMAPAPPMAGPPPVDPFAPPPPPEPAVVPVVLDVPAPPAPEAPPALGV
118472666YP_885682.1 FAD binding domain-containing protein [Mycobacterium smegmatis str. MCMPRFMVHGAFTLVTVAGMDLNTVEVVDRPTRREEVWPLGAGDAVLAGGTW
LFSEPQPQLRRLVDLTGLGWPPVTLSDSGIELAATCTLAEVSRLSADLQE
HRTQWTAAPLLHQCCGALLASFKIWHCATVGGNICLSFPAGAMISLCTAL
DGEATVWRADGNDFRLPVAALVTGAGTNLLAAADVLRSVHLPAAALRART
SYRKLAPSPLGRSGIVVIGRRDTVPDGGRFVLSVTAATVRPFVFTFPGVP
DQDQLTDALGAIPPDAWSDDPHGDPDWRRAMTLVLAEQVRSELT
118472665YP_889462.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MKFVSTRIITADVKRLVDFYETVTGLSAVWANELFAEIPTPAGTLAIGSE
KTVPLFGPGSAQPAANHSAIIEFIVDDVDAEYERLRKHLVDVVIEPTTMP
WGNRALVFRDPDGNLVNLFTPVTEDARAKFGVASA
118472664YP_889658.1 hypothetical protein MSMEG_5417 [Mycobacterium smegmatis str. MC2 155]MLSLQSPRQPAANELATPNSLKPASSRSPWSHGTESAVSMDGGAANTCRT
118472663YP_884900.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTTVLPQRAATVPQSPRRRTSTPSPGRRRVILHALQGGIVLSALAAWELG
ARSGSISSFLFGSPSAVWNVLYKRAVSGELWSDIGVTSSEVILGFLVGAV
GGSALGLLLWYSQFVADLTAPFIAAIGSIPVLAVAPLTIIWFGTEMTSKV
VIVAFSCVVVSLTTSYSGARRTDPDLVNLMKSFGATRSQIFRKLVVPSAM
SWVVSGLKLNIGFALVGAIVGEYISSDAGVGHMILRGSSNFTITLVIAGI
AIVMVMVLVFNILVAGLERILGRHQKS
118472662YP_886035.1 ribonuclease [Mycobacterium smegmatis str. MC2 155]MTEPADESAKPGLLDRLKARWPWFDHVMRAQERYNDSKGDFYAAGITYFT
IFALFPLLMVGFAVGGFVLASQPELMGQLEDKIRQAVSGDLGAQLVQLMD
SAIDSRTSVGVIGLATAAWAGLGWMANLREALSQMWGLFREEKPGFVRTK
LSDLLALLSAFVAIILTIGLTALGSSTAIENVLNRIGMPDSVGLSILLWV
LSVLMSLFVSWLLFTWMIARLPRETVTFRSSLRAGLLAAVGFEIFKQLAS
IYLKSVITGPAGATFGPVLGLMVFAYITARLVLFATAWAATAEENLEAAR
VLPPEPVQITTRVQVREGAGVPAMLTAAAAGAVGGFGLSRLRFRQ
118472661YP_889070.1 hypothetical protein MSMEG_4814 [Mycobacterium smegmatis str. MC2 155]MSQIPGRPLPTVTALNEYFWTAGRDGVLRIQECRSCDALIHPPQPICRYC
RSHDLGVRDVSGRATLAGFTVNERFGFPDMPPPYVVAEVAIVEDPRVRLT
TNIVDCDPQSLELGQPVEVSFQHIDDVWLPVFTPSADTTPTPAPVEDIAP
QDIGKFVRPMLTEDKFEDHSAITGIGMSRIGRRLMVPPLSLTIEAAEQAV
ADAGLTFDDIDGLSTYPGLDIAGMGEGGVSVLEGALGLRPTWINGGMDTF
GPGGSVIAAMMAISAGLARHVLCFRTLWEATFGQLVKEGKMSPPMSARTN
SWQQPYGATSAAHTLAQNAGRHFHRYGTTRETLGWIALNQRANAALNPTA
IYREPLTMEDYLSARTITTPFGLYDCDVPCDGAVAVIVSAVDAARDLPRP
PIRFEAVGTQIIERLDWDQTTLTHEPQVLGQSAHMWSRTSLRPSDVDVAE
LYDGFTFNCLSWLEGLGFCGIGEAKDFLDGGRNIARDGIIPLNTHGGQLS
HGRTHGMGLIHEAVTQLRGEAGERQVEDARVAVASSGGLTPSGVLLLRRD
D
118472660YP_889604.1 formate/nitrate transporter [Mycobacterium smegmatis str. MC2 155]MSYVSPSDFVGKMIDAGEAKAHMSTRDTLIRAYMAGAILAIAAAFAVTIT
VQTGNALVGAILFPVGFCLLYLLGFDLLTGVFTLVPLALLDKRRGVTVRT
VLRNWGWVFLGNFAGALTVAFMMAIVFTYGFSVDPNEVGQRIGEIGHSRT
VGYAEHGAAGMLTLFIRGVLCNWMVSTGVVAAMMSTSVSGKVIGMWMPVM
LFFYMGFEHSVVNMFLFPSGLMLGGDFSIADYFIWNEIPTAVGNLVGGLT
FVGLTLFATHARTAAPRFSIPAVAEPHSAEARKISA
118472659YP_884902.1 racemase [Mycobacterium smegmatis str. MC2 155]MSLLEGVRVVSFTHFLQGPSATALLADLGATVIKVEPPSGAFERSWSAPD
AYLNGESVFFLLGNRNVESVVVDLKDPEWLEVVLRLLDEADVLIESFRPG
VMDRLGLGWERLRERNSRLVYCSLSGYGSDGPYKDRPGQDVLLQSMAGIA
SVTGTADRPPTPVGASLVDQHGAVLGAFGILAALHGRDRTGQGTRVESNL
LSAAMDLQIEPLSYFLNGFDGIRSATGISSPYYKSPYGVFATADGYLTLS
LNALEKLAELFEDNWFRSIGEQSSYARREEINERVAVHLGKRSTEEWTTL
LAAAQMWFAPVNGYAEVVDDPQVNHNGSVIEIQHPRAGAVKLLAHPITYD
GQRPGVRSTPPELGGSNRKVLAELGYSTEHIDRLQAKVQK
118472658YP_887764.1 ferric uptake regulation protein [Mycobacterium smegmatis str. MC2 155MPSRAEFEAQLRMTDLRVTRPRIAVMEAVHANPHADTETIYSVVRGSLPT
VSRQAVYDVLHALTAANLVRRIQPSGATARYEARVGDNHHHVVCRNCGSI
ADVDCAVGEAPCLTPSNDDHALDGFLLDEAEVIYWGRCRECSVDGP
118472657YP_886375.1 LacI family transcriptional regulator [Mycobacterium smegmatis str. MCMARRSVTSFDVAKKAGVSQPTVSRALRNLPGTSPETRERVRTAALELDYI
PSASGRTLSTRTTQRVAIVAEALTNPFYPELVEPLRNALGEYGYRAVLVA
DRADDPVTIDALADGSYDGVLLCTVTRRSTLPRDLTERGVPHVLVNRILD
VPESSSCSFDNLAGGRLVGEFLAGLGHQRIGALHGTVDNSTARDRASGLR
SSLRSHGLHVRRTDLRRVPFSYDAGHRAALEFLDRPDRPSAVFCGNDVIA
VGALSAAKALRIRVPEELTIIGFDNIGAAGWGTVDLTTVHCDRDELARVS
VELLLRAIDGAEPEQHVIAPGGMVERGTHGAPGC
118472656YP_885123.1 major facilitator superfamily protein [Mycobacterium smegmatis str. MCMTTIDNEVGQKVGAVSPARVATASFVGTAIEWYDFFIFGTAAGLVFGVAF
FPNLSPLSGTLAAFATFGVAFFSRPAGAIVFGHFGDRIGRKKLLVLSLLL
MGSATVAIGLIPTYDQIGIAAPVLLVVARLVQGFAVGGEWGGAVLMAVEH
APPKRRAFYGSFPQAGVPAGLVLATVAFLIVERLPDDEIMAWGWRVPFLA
SSALLLVGLYVRLQITESPEFEQIRRNDQVVRRPIVDVLRSHKRPLAVGI
LTQAASLVPFYLVTVFVLSHGPEELGVARETILMSLLVACVLDIFTVPYV
SIVADRMGPRKMLILGSLYMAAIGYPFFWLLSTGEGWAVLVAMILIVTVG
HAVTYSAVAAYVSRLFPADVRYTGASVSYQMGGVVFSAPAPFIAVTLWSA
THGHWSLAAYLAAACLATVFALMFTKTAKVSY
118472655YP_890179.1 hypothetical protein MSMEG_5953 [Mycobacterium smegmatis str. MC2 155]MNSTRWLDLGAITLAAAIALGIAGISRPEVVTTPYSTSSSVREDHAPPDT
RPLALFIGDSYTAGESSAELSYACRAALRMGWLCALSAVGGTGYISGGPA
NRWDDPYTGKSLSFIERIPGLSAKYDPDLVVLDGGRNDDFAPRTYAFEET
VSTLGEVRRAWPRAQIVFVRPRFLDDPTDDLGMTDEFMARLKATPDAKGV
IFIDPLSTLSGTDTSDLLASDKIHPNAEGEKRILAALIEALQTRNVRPPS
118472654YP_888210.1 hypothetical protein MSMEG_3922 [Mycobacterium smegmatis str. MC2 155]MTDRHAEKPPLLRRVWEAIIGEFTPPSTPRPTPSEAEFTEGYLAVGMIND
AIEDGPGGDVQGPDKLVISADIPGHGTIYRTRSCPLSMPGSGLKLIGHSI
RFRHTTFDPDYSNDIQVTRWPPEVRKALEPVRYEGPGALRARAWGLLAGC
NFLVMWAGIALTPILLCGIMFGGDMFTDLPAWFHPGVALASSVGAVPLGL
FLVAVCNVHRDAALSRTRSRRSPGHETRSSSSGIADDEPCG
118472653YP_887581.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein [MycobacteMTSTVAAPAQTGTAQSLTLSKLVKTYSSRGRESFTAVKGIDLDIRPGELV
ALLGPSGCGKTTTLRMIAGLETVTSGSIKIGDREVSQLPAAKRGVGVGFE
SYALYPPMSVRENLLYGLKARKVKGAEEMVAAISRRLEMDDMLELRPAGL
SSGQKQRVALARALVRNPPVLLLDEPLSHLDASARQRVRRELKVLQREFG
YTTIVVTHDQVEALSLADRLAVMDAGVVQQFGTPDEVFDDPANLFVAQFV
GEPQINVVRGTVRVEGGRAHVEIGSRAGALPTTVTGVADGTPVSVGIRPQ
DCALRPADATGGVSATVAYFEHLLEFGLATSTVAGVEEGIVVQTPALESY
EPEQQVVVTAPPERVYLFDAESGERLR
118472652YP_888191.1 L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium smegmatis sMHVLESAPGRNSRTLNLRPPQGDDAIGIRDIAEATEVLDLNSTYAYLLLA
TDFSATSIVAECDGDLHGFITGYHPPPRPDVLFVWQVAVAPSAQGTGLAS
AMIDNLVQRVRSDRGGRPITVEATVSPGNAASRAFFGAFARRHGVPLIER
PHFDSELLAADGAHEDEPILRIGPIGV
118472651YP_886140.1 hypothetical protein MSMEG_1768 [Mycobacterium smegmatis str. MC2 155]MTAPTLTALALVCSLKRSPAESSSDLMARHVCDDLGAAGVGTEILRCADY
TIEPGVEADMGGDDQWPRIREKILGADILVLSTPVWVGHPSSITQRVLER
LDAELSNTDDAGRPVLAGKVVLVAVVGNEDGAHKTVADVFQALNDMGYSI
PAQGCTYWNGEAMQGVDFKDLDTVPDPVAGATAAAARNAAHLAGLLSTGP
YPRYE
118472650YP_885450.1 hypothetical protein MSMEG_1054 [Mycobacterium smegmatis str. MC2 155]MPSPRNSLILHGCRAKSSHEAHHFLWRFRQFPVKLPASCR
118472649YP_884896.1 shikimate transporter [Mycobacterium smegmatis str. MC2 155]MSRAGNDAAEKPPNQARKAGIAALVGTTLEWYDFLIYGTAAALVLNSQFF
PGVNPTAGTLAAFASYAVGFLARPLGGIVLGNMGDRLGRKRMLVFTIVLM
GVATTLIGVLPNYDAIGVFAPILLIVLRLLQGFGAGGEYAGAVVLSVEHG
DQKRRGMAGAWAPTGFAIATLLSTGVFQLATLLPDDAFHTWGWRVPFLLG
AVLLVVGYFIRRSIDETQAYEDAVAAEAEGTAEQTKIPVLDAIRRSPRSF
LVVVGSRLAENGFAYLFPVFAVGFAVNSLGVSSSTTLLAVVIASAVQIGA
IPVWANVSDRIGRRPVYAAGALISVLWLVPFFLLLESLSPALLVLGFVVG
LGILYPAMLAPQAAYYAELFDTRTRLSGFAFAREIGSVLAGGFLPLIATA
LIAAFGHWWVIVVYLAVLTLLTLVALAYGPETNRRDIVSPNETDATASGT
EVRVAPR
118472648YP_885020.1 hypothetical protein MSMEG_0609 [Mycobacterium smegmatis str. MC2 155]MTSERLGEFLRARRAQLNPEDVGLRDFGGRRRVAGLRREELAQLAGVSVS
YYTRLEQGQAVNASDAVLDALADALQLNVHERKHLRDLATQRAQPVRKPP
AERVSPLTRDLLRALGDVPAMVVGRRTDVLAWNEAGHALLAGHVDREAVE
RPAERPNLARMMFLDPHTRELYADWPRKARAVVGNLRYVAGRHPEDALLA
ALIGELTVKSEEFVTLWADHRVKRCEADTYDLRHPIVGPVTITQQNLVVA
RSPEQSLCIITTAAGSASEDAMKLLIRASRSGQRHPAPQRA
118472647YP_890259.1 nitrilotriacetate monooxygenase component B [Mycobacterium smegmatis sMTATQPIDPRTFRNVLGQFCTGVTVITTVHENVPVGFACQSFAALSLDPP
LVLFCPTKQSRAWKAIEATGRFCVNMLHENQQHVSAQFGSKAADKFAGID
WHPSKLGSPVIDGTLAHIDCTVHSVHDGGDHFVVFGAVHSLSEVPKTKPR
PLLFYRGEYTGIEPDKNTPAQWRDDLEAFLTATTDDTWL
118472646YP_887394.1 excinuclease ABC subunit C [Mycobacterium smegmatis str. MC2 155]MPDPATYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADI
TSLAPRTRQMVMTAGSVEWTVVTTEVEALQLEYNWIKEFDPRFNVRYRDD
KSYPVLAVTLNEEYPRLMVYRGPRRKGVRYFGPYSHAWAIRETLDLLTRV
FPARTCSAGVFKRHKQIDRPCLLGYIDKCSAPCVGRVSAEQHRQIVLDFC
DFLGGKTDRLAKDMEQQMTAAAEQLDFERAARLRDDISALKRALEKQAVV
FGDGTDADVVAFADDDLEAAVQVFHVRGGRVRGQRGWIVEKSSEPAATGD
ADLGQSGQEQLVEQFLTQFYGEQAELGSASDTGGDEATNPVPRQVLVPVL
PPNADELATWLSGLRGSRVSLRVPVRGDKRALAETVQRNAQEALAQHKLK
RAGDFNARSEALQSIQEALGLADAPLRIECVDISHVQGTDVVASLVVFED
GLPRKSDYRHYAIREAAGDGRSDDVASIAEVTRRRFLRHTSDSQPDPSAE
QRPRRFAYPPNLFVVDGGAPQVNAAAAVLEDLGVDDVAVIGLAKRLEEVW
VPSEPDPVILPRNSEGLYLLQRVRDEAHRFAISYHRSKRSKRMTASALDS
VRGLGEHRRKALVAHFGSVARLKEATVDEITAVPGIGVATARAVQEALGV
APQNGTAPDPAPGTGDPQTPADPHSAATAADIEDDRHATGATGPQMNGSE
QQVDRV
118472645YP_888914.1 AP endonuclease- family protein 2 [Mycobacterium smegmatis str. MC2 15MTDLKIAGAPISWGVCEVPGWGHQLDRQRVLSEMRTAGLTATELGPDGFL
PSDTGELTALLGAHDLSCVGGFVPVVLHDAEHDPADDLAGPLASLRAANA
GVVVLAAATGADGYDSRPTLSERQWATLLSNLDRLARIADEAGLLAVLHP
HVGTMVETREDVDRVLNGSQIPLCLDTGHLLIGGTDPLELAKAVPHRIKH
AHLKDVNAALAARVRAGEVSYTDAVRAGIYTPLGTGDIDISGIVSVLRDN
GFDGWFVMEQDTILDAEPTDEGPLRDVRTSVAYLGTLTA
118472644YP_890807.1 hypothetical protein MSMEG_6595 [Mycobacterium smegmatis str. MC2 155]MPSTLRTRLSSRHRPGVLLAALLLTAGAAVACSAEDAAAGDAQAPGTASA
IPDNTEVIAAIEADPALSAALPPAIAQSKTINLGSNIQSAPNNFYAGDGK
TPIGYEVDLAKAIAAKLGVQAKHQDMAFGSLITSLQSGRVDMTMAAMNDT
KERQQQIDFVDYFSSGITIMIQKGNPENITGPDSLCGKNVAVVQGTSHQK
FAAAQSQRCEQEGKPAVNVTATDSDTQNQNQLRTGRVAAILNDLPSAVYI
SRTAGDGNAFEVVPGPPIEGGPYGIGFNKDNVALRDAVAKALGELMTDGT
YETILQSWGVEQGALKEPAINGGS
118472643YP_887244.1 permease membrane component [Mycobacterium smegmatis str. MC2 155]MTTTAPDTERVALPAEPSSRLGLGRWLIQPLVCVAAVAGSLLYVEVADVS
ESERRALGIGNLLTLLREHMVISVAATVLTCVLAIPLGIALTRGSMRRYA
KPIITVAGFGQAAPAIGLIALGAVLFGIGTTGSIAALTVYGALPIIANTV
IGLDGVDPRLVEAARGMGMSSFSALLKVELPLALRVIVAGVRTALVLIVG
TASLAAFTGGGGLGQLITVGIRLQQTTTLVVGAILVASLALFIDWLARVV
EMLAAPKGLG
118472642YP_887101.1 TrkB protein [Mycobacterium smegmatis str. MC2 155]MKVAIAGAGAVGRSIARELLESNHEVTLLERNLDHIDVDAIPAAHWRLGD
ACEITMLESVRLEEFDVVIAATGDDKVNVVVSLLAKTEFAVPRVVARVND
PRNEWLFDENWGVDVAVSTPRMLASLVEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKPVKRLELPRDAALVTILRGARVIVPEADEPLEGGDEL
LFVATTEVEDELLEVLLRPTRR
118472641YP_886159.1 STAS domain-containing protein [Mycobacterium smegmatis str. MC2 155]MPTISVAKRSSPHSGSHAPQRAHFTTEQINTATAVVTVHGDLDASNAGLL
TDYALKALTRNAKLVLDLSDVAFFGAACFTALHTLNVRCAGADAEWVVVP
SKAVTRVLRICDPDSGLTTAPDVVSALSRKSDQRPLQLVENT
118472640YP_887783.1 thiol peroxidase [Mycobacterium smegmatis str. MC2 155]MAQITLRGNPINTVGELPAVGSSAPGFTLTGTDLGEVTNDQFSGKSVLLN
IFPSVDTPVCATSVRTFNEKAASSGATVLCVSKDLPFAQKRFCGAEGIEN
VTTASAFRSSFGEDFGITIADGPMAGLLGRAVVVIGADGNVVYSELVPEI
GQEPDYEAALKALG
118472639YP_888278.1 integral membrane transporter [Mycobacterium smegmatis str. MC2 155]MSPSVPDAPTDTSARGSGRRRTVIASMVGTTIEWYDFNIYGSVAALVFGK
LFFPDMAPAVGTLLALATFGVGFFARPVGGIIFGHIGDRVGRKAALVTTI
LLMGAATVAIGLLPTYSTIGILAPILLVLCRLIQGIGIGGEWGGAVLMVV
EQDGAEHTRGSAGSWTQSASPIGFLLSTATLSAVSALMTEEQFLAWGWRV
PFLLSAPLVLVGLLIRVKIMESSVFTRSRRHGTQEAKAPILQVLRYAPKM
ILLVVLLGLGQQVAYFVINVFSLSYVTQHTDISRSAVLNAISVGAVVQLL
SILCFGRLSDRLGRRVPFLVGGVGMAVWAFAVYPLMGTGNFALMVLAVSV
AMVFQGAMYGVLAAFIAELFDTRFRYTGVSLGYMLIGVVGGGFAPMIAST
LLDTTGSVTAVAMYISLASVLTVIAAYLAPETSERDLDNVERASDSAPEP
SEPVTKTV
118472638YP_886450.1 cell division protein FtsX [Mycobacterium smegmatis str. MC2 155]MRFGFLINEVLTGLRRNVTMTVAMVLTTAISIGLFGGGLLVVRLADQSRD
IYLDRVESQVFLTDDISANDPTCDSDPCKALYRKIDDRDDVRSLRFLNRE
QAYDDAIKKFPQYKDVAGKDAFPASFVVKLVDPENHEEFDQAMVGQPGVL
NVLNQKDLIDRLFAVLDGISSAAFAVALVQAIGAVLLIANMVQVAAYTRR
TEIGIMRLVGATRWYTQLPFLVEAMLAALIGVILAIVGLIAVRAMFLEKA
LDQFYQANLIAKVDYADILYYSAPWMLFLGLAMSGVTAYVTLRLYVRR
118472637YP_889637.1 KDP operon transcriptional regulatory protein KdpE [Mycobacterium smegMTAPIKTRVLVIDDEPQILRALRINLSVRGYEVRTAASGAEALHSAADHR
PDVIVLDLGLPDMSGIEVLHGLRGWLSAPVIVLSARTDSSDKVEALDAGA
DDYVTKPFGMDEFLARLRAAARRAAVPETDQPVIETTSFTVDLAAKKVIK
NGAEVHLTPTEWGMLEMLVRNRGKLVGREELLREVWGPAYATETHYLRVY
LAQLRRKLEDDPSHPVHLLTEAGMGYRFEA
118472636YP_884502.1 1-phosphofructokinase [Mycobacterium smegmatis str. MC2 155]MIVTVTLNPSLDRTVTLTAPLTRGAVQRVDSVTVEAGGKGINVAKALTSA
GVDALALLPAATDDPLLTALRCADVPFAAVPIAEPVRTNIAITENDGTTT
KLNERGATLDAAALDAITRCVVDEAQHAAWVVLSGSLPPGVPPQWYADLV
AKLAPLPCRVAVDTSDAPLAALASKLSTASPELMKPNVEELASISGVAEA
DLETTVAEGDLSLVVAAAVKLVERGVGAVLATLGAAGAVLVDGTGAWFAA
PPPITARSTVGAGDASLAGYLRAEVGGAEPSQRLRMAVAYGSAAAALPGS
ALPVPAQLDVDAVRVTGLITTNREVLQ
118472635YP_885160.1 hypothetical protein MSMEG_0754 [Mycobacterium smegmatis str. MC2 155]MGDLLGPDPVYLPGDPAAEEELAAGEKAAVVAAAHPSASVAWATLAEQAL
DDDKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPFSHEPNQGFLRCVAA
LARAADDIGETDEYQRCLDLLDDCDPTARRELGLG
118472634YP_890459.1 hypothetical protein MSMEG_6240 [Mycobacterium smegmatis str. MC2 155]MTPSKILDLVAAAFGELLRRAGVATSPAEVIEVRRVLGLLGARDQEALRA
ALRATCAKYVREQRGFDRAFDAMFGVASIVTEHDVADPSRAHTGSGLPDH
LEIDEDQEIGRYAEYNERAAEVGDHFDTPDADKGFNPHKDDDDFSVSGAD
NQLSVSAESDAGRRGVRYTVEVDRAASSLAGDLADSVAPVVAGALHWDDP
ESILAWLDAYDPARTYGDDAGDQPLTAEQLDQLTQAVESFVAALADRCGL
TAEPDTPAGPTDATVATDVDLACHEVLRRMRGAPRPRPAEMRGRLDMRRT
TRHSLRTDGVPFRLITRTPRPDRVRLLVIADVSLSVRPVTAFTLRLAQAM
HRRAHRCRVMAFVDRPVDVTEILLQTGGDDALAAVLAEAQIDLEASSDYG
QVFDEMLSAQAEALDSRTAVLIVGDGRSPGLPPRTDSLRALRRRVHRLAW
ITPEPTRYWRQATCAMPDYAEVCDKVVVARDAEQLIARAGELAHALS
118472633YP_886737.1 AsnC family transcriptional regulator [Mycobacterium smegmatis str. MCMVEAYVLIQTEVGRAEVVAKQLASLAGVVSAEYVTGPYDVVLRVSADTLE
ALRADVVPSVQQVAGITRTLTCPIASGT
118472632YP_886822.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMADIGRSTLVLDALAEASKPLTLSELATRTGLPRSTVHRIVQSLERSLYL
VRGVDRHGYSLGPGLLKFGMNAHLRLLAGNRPLLARLVREVGENVELAIF
SGREVVVVDQLASVNRLHGVTKVGKSFSLHASCIGLALLAHLPDDQVAGL
LSPPLQRFTEHTVTDLPAIMGRLDEVRRTQIAVDTEEHDVGICAVATAFP
GPTGALQAVAVVMPTARFRAKRERAVESLQRINPLLAHRN
118472631YP_890162.1 hypothetical protein MSMEG_5938 [Mycobacterium smegmatis str. MC2 155]MGPSCRVTPTRNHSRIRARACNQVAARGKAATWLPQSELFERVGHRRRRH
VDAALCVEIDDGLVDLLQILRHLRIAREERPVQVVGAIVGLPGDVGQRPV
GLGMRGQVRAGGRRHRADGARDPTLAALIGLGVRHRDREPGGEDAARAHA
VQAATDSACGHLLHRSLLRSAIFSIATKGLTDACEAKQPVPAATWTRRLP
AHA
118472630YP_890890.1 RNA polymerase sigma-70 factor [Mycobacterium smegmatis str. MC2 155]MDAESREWLRLLDAGACPADRRTAIERLHERLLRVARREVHRRHTAITGS
ELDDIAQQAASDATLSILGKLDSFRGESRFTTWAYKFVILEVAHKIGRHH
WRHPPVALDTEDWNRLPERFGIDPSEHAEAAELSAAINRAVEATLTERQR
QMFVAIVIQGTPLDALVVKLGVSRNAIYKTIFDARRKIREFLVTNEYLTN
HVALERP
118472629YP_886878.1 ribosome recycling factor [Mycobacterium smegmatis str. MC2 155]MIDETLFDAEEKMEKAVSVARDELGSIRTGRANPGMFNRINIDYYGSMTP
ITQLASINVPEARLVVIKPYEASQLRAIEDAIRNSDLGVNPSNDGNIIRV
AIPQLTEERRRELVKQAKSKGEDAKVSVRNIRRKAMEELSRIKKDGEAGE
DEVSRAEKDLDKSTHTYTAQIDELVKHKESELLEV
118472628YP_886944.1 cobalamin biosynthesis protein CbiM [Mycobacterium smegmatis str. MC2 MHMSDGIVNVQTSLVFGALAVAALGVCALRARDELDERTVPLAGLVAAFI
FAVQMVNFPILPGVSGHLLGGALAAILVGPYTGALCIAIVLVVQSLLFAD
GGVSALGTNITNMALIGVAAGYATAVVLSTVLRGRGAAGSPPDRHIGVVA
FVAALVGTVCAAMGFVVEYVIGGVATTSIQAVAGYMFGTHVLIGIGEGII
TALTVTAVARVRPDLVYLLRRQRQEVAA
118472627YP_887222.1 hydrolase [Mycobacterium smegmatis str. MC2 155]MGENLVVAAVQPRVLDGDVEANVASHVEAIVSADARLVVFPELSLSGYRA
DAQPVDLAGDGLAQLVRACAATHSVALVGAAVETSGGRFIAMVQVDGTGV
DVAYRKTFLSGDESRHFTAGDGPSVIEVDGWRVGMGICRDTGIDDHVRGT
AALGVDVYACGVVHHATELAEQQRRGRNISAVCDAPVVMASFAGATGGGF
TKTAGRSAIWAKDGSVLAEADACPGGMAHTTLQRTVIAARRARRASR
118472626YP_890038.1 monooxygenase [Mycobacterium smegmatis str. MC2 155]MSKRPLYFSAFVMNTASHVLHGLWRAPEAQNHRFNELKHWTSVATSVENA
GFDLLFFADVFGLRSPWNGNWRKAVEGGIQIPVNDPSVLASALAAATDNL
GIVFTSSIVQDHPFNFARRMSSLDHYTDGRLGWNIVTSFNANVYRSFGHE
DVLAHDQRYEWANEYVEVAYKLWEGSWDEDGLVQDKERSIHADPTKIHKI
NHVGKRFKVEGPHFVSPSPQRTPVLFQAGSSPAGQLFSARHAEGVYISSP
SPEAAHGLTTESRALAAANGRDPEDITFAQGLSFVIGETHRDAVKREDEI
KRYLDLEGVALHALGDAGVDAGHLSLDTPISQLGEFKGVQSFKRWAAEHS
GNDDPTIRDMAWVLEGANRVVGTAEEIADRLEEWREAGVDGVNVYHATVP
GSFLEVSQRLFPTLRERGLISNDKSGTLRHKLFGRGDRLPGTHPAARYRG
AFGDNDLLDGVEEPIAARS
118472625YP_885363.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MKVRAVLQIVIAVVAAVGCVVSWVASRATVEVAPVLPGEPVTYSVTYSAP
MLTLALLLATVAGVLAVLGVANALRR
118472624YP_886049.1 cytidine deaminase [Mycobacterium smegmatis str. MC2 155]MNWNALRSKAIEVSRHAYAPYSGFPVGAAALVDDGRTVTGCNVENVSYGL
GLCAECAVVCALHSGGGGRLVALSCVGPDGGVLMPCGRCRQVLLEHGGPE
LLIDHAHGPRPLRELLPDAFGPDDLGRR
118472623YP_886430.1 phosphotransferase enzyme family protein [Mycobacterium smegmatis str.MTETRDPASLTGGLVDVLAPVVGAGVSVENLRELTGGASRTTWSFEAVTA
SQRRALILRTGPPDEVHAGMELEAGAQRAAAAAGAPVPHVLVADNSTAAL
GNPYLVCDFIPGETIVRRIQRQLDAAGRAKLLTQCAQALAAIHRAEPPTD
IGLTELDQVGQWRDQLDEMGDTTATFEWAFRWLAANRPPASPPRLIHGDF
RMGNLIVDGSDLAAVLDWELVHIGEVYEDLAWFCIRAWRFGATESHAAGG
LGSIENFLTAYEDAGGMTLDRDAIRWWLVLATLRWGVICLYQAERHLSGQ
TRSVELATIGRRVCETEWDILTLLDGSTA
118472622YP_886935.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDLTQRLAGKVAVITGGASGIGLATGRRLRAEGATVVVGDIDPTTGKAAA
DELEGLFVPVDVSEQEAVDNLFDTAASTFGRVDIAFNNAGISPPEDDLIE
NTDLPAWQRVQDINLKSVYLSCRAALRHMVPAGKGSIINTASFVAVMGSA
TSQISYTASKGGVLAMSRELGVQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHIPLGRFAEPEELAAAVAFLASDDASFITGSTFLVDGGIS
SAYVTPL
118472621YP_885614.1 ISMsm6- transposase [Mycobacterium smegmatis str. MC2 155]MAYVRKVRTASGAVAVQVARKDAGKVVILAHLGSAHTDAELGILLEQAKA
MVIGGQVALDFEVAARAQSMADVADFREQRVLGEKSGPSAAAPVVPPGRT
VGASSRLLYDLLGHVYDWHGFDTVGDAVFRDLVIARIVEPTSKLDASRVL
ADLGAQLVSYKTIDRHVRTIHARGHRDVIAEKCFAYATDCGGLSLILYDV
TTLYFAAESEDSLRKVGYSKERRVDPQIVVGLLVDRTGFPLEIGCFEGNT
AETTTIVPIITSFLERHNLVGTPMVVAADAGMLSQTNLTALDEQELSFIV
GSRMTKAPGDLESHFHWNGDVFTDGQIIDTVTPRHGNTRVNDIKKRAEPV
WDPERDTGAWRAIWSYSAKRARRDQKTLAAQEARARAIVAGEKKAKTARF
VKTHGADRALDQASLARAQSLVGLKGYVTNIPVTVMPAAEVIAKYHDLWH
VEKSFRMSKSDLDARPMFNRIRDAIEAHLTIVFAALAVSHTIQSRTGLSI
AKVIKLLRPLRSATITINGATQTFPPAIPDTERQILTNLGFNPGY
118472620YP_885747.1 alpha-mannosidase [Mycobacterium smegmatis str. MC2 155]MHVTSAESTERYTGPAEEPRQLVAVTYRGCTQPSIITVEGDGISGSARID
PGDGVVEVPVDVERPVPGEIRRAHASGLGFDFTVAEPGWTMYMISHFHYD
PVWWNTQAAYTSVWTEDPPGQCRQTHGFDLVRAHLEMARREPEYKFVLAE
VDYLKPYWDAHPEDRADLRRFIASGRVEIMGGTYNEPNTNLTSPETAIRN
FVHGMGFQRDILGATPATAWQLDVFGHDPQFPGMAADAGLTSSSWARGPH
HQWGPMQNDGDPERMQFCSEFEWIAPSGRGLLTHYMPAHYSAGWWMDTSA
SLAEAEDATYTLFTKLKRVALTRNVLLPVGTDYTPPNKWVTEIHRDWNAR
YVWPKFVCALPSEFFAAVRAELDERGITPSPQTRDMNPIYTGKDVSYIDT
KQANRAAEDAVLDAERFAVFAGLLGGADYPQAALAKAWVQLAYGAHHDAI
TGSESDQVYLDLLTGWRDAWELGTTARSAALQLLSEAVDGSIVVWNALAH
SRTDVVTMHLDRPFPGALLGTDGNVVPVVVEHDGLTVSWLARDVPSLGWR
SYRLADGAGGGWSPVLGDAISNERYRLRVDAARGGGVTSLVRDGRQLIAG
GGVGNELAVYDEYSAHPQAGEGPWHLLPKGPVVCSSAAPADQVRCYRSAV
GQRVVVRGRIGDLLRYTQTITLWNGLDRVDCRTVVDEFTGEDRLLRLRWP
CPVPGALPVSEVGDAVIGRGFGLMHDGVSDGRAVDSARHPWTLDNPAYGW
FGLSSAARIRINTGVRAVSVAEVVTADEDPGAARELMVALVRAGVTATCS
SADKPRYGDLTVDSNLPDTRFALGGPDENPFTAAVLADADMAYTDELKRQ
LDAHGTARVWVPATAPLTEVWVPGADLRGVRAVGVLILAGDLDAVIEDLV
DAEISVDQEILGDPGSFEDFTVAVLNRGVPGFAVDPDGTLHTSLMRSCTG
WPSGTWIDPPRRTAPDGSNFQLQHWTHTFDYAVVAGDGDWRDVGAPARAA
EFNRPLVAVPSEDGRGEHPGGLPPWGSLLEIEPAEVVQLGALKATGNPLA
SGSVHTVRPAEGITARLVEITGAATEVKIRSGLRNASGAVPLNLLEEPVD
GEPSHLHGYQIATLSTRMNLPQVLRGEHRQLAPEAEAAQPLYARYWLHNR
GPAPLGGLPAVAYLHPENAAAEPDSQVALRLTVASDCTDAPLHGRVRVTV
PPGWTVATTELSFVLPPDEYLETEVVIDIPPGAEPGLYPVRAELAVTGGD
AAGVPPSWRQCVEDVCVVTVGEPGGHILRMLAEPQPVEVAVGDVARLSMT
VGTDARADLSAEAHLISPWGTWEWMWPAAAGVDLPAGGSAEVVFDVAPPP
WVAPGEWWALIRVGCAGRLLYSPAVQVVVR
118472619YP_886702.1 methionine synthase- vitamin-B12 independent [Mycobacterium smegmatis MSIFATATGVGSWPGTTARQAAEIVVGELHTLSHLVELPARGIGADLIGR
AGALLVDIGIDTVPRGYRIAPGRSSALRRAVSLLGEDLDALEEAWEKAGL
RGSGRPVKLQAPGPVTLAAHLELPGGHRAITDPGALRDLGASLAEGVAAH
RAEVARRLETTVVVQFDEPSLPAALQGRLSGVTSLTPVHPVDEPLAMSLL
DACVAQADTEVAVHSCAADLPWKALLRSNIHAISVDVSTLTAADLDGVGE
FVDAGRTVLLGVVPTSAPNRRPAVEEIAKSVVAVTDRLGFAREVLRERIG
VTPACGLAGATPEWARTAIELAQKVADGFAQDPEGI
118472618YP_884918.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MKPYLYVAPAFVVFAVFLGAPVLQTVQYSFYNWDGLGVATVAGLKNYVAV
FGDERLRDSFLHAGVLMLFYAAAPVFIGLVLSALISRAHGLRSMSFFRTV
LFLPQVIATVVIATIWISIYSRDGLFNQTLRLVGLDSITRVWLGDHTFAL
IAIGLIGTWLNIGLCLVLFLSGIGNIPPELFEAARLDGAGRVREFVAITL
PSLRGQIAVALTLTVVSALKTFDLVFITTRGGPGNATSVPAFEAYNRAFN
TGQVGLASAMAVVLTIVIVVLTVLISRIAPREAE
118472617YP_884923.1 sugar isomerase [Mycobacterium smegmatis str. MC2 155]MTSPQAHHAEIPAQSAGGATILEIGQQPDVWREIAGRSDAETSEFLRPIV
ERPDLRVILTGAGSSAFIGEIVAASLRRNLKRRVEAIATTDIVAVPLDHL
ERDTPTLLVSFGRSGNSPESVATTELADELVTDVWHLIFTCDPAGTLART
HEGRANSRVVHMPARTNDTGFAMTSSLTSMLLSCLLTLGGVRPESAEALA
AAAEHVSGLSSDIRDLARAKKQRFVYLGSGPLTGLARESALKLLELTAGE
VVTYFDSSLGFRHGPKSVLDSDTLAIVYVSTDPYTRRYDLDIIAELREQL
GQEAVKAISAEPIPDALGPALVLPGLGGLDDAQVALPYLVFAQYLALFSS
LEYGKTPDNPFPSGEVSRVVKGVTIHPMER
118472616YP_888991.1 glycosyl transferase family protein [Mycobacterium smegmatis str. MC2 MAAIPNYNMGHNLNRLLPEVLAQGYDAVYVLDDASTDDSADVVRQFGSDV
KFVRSPRNQGAGANRNQIIDCVDDKTLIHFVDADMELRTDRIPDTAREVF
ARYEHRGVGMIGGLVCRHDGTQEPHNYGAVFSAWGGLTSGLPLMIDRLRD
RPRLAAAAQRIAAPLMKEWPDVLATPRPTPAYWLHEGNMLVDSGVLRSLG
GYDPDLRCHEAQDLAIRMEKRGIGRQFDPDIKVVHLHIDVRGKNRNRWAN
HAVRQLIRKHGVMRWLCDR
118472615YP_886322.1 hypothetical protein MSMEG_1955 [Mycobacterium smegmatis str. MC2 155]MTARFTLTPDRPVLLRPDGAVQIGWDPRTAVRVRPPDGMTPTQLTDLLHA
LQTGRSIEQLRSATEQFGDPALVGDVLAALDSAGVLVRRSASPARTATIR
IHGRGPLSELLAGSLRRSGARLQHTAESYATPRPGTDLVVLADELVTEPR
IVRELHRGRIAHLPVRVRDGTGLVGPLVIPGVTSCLHCADLHRADRDAAW
PALAAQLRGTVGSASRATILATAALALRQVDLVIRAVSGTAGPDDPPEPP
ATLDTTLELTADGYSMSFRRWSRHPDCQC
118472614YP_888735.1 hypothetical protein MSMEG_4461 [Mycobacterium smegmatis str. MC2 155]MNAAQRQFTAYGPSYWSAIAVFVIVAVVLVWLGRRQTERQARVLGRVLGG
VTAAIYVAMLVYTWIPPTLQRSVPLRLTDLATVAGAYAFWSQRQWAFELT
YYWGLTLSAQALISPVLKSPDFPHHEFLAFWSIHLLVVWAAIYLCWGRGM
RPTWRSYRFAVVVTATWTAVTMAFNGIAGTNYGFLNAKPATASLLDVMGP
WPVYVLTASALVLVVWALMTWPWESRRQ
118472613YP_888695.1 cupin [Mycobacterium smegmatis str. MC2 155]MRVLRAFTALTAVLAVAHAAHADPMPPNANQAPVVRKVFDQPSNVRGKVV
QAVTVSYPPGSRSAPHHHAKSAFIMAYVISGAIRSEVEGAQPARIYHAGE
TWSESPGAHHTISENVSATEPAELLAVFLLDAGDGPRTTDDPTR
118472612YP_887947.1 MerR family transcriptional regulator [Mycobacterium smegmatis str. MCMDLTTGAEPPVRPSSEPVQAGLFPDDSVPDELVGYRGPSACQIAGITYRQ
LDYWARTSLVVPSIRSAAGSGSQRLYSFKDILVLKIVKRLLDTGISLHNI
RVAVDHLRQRGVQDLANITLFSDGTTVYECTSAEEVVDLLQGGQGVFGIA
VSGAMRELTGVIADFPSERADGGEAIAAPEDELASRRKSRDRKIG
118472611YP_888082.1 inner membrane permease YgbN [Mycobacterium smegmatis str. MC2 155]MTTFVDWLRHDTAGLLTLAAVSIAVLLLLIIKMKVEPFIALIVVSVAVAL
TAGIPVAELVGTPAKSGDSLLETGFGGILGHITVIIGLGTVLGAMLERSG
GADVLTTRLLNLFGPKGAPLAMGITGVILGIPVFFDIGIFILAPLVYVAA
KRGGRSLVLYALPMLAGLSMTHAFLPPHPGPVAAAGLLGVSLGWIIIMGL
ACGIPAWFVSGVVWGAWIGKRVHVEVPEEFVPEEDEADTASPPSLLLVGF
IIVAPMLLILAATLADVLLDGGRLLSVLTLIGNPAIALTIAVMLALYLLG
IRRGITAPELAKISGVSLRPVGMILLVVGAGAFFGAVLRATGIGDALADS
MTAIGLPVIVSAYLISCALRIAQGSATVAIVTTAGIIQASVADGHHSPAQ
IALIVVAVSAGSIIASHVNDGGFWIVSRYFNMSVKDTLKTWTVLETTLSV
VGFAMAGLLWLVV
118472610YP_886730.1 NUDIX family hydrolase [Mycobacterium smegmatis str. MC2 155]MMPVDDLQEIPLSKDTTEKSKHTVRAAGAVLWRDASEHGGTTGHPATVEV
AVIHRPRYDDWSLPKGKLDQGETEPVAAAREIHEETGHTAVLGRRLGRVT
YPIPQGTKRVWYWAAKSTGGDFSPNDEVDKLVWLPVDAAMDQLQYPDDRK
VLRRFVKRPVDTKTVLVVRHGTAGRRSRYKGDDRKRPLDKRGRAQAEALV
AQLMAFGATTLYAADRVRCHQTIEPLAQELDQLIHNEPLLTEEAYAADHK
AARKRLLEIAGRPGNPVICTQGKVIPGLIEWWCERAKVRPETTGNRKGST
WVLSLSDGELVGADYLSPPDEK
118472609YP_885706.1 peptide chain release factor 3 [Mycobacterium smegmatis str. MC2 155]MTDTPALAPSANTSLSRRIAAEATRRRTFAVISHPDAGKSTLTEALALHA
RVITEAGAIHGKAGRRSTVSDWMEMEKARGISITSTVLQFPYRDSVINLL
DTPGHADFSEDTYRVLTAVDCAVMLIDAAKGLEPQTLKLFQVCKHRGIPI
ITVINKWDRPGRHALELIDEIQTRIGLKPTPLTWPVGIAGDFKGVLDRRG
GQFIRFTRTAGGATAAPEEHIPADAAHAAAGDDWDTAVEESELLSADGGD
YDRDAFLAGTASPTLFTSAALNFGVNQLLDVLVELAPSPNGALDVDGERR
DPDAPFSAFVFKVQAGMDSAHRDRIAYARVVSGTFERGDVLTHAATGKPF
VTKYAQSVFGQQRSTLDDAWPGDVIGLANAQALRPGDTLYRDVPVQFPPI
PSFSPEHFAVARGTDPSKHKQFRRGIEQLEQEGVVQVLRSDKRGEQAPVF
AAVGPMQFEVASHRMATELSAPISLEPLPYQVARIVDPEDADFMNRQPSA
EVMTRSDGVMLVLFSTPWRLEGFQRDNPDIKLRSLVAS
118472608YP_885520.1 hypothetical protein MSMEG_1126 [Mycobacterium smegmatis str. MC2 155]MAASQPVLEALGDHDYLLRFTQDYDAPVVVRVYADPTVVAQIAADETRVV
AATADYLIARQSLEDLPEQVDLDEVAAAYDDYVDDLHNRLNPPT
118472607YP_887953.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MIGIVALVVGIVLGLVFRPDVPEVVEPYLPIAVVAALDAVFGGLRAYLEK
IFDSKVFVVSFVFNVLVAALIVYLGDQLGVGTQLSTAIIVVLGIRIFGNA
AALRRRLFGA
118472606YP_886415.1 NADH dehydrogenase subunit J [Mycobacterium smegmatis str. MC2 155]MNSDLMLLAAEGARTSTSEAVVFWVVGTVALVGAIGVVAARKAVYSAVFL
ACTMISLAVLYIAQDAPFLGVVQIVVYTGAVMMLFLFVLMLIGVDLTESL
VETIKGHRIAALIAGAGFGILVIAGIGNVSVAGFSGLAAANSGGNVEGLA
ALIFTRYLWAFELTSALLITAALGAMVLAHRERFERRKTQRELAIERFQT
GGHPTPLPNPGVYARHNSVDVPARLPDGSESPLSVSTILPHRTVGSATNG
KR
118472605YP_886016.1 hypothetical protein MSMEG_1639 [Mycobacterium smegmatis str. MC2 155]MDELERTDEPNLVRPYTLTAGRTAPPVNLPLEAPVETLDTPNAPTWPGRD
VRGQIVELCTGSPSVAEIAAHLSLPLGVARVLIGDLVKQGYLRVHTTLED
SASFDERRELIGRTLRGLRAL
118472604YP_887632.1 hypothetical protein MSMEG_3324 [Mycobacterium smegmatis str. MC2 155]MTVQVTRNDGLTDEFARFGDRYIKHADGSLEVVRAGTMQPVAYPAGGWTE
VAGDEKRKPHGLFRHRS
118472603YP_887149.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
PAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIE
PSSKADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGL
GPASLVLFDVSTLYFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFP
LTVEAFEGNRAETATMLPVINAFKAAHQLTDVTVVADAGMISEANQVALQ
SAGLSYILGAKIPFLPDVVREWRDKHPDEAIPDGLVLTQPWPATSSEKAR
GIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPVKRNRYIQLTG
ATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFRM
SKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTA
RRYRTVKIKAGTQTLTAADPLPEDLRAVLIKIRADGAH
118472602YP_890838.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MSDHEVKMVVLSTENLDESIKFYETLGFSLKFRDGAHFAALDGGAVTLAL
ATPVDHPIPGKVVVGIKTADVDAAAKEIEATGGAIIKGPYDDAHERRAVV
YDNTGNGLVFYSPLKR
118472601YP_887359.1 aspartate carbamoyltransferase [Mycobacterium smegmatis str. MC2 155]MTKRHLLSAGDLTRDDATAILDDADRFREALLGREVKKLPTLRGRTIITM
FYENSTRTRVSFEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAG
ADALIIRHPASGAAQQLAEWTVEEDGGGPSVINAGDGTHEHPTQALLDAL
TIRQRLGSVEGKRVVIVGDVLHSRVARSNVTLLHTLGAEVVLVSPPTLLP
RGVENWPVTVSYDLDAELPAADAVLMLRVQAERMNGSFFPSAREYSVRYG
LSEKRQAMLPDRAIVLHPGPMVRGMEISFPVADSPQSAVLQQVSNGVHVR
MAVLFHLLVGADREAINV
118472600YP_887218.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMPRVSREQMQSNRAAVVQAASELIRERGMADVTVDAISARAGLTHGSFHK
QFASKQALLLEAICAAVDQRRAAVQKTVEEHGSDAPDVLKDWYLSEEHRD
NPATGCAVAALVGHAATVTDDALRDAYCRAVGDLLAMIEDGGTADAFGEV
ALMVGALELARATKGTPLSARFLESARQRLSRQE
118472599YP_886582.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MTTDPERLPYLAVDVDNHYYEPLDAFTRHLPKEFRSRGVQMLTDGKRTYA
VFGGVVNHFIPNPSFDPIIEPGCLDLLFRGEVPEGVDPASLMKVDRLTDH
PEYQNRDARVAVLDRQRLETVFMLPTFACGVEEGLKHDIGATMASIHAFN
LWLDEDWGFDRPDGRIIAAPIISLADPEKAVGEVEFVLGRGAKLVCVRPA
PVPGLVRPRSLGDPVHDPVWARLAEAGVPVVFHLSDSGYMAIPALWGGSG
VFKGFGKRDPLDMVIMDDRAIHDTIASMIVHQVFTRHPKLKVVSIENGSY
FVYRLIKRLKKSANNAPYHYKEDPVEQLKNHVWIAPYYEDDVKLLADTIG
VDKILFGSDWPHGEGLADPTSFTADIPQFPEFSHEDTRRVMRHNALELLG
DPDRTAPGARHLAASV
118472598YP_885695.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAWDTARTKQKLLDAAVHEFSEHGPLGARVDRVASRAGVNKERIYQYFGS
KQNLFSAVLEQEMIKLAAAVPLTPELAHDLGEFSGRIYDYHREYPHYLRL
LLWEGLDRNPLDGNPPAARDERAEHYAGDRRVVALAQADKTLRDDVAPAY
LLYVARSMAAWWLAVPAAIDLMLGTTVAGEGPDVRRKALVTLVNDAVRYR
KS
118472597YP_890946.1 transcriptional regulator YdhC [Mycobacterium smegmatis str. MC2 155]MPVPIERGKHRRSLLRDQAYVSIRDAIVNGTLAPGEKLRDPELEEWLGIS
RTPIREALARLETAGLVHTTPGRSTVVAAIEPQAVLNAQSVAAAMHALAV
RTAVPLMDKSDFDAMTAANHAFAQAISRGDPEAAMRSDDHFHGVAVQASG
NEVIEQVLEQVTPVLRRLEYLRFSALSGRESIEQHRRIVSLCRKRDAEGA
AAATEQNWQTLSQVVEKLAAEETDTDG
118472596YP_885306.1 dihydrolipoamide dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTHFDVVVLGAGPGGYVAAIRAAQLGLNTAIVEPKYWGGVCLNVGCIPSK
ALLRNAEIAHMFNKEAKTFGISGEATFDYGAAFDRSRKVADGRVAGVHFL
MKKNKITEIHGYGKFTGPNSLEVALNDGGTEKVEFSNAIIATGSSTRLVP
GTSLSENVVTYETQILSRELPGSIIIAGAGAIGMEFAYVLKNYGVDVTIV
EFLPRALPNEDAEVSKEIEKQYKKLGVKILTGTKVEGIADDGSTVKVTVS
KDGKTEELKADKVLQAIGFAPNVEGYGLEAAGVELTDRKAIGIDDYMRTN
VGHIYAIGDVTGKLQLAHVAEAMAVVAAETIAGAETLPLGDYRMMPRATF
CQPQVASFGLTEEQARDEGYDVKVAKFPFTANGKAHGLADPTGFVKLIAD
AKYGELLGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEAL
QECFHGLAGHMINF
118472595YP_885504.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MPVADRVRAAARVVLPHLYGEPGETRRQRIIRRVRIGIVIAACLVTLQSV
LLVLGAWRNDRQIERNMGVAAAEVLSAGPRRSTIEFVTPDRVTYRPELGV
LYPSELDTGMRIYVEYDKNNPELVRVRDRNAALAIIPAGSIAVVGWMIAG
AALVGLWLLQRRT
118472594YP_888108.1 excinuclease ABC subunit B [Mycobacterium smegmatis str. MC2 155]MGEHHRNLSVRSSTLVNMAFATEHPVLAHSEYRAVDEIVRTGKPFEVVSP
YAPAGDQPAAIDELERRIRAGERDVVLLGATGTGKSATTAWLIERLQRPT
LVMAPNKTLAAQLANELREMLPHNAVEYFVSYYDYYQPEAYIAQTDTYIE
KDSSINDDVERLRHSATSSLLSRRDVVVVASVSCIYGLGTPQSYLDRSVE
LQVGQEVPRDGLLRLLVDVQYNRNDVAFTRGTFRVRGDTVEIIPSYEELA
VRIEFFGDEIEALYYLHPLTGDVVRQVESLRIFPATHYVAGPERMAAAIE
SIEKELEERLAELENQGKLLEAQRLRMRTNYDVEMMRQVGFCSGIENYSR
HIDGRPAGSAPATLLDYFPEDFLLVIDESHVTVPQIGGMYEGDMSRKRNL
VDFGFRLPSAVDNRPLTWEEFAERIGQTVYLSATPGPYEISQAGGEFVEQ
VIRPTGLVDPKVVVKPTKGQIDDLIGEIRTRTERDERVLVTTLTKKMAED
LTDYLLEMGIRVRYLHSEVDTLRRVELLRQLRLGEYDVLVGINLLREGLD
LPEVSLVSILDADKEGFLRSTRSLIQTIGRAARNVSGEVHMYADKITDSM
REAIDETERRRAKQIAYNEANGIDPKPLRKKIADILDQVYREADDTESVE
IGGSGRNSSRGRRAQGEPGRAVSAGIVEGKDTSNMPRAELADLIKELTDQ
MMAAARDLQFELAARIRDEIADLKKELRGMDAAGLK
118472593YP_889118.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium smegmatis str. MC2MAALDALVRYDGRHVVVTGCSSGIGAKVTDQLRCLGARVTGLDLRAPDSG
AGPDAFREMDLADPDSVDAAAAAIDGPVHALFNVAGVSSGIGDPLLVVRI
NFLGTRQFTEALVDRIADGGSITSVSSLAASAYRENRAVTAGLVSTGSVD
EGLRWCAENPDALADGGYRLSKEAIILYGMSKAVELGARGIRVNCTGPGV
TDTPILDQLRSAYGQQYLDSFTTPLGRNSEPDEQAALLVFLGSAAASYVT
GQVIWADGGIIAQRETALIESTRATQES
118472592YP_885619.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMLRGKILDGVYGGLAAARPMLPPENELAAEFGVSRNAIREALELLRGEGL
ITRVQGAGTFVTGAKLSQRIDRLEGLAESLAGHQLPVENTVLSVRESVAS
PFVAAKLQLPEGAPILFIERLRSVGGVPLSLDTTSLRLGAVSVDDNLDRQ
DVFALIERELGMRLGWAEMTVESVSADADTAKLLQIRSGAPLLLLHRLTH
LEDGTPFDFETVRYRGDRCTLMTTAARGVDDPPQAPQEPPQ
118472591YP_890655.1 DNA polymerase IV [Mycobacterium smegmatis str. MC2 155]MFVSAAESASILHADLDSFYASVEQRDDPALRGRPVIVGGGVVLAASYEA
KAYGVRTAMSGGQARALCPQAIVVPPRMAAYTQASRDVFAVFHDTTPLVE
PLSVDEAFLDVSGLARVSGTPVEIAARLRARVREQVGLPITVGIARTKFL
AKVASQEGKPDGLLLVPPDRELAFLHPLPVRRLWGVGAKTAEKLRAHGIE
TVADVAELSEATLGSMVGGAMGRQLFTLSRNIDRRRVTTGVRRSSVGAQR
ALGRRGNSMSAAEVDAVVVNLVDRITRRMRAAGRTGRTVVLRLRFDDFGR
ATRSHTMPWATASTDVILCAARELVAAAAPLIAERGLTLIGFAVSNIDRG
GTQQLELPFAEQPDPVAIDSAIDQVRQRFGNAVLTRGVLVGRDPGLEMPM
LPD
118472590YP_888462.1 phosphoglycolate phosphatase [Mycobacterium smegmatis str. MC2 155]MLAVLWDMDGTLVDSEKLWDISMHALYARMGAVLTPEVRESTVGGSSETV
MRIVYEDIGLEPDPAAMAESADWLHAYTGELFEQGLPWRPGAQEMLDALV
AAEVPMALVTNTRRDLAERALNSIGRHYFSVSVCGDEVPSGKPAPDPYLR
AAELLGVPVARCLAVEDSVTGTTAAEAAGCPVLVIPNDVAVPHGPRRKQV
ESLSLLGVDDLRAIHAELGPERLSA
118472589YP_884562.1 mosc domain-containing protein [Mycobacterium smegmatis str. MC2 155]MADELLRVDSLHRYPIKSMLGESVTSLEVYLGGVDRDRHLAFIDQETGRV
ASAKQARLWRNLLKCRARIDDNGSVQVRLPDGTESSPEDDDFDDVFSKLL
ARPVRLLTSRPDGASLERADPEQVLMAGLDAEVDAPLLEIAEATPGDSFV
DLAPLHVITTATLERIGTEAARYRPNIVITTPPDYPAYSENDWTGREFTI
GGVRVKAMGPTPRCVIPTLEHGDLDRAQHALRTPAAENRVESFGLGELPC
AGAYLEVLGEGTVRVGDEFRPA
118472588YP_889165.1 ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium smegmatMVTPAKARPGTREEVDVASVESTEAPWVTIVWDDPVNLMSYVTYVFQKLF
GYSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLHAAGLWATMQQDR
118472587YP_887258.1 glutamine amidotransferase subunit PdxT [Mycobacterium smegmatis str. MTAHVGVLALQGDTREHLAALREAGAEASTVRRLSELAAVDALVIPGGES
TAISHLLREFDLLEPLRARIAEGMPCYGSCAGMILLATEIADAGVPGRAA
VPLKGIDMTVRRNAFGRQVDSFEGDIDFVGLDTPVHAVFIRAPWVERIGP
DVEVLARADDHIVAVRQGPMFATAFHPEVTGDRRIHKLFVDSL
118472586YP_887946.1 hypothetical protein MSMEG_3643 [Mycobacterium smegmatis str. MC2 155]MISLWARGSAAGVEAQTYVLVVLLSLSLCRRPDRAPERFGPRPCEPFPMG
GRLPAPLSRGIVAWCGPGCLRG
118472585YP_885938.1 hypothetical protein MSMEG_1558 [Mycobacterium smegmatis str. MC2 155]MKRMTVGAALGGALFLSAGMGIANAQPRDGQVDLALGTAGVLEDVPIGAA
SQVAAGVCDGDIGQITTLAETVDANGAQTNVCNNTIGAVEFRQNDGAPAS
AEEPQSNQQGTQESTEGSAEESTDGASAEGTGPSEDTDSSTAPTTTTTEE
ESGS
118472584YP_889401.1 nitroreductase [Mycobacterium smegmatis str. MC2 155]MEFTDVVRTTAAIRQFTGDPLPDDVLRRILDNARFAPSGGNRQGTRVVVI
RDRDTREALAELTITGSRRYIAQKRIGENPWNPLHPTAVTEADLAAVDVP
RATPLLDAAVVLVVCVDLGVVAAFDQDLDRIGVVSGASVYPFVWNILLSA
RNEGFGGVLTTMAIAEEPKVKELLAIPDDYAVAAVLPLGKPVHQPTKLTR
KPVSEIATRERFDGAPF
118472583YP_888712.1 cytochrome C oxidase subunit I [Mycobacterium smegmatis str. MC2 155]MTTHAPSAGELLARRPFPQRLGPRWTLLYKLVTTTDHKLIGMMYVVACFI
FFFIGGLMALLLRTELAVPGLQFLSNEQYNQLFTMHGTVMLLFYATPIVF
GFANLVVPLQIGAPDVAFPRLNALSFWLFLFGASIALGGFLAPGGPADFG
WTAYTPLSNAMHSPGAGGDLWIFGLIVGGLGTILGAVNMITTVVCMRAPG
MIMFRMPIFTWNILVTSVIVLVAFPLLTSALFGLAADRNLGAHVFDPANG
GTMLWEHLFWFFGHPEVYIIALPFFGIVTEIFPVFSRKPVFGYTTLVYAT
ISIGALSIAVWAHHLYATGAVLLPFFSFMTFMIAVPTGIKFVNWIGTMWK
GQLTFETPMLFSVGFLVTFLLGGLTGVILASPPLDFHVTDSYFVVAHFHY
VLFGTIVFATYAGVYFWFPKMTGRLLDDRLGKLHFWLTLIGFHTTFLVHH
WLGAEGMPRRYADYLPTDGFTTLNIVSTIGSFILGVSMLPFVWNVFKSWR
YGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
IERLRAESHPGRTQGGPGAVTLPQPQARSHPVE
118472582YP_886251.1 2Fe-2S iron-sulfur cluster binding domain-containing protein [MycobactMAKNHIKISANVADTVRPTVAGADERPGWHALRRLAARITTPLLPDDYLQ
LANPLWSARELRGRVLEVRRETEDSATLVIKPGWGFSFDYQPGQYIGIGV
FLDGRWRWRSYSLTSSPVTAHPKGRARTITITVKAMPEGFLSTHLVGGLE
PGTVVRLAAPQGNFVMPDPAPASVLFLTAGSGITPVMSMLRTLVRRDQIT
DIVHLHSAPTESDVLFGSELTALQGTHPGYRLRIRSTRTEGRLDLERIAD
EVPDWRERQVWACGPEGMLADAERVWKAAGVGENLHLERFAVKRAAPHGT
GGNVTFERTGKTVHADAAKSLMEAGEEVGIRMPFGCRMGICQSCVVGLVD
GHVRDLRTGVEHDAGSRIQTCVSAASGDCVLDV
118472581YP_887500.1 glycogen debranching protein GlgX [Mycobacterium smegmatis str. MC2 15MSDPTASPPAPMNMVWPGEAYPLGATYDGAGTNFSLFSEVAERVELCLIA
KDGTETRINLDEIDGYVWHAYLPTISPGQRYGFRVYGPWDPSKGLRCDPS
KLLLDPYGKSFHGDFDFSQALYSYDLEADPPGSGTPPRVDSLGHTMTSVV
INPFFQWGSDRAPKTPYHDTVIYEAHVKGMTQTHPGVPEALRGTYAGLSH
PVIIEHLQSLNVTAIELMPVHQFMHDHRLLDLGLRNYWGYNTVGFFAPHF
QYAATRNAGGAVAEFKTMVKAFHDAGIEVILDVVYNHTAEGNHLGPTINF
RGIDNAAYYRLLDGQPEFYKDFTGTGNSLNARHPHTLQLIMDSLRYWVLD
MHVDGFRFDLASTLAREFYDVDRLSAFFDLVQQDPVVSQVKLIAEPWDVG
EGGYQVGNFPGLWTEWNGKYRDTVRDYWRGEPATLGEFASRLTGSSDLYE
ATGRRPSASINFVTCHDGFTLNDLVSYNEKHNEANGEDNRDGESHNRSWN
CGVEGPTDDPEILALRAKQMRNIMATLMLSQGTPMIAHGDEIGRTQLGNN
NVYCQDSELSWMDWSLCETNADHLEFTRKVVAFRKQHPVFRRRRFFEGKP
IRSGDQVRDIAWLTRAGTEMTPEDWGAGLGTCVAVFLNGEAIPTPDARGE
RVVDDSFLLCFNSNDHPEDFVTPNGDYAAEWTADLDTADPVGNSDLVVKA
GEKISIQPRSVLVLRKTA
118472580YP_889397.1 hypothetical protein MSMEG_5152 [Mycobacterium smegmatis str. MC2 155]MSNTSNSIRSSPDVQSIDWENDEIHLESHFHRHDRGSGRSPGRGGPERRG
ERRAGPGSARADAEPAGGQPTRRRAGRRAAAAAGRRLRAHRNPGAGSRAA
ADRAGNPDPAAGAGHSARHGACRDRHRARGHPGRQRRGLARAVGRGHHPA
GARYADPAAADGQHPRRPRFAGAHRLAAGRPRPGRHQHRRQRGHGSRTRP
HRTRGFGPLGSRAAGAAADRRSAVTPELV
118472579YP_888857.1 nitrate/sulfonate/bicarbonate ABC transporter inner membrane protein [MTDTVTVVRAGPPETDDTTTPDSPTVVERDFRPSASESRRGRTRRLSVGI
RFVVPVLLLVAWQVAAAWELVSPSVLPGPLTILQSYRELWQIGDLQAALP
ISLQRAGLGLLIGGITGLVLGVAAGLWAVAERIYDAPLQMLRTIPFIAMV
PLFVVWFGIGEESKVALIVGASIFPVYLNTYHGIRAIDRKLLEVGQTFAL
SRRETIRLVVVPLAMPSILVGWRYAAGTALLALVAAEQINTTSGIGYILN
TANQFQRTDIIIAGILVYAALGILVDVIMRLIERAALPWRATHDGH
118472578YP_890362.1 N-acyl-D-glutamate amidohydrolase [Mycobacterium smegmatis str. MC2 15MSYDVIVRNGLWFDGTGRPPQVRTLGIRDGVVATVSAKPLDETGCPEVID
AGGKWVVPGFIDVHTHYDAEVLLDPGLRESVRHGVTTVLLGMCSLSTVYS
DAEDAADLFSRVEAVPRQFVLGALESRKTWSNPAEYVAAIDALPLGPNIA
SLLGHSDLRASVLGLDRATTRGVVPTDDELETMADRLDAALDAGMLGMSG
MDAAIDKLDGDRFRSRALPSTFATWRERRRLIKVLRKRGRILQSAPNVAK
AQEALNFFLESSSLFGRRRGVRMSLLVSADAKSSPGAARVIGMGTRLLNK
TLDAKVRFQHLPVPFELYSDGIDLPVFEEFGAGTAALHLRDQLERNKLLA
DPEYRRRFRRSFDRRKLGPTLWHRDFHDATIVECPDESLIGKTFGRIADE
RGIHPLDAFLDVLVDNGEKNVRWTTIVANHRPKVLDQLANDPAVHMGFSD
AGAHLRNMAFYNYPLRLLKRVRDAQLSGRPFLTTERAVYRLTAEVADWFG
VDAGTLREGDRADFVVIDPNCLNSDVDAYHEETVPFYGGLSRMVNRNDDA
VVATAVNGTVVFGKGEFRDGYGDTVKSGRYLRAGADSRLKTAV
118472577YP_886810.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MHAASSALLDALRAHGDRTALITAERHVTYRELADQVADASARLGTGRRL
VLLETSNDIATVVHYLAALAGGHVALPVAPGGDHTAITQTYSPDTVIDAD
GIRHRHDRPAHRLHDELALLMSTSGSTGSPKLVRLSHTNLRSNAAAIAEY
LGIRETDRAATTLPLSYCYGLSVLNSHLLRGAALILTEDSVLDDAFWELF
TEHRGTSFAGVPHTFELLDRIGFDDMSLPHLRYITQAGGRMAPERVRRFA
ELGQRQGWQLVVMYGATEATARMAYLPAELALTRPEAIGTPIPGGRFDIE
QLDGWPEGTGELVYRGPNVMLGYAHGPDDLALGATLDALRTGDIARRGAD
GLFEIVGRSSRFVKLFGLRIDLQRLESGLAEQNITALCTGDDDGVAVAAL
APASAAEVTRLVAAAARIPASGVRTTVVDELPRLHSGKPDYPAVRALASD
RTTTEVPAGEVTDLRTLFGEVLQLDPASIDPDASFIDLGGNSLSYVAMSV
RLERALGQLPAEWHRLPLSELERRAAPRRRWGATVETSVALRAVAIVLIV
GSHAELFELWGGAHVLLAVAGYNFGRFCLTPLPREQRSRHLRRTIAGVAV
PSIVWVAIALLITDHYHVTNLFLANKFLGPPDSMTAGRLWFVEVLVWILV
ALAAVCWLPAADRLERRQPFAFAAAFLAAGLALRYNLISFDLHDQACFTV
LAFWFFAAGWAAAKATQTWQRVAVTAVLAIGVYGYFGDSQRELMVLAGFA
LLIWVPALRCPAPVAAVLGVLAEASLYTYLTHYQIYPLFGDHRILGVLAS
LVVGVAVTYAVTAARTRWSRRSVRRPLGHQTLLHERGDDAAVELHETRGD
DAAATGRGR
118472576YP_891116.1 hypothetical protein MSMEG_6921 [Mycobacterium smegmatis str. MC2 155]MAQSEDPEDFIAPAAHRVRPGTLLLANTDLLEPTFRRTVIYIVEHNSGGT
LGVILNRPSETAVYNVLPQWAEVTAKPKTMFIGGPVKRDSALCLATLRVG
MQADGVDGLRHVQGRVVMVDLDADPEELAPVIEGVRIFAGYSGWTTGQLD
GEIERDDWIVLSALPSDVLIEPRIDLWGRVLRRQPLPMSLLATHPIDVSR
N
118472575YP_887986.1 hypothetical protein MSMEG_3683 [Mycobacterium smegmatis str. MC2 155]MADHDYITYEEFGRRFFEVAVSEDRVGDAIGAIAGDEFEIGPIAQGPGKI
AKVTARVKIQKPRVSREIGETIVFTIRIPLEIDMVIDLRIDRPRFMVFGE
IALRAHALAAKPLLLILDVKKPRPSDIAIHVTSKSLRAEVLRILAGVDAE
IKRFIAAHVAGEIDSPESEKAKVIDVAEELDSSWTGI
118472574YP_886913.1 deoxyribodipyrimidine photo-lyase [Mycobacterium smegmatis str. MC2 15MPTLLWFRRDLRCADHPAVLDAAQGDADVLACYVLDPRLTGSSGDRRLAY
LYGALRDLREQLGGKLLVTRGRPEQRIPELAAAIGAASVHVSGDFSPFGL
RRDEAVRAALADLPGDVGLYATGSPYLVTPGRITKDDGNPYRVFTPFFRA
WRDHGWRAPADSGPGSARWIDPSEVPGGAEIPEPPTDLELPAGETAARAQ
WRAFVRESLRDYSSNRNRPDLDATSRMSAHLKFGTIHPRTMAADLERDGA
GDGAAAYLRELAFRDFYAAVLHHWPDSAWWNWNRTFDAIETDEGPDAQRL
FDAWKAGMTGFPIVDAGMRQLAATGFVHNRVRMIVASFLVKDLHLPWQWG
ARWFLDQLVDGDIANNQHGWQWTAGCGTDAAPYFRVFNPTKQGEKFDPDG
VYIRRWVPELADPATVPDVHRIDGSRPADYPEPIVDHAQERAEALRRYGR
LS
118472573YP_888468.1 cysteinyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MQSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGPTATMYVCGITPYDA
THLGHAATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDW
RTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAY
IVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQ
LDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIALTRIGTGLDIQGGGS
DLIFPHHEYSAAHAESVTGERRFARHYVHTGMIGWDGHKMSKSRGNLVLV
SQLRAQGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSATALP
EAPDATDVIARVRQYLADDLDTPKALAALDGWCTDALSYGGHDTESPRLV
ATTVDALLGVDL
118472572YP_887453.1 thioredoxin [Mycobacterium smegmatis str. MC2 155]MSTLDITAEQFNDTVNDNEIVLVDFWASWCGPCKAFAPTFAASAEKHPDV
VHAKVDTEAEQALAAAADIRSIPTLMAFKKGKLVFNQAGALPPAALEDLV
QKIKEFDIDAAMREQAAQGGAEEV
118472571YP_889998.1 hypothetical protein MSMEG_5769 [Mycobacterium smegmatis str. MC2 155]MKIELGTVLGVSTAGCALAFCGAGMAAAAPDVVGQPYSDAVTAIEDGGGT
PHVAVTVGSRLPQDECIVTNAWTTTAVVPMTDDVYWERSDNVVQLSLNCA
GDHATATNPGASVASTLGREAKEAADEAATSEESELAEVSTPDE
118472570YP_884636.1 hypothetical protein MSMEG_0221 [Mycobacterium smegmatis str. MC2 155]MLMSLLVLAGCGENHQAAEPGWTDTDVSFDSDGLTIHGTYRHDGKPGPAA
LLISESGPTDRNGDNKVVGPVGNMRQLAETLSDNDVSSLRFDKIGTGATG
LGPYETKPTQVVSGVYTAGAGAALRYLADQPDTDGDRLSIYAVGEGAVHA
MSLAGREDPKVHSLALFQPLSGRYLDIITNRVRAGGTPEVLDAWLATVEE
IRTKGTVPDDLPEGLTAIVNPGNLNAIIEADKIDPLALAAQLPDDMPVLL
TCSDTDAQASCETERPLIDALHHTALTVIELKGVNHVLRDDPTDNIANYS
TSAPLSPQVTDAIAEFASK
118472569YP_888009.1 catalase [Mycobacterium smegmatis str. MC2 155]MPDNPKPVLNRRRVLLGAAAIGGFLAVDLGALLFATNTLGTQRLTPRAIL
EALAPPGGRPRGYRANHAKGVAVSGYFDSNGNGQEISRAAGFAPGRTPVI
GRFSFGGSDPHVADDPSLARGLGLAFGFPSGQQWRTAMLSLPVFPDKTPE
GFYERTLAGKPLPSTGKPDPDAMPKYLAAHPETKAALDIIKAAKPSPGFA
DSTFRSLMAFYFVDDKGVRTPVRWSLEPMQAALPAGTGDDRLFDALVRQI
RSGPVRWRLLLTVGEQQDPVTDATVPWPADRRVIDAGTLTLDTVETDGPG
NGRDVNFDPLVLPDGIEPSEDPMLSARSAAYAASYRLRTSETPSIPPEVQ
VDKVEEVAQ
118472568YP_887872.1 hypothetical protein MSMEG_3569 [Mycobacterium smegmatis str. MC2 155]MEKVIVTMRSARADDAWCARMVQDVSAELLEIGLPGLVLNIRDAPVRDSL
MTLTTLDPPVVALASVWVQQYHGEQLRAALDLLGAECDSAAAYLVTESEP
LPPPDLRAGLTPGRRTDALANIALLRRPPDLDAATWLHRWHVDHTPVAIE
TQATFGYVQNTVVRALTADAPAIDGIVEELFPPQAVADLHAFFGAADDED
LSRRMQAMVASTDAFGASSNIDTVPTSRYVWRSPFSAPAAASETCSS
118472567YP_888983.1 hypothetical protein MSMEG_4723 [Mycobacterium smegmatis str. MC2 155]MTTESTATPAQQIAAGYAVEGQALELGTVVVDGAVDPTAQVRIPLATVNR
HGLIAGATGTGKTKSLQVLAEQLSAAGVPVLMADVKGDLSGLAKPGESND
KVTQRAADTGDDWTPTGFPVEFLSLGTEGIGVPVRATITSFGPILLSKVL
GLNQTQESTLGLIFHWADQKGLPLLDIKDLRSVIQYLTSDEGKPELKALG
AVSTTTAGVILRALVNLEAEGADTFFGEPELEPKDLLRVDDQGRGVITLL
ELGAQAARPVMFSTFLMWVLADLFTTLPEVGDVDKPKLVFFFDEAHLLFN
DASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDVPNDVLSQLGARIQHAL
RAFTPDDQKALTKTVRTYPKTKVYDLEEALTSLGIGEAVVTVLSEKGAPT
PVAWTRMRAPRSLMDTIGADAISAAAKASPLQATYGQTVDRDSAYERLAA
KLAPPEGGDAGGFAGVEATGEAAPMPAPAQPEEPGFFEKMVASPAFKSAM
RSAGTVIGREITRSIFGTGRRRR
118472566YP_889276.1 hypothetical protein MSMEG_5026 [Mycobacterium smegmatis str. MC2 155]MGAGILERMFDGTSDAGLIDAIAEAKRQENAATARRLFAIGELDTRRAID
LAECNFWRTDPFEEVCAEVSAALRISRSRANWQVHLARVLRDRIPKVAAV
FAQGDIDFRIVTKIATRTELVDPAAMPALDDVLARRCPNWMRLSEPKLEE
RIDQCILRLDPDGQRVTKRSEDSRYFTVQPADTPGMANAQGYLPAHDAAG
FDKRLDAIAATVCPNDPRTPDQRRADALGALGRYRDTLDCQCGREDCTAV
AERDAVNNAMIHVLAEQSTLDGGNEPGYLPGFGMLPAHMVREVAKTATTK
PVTIPKDKAQSGYRPNAELTEFIRWRDLTCRFPGCDAPAMAADIDHTRPY
PQGPTHPSNTKLYCRTHHLIKTFYTGPNGWTDRQLPDGTIEFTAPTGHIY
TTEPQGAALFPVLGTPTGELNLPPQQDEPHPNRGVMMPKRRQTREQDRAD
RINAERRERAELNAEQQRQRQAWLADNYEPPPF
118472565YP_886290.1 N-acetyltransferase Ats1 [Mycobacterium smegmatis str. MC2 155]MTELIRRARPGDEVEITAMIRELAEFEHASDECTVTEEQLHTALFGDKPV
AYAHVVEVDGQAAATAVWFLNFSTWDGVAGIYLEDLFVRPAFRRRGIARK
LLATLARECVDNGYSRLQWAVLNWNVNAIALYDAVGGKPQTQWTTYRVSG
RELTALAAE
118472564YP_886394.1 hypothetical protein MSMEG_2032 [Mycobacterium smegmatis str. MC2 155]MTGSDTTAYSTARTVEDFTRNLQAVNTRIGAALQRAGREPGEVRLLPVSK
TVDEDRLRVAAAAGCTMFGENKVQEAMRKWRNLSDLDVEWSVIGHLQTNK
AKDVAEFAAEFQALDNPRAAAALDRRLQALGRQLDVYVQVNTSGEESKYG
LAPDDVIPFLKTLPAYTALRVRGLMTIAVFSTDPERVRPCFRLLRSLRDQ
ARDLDLIGPGELSMGMSGDYELAIAEGSTCVRVGQAIFGARPTPDSQYWP
GN
118472563YP_887014.1 hypothetical protein MSMEG_2679 [Mycobacterium smegmatis str. MC2 155]MATLTVAQARRIAVAAQGFHEPRPRGSVTRAHVRRLINRIQVLQLDSVSV
AVRAHYAPVFSRLGPYDRDVLDRAAWSHTARSPRLLVEYWAHEAALMAVE
DWPLLRWRMREYTHGRWGREIVKKNPRLADDIVSAVAELGPATAGQIEAH
LEAEPRGRKGPWWDRSDTKWVAEALFAAGILTTATRVGFARHYDLAENVL
PPEVLAREVGDEEAVRELALRAATALGVGTEADIRDYFRMNAKQVKPAIA
KLVADGELEPVDIDGTPAYLRTGQIIPRRDRGTALLCPFDPLIFFRPRVQ
RLFDFHYRIEIYVPAPQRQFGYYVWPFLLDGRLVGRVDLKRTDAALQVLG
AFSEDGRDRAHVAQALAGELRSMAGWLGVPAVEVGDRGDLAPVLREVV
118472562YP_886041.1 hypothetical protein MSMEG_1664 [Mycobacterium smegmatis str. MC2 155]MGFPGGLHRGTIDPTARDFYCHTHGPTLTDRSPVRLRNPYAIPQSRCLQT
SDFIDTVAPNNGFRAQSWHDQPRWSRAGTRAVATGEPFSSRCISAR
118472561YP_888280.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDLGLKGKRALISGASDGIGLAAAELLAEEGVDVALVARRANVLKEGCDS
IASKTGVKAVPLAADLSDKSVFDAVVNDAVDELGGLDILINNAGASSFGG
FGDITDEQWVADINLKLFGFIRMTRAALPHLLKTGSGRIVNVAGNSGKQA
LEYHMPGAAANAAILNFSKSLSLQVGAQGVIINTVCPGPVRTARLVKQFA
ANARDWNCTPEEAEERFLAGLPLPYIPSARDIAYSIAFLASPRAAYLNGT
TITNDGGITRAV
118472560YP_890834.1 glyoxalase [Mycobacterium smegmatis str. MC2 155]MSVSHVGLRVRDIETSKKFYEAIGFTEAKRLTLPDKIAGGLLGLDPPIGF
EAAYLEKDGFVLQLLTFGGYPAPEEPERSMVNSGLTHLSLAVDDVSAVRD
AVRDAGGVIVSDGGYACLVRDPEGQLIELIHTSVRPVAPT
118472559YP_887907.1 sorbitol utilization protein SOU2 [Mycobacterium smegmatis str. MC2 15MDVRSAFDLSGRTALVTGGNQGLGKAFAIALAQAGARVSFSGRNAERNEK
TAAEAAAAGHQLHAITADITRAEDVERMTAEAIEALGHIDILVNNAGTCH
HGESWTVTEEQWDDVFDLNVKALWACSLAVGAHMRERGSGSVVNIGSMSG
IIVNRPQMQPAYNASKAAVHHLTKSLAAEWAPLGIRVNALAPGYVKTDMA
PVDRPEFKRYWIDDTPQLRYAVPEEIAPSVVFLASDAASFITGSVLVADG
GYTAW
118472558YP_886754.1 phosphopantetheine adenylyltransferase [Mycobacterium smegmatis str. MMSGAVCPGSFDPVTLGHIDVFERASAQFDEVVVAVLVNPNKKGMFDLDER
IAMIEESTTHLPNLRVESGQGLVVDFVKSRGLTAIVKGLRTGTDFEYELQ
MAQMNKHVAGVDTFFVATTPQYSFVSSSLAKEVASLGGDVSALLPSPVNR
RLQEKLNG
118472557YP_890539.1 glycerol dehydratase large subunit [Mycobacterium smegmatis str. MC2 1MVAVTESGDPGQSPELGRMRILDAKPVNLDGFSVPDPDLGLAAMSSPHDP
QPSLVIRDGRVVEMDGKAAEDFDVIDEFIARYGLDLDVAPEAMAMSDIDL
ARMAVDINVPRAEVVRLIAGTTPAKLAKVIAVLTPVEMQAAMAKMRARRT
PSNQAHVTNQLDDPLLIAADAASAVAYGFREVETTVPVLADAPSNAVALL
IGSQVGVPGAMAQCSIEEALELRLGLRGLTSYAETISIYGTEQVFVDGDD
TPFSKAILTSAYASRGLKMRVTSGGGAEVLMGAAEKCSILYLESRCVSLA
RALGSQGVQNGGIDGVGVVASVPDGMKELLAENLMVMMRDLESCAGNDNL
ISESDIRRSAHTLPVLLAGADFIFSGFGSIPRYDNAFALSNFNSDDMDDF
LVLQRDWGADGGLRTVPADQLAAVRRRAARAVQAVYRDLGLADFDDQHIE
NVVAANGSRDLPPGDPKAVLEAANAIEAKQLTVFDVVASLKRTGFDPEAE
AIMRLTAERMRGDQLQTSAIFDEQFRVLSKITDPNDYAGPGTGYTLSEQR
RAEIDNIRQQRSAAELTADQAEHAGHITVTEIEPARQGSDPREVCIGLSP
ALGRSVWLSLCGLPIGEVIRQISAGLEEEGCVPRFVRVRSTIDVGLIGLT
AAKLAGSGIGIGLQGKGTALIHRRDLAPLANLELFSVAPLLTARNYRELG
RNAARHAKGMAPVPILTGGTDESISARYHARAVALVALERQASEPGEAPV
TVEVRRP
118472556YP_887227.1 2-keto-3-deoxygluconate kinase [Mycobacterium smegmatis str. MC2 155]MSTFDVVALGEPLIEVSTRGKITHGVDCGFAVSGDVVNTATAAVAAGARV
AVVARVSDDELGTAVIDHLAGLGVHTGHIRRDRGFQGIYVQHSDPKGDRQ
FCYARSGSAGSRLAPEDLPDDVLESAGAVVVSGITASLSSTTRATVLAAA
GRATRFVYDPNFRPRLTTAEDARALLLEIAPRCALITPSAPHECAALLGT
SEAAEAAARLRTAGAAAVAVTCGAAGVHVDAETTYWQGAFAAPSVVDQTG
AGDVFTGTVAARLALGDETSDAVRIGAAAASLAVGGVGGSGGIAPLEAVR
AHAEVLA
118472555YP_887070.1 PPE family protein [Mycobacterium smegmatis str. MC2 155]MGTHARSVSRTLLITLVVVIGTVALAFASTISSAARLVATYALIVPGTGT
PNPAVVQNYMENAVNHYLVPGGDCVGGCEPPIAVPYIAQFWPIPLPGWGG
LEGAKWNVSVGSGVTSLTTRYNNVLVNPDFTDTDDISIFGYSQGATVASI
VKGNLDNPDNADHLNFFFIGNPQRPNGGFFERLAFLGTVPVLDATFGNPT
PTDTCEHSDGTHCATDFALMYDGVVDFPAYPLNLLATANALAGFWYVHGT
YLAPDDDEPPTATPYGYTPDEVKTAIEAANAPDGCTAANHCQRHGDTIYV
TLPAKTLPIMQPLLDLGAATGTSALIIPIVDLISPLTQTLIETGYDRTNY
GRPTPAGLIPRINLVKLVSDLINDIPEGINAALTPGLTPLPGSTGPTVTA
TVQAPAPKTGDTENRIQAVTDVVGKDTNKVDVKTTDTGTEPVQPTDQPTD
QGTVTGDVTAAAAPEVTAPADTDAVETPKANGKPLIRISPIAKPNEGMTA
GTGTSGKAQPPSLRKALGIKGHPVRDLVKSVSKALGIDRPAKGGSNPKKA
TTDAKDTKAASDAKDAA
118472554YP_886127.1 anti-sigm factor- ChrR [Mycobacterium smegmatis str. MC2 155]MTTSKGTPKGDISQFGPNAPGYTWVSAADVPPREPFPGITIKLLWEGDNG
AKAVVTEIAPGAVWGKEDHHNPGPEEVYVVSGVFNDGVNDYPAGTFLHAP
AGSWHVPQSREGCVLFLFYPEG
118472553YP_890296.1 cysteinyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MTDRAQAVGSGPELGLRLYDTMAGAVRDFVPLRPGHASIYLCGATVQGLP
HIGHVRSGVAFDVLRRWLTANGYDVAFIRNVTDIDDKILNKAADAGRPWW
EWAATFERAFSAAYDALGVLPPSAEPRATGHITQMVELIERLIDKGHAYA
AGGDVYFDVLSLPDYGQLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKP
GEPSWPTPWGRGRPGWHTECVAMCEAYLGPEFDIHAGGMDLVFPHHENEI
AQAHGAGDGFARYWLHNGWVTMGGEKMSKSLGNVLSIPAVLQRVRAAELR
YYLGSAHYRSMLEFSETALQDAVKAYTGIEDFLHRVCSRVGSVPIGEWTP
KFAAALNDDLSVPIALAEIHAARAEGNRALDSGDHQTAMQQASSIRAMMD
ILGCDPLNERWESRDATSAALKAVDVLVQWALASRAEARERRDWAAADAI
RDRLKEAGIEVTDTADGPQWALIERDK
118472552YP_889492.1 hypothetical protein MSMEG_5246 [Mycobacterium smegmatis str. MC2 155]MSDTRLDVATLANAVQLAARAPSLHNTQPWRLIAEDGELKLFLDPSRVVR
STDRSSREAVMSCGVLLDHLRVALAAAGWDTEVQRFPNPNDRDHLATLSF
RPLQFVTEGHRKRADAILARRTDRLPMSAYVDWDAFETLLRARLGDGPVH
MDTLGEDVREEVAEAAALTESLRLYDAAYHSELAWWTTPFATEDGIPQTA
LISAEESERVAVSRDFPVAPHSSRRPALNNDAATIVVLSTDGYSREDALD
AGEGLSKVLLECTMSGLATCPVTHVTELHTSRDIIGRLIVRDACPQVLVR
IGLAPALDEVPPPTPRRPVDAFLEVRPRS
118472551YP_888379.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSTQPTELDEALVRIRAVFDALAEGAAERDQANEHPYALVSDLAGAGFG
RLRLPREFGGFGVDLPTLFALLAEAGQADSNLPQIWRGHFTTTEILLREC
DQDARRHWSEKIAAGAVFGNAQSEPSSVVAGIDPTDGCGAITTRVRINDR
GRRVVSGTKFYSTGSRFADYIRAAVLDEQGRRRFVVIPARHPGVDHVDDW
DGIGQRQTGSGTTILTDVPVEPHGCIGHHLHSVQGLDSFVQIVHLANLTG
IARSIVAETVDIVRTRTRTSRHALTQSAANDPDVLAVIGKLQARRLTAEV
LLDRAARRLEAAHAAGDEDSYAEAYTETSTAQVAVIEAVLDAATTAFDAG
GSSAVRTRVHLDRHWRNARTLASHNPVIYKPRVIGDFLVNGNRPVSGYYN
GHDTGVDAS
118472550YP_885352.1 HAD-superfamily hydrolase [Mycobacterium smegmatis str. MC2 155]MTDEAGEARGAQELGGEASAEVAVTDLQAEQTPPPSAPPPDLTAAAFFDV
DNTLVQGSSLVHFARGLAARKYFTYRDILGIAYAQAKFQLTGKENSDDVA
AGRRKALAFIEGRSTAELVALGEEIYDEIIADKIWPGTRALAQMHLDAGQ
QVWLVTATPYELAATIAKRLGFTGALGTVAESVDGVFTGRLVGDILHGTG
KAHAVRSLAIREGLNLRRCTAYSDSFNDVPMLSLVGTAVAINPDAALRDV
ARERGWEIRDFRTARKAARIGVPSALALGALGGALAAVASRRHDLR
118472549YP_885901.1 translation initiation factor IF-1 [Mycobacterium smegmatis str. MC2 1MAKKDGAIEVEGRVIEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
118472548YP_890467.1 hypothetical protein MSMEG_6248 [Mycobacterium smegmatis str. MC2 155]MCRHVAWLGAPRSLADLVLDPPQGLLVQSYAPRRQKHGLMNADGWGAGFF
DDEGVARRWRSDKPLWGDASFASVAPALRSRCVLAAVRSATIGMPIEPSA
SAPFSDGQWLLSHNGLVDRGVLPLTGAAESTVDSAIVAALIFSRGLDALG
ATIAEVGELDPNARLNILAANGSRLLATTWGDTLSVLHRPDGVVLASEPY
DDDPGWSDIPDRHLVDVRDAHVVVTPL
118472547YP_885093.1 oxidoreductase- molybdopterin-binding subunit [Mycobacterium smegmatisMKAFGYHVATSPADAVATLAGHPGAAYLAGGTNLVDHMKLGVAEPDLLVD
VSRLDLDQISVTDDGAVRIGANVRNSDLAADPVIRSHYPVLARALLSGAS
GQLRNTATTAGNLLQRTRCVYFQDVTTPCNKREPGSGCAALGGYARYHAI
LGASEHCVAVHPSDMAVAMSALDATVVVQGPDGQRRLPIDDFHRLPGDEP
QRDTTLQHAELITAVELPPPPVGAVSDYRKVRDRASYAFALVSVAAELTF
TDTRQISSARIALGGVAHKPWRARRAESVLIGDQPSDETFIAAADAELNA
AEPLPGNEFKVELARRTLVAQLRMLTARRQQ
118472546YP_889503.1 hemolysin III family channel protein [Mycobacterium smegmatis str. MC2MTAPIDGSHDRRTAPYRSAAADAAGSQRQAEDLPAAVADGVAQFFGKPRA
RGWIHVYSAIVALIAGAALVSVSWSVQSTRAGLATLLYTFTIVAMFTVSG
VYHRVNWTSVTARKWMKRLDHSMIFLFIAGSYTPFALLALPESKGMVLFW
IVWGGAIAGVLLKMFWPSAPRWLGVPLYILLGWVAAWFIGPIMDGAGVAA
VVLLIVGGALYSVGGVLYALKWPNPWPATFGHHEFFHACTAVAAICHYIA
MWFAVF
118472545YP_890845.1 [Mn] superoxide dismutase [Mycobacterium smegmatis str. MC2 155]MAEYTLPELDYDYAALEPHISGQINEIHHSKHHATYVKGVNDAIAKLEEA
RANGDHGAIFLHEKNLAFHLGGHVNHTIWWKNLSPHGGDKPTGDLAAAID
DQFGSFDNFRAQFTAAANGLQGSGWAVLGYDTLGDRLLTFQLYDQQANVP
LGIIPLLLVDMWEHAYYLQYKNVKADYVKAIWNVVNWQDVQVRFAAATGK
GPDPIV
118472544YP_890971.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MPVIELPSGPIAYEDTGGDGPVLVFGHGLLMDGRQWRKVIPLLPGCRCIT
PTLPMGAHTAPMRPDADLTEQGVAGILADFLDALDLKDVTLVLNDWGGGQ
FLITDGRDARIGRLVLASCTAFDNYPPAPARPAAALCRLPGGGRLLTKMF
GTRFFRHSRLAYGALSKAGLPDGLFDEWFRPAVENAAVRRDLVKFATGAP
PRRRLLELSERLRTFTRPVLVVWAREDRMMPLDHADRLVELFPDATKVIV
DDSWTLIPEDQPEVMAGALREFVG
118472543YP_891053.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMELRQLEHFVAVAEELSFTRAAQRVHVVQSALSSSVAKLERELGVELLDR
TRQQISLTAAGDRFRTYALGVLREARNAVDVVSEFRGELSGTVDFGSLIS
FGPMDVARALGDFHRAHPHVRLRLRLSQSGASAYLSGLIEGSLDLALISV
PNRFPPQLEMRLLFEEPMVFVCRPDHPVARRRRVSLDVLGTEDLVGFPPE
FGLRRLTDDAFRAAGVQARTQYEVPAGFAAVADLVANGLGTALMPASEAR
RLGNLTAVTLETAVIWQVYLASPPADRMTPATARLADTLLDEAVRARARR
YGTRPGIDHP
118472542YP_887814.1 hydroxylase [Mycobacterium smegmatis str. MC2 155]MAGQAVVLGASMSGLLAARVLADHFDTVAVVERDVLPDGTDQRRGVPQGR
HVHGLLCAGASALDALFPGFLDELAADGATRLDERGAHRLSMMFGGHPLH
FPMSFTRPLVSYLCSRPFLETHVRQRVRSAGNIQILDGHDVADMTMSGDG
RRVSGVRIADRAGGAEQTLDADLVVDATGRSARTPAFLERHGYPRPVEER
IAIQVAYSSQLLRIPRDAVEQILFLIAPAPELAAAAVLFAYENDTWMFTA
VGLTGNDPPTDPGGMKAFVAPFAPQALRAALDAAQPLSQVSSYRYPASVR
RRYDRIRRFPLGLLVTGDAICSFNPAYGQGMSVAALEALILRDCLESGTR
DLHRRFQHSAAKLLDRVWQMAAGADLTFPQVEGPRPVSIRLNNWYTDRVL
TAAESDTTVSEAFFRVMNLVDPPTRLLRPSVLARSIAARSHRAPATATGQ
LSAAPGVTSDR
118472541YP_888159.1 hypothetical protein MSMEG_3868 [Mycobacterium smegmatis str. MC2 155]MKRFVVAGFALVVFVELAALAVPGRSMIGWATGAALAVLLVSVRLALRED
PVHDARSTASEDAAELLARWQSETEILISRADSTRSQWDRHLRPRLAREF
AAASGQRLVGDQSAFQATGRMLFGERLWQWVDPNNVASARDDGPGPGRAV
LAEILQRLEQL
118472540YP_886259.1 UbiE/COQ5 methyltransferase [Mycobacterium smegmatis str. MC2 155]MPQPKPTNWAAGRYQAVAERIAPIAEEVVVAAGRVGPQRGPLTGGDIVDL
ACGTGSAALAAAAAGADVTGVDITPELIDIAKTRPGGDQVTWVAADATRT
GLPDGGFDAAVSNMGIIFVEPTGLVAEVARLLRPGGVFAFSAWVRDDRDG
AENPFFAPIVEVLGPPSAAAFTPDQWGDRDVVAQRLAAHFGDITVETSDL
TWNFASLAAAMEFLEFESPAHVSLFQSLDTPVRDRLRSVFEAALRRHVDT
TGTVAFASPYLVTTALRR
118472539YP_887053.1 hydrogen:quinone oxidoreductase [Mycobacterium smegmatis str. MC2 155]MTTTAPKPSDTEREPGQLVEMSWDPITRIVGSLGIYTKIDFENREVVECH
STSSIFRGYSLFMKGKDPRDAHFITSRICGICGDNHATCSCYAQNMAYGV
QPPHVAEWIVNLGEAAEYMFDHNIFQENLVGVDFCEKMVSETNPSVLAKA
ENTEAPHAGMHGYRTIADIMRALNPFTGEFYREALQVSRWTREMFCLMEG
RHVHPSTLYPGGVGTVATIQLMTDYMTRLMRYVEFMKKVVPMHDDLFDFF
YEALPGYEQVGLRRTLLGCWGSFQDPEHCNFSYRDMEAWGRKMFVTPGVV
VDGKLVTTSLVDINLGIRILLGHSYYDDWEDQEMFVKTDPLGNPVDRRHP
WNQHTNPKPQKRDFDENYSWVMSPRWFDGKDHLALDTGGGPLARLWATAL
AGLVDIGYVRSTGNSVQINLPKTALKGPVEFEWKIPAKGSNTIERNRART
YFQAYAAACALHFAEKALTEIRAGRTKTWEKFEVPDEGIGCGFTEAVRGV
LSHHMVIRDGKIANYHPYPPTPWNANPRDSYGTPGPYEDAVQGQPIFEEN
DREHFKGIDIMRTVRSFDPCLPCGVHMYLGGGKTLDLLHTPTQSATGD
118472538YP_887936.1 inosine 5-monophosphate dehydrogenase [Mycobacterium smegmatis str. MCMRFLDGHTPAYDLTYNDVFVVPGRSDVASRFDVDLSTVDGSGTTIPVVVA
NMTAVAGRRMAETVARRGGIVVLPQDLPITAVSETVDFVKSRDLVVDTPV
TLSPEDSVSDANALLHKRAHGAAVVVFEGRPIGLVTEANCAGVDRFARVR
DIALSDFVTAPVGTDPREVFDLLEHAPIDVAVMTAPDGTLAGVLTRTGAI
RAGIYTPAVDAKGRLRIAAAVGINGDVGAKAQALAEAGADLLVIDTAHGH
QAKMLDAIKAVASLDLGLPLVAGNVVSAEGTRDLIEAGASIVKVGVGPGA
MCTTRMMTGVGRPQFSAVVECAAAARQLGGHVWADGGVRHPRDVALALAA
GASNVMIGSWFAGTYESPGDLLFDRDDRPYKESYGMASKRAVAARTAGDS
SFDRARKGLFEEGISTSRMSLDPARGGVEDLLDHITSGVRSTCTYVGAAN
LPELHEKVVLGVQSAAGFAEGHPLPAGW
118472537YP_886155.1 hypothetical protein MSMEG_1783 [Mycobacterium smegmatis str. MC2 155]MIENVSGIRSAMERQDVPDEVPVADAVEQQQGAVRPPIDDDTPGSDPGSP
PLEASDGDWQEQRETVEFDPDDDRES
118472536YP_888924.1 hypothetical protein MSMEG_4660 [Mycobacterium smegmatis str. MC2 155]MYSFECMSVHQLHCGRDGRAHVVVGRVQEASARDETAYRRQRQGFLPGRE
RLVGICRVAAEQQCRHGRRVHHALHLVDDRQLEPRVGRRRTQRLADVDRL
DHGVRGQVVADLAVDPARQERLQHGDQAVRRQRVDGLGARRQRRDRSGIV
EVDAAQHLSAVHPGGGGRRRGGACHAVVHLEDRTGEPAAVERREHHLVFQ
RAEQQEVVEDVGGGQHTVDAGIGQRGAQAVEQVGAAVHRGGPRSDGQCAA
RGMVGRDDHEPAVAADGRPGGAALPRRGDHAGFGCPEVGDGAVAGADSGS
RH
118472535YP_886902.1 4-hydroxy-2-oxovalerate aldolase [Mycobacterium smegmatis str. MC2 155MTASRLQQALADRQTVWGGWVVGPTILGPEEFAAAGYDYVGFDVQHGYLD
DADVALLLRRLEHVPIATAVRLPSPDPAPIGRVLDAGADAVIIAMVETPE
QAAAALAATRYAPEGVRSFGPLRASLGHDTVALQERASVIAMIETATGVA
AVQDIAAVAGLTGLYVGPADLAISMGNQPTDAWTHPDVLAAFVTVRQAAD
AAGLAGGIHAGTGRAGKAAADMGFRMITLASESQALRRGAVEHLDEATGA
GGGHEQRGYL
118472534YP_886550.1 hypothetical protein MSMEG_2197 [Mycobacterium smegmatis str. MC2 155]MWDDELDVVCCGSGSGAFAAAIAAADADLDVEVACRPVTPQGTSGSPWLG
RGIEDSETREYLDELVADQDPSSRDSEHADIEIRAMRQLSPAAPRTPVET
FHGAQLRDWAGQCLRSPYGLLYTRLTERGGVPMETEAGEIIEANVLGSID
LPAGAGAAAAVDGWMRMQLRERDIPSDDDAALERIVFEEGEIVGVALATA
DGPRTVRVRHGIAVSTEVPAAGRRRMETAQTLRVALVGRSASRFSRVELL
TIPSAGHPDDLAQGNGAPHSHARRS
118472533YP_886916.1 zinc metalloprotease [Mycobacterium smegmatis str. MC2 155]MMFGIGIVLFALAILVSVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRANRLGSTEYGIKAIPLGGFCDIAGMTSVDEIAPEDRPYAMYKQKVWKR
VAVLFAGPAMNFVIGLVLIYGIAIVWGLPNLHQPTTAIVGETGCVAPQIT
LEEMGECTGPGPAALAGIQAGDEIVKVGDTEVKDFAGMAAAVRKLDGPTR
IEFKRDGRVMDTVVDVTPTQRFTSADASAPSTVGAIGVSAVPVQPPAQYN
PITAVPATFAFTGDLAVELGKSLAKIPTKIGALVEAIGGGERDKETPISV
VGASIIGGETVDAGLWVAFWFFLAQLNFVLGAINLVPLLPFDGGHIAVAT
YEKIRNMIRSARGMVAAGPVNYLKLMPATYVVLAVVAGYMLLTVTADLVN
PLSIFQ
118472532YP_888615.1 NAD/mycothiol-dependent formaldehyde dehydrogenase [Mycobacterium smegMPQTVRGVISRSKQQPVELVDIVIPDPGPGEVVVDIIACGVCHTDLTYRE
GGINDEFPFLLGHEAAGTVEAVGEGVTNVAPGDFVILNWRAVCGQCRACK
RGRPHLCFDTFNATQKMTLTDGTELTPALGIGAFADKTLVHEGQCTKVDA
DADPAVAGLLGCGVMAGIGAAINTGAVTRDDTVAVIGCGGVGDAAIAGAA
LVGAKKIIAVDMDNKKLDWAREFGATHTVNAKDLDAVETIQDLTDGFGAD
VVIDAVGRPETWKQAFYARDLAGTVVLVGVPTPDMKLEMPLIDFFSRGGS
LKSSWYGDCLPERDFPTLISLYLQGRLPLEKFVSERIGLDGIEDAFHKMH
AGEVLRSVVVLDR
118472531YP_890216.1 lipid-transfer protein [Mycobacterium smegmatis str. MC2 155]MTGLSGKAAIAGIGATDFSKNSGRSELRLAAECVLDALDDAGLEPSDVDG
LVTFTMDSNQETAVARSTGIGELKFFSQIGYGGGAAAATVQQAALAVATG
VAEVVVAYRAFNERSEFRFGQVMTGLTTNADSRGVEYSWSYPHGLSTPAA
SVAMIARRYMHEYGATSADFGVVSVADRKHAANNPKAHFYGKPITIEDHQ
NSRWIAEPLRLLDCCQETDGGVAIVVTTPERAKDLKHRPVTIEAAAQGSG
ADQFTMYSYYRDELGLPEMGLVGRQLWQQSGLTPDDIQTAILYDHFTPYT
LLQLEELGFCGKGEAKDFIAGGAIEIGGKLPINTHGGQLGEAYIHGMNGI
AEGVRQLRGTSVNQVEGVEHVLVTAGTGVPTSGLILG
118472530YP_890549.1 amino acid ABC transporter permease [Mycobacterium smegmatis str. MC2 MQYLLTHLDDLWELTVIHLRLSLVPIVLGLLIAVPLGALVQRTTTLRRLT
TVAASIIFTIPSLALFVALPLIIPTRILDEANVIVALTLYTTALLVRAVP
EALDAVPEHVRDAATAVGYRPLTRMLKVELPLSIPVLVASLRVVAVTNIS
MVSVGSVIGIGGLGTWFTEGYQSNKSSQIIAGIIAIFVLAIVVDTLIMLA
GKLIAPWNRAEVTA
118472529YP_888568.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium smegmatis str. MC2 155]MRVLVQRVSRAQVTVDGEVVGAIDPQPQGLLALVGVTHDDDAAKAQRLAE
KLWKLRILDDERSASDVAAPILVISQFTLYANTDKGRRPSWNAAAPGSVA
EPLVTEFTEALRRLGATVETGVFGAHMEVELVNDGPVTVLLEL
118472528YP_888402.1 CAIB/BAIF family protein [Mycobacterium smegmatis str. MC2 155]MTNTTDNGPLHDLTVVDMTTSYAGPTAAMYLADLGARVIKIERPGSGDDT
RGWGPPFVDGDSAWFASANRNKRSLVLDLRSGTGRDVLLRLIDSADAFLQ
SMNPAKLVRMGIDAENLHRRNPRLVYCAMSGFGLDGPDSNLPGYDLVAQA
RSGLMSVTGEKGRSPQRVSTALSDIATGMCAALAVSAALVQQAKTGKGAT
IDVSLLDTDLALMAPRIAAYHAGDPEPGPSGGTDSVLAVYQSFEASDRSI
VVAIGNDAMWLRFCAAIDLPDLASDPDLADNAGRRAQRPRITALIAERIS
TRTAAEWVRILNDVDVPVSLVQTLSEVVKDPQVVARGSLMPVPGSTERLA
TVHSPFRFDGLAVRNKRFPDLGADSRRVLAELGYGPDDIAALFAAGVVSE
PAGAGEVVS
118472527YP_888800.1 phosphoadenosine phosphosulfate reductase [Mycobacterium smegmatis strMTDVTTSTENELRELAERGAAELADASAEELLRWTDEHFGGNYVVASNMQ
DAVLVEMAAKVRPGVDVLFLDTGYHFAETIGTRDAVEAVYDVHVVNVTPE
RTVAEQDELLGKNLFARDPGECCRLRKVVPLTNALKGYSAWVTGIRRVEA
PTRANAPLISWDNAFGLVKINPIAAWTDEDMQNYIDANGILVNPLVYEGY
PSIGCAPCTSKPIPGADPRSGRWAGLSKTECGLHVS
118472526YP_888259.1 hypothetical protein MSMEG_3969 [Mycobacterium smegmatis str. MC2 155]MDDNTNTLDINAAVADAALAVWLRMWNSDSRIARRICSDDFRIHFLISDS
DGSNPGDDVLGAESFARFLERWRVRHPRVVFTEVSRAVDGAHGRMLWNVQ
DGEVAVGGIDVFDFTENGLIREVWSTTGTRTHSV
118472525YP_889708.1 molybdopterin biosynthesis protein MoeA 1 [Mycobacterium smegmatis strMRSVEEQQARVAAAAVAPRPVRVAIAESQGLMCAEEVVTERPMPGFDQAA
IDGYAVRSVDVLGVGSDSEDGGEISLPVMGVIEAGARTPSRLQPRQAARV
QTGAPMPTLADAVLPLRWTDGGENRVRVLRGVRSGAYVRRTGDDVQPGDV
AVRAGTIIGPAQVGLLAAVGRDKVLVHPRPRLSVMCVGGELVDVSRTPGT
GQVYDVNSYALAAAGRDAGAEVNRVGIISTDPRELRETVEGQVNRNEIVV
IAGAVGGAAAESVRTVLSELGDMEVARIAMHPGSVQGFGQLGRDRVPVFL
LPANPVSALVVFEIMVRPLIRLSLGKRQPMRRIVQARTLSPITSMPGRKG
YLRGQLMRDQDTGEYLVQALGGAPGASTHLLATLAEANCLVIVPADVEEV
RTGETVDVAFLAQRG
118472524YP_888832.1 iron ABC transporter substrate-binding protein [Mycobacterium smegmatiMRAITALLTLLPLAICALSGCSARGTEPSPHEETTNYPLTFENCGVTVTI
DRPPQRVVSLYQASTEILLSLGLADRMVGTSTWFDPVLPALAEDNASVPR
LADNDPSLETVLAAEPDLVTSASAHTFTPAVVAERARLGQLGVATYQSPS
VCTGAEVDGETVTRTEPLTFDTLFDEINQLARMFDVPERGARLVDDLQRR
LSEASLEPKPGTTVAYWFSGLRTPSMAGCCSAPGLYTAALGLANVFADAS
EDWPEVSWEAVAARDPDVLVLADLNRRRIDGDALDAKIGFLESNPVTRHM
TAVRNKRYVVLTGSELDPGIRQVQAVEKMAAGLESFGLVS
118472523YP_884787.1 glycolate oxidase subunit [Mycobacterium smegmatis str. MC2 155]MSALTAPNVTVDKTLIHRFTEAVAGHAEVITDGAVLDARGHDFWGVGGTA
ELLLHPHDRDEVAAIMRIASQHQVPIVPRGGASNCSGGMMPARGRVLLDL
SNLNRIIDVDVESRCARVEPGVINSALQEHLAPYGLCFSPDPVSAHLATV
GGNIIENAGGPHALKYGVTYNHILGVEVVLPDGTTVTLDAEDDGPDLLGL
VVGSEGTLGIVTEATVALRPVAEVTHSLMGAFATAREAADTIAAIIATGV
VPAAVEWLDHDGIMGLQQFYDTGYPLDADSIVLIDVDGTADEVARDQAIV
ERVLRERATTVRIAEDEKDRAALWYGRLHAPDSVVQSGKGFFIGDVTVPR
DRIPEMQEAIGATAERHKDGLLFIAVCGHAGDGDLHPTTFYDKDNPLAAS
ALEAANNEIIEAALRLGGTITGEHGVGTEKIQFMTKRFTPVEIAAQRAIK
EAFDPAGLLNPGVMLPEQSPDEPVTAAFGTAVRDAVEGTLLTDPGAALTT
GTDTGIAANLGNLSLVVGADATVEQINRYLDDHGIFCPAVPATGGERSIG
EVVATATGAERIGIRHALLGADVTVVDGNAAARFGAETMKDVAGYDAKRL
YIGGHGAFGALRTLIFKICVRR
118472522YP_891046.1 2-2-dialkylglycine decarboxylase [Mycobacterium smegmatis str. MC2 155MDPVSQLEADARHLVRYSGRGGFTPTVIGSARGSLMFTEDGRELIDFTSG
QMSAILGHSHPEIVATVQSQIAHLDHLYSGMLSRPVIELSRRLAETLPPT
LDKVLLLSTGAESNEAAVRMAKLVTGKHEIVSFARSWHGMTQAAANATYS
AGRRGYGPAAPGNFALPVPHRFRPDITDELGELDWRRQLDLGFDLIDAQS
VGSLAACLIEPILSSGGIIELPPGYLAALAQKCREREMLLIVDEAQTGLC
RTGDWYAFEHDGVVPDILTLSKTLGAGLPLAAVITSSEIEQRAQEREFLF
FTTHVNDPLPAAVGLTVLDVLSRDRLDVRARELGQRLRAGLDELAGRHPI
VADVRGRGLLLGMELSAEDTPGVSADQLGAVVTRRCFELGLHMNIVQLPG
MGGTFRLAPPLTATDNEIDRALEIMDEALAYAREPAVHRS
118472521YP_890712.1 hypothetical protein MSMEG_6499 [Mycobacterium smegmatis str. MC2 155]MAVNMGDLFAANLESLRYQPTAKRIRACLGGEPVVDTCAAVLVWEPRRVV
PTYAVPRAAISAQLVPAGGDHGDDEIPGFLDPSVPFTAHTCSGTGFDVIA
GGENSPAAAFTPDDPDLADYVILDFDSFEWREEDEPVVAHPHDPFHRIDI
RRSARQVRIELDGHLLAESTQPMLLFETGLPTRFYLPYDDVVAPLELSQT
VTYCAYKGRASYYSVPDGPADIAWTYHEPLHDAVPVRDRICFFDERVDVI
IDGQRQNRPVTPWSD
118472520YP_885813.1 cytochrome P450-terp [Mycobacterium smegmatis str. MC2 155]MSTPTMDDAAKALADPTAYADDARLHEALARLRAENPVAWVDQAPYRPFW
AITKHADIMAIERANDLWLSAPRPLLATAEADDLGRSQQEMGIGLRTLIH
MDDPHHRKVRAIGADWFRPKAMRELKVRVDELARIYVDKMREIGPECDFV
TDIAVNFPLYVILSLLGLPEEDFGRMHMLTQEMFGGDDDEYKRGTTVEEQ
MAVLTDFFNYFSALTNSRRENPTDDLASAIANGRVDGELMSDMDTLSYYV
IVASAGHDTTKDAISGGLHALIENPGELARLKADPGLMGTAVEEMIRWST
PVKEFMRTAAEDTEVRGVPIAKGESVYLAYVSGNRDEEVFTDPFRFDVGR
DPNKHLAFGYGVHFCLGAALARMEMNSLFSELLPRLDSIELAGEPELSAT
TFVGGLKHLPIRYSIR
118472519YP_889091.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MRTYFDLTGRSALVTGAGCGIGAAVSEALAAAGAAVLVTDIDGEAARTVA
ERINAAGGKADSAALDVGDRDAAVAAAERAAALGQGTLHILVNNAGVTAP
AMFPKLTDETFRRTFDVHVMGSFHVTQSALPHLATDGTGRIINVTSSAGI
TGTLGQVNYSAAKAGLIGFTKSLARELAPRNIMVNALAPLAATPMTETIR
TNEKFAANMMNRILLKRWADAEEVAGAFVFLASDAASYITGQVLPVDGGM
VM
118472518YP_891047.1 NAD-dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MMTQTVLITGANGGLGRLMRPRLAREGRTLRLLDLVTPEPPADGEDVEVL
QGSVTDEKVVRDACDGVDAVIHLGGISVEAPWQDILTNNIDGTRVLLEQA
RDAGVERVVLASSNHAVGFYGKEEAGPDGLRADILPRPDTYYGFSKAALE
ALGSLFHSRYGMDVTCLRIGSCFEKPWDARSLWTWMSPDDGARLLEACLA
TPEPGFRIVWGISRNTRRWWSLEAGEQIGYHPQDDSEVFAQEILAHVEES
GQGADVRLVGGKFCFTELGAHQH
118472517YP_886193.1 biotin-[acetyl-CoA-carboxylase] ligase [Mycobacterium smegmatis str. MMNSDTERPALDADAIRSAVVRPRGSWRSFDVVAETGSTNADLLARARSGT
DINGAVLAAEHQTAGRGRNGRQWTTPPRSQIAVSVGIDTTGVPSTAWGLL
PLATGVAVVDAISAVTGVEAKLKWPNDVLVDTGKLAGILAEVASPAPTVV
IGTGLNVSVMPDDVPDSVATSLAMLTDAPVDRSALLTEFLTRLADRVESW
RAAGGADDRLLDDYRQCSGTLGTAVRVLLPGDRQLLGDAVDIDESGRLLI
DSEGERITVAAGDVTHLRPA
118472516YP_886274.1 benzoate 1-2-dioxygenase subunit alpha [Mycobacterium smegmatis str. MMTTHLSPDHLENVLADAVIEDPAAGVYRANRRIFTDDEIFELEMKHIFEG
NWVYLAHESQVPNPGDYFTTYIGRQPVVITRDRDGDLHCLINACAHRGAM
ICRRKTDNRTTLTCPFHGWTFRNDGTLLKVKDPDGAGYPDTFNSNGSHNM
TNVARFEGYRGFLFGSLNPDVLPLTEHLGDTTTVIDMLVDQSPDGLEVLR
GASTYTYDGNWKVQAENGADGYHVTATHWNYAATTSRRTCGESKNDTKAL
DAGSWGKSGGGYWSFPHGHLCLWTWAANPQDRPLWDRLDELKARFGDAKG
EFMVKGSRNLCLYPNVYVMDQFSTQIRHFRPIAPDKTEVTIYCIAPKGES
AAARAHRIRQYEDFFNASGMATPDDLEEFRSCQLTFRAQAAPWNDMSRGA
QHWLSGPDPVAESLGMHGIVSSGLRNEDEGLYPVQHGYWLETLRRAVTSN
PTEH
118472515YP_888913.1 oxidoreductase YisS [Mycobacterium smegmatis str. MC2 155]MTTLGVIGLGRIGAFHVDTLSSLDGVDGLVVADERPDAVAAVAAKHGAKP
ADSVEELLDSGVDGVVVAAATPAHAELTLAAVHRGLPTFCEKPIAATAAE
SARVAEAIARSGVPVQVGYQRRFDAAFAAAKREVDSGSLGALHTVRSTTM
DPAPPSMDYIKGSGGIFRDCAVHDFDALRWITGQNAVEVYATGTVQGDPR
FTEYGDVDTAAVVVRFDGGALGIVSAARYNARGYDCRLEVHGFDNSIVAG
WDQGTPLQNMDPRNDFPTGPYHHFFMDRFTEAFRSELAGFVEVVKGNPIP
GATVADAVEVAWMAEAATESLRRGAPVRIEEVRNR
118472514YP_889094.1 hypothetical protein MSMEG_4838 [Mycobacterium smegmatis str. MC2 155]MSLTSIFSLVTRTREQLPLTIGRKDGNLLVVNENLILMDES
118472513YP_890059.1 phosphoribosylformylglycinamidine synthase I [Mycobacterium smegmatis MTTRVGVITFPGTLDDIDAARAVRLAGAEAVSLWHADADLHGVDAVVVPG
GFSYGDYLRCGAIAKFAPVMGSVVEAANKGMPVLGICNGFQVLCEAGLLP
GALTRNAGLHFVCRDVWLEVASNTSAWTTRYETGADLLIPLKSGEGRYVA
SESVLDELEGEDRVVFRYRENLNGSMRDIAGICSENRRVVGLMPHPEHAT
EALTGPSDDGLGLFYSALDAILSV
118472512YP_887630.1 hypothetical protein MSMEG_3322 [Mycobacterium smegmatis str. MC2 155]MWPVQTETVHSYTMRLAHANHLPLKVLHTYLSGTAVSNQPRPEWLAAAGG
YPLDLLEIRLKGLTRGHGFAEQLRRSRPGCRLCMARRGIYEPVYCWLPEH
RTVCFRHRRWIGAPAHRWGDQRPLEHRPPVLTAARRHARMAYQHKDFAPF
AMRDARRILNCWWREGCTVTPVLSLREITVEEYLDAYSDHVALAVILADY
RPHIATTHPHSGQLLDALHRRIETDFPDRCGSTGALDQWICDQRLAMHRP
AGTITRLLGPHRGS
118472511YP_889114.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMTRFTGLVTTASRTASRTAARTARADRATSTQEAILKAAERLYAEHGVFA
VSNRQVSEAAGQGNNAAVGYHFGTKTDLVRAIEHKHRGPIEYLREQMIGT
VQGSTDLRDWVGALVRPLTDHLAALGNPTWYARFAAQVMTDPAYHNIIVR
DALSSPSLVQVIEGMNNCLPDLPAEIRAERNIMARNLLMHSCAERERALA
QGAPVPRSSWQGAASGLIDAIVGLWLAPVTGEDR
118472510YP_886295.1 hypothetical protein MSMEG_1929 [Mycobacterium smegmatis str. MC2 155]MVKPERRTRGDIVAAAVIVVVVAVAAGLIWWTSDARATLSRPAAAPVPYL
TPAAEVPAGLHEMWTAPSPKTTAPVVAGGAVVTGDGRTVDGRDPISGAVL
WTYARDADLCGVTSVYSYAVAVYPDVRGCGQVSTIDGRTGMRGPARTAFA
DPEVKLSTDGVTVLSGGDSRLELWRSDMVRMLSYGALDARIKPDVPASPV
CRQLSAAASSSAVSVIESCPKTDEVRLTLLRPADEEDTPDLRYVELPGVT
DESGAQVIAVSDTTTAIYVPTPEPKVDVIDETGATVASTILPKPAAPQST
TTRAGDLVTWWTGDSVMVFDAAGLRYKYTVSPAGPHAPVGPATAMAGKLL
VPVDDGYDVFDPETGTGDRHISLPRTPSVSPVVPAVAGSIVLEQRGTELV
ALGAA
118472509YP_890312.1 negative regulator of genetic competence ClpC/mecB [Mycobacterium smegMFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKEA
AEAGTGGRGGESGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVEHTIEILKGLRDRYEAHHRVSITDSAMVAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAAAL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFSQGGSENNYERMKQKVHDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIQMVDLMIGRVSNQLKTKDMALE
LSDKAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEIGPGQLV
TVDVEGWDGEGQGEDAKFTFSGGPKRAETAEPDLAGAGAAGAPTAGTE
118472508YP_885656.1 hypothetical protein MSMEG_1265 [Mycobacterium smegmatis str. MC2 155]MSGHVFIINGDLTKIACDAVLVPTDDHFTIEAPWRGLFEGRRHEIPETWG
TERVLALPPRKNEPQIWLGNVGQVGDSSDFSVFAPIVRDFVVNARTELKS
VANEDRIYAWPKPRLALNVVGSGRGGGSEKKGHLVLGLVKTLTALADEND
VDIVLVTFGPKPYAAAQRARRHFVHKEEDVWRFHEEANSDLIKEAHRLAD
EAIKRHLVLFVGAGASAGAGLPTWKGLLDRFAEEAGFDKATRERLTERDF
RDQATLIERELKRRDVDLKDGVAAEFRGFERFSLTHGLLASLPSSEAVTT
NYDNLFETAYKTRGRDVAVLPENPRTTEGHWLLKLHGSVDQPEKIILTRS
DYLSMPRQYGALMGLVQGLLLMRRMVFVGYSLSDEDFHELIDEVRAARGD
SETGLGRGVALTLYADPLDRQLWEKDLDIVPMITGTQVEAPVAARELELF
LDLVGYLSTTSASFFLDASYSDLSDNEAELRDALAALAIKTAGSPLDSVG
HLVEEFLKDLGA
118472507YP_890102.1 hypothetical protein MSMEG_5875 [Mycobacterium smegmatis str. MC2 155]MILCTMDSHDNGRPIPADARQTTEQQEELQDEFDRRGADPEAPGLHESRE
QIADEN
118472506YP_890822.1 hypothetical protein MSMEG_6610 [Mycobacterium smegmatis str. MC2 155]MGRHLDAAKAHFGRDAGGLLEGGRYSLVHTRSLEFDELRPYVRGDDVRDI
DWKATARSGHTLIKRFVSEKHHKILVVADGGRNMSAMAPSTELKRDVALN
LIGAIGLITLPRSDEIGMVAGDRRGCVDIRLRRGETHIESMLHRFHHHTT
TEPGPSDVATQLEWVARHHRHRLLVFVVSDEPEITDRLDAVLRPLTARHD
VLWPMIADMPALGTGEQRGYEVSDGRLIADDLGADVLQAYRRAEEQRRQR
LSEFLTGHRIPHTRVTGSARIRTALTAMTGVYARAG
118472505YP_884471.1 ISMsm2- transposase [Mycobacterium smegmatis str. MC2 155]MPTPHAAEIVLSADERAELEGWARRRTSAAGLAMRARIVLAAADGGSNTE
LADRLELSIGTVRRWRNRFAELRLDGLVDEPRPGRPRVVGDEQIEALITA
TLETTPPDATHWSTRSMAAHLGLSQSMVSRVWRAFGLAPHKQDSWKLSKD
PLFVAKVRDVVGLYLNPPERALVLCVDEKTQIQALNRTQPVFPMLPGTPA
RASHDYVRHGTSSLYAALDLTTGKVIGALHSRHRATEFLAFLKKIDVEVP
DDLDVHLVLDNASTHKTPAVKRWLTGHPRFVLHFTPTSSSWLNLVERWFA
ELTTKKLRRSTHTSVRQLNADIRAWIDTWNDNPKPYVWTKTADQILASIA
NYCARINDSGH
118472504YP_887437.1 FeS assembly protein SufB [Mycobacterium smegmatis str. MC2 155]MTTTPETAPLTQEETIASLGKYGYGWADSDVAGASAQRGLNEAVVRDISA
KKNEPEWMLDIRLKALRTFDKKPMPTWGSDLDGIDFDNIKYFVRSTEKQA
ASWEELPEDIRNTYDKLGIPEAEKQRLVSGVAAQYESEVVYHQIREDLEA
QGVIFLDTDSALREHPEIFKQYFGTVIPAGDNKFSALNTAVWSGGSFIYV
PPGVHVDIPLQAYFRINTENMGQFERTLIIVDEGAYVHYVEGCTAPIYKS
DSLHSAVVEIIVKAGGRCRYTTIQNWSNNVYNLVTKRARAEAGATMEWID
GNIGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEGQHQDTGAKMLHLAPNT
SSNIVSKSVARGGGRASYRGLVQVNKGAHGSRSSVKCDALLVDTISRSDT
YPYVDIREDDVTMGHEATVSKVSEDQLFYLMSRGLTEDEAMAMVVRGFVE
PIAKELPMEYALELNRLIELQMEGAVG
118472503YP_886478.1 hypothetical protein MSMEG_2120 [Mycobacterium smegmatis str. MC2 155]MSGWPFVGRDDELREAAEALRDSSRGVVLAGPSGVGKTALARALAGQLET
EGYTIRYVLGTETGQAVPFGAFHHTLELSDAHEPTVMLAAAHHTLSADPN
VLIVVDDAQYLDPLSALLVQQLAVHGSIKLIVTMRSGATTSDAVTALWKE
HLLVRLDVEPFSRAQTAEVASTVLGGEVDEHAVAELHRYSSGSPMFLRGV
LTAAMGDGVLVQAHGRWRLRGNLRPSPDLYELIASRVETLSAEELDVAEV
VATADMLDWHVLLAICGPDAVARAERRGAIQVTSAGSHAVVQPGHPIIGE
VVRSRCPVSRTRQINTLVAEHLSAQLRVATDASAVDVRTRIQLARFMTRA
ESPPDTDLVTEAAASAVTMSDLVLGEQLARFAVEHGAGVNAALVLADAIS
WQGRGDEADALLARYPPDGEDDLTVTRWGCQRAANLFFVCGRPEPAWEVL
AKTRDAVGSGKLTGLVTAMEVAFTYFSADMAGAAAAGSAALATEMMPAAT
VWVALATAGALAKSGRFSEVAAVVRTGEHAASRCESGPHRYSLPLAEVLA
GTLAGEFDDAQRACDRYAAASSDIPQADVMVTALAGRMKLARGQLEDACE
QLQAAVWSMAAKLPPGWPMLVASWLAQAEGARGNAEAAAVALTKAEAEVG
PQVEVFAPELELARAWRAAAAGETSRAQHHAVLAAQNAHAAGMTAVELTA
LHTSTRFGDRTVDARIQQLPTELDCPLGEAIALHSSGLAGHDGNRLVTAA
DRFERIGAMVLAGDAAAHASREFGRRGERGNELEASTRAHWLASRCGAVT
PALRCAADPLPLTPREWEIANLVSSGLSNRQVADRLCLSVRTVDGHLYRM
FAKLGVADRDQLAKLIRFRPAT
118472502YP_888183.1 hypothetical protein MSMEG_3893 [Mycobacterium smegmatis str. MC2 155]MTTTTLARPATRTAVLYRPGSAVFWVFVIALAAGAFALLNQEGSAIHETL
DANLALAPFWVAFVAFMVWLLLRFDPFRAMRPYPQVLVAGAVLGATVAVP
MAITGNTSLEALWGLVFSPEVVANWGPSLCAPIIEEASKLMCALVLLVLC
ASVVTRIAHALLIGMFVGLGFDLMEDLGYASSSAILSLDSDLSGAGTSLL
VRAFTAVPAHWSYTSLTAVGALLLLPSFAGRRDWPAARRIPVAVGLLLAG
PLMHFVWDAPLPDDYDGPLTLVKLVGSLVFYLVIVFALLPFERRWVTARI
ADGRDSGWLSDVSADVLDSLPTRRQRRALRKAARKSGGRKTAKAVATQQD
AALDLIQTAS
118472501YP_884609.1 N-acetylmuramic acid 6-phosphate etherase [Mycobacterium smegmatis strMDLSALETEGRNTRTTELDRLTVPELLAVMNDEDRTVASAVRDVLDQIGA
AVELITESLRRGGRLIYLGAGTSGRIGLLDAVECPPTFGTTPDQVVGLLS
GGPGAFVTAVEGAEDQPERAADDLDAIGVSADDTVVGLAASGRTPYVVGG
LQHARGAGAATVSIACNRDALVSRYADVAIEVLTGPEVLTGSTRLKAGTA
EKMVCNMLSTASMVRLGKVYGNLMVDVRATNGKLVDRVRRIVVESTGAEP
ETAEQALAAADGHAKTAIVMLAAGCSADEAARRIERAGGDIRTAIGAG
118472500YP_889440.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MSTDIGRTAGQKAQRIHWAWVVAAVSFVAILGAAGFRSIPGVMMNPLHHE
FGWTHGTVGLAMSVNMMLYGLTAPFAAALMDRFGVRPVLTVSLLLITTGS
ALSITMTASWQLVLLWGVLVGIGTGSISMGFVATIATRWFEQRRGLVTGV
LTAASATGQLIFLPIVAAVTTHHGWRWASLIVAAAALAVVPLVAVFMRNY
PADKGLAPYGAEEAQAAAPVVPASSFAAAFDGLRLGARSRAFWLLAASFA
ICGMTTNGLIATHFIPAANDHGMPTTVAAGLLATIGILDVAGTVFSGWLT
DRVDPRVLLLVYYAGRGVSLLLLPSLLSPQAEPSTWVFVVFYGLDWVATV
PPTIVLCRDFFGTRSPVVFGWVFASHQVGAAIAAAGAGWLRDLNGNYDMA
FYLAAGLCFIAAVFSASIGKSQVSSEEADSVETSALP
118472499YP_890322.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [MMTSTVLSIGSNLGDRLTRLQSVLDGLGPAVRAVSAVYETAAWGFEEQGPF
LNAVLLADDPDLDGHGWLRRAQELEAAAGRVRGQRWGPRTLDVDLITCHD
GADEIISRDEGLTLPHPLAHLRAFVLIPWLDVDPDATLTVAGESRPVQRL
LSEIDQSERDGVTRTDLVLDIRTETAAG
118472498YP_888088.1 hypothetical protein MSMEG_3795 [Mycobacterium smegmatis str. MC2 155]MTDQNVTPDAAEAQVRDLAEIPAVEVITRAAIMLMSAAAEKIGLSHENPD
NSPHRDLDEARRLITALAGLVTASAEYLGPHAGPVRDGLKGLQLAFREAS
AAPDEPGQGPGEKYTGPVW
118472497YP_890987.1 hypothetical protein MSMEG_6779 [Mycobacterium smegmatis str. MC2 155]MRLRTAERDRVFDAVAHERRGIADLIDGLTPEQLATPSLCGGWDVKTVAA
HLVSDFLDGFRGFLVSGIRHGNMDKGIDALARRRAQAPAAEIAETLRTRA
EFRLSPPVTGPLAGLTDVLVHGADIRIPLGLAHRPDPANVAWVLDFLAGR
TQFGFFPQRRLRGLALHDGDTGRTWGAGQEIRGPGVALMLAVCGRTVALD
RLTGPGVTVLRSRLT
118472496YP_888554.1 branched-chain amino acid aminotransferase [Mycobacterium smegmatis stMNSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGW
HNAQVIPYGPIQLDPSAIVLHYGQEIFEGLKAYRWADGSIVSFRPEANAA
RLQSSARRLAIPELPEEVFIESLRQLIAVDEKWVPPAGGEESLYLRPFVI
ATEPGLGVRPSNEYRYLLIASPAGAYFKGGIKPVSVWLSHEYVRASPGGT
GAAKFGGNYAASLLAQAQAAEMGCDQVVWLDAIERRYVEEMGGMNLFFVF
GSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKK
AGAGEITEVFACGTAAVITPVSHVKHHDGEFTIADGQPGEITMALRDTLT
GIQRGTFADTHGWMARLN
118472495YP_887133.1 hypothetical protein MSMEG_2802 [Mycobacterium smegmatis str. MC2 155]MAAPRGRSPGQAARRSRSPACRPCIDHMFEWVGAGHCPSIVILTWCARGR
QMSMLCATAAGSLHGGSTVAGISVPVSTVITTHCARPRASSQPRPSKAAS
ASRSIASSRRAAWMPGWGRCSAQRTITSRAAVLVSVG
118472494YP_885481.1 dipeptide transporter permease DppB [Mycobacterium smegmatis str. MC2 MTATIRNRLLSTLLVLFGVSLIVFLLLQLVPGDPAVTILGSGATAEAVAA
LRTELGLDRALPIQFFDYLGGLVRGDLGRSLTVNAPVADIMLPRFANTII
LTVAALILCIVVAVPLGVIAAHKQYSIFDRVSMMVSLAGASVPVYWFGLL
LIGAFAVTLGWLPTSGMYNPRFPGGFTDLLAHLVLPAIAAALVPLAVIAR
MTRSVMIDILQQDYIRTLRASGLSTNSVLWRHALRNALPPIVNIIGLQVG
YLLGGVVFVEVVFGWPGLGQQLYTSITQRDIPVVQAGVLFIALAFVIINL
LADGAVGLLDPRTRRKVGA
118472493YP_885725.1 BadM/Rrf2 family transcriptional regulator [Mycobacterium smegmatis stMHLTRFTDLGLRTLMLLSAGESQDQRVTTRTIAKSANASEHHVAKAVSKL
VEMGMVHARRGRVGGLELTEAGRTASIGRLVRELEGDREVIECGGAAPCP
LIAACRLRRALAEAKEAFYRELDRYTVTDLTGGPSLPIVLQLTAAQPATE
RNP
118472492YP_887967.1 transporter monovalent cation:proton antiporter-2 (CPA2) family proteiMEVSGALLLELGVILVALTVLGTAARRFALSPIPLYLVAGLALGEGGLAP
VPATVEFVNTGASIGVVLLLLTLGLEFSIGEFASSLRRHLPSAWIDLVLN
ALPGAIAGWLLDLGAVGILALAGVTYISSSGVIARLLGDLRRLGNRETPA
VLSILVLEDFAMAAYLPLLAVLAAGGTLLHALLGMAVAIAALVVAFVVSY
RWGHHVTRFVSHPDNEQLLLRVLGLTLIVAALAEFIHASAAVGAFLVGLT
LTGDSAHRARLVLSPLRDLFAAIFFLAIGLSVHPSDLIPMLPAAFVLAVV
TAGTKVLTGQFAARRDGVARAGQLRAGTALIARGEFSLVIIGLVGQTYER
LEAIATPYVFILAIAGPVLTRYLGARPVVRT
118472491YP_887566.1 DoxX subfamily protein [Mycobacterium smegmatis str. MC2 155]MLSATFIARGVDALRNPKPAADAARPTLGMMSSLPDPVGSKVPSDAETVA
KINGAVQVVGGLLLASGKMPRLTAAALALSVVPGSLGSHSFWKESDPQRS
AQERREFLTDLSLIGGLIIAAADTEGKPSLAWRGRRAAHKVTASVAAALP
AGAAASESIADSAVAEKLGHGLSVGAERGRELAEIARERAAELAHAAREH
APELAEAARERSAHLAERGAVLADVARERGLEFADVAQKRGLEFADVARG
RGAELAETAREAAPELAETARAHGNVLANRTRKQLKQARRR
118472490YP_885647.1 hypothetical protein MSMEG_1256 [Mycobacterium smegmatis str. MC2 155]MPPTEPTEPPTGGVAPNPNDILVLGENRWLTIQGQVISDQFGDPVRLRPA
TLDFWESAALRGTGKPLSDLFAGLNLDVDRRIRELEMLERLKFDAEKSYA
TEPNDKQAGQQLRRIKERIDKLKTDLVIDLRRGGLDLDD
118472489YP_885087.1 hypothetical protein MSMEG_0679 [Mycobacterium smegmatis str. MC2 155]MDIVLGVSMTPTTVRMVLVEGENADGITVDHDVFDVTAVEDAATMSAADQ
VVAAILGTQESADAGGHHLKSIGVTWSDHSDASALRDSLTAHGIDDVMLV
SEGHAAAALAQAVGRAVGYDTTALLFIDRDAATLSVVQTEDGSVVKVLGS
SLHSTDAMAVLSDMAAAVVAQETPPDGMFIVGSGVDVSSVKEHLQHLVSM
PVNAPEEPELALARGAALASATAPALEASTVGLAYSQDPDGPTAGSAYAL
AGLDTQLAPAGSDLGSLVDGGVDELDPAVFNEVAAADEERKPFLLVGSAL
TSVFVIGVVALVISLAVSIRPTVDQRPAPAQGAVVPTAPVAKAPAPAPAP
EAKPVQEAPPPAPPPETIKAPVPVVQEAPQPQAPPRTVYVEQPQAPAPAP
AAPPPAPEAPPPAPVAPVLPAPAPVYQPPGYIPPVVVLPRVPSIFRPPWE
PQRPPQQNPWNPPWDPPKQAPKPQWPGSGPGGWDPGPGRGSDNGPGRGGG
DNDWNPGRGSGGPGRGDSGNSGWNPGSGGGRNGGGGGHNGGGHNGGGGGG
PVWPFPFGGGHH
118472488YP_885839.1 hypothetical protein MSMEG_1457 [Mycobacterium smegmatis str. MC2 155]MHRIHRITLDDALPLLAAGRAKAEEIGVKQTLCIVDDGGNVIALHRLPGA
RLTGVDIAIAKAFTAAGHERATHLFNEPPNGPALPGNEAFGISHMLPGKF
AIFVGGFPLVYDGQIVGGVGISGGNGEQDKAVGAAILAEFEALTAAQV
118472487YP_888699.1 endoribonuclease L-PSP [Mycobacterium smegmatis str. MC2 155]MTTTSTRIHTGVGAHIATGYADAIAVPSAGTTIYVSGTPGLREDGTTPED
FTEEARQCWANVEAALTKAGAALTDIVYMRQWLTSRDNVSAYMAVSGDVI
RHRPAAMLTIVTGLVWPSIHVEVEVVAVLPA
118472486YP_886001.1 universal stress protein family protein [Mycobacterium smegmatis str. MKLVVGYLATPGGADALALGIRFARTLGAELEICIVLPPDTRAPGMPKGG
YEEVLAGQAQEWLDDALKRVPDDVVAHGHVTFAESFTDGLIGLAQKHDAV
AIVVGGSGGGLVGSFSLGSVVSELLHSSPLPVAVAPRGTRESAIKKVREV
TCAIGQRQGADRLLATAVAASKAAGTPLRLVSLVALDPAFGHLRSDDDAV
RRRAHEHAQKTLDAAKAELPEGFPVTSTIVSGTSVENAVSQLDWHDGDVI
MVGSSRLSAPKRIFLGNTAAKMLRVLDVPMVVVPRDDLEDGEDRS
118472485YP_889374.1 hypothetical protein MSMEG_5128 [Mycobacterium smegmatis str. MC2 155]MGRRLAGGAARQHPDLTSRAGIVLTLLAIDGVISAVVGALFLPIYIGTIP
FPISAVLTGAVNLALVWAAAHWADSLLLAGLPLWTFLAMVVVMTLGGPGG
DLIFAGTGLYAFGAMIFLAVGSLPAVWFLRRRFH
118472484YP_890169.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MRGTAGASGAGFLDGWDEHPDHPALITDGHTVTYAELSARVSAESQLCDM
ARCLVLVELSNTVEAVVSYLAALRAGHVVLVASGADSRDTLVAAYDPDVV
IGTDGADGWTVHRRRLTTRHELHPDLALLLSTSGSTGSPKLVRLSHANLD
SNARAIAQYLGIDGFDRAMTVLPLSYCYGLSVLHSHLTQGATVVVTGLSV
VDAGFWDLARATGATSFAGVPYTFGLLDSVGFADIELPSLRYVTQAGGKM
SAARVRRFAELGHRRGWDLVVMYGQTEATARMAYLPPERVLDAPEAIGQP
IPGGAFTIDGDSELIYHGPNVMLGYATTSRDLALGRTIDCLHTGDLARRR
ADGLYEIIGRRSRFLKLFGLRVDLDQLEHSLRADGIEALCAGDDARLVVA
VTRSTPDPVPVVCTKVGLPATAVQTVVLDELPHNANGKPDYAGVLRLAES
RTQGTESAAPAAQNSDVRALYREVLAVDEVADTDTFVSLGGDSLSYVETS
RRLDDLLGTLPTHWYLHSVADLEQHARSKQRGLFAWMELSTVLRAVAIVL
VCANHVGLTYLFGGAHVLLAVAGHSFARFQLNAVATSGRVRPLIRSIVRI
VVPSVIVIAAAYAITRHYDVWNILLIEHLFAPEGPELGPDAWDPVWNYWF
IEVLFLALVFCAVLLAIPAARRVERTWPFGFATGLVAVGLALRFQPFSGD
GAMELYRPVATLWLFAIGWAAARATRDRERVLLTVAAVCGAMLPGFSDGD
SGRKLVIACGLLLLIWVTRVPVPVGLRRITAILAGASLMIYLTQPLTFFL
LEWGRSLLVDQPDARVPRPAPSGVMHDLRLVAATVIALVAGVLAWKAYEL
VLRHLARLRRDQLHTREHDGVVP
118472483YP_885197.1 sulfur carrier protein ThiS [Mycobacterium smegmatis str. MC2 155]MITITVNGESVEVDDTITIERLLETRGFPEKGIAVALDWSVLHRSEWDQT
LSDGARIEVVTAVQGG
118472482YP_885997.1 hypothetical protein MSMEG_1620 [Mycobacterium smegmatis str. MC2 155]MTAAADLDVRRLTRAEQVEHLRRKMASVSAKVGSAHRGVSGSDDLISPAG
DLLAGPESQDGTAPEQLPRTLPRGTVAVARGARSLTLGMVAAVTAAGGHA
VIVGQPDAGLLAAVEMGADLSRLAVIPDPGADPVEVASVLMDGMDLVVLG
LGGRSVPPSRTRVMTARARQKGCTLLVTDGDWQGPSARLEARVCGYEVTG
AGRGEPTPGRGRIGRIRLTMRSRGRALGPVRAVGG
118472481YP_889603.1 cyanate hydratase [Mycobacterium smegmatis str. MC2 155]MTPIMSKADAAGLVVAARIRNGLSWADIAKHLDAPLVWCVAALLGQHPLS
AEQAEKVCALLDLDASVAESLQLQPARGIDPALQSDPTIYRFHEALNVYG
PALKELIHEEFGDGIMSAINFKVDIQRRPDPDGDRVVVTFDGKFLDYRW
118472480YP_890884.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MADDPELTTFALRMPRWPALVRLRGRDPLVRAVDRVEALIFCLVVVVAVL
AVPVVGAIGTAVHDARSQHNAQAAASRTPVEATVVDISTDAGDAFANTHT
VTGRWLVDGTEHTGVVPASPNVSVGDTVQIWVDRSGAWAPAPPPASSAAA
DAITLSVLILFGLAGATLTVLVLTRKSCDRVRFNRWQHGLDAFIDHGDGY
ASRP
118472479YP_886742.1 dihydroxyacetone kinase [Mycobacterium smegmatis str. MC2 155]MSARRLDASALRDWAHTAVGDLITHTDEINRLNVFPVADADTGTNMLFTM
RSAWAHADAQSGGDVAQVASALAAGALQGARGNSGVILSQILLGLAEVIT
SAAADRGGDLLDVDGPLFGAALRHGVALVAVSMGDPVPGTIVTVLQAAAD
AAEKCVVGGADLAEVAASAADAAATALERTPQQLDVLAEAGVVDSGGRGL
LVLLDAMTATITGHAPRRPAYTPAPPRATASSSVSARAGVPADDVAPTQV
PQFEVMYLLSGCAPEAVEHLRAGLEQIGESVAIATSGGDRYSVHVHVDDA
GAAVEAGLAVGTLNRIQITALTGSGGSRPSGGWERERAVLAVVDGDGGAE
LFAGEGAHVLRPEADEPVSAKQLLRALVDVGAAQVMVLPNGYVAAEELVA
GCTAAIGWGIDVVPVPAGSMVQGLAALAVHDAARQAVDDGYTMARAAAGA
RHGSVRVATEEALTWAGACKPGDGLGIAGDEVLIVGPDVTAAAAGLIDLL
LAAGGELITVLTGHGVDSAVGEALQAHVHDKHLGVELVTYHTGHRGDALL
IGVE
118472478YP_889742.1 hypothetical protein MSMEG_5504 [Mycobacterium smegmatis str. MC2 155]MPRSVLVTGATGTLGHHVVPEATQAGHAVRALSRRPRVGYTGVHWQQGDL
SDAGTLDAALDGIDTVVHCATQPTGDKDIVAARNLTNAVRRNNVGHLIYV
SIVGIDKIPLPYYRTKLRVEQLLADSGVPHTIQRATQFHELIKRIFDIQR
FSPVLVALRDVRFQPIDTRDVASRLVELIDQEPGGRVTDMGGPEVVEHPD
LAQMYLAAHSSRRRVVRFTPPGRIAAGYRSGAHLTPDNAVGTVTFQQYLA
SGT
118472477YP_888201.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MQPLLARHAGDINRRRPDEVIDALTQAGLFRMLTPRRFGGYAVAPRTVVE
VSETVAMTDASAGWVAGLTPMSRGLLPTAPSRCSLRERTDARVKAALAAV
PPE
118472476YP_886802.1 carbon-monoxide dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSNANGRGLIGSSVRRREDDRMLGGRGHFVADLSAGAHHVVFLRSTEPH
ADITRIDTAAATRMPGVIGVFTADDLGMAGACIPSLTTPDESFTAATSLK
LAEQRLPVIASDRVYFVGQPVAAVIAEDRYRAEDAAEAIEVDYVSRPAVA
DPAEALQPRSPVLFDHLDSNAAARIHFAFGDPESAFTRAAAVVSGTYRMN
RHGAVPLECRGVIADFDVRRQRVEITTSTQVPHMVRNAICAVTGWSQADV
VVSVPDVGGGFGTKANVYAEEILLARLARETRRRLIWVEDRQEHLVASAQ
GRDQIHHTRLAVDEQGRILAWADDFVVDIGAGSLWVAGIVANTAIHLLGP
YRVPAAEISGRAALTNKTLVAQYRGAGRPEATFALERSLDAAARELGLSG
VEIRRRNLLTSDDLPYPRPIPYRDGVPIEYDGGDYRACLESVLEALPRDE
IARCAAEHPQYRIGYGLSSYLEATGRGPHETARIRLSPDGRFEVTAGAAS
AGQGHETVFAQVAAEALAVPMEQVIYTPGDTEWLPEGVGTFASRSAVLAG
SAVHRAARELVGSAIDRVARLIGADPDDVQYRDGCFSVGGRPALDWADLV
RAAGVGGALETGGMLDVSAVHRVSTVTWTMGVHAAIVGVHRRTGIVKVLR
YAVSHEGGREINPQIVEGQIIGGVAQGIGGTLFERWAYSEAGQPQSTTFA
AYHLPLTTDVPRVRVRHLHVDTPANPLGVRGVGESGTIAVYAAVASAVDD
ALDGRVHIDTTPIATGDLCRVLARTAS
118472475YP_888703.1 hypothetical protein MSMEG_4428 [Mycobacterium smegmatis str. MC2 155]MGISEFDDVSSHLLEPEESLDSEQTGIDLDEGYSPPESPRELGAWGLTER
EARMHESLTRRLAREVPDTTDRWDGDGIGDSVDSDGEPIDNQVGDARAGR
LLAFEIDPTDSTSDYRAYDVGIDGGAASAEESAMHIVADDDWRIL
118472474YP_890783.1 hypothetical protein MSMEG_6571 [Mycobacterium smegmatis str. MC2 155]MSTLTDHAAHLRGGLVGLCSALTAAVAHTAAGGVPPSGSPLVILLIACAT
LGAAVGGFSPRTRSAATALLIVGLGSGQALGHLILAVTGGHHHGGALVSA
PMLALHAAAAVGLGLLIGAVEYLFIVCATVLSWLRLFAVGRVEPAGDAAW
WPSDVVVARPVLLRAGLGMRAPPQALTAGV
118472473YP_884665.1 membrane protein- MmpL family protein [Mycobacterium smegmatis str. MCMFAWWGRTVYQFRYIVIGVMVALCLGGGVYGISLGNHVTQSGFYDEGSQS
VAASLIGDEVYGRDRTSHVVAILTPPDDKKVTDKAWQKKVTEELDQVVKD
HEDQIVGWVGWLKAPDTTDPTVSAMKTQDLRHTFISIPLQGDDDDEILKN
YQVVEPELQQVNGGDIRLAGLNPLASELTGTIGEDQKRAEVAAIPLVAVV
LFFVFGTVIAAALPAIIGGLAIAGALGIMRLVAEFTPVHFFAQPVVTLIG
LGIAIDYGLFIVSRFREEIAEGYDTEAAVRRTVMTSGRTVVFSAVIIVAS
SVPLLLFPQGFLKSITYAIIASVMLAAILSITVLAAALAILGPRVDALGV
TTLLKIPFLANWQFSRRIIDWFAEKTQKTKTREEVERGFWGRLVNVVMKR
PIAFAAPILVVMVLLIIPLGQLSLGGISEKYLPPDNAVRQSQEQFDKLFP
GFRTEPLTLVMKREDGEPITDAQIADMRAKALTVSGFTDPDNDPEKMWKE
RPANDSGSKDPSVRVIQNGLENRNDAAKKIDELRALQPPHGIEVFVGGTP
ALEQDSIHSLFDKLPLMALILIVTTTVLMFLAFGSVVLPIKAALMSALTL
GSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLSTDYEVFL
VSRMVEARERGMSTAEAIRIGTATTGRLITGAALILAVVAGAFVFSDLVM
MKYLAFGLLIALLLDATIIRMFLVPAVMKLLGDDCWWAPRWMKRVQEKLG
LGETELPDERKRPTVRESETDQRALVGVGAPPPPPRPHDPTHPAPEPVRP
MPPMRSNAPSAAGTARISTPPQPPQPPQAPAQQAGDEPATTRFAMARNAV
RNAVNSAVHGGAGSAAAPTERAPRPGGPAQPPAPPQREEREIESWLGALR
GPAPAKNVPQPPAQPQRPSTDTTRAMPPQGRPPAGPADRGNENAPTTAFS
AQRPPNGGAPADATTAIPTPPQREQEPSTEKLNTREDAPEDPETKRRGGG
MSAQDLLRREGRL
118472472YP_885573.1 N-formimino-L-glutamate deiminase [Mycobacterium smegmatis str. MC2 15MTSYFADHTWLGDEQVADNVLITVDGDTITAVQRDAARPADATHLKGVTL
PGLANAHSHAFHRALRGRTHRGGGSFWTWREDMYAVAECLTPDSYYALAR
ATYAEMALAGITCVGEFHYLHHLPGGTRYDDPNAMGAALIAAAHAAGIRI
TLLDTCYLTGGVGQELQGPQLRFGDGDTATWAERADKLAAAPHAKIGAAI
HSVRAVPPDSIAAVAEWAAQRDTPLHFHLSEQRAENDACLQAYGTTPTRL
LAEHGALGANATAVHATHLTHTDITDLAGTGTTVCITPTTERDLADGIGP
ARELADAGCALSVGSDSNAIVDIFEETRAVELDERLRSEKRGHWTAAQLL
TAATADGHRALGWSTAGRIAPGAAADLVTVSLDSVRLAGAEPETLLESVV
FAAHAGDVRDVVVSGRQVVADGRHTMVDDVPAALHAAIKDTLA
118472471YP_890586.1 hypothetical protein MSMEG_6373 [Mycobacterium smegmatis str. MC2 155]MNQSMNDKVIITCAVTGGMTVPAQSKAIPITVDEIVRAGVEAAEAGAAVL
HVHVREETTGRPVADLDLFERALTELKKNTDAVIQPTTGGGRGMTVEERA
SVLKFRPEMATFNAGSFNFGLFPVAARDLPFADWERDYLEGTTDYIFKNT
FADMTYMAEQMRQSETRPEIEVYDVGHIYNLEQLVKDGVLEPPFNLQFVL
GVLGANAAEPDQLIHMLRTAERVFGRDAFTWSAAGVGYRGEFGLAALSLI
LGGNVRVGLEDNLRITRTENATSNAQLVRKAVDLAATFDRAPATPDEARQ
FLGLKGAAAVGF
118472470YP_888566.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MGSWLSGPGPFDAGDGSDGNDRRGKYPGERLGLPEDGPGSIARTGRRLGA
LIVDWLIAYGLAALLMTFGVISFPLLSTAVLVIWMVIGTLAVRLFSFTPG
QYVLGLVVVPADGRDGIGIVRAFIRVLLIALLIPPLVSDSDLRGLHDRAS
FTAVLRR
118472469YP_886231.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
PAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIE
PSSKADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGL
GPASLVLFDVSTLYFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFP
LTVEAFEGNRAETATMLPVINAFKAAHQLTDVTVVADAGMISEANQVALQ
SAGLSYILGAKIPFLPDVVREWRDKHPDEAIPDGLVLTQPWPATSSEKAR
GIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPVKRNRYIQLTG
ATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFRM
SKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTA
RRYRTVKIKAGTQTLTAADPLPEDLRAVLIKIRADGAH
118472468YP_891102.1 hypothetical protein MSMEG_6902 [Mycobacterium smegmatis str. MC2 155]MATRQTSMTRAKDSDRNDTCKVLDSAMAEGQLSMEEHRDRLSAAMKATTL
GELADLVADLQNEAAPVRLPTLKPPRIPRPSSGSPGWGFKIASAVVLVLL
GIGIGWGMYGSSPTPFHVASDPGAQADGIAPEVLAAPRQLQSLNGFNGLF
DQMRKKFGNTMGYELDIHSDMAFLDRPDPSDNRREMSYTYRGGWGDPSGS
PSAVDSDARLVDLSKFDYEKTLAIMRGAPDTVGIKRADVKDTWLRIGPSE
DPATPEAVNVEIFVNSEFGNGRIELYPDGTTKAIWPAGR
118472467YP_889980.1 hypothetical protein MSMEG_5747 [Mycobacterium smegmatis str. MC2 155]MSFDGVRTVLTPDHQARLAVMRAIDLEAAQVAVPGPVVTGPAWAGRGLRL
PAPPDPEHAAELAQRAVDAARNVSGIELDYAPASLSLVDGILEELREPGS
DAVAETIFAFGCYVGEVLVRNAGYEWVDTPPDLVRNMGPLTNYRASTATH
ANPIGKAFKRVDNGDTDSVAYFYRVFTMDTEPGRRGV
118472466YP_888327.1 hydroxyquinol 1-2-dioxygenase [Mycobacterium smegmatis str. MC2 155]MDITPDESAAVVAASFDNTPDPRLKEVMQSAVRHLHDFVREVRPTNAEWE
LAIDFLTRTGQACSETRQEFILLSDILGVSMLVETLNDAGGRLPEGDGLP
VTATTVLGPFHMTTSPTRRLGENIDVVGSGMPCVVKGHVTDVSGNPIPGA
KLDVWHANEEGFYDVEQPDKQPAGNGRGIFTTDEDGSYWFRTVTPRHYPI
PTDGPAGGLVVQAGRAPYRPAHLHFIAEADGYEAVTTHVFMSKSPYIDSD
VVFAVKSSLIRDFVEIEDEHQAADYGVRAPFRLVQFDLALAHAD
118472465YP_884576.1 formate dehydrogenase subunit beta [Mycobacterium smegmatis str. MC2 1MSEPVTVYVPCDSAAKSVGADEVAHALTAAAERVGRPIRLVRNGSRGMLW
LEPLIEVATPNGRVGYGPVTPDQVDELVGAGLFDAAEHPLRVGVVEDLPW
MATQDRVTFARVGVTDPVSPDDYLDHGGLAGLRRALQMSPAEVVAEVTDS
GLRGRGGAGFPAGIKWKTVLDCADALKFVCCNADEGDSGTFADRMVMEGD
PFMLIEGMTIAAHAVGATEGYIYIRSEYPDAIATMRAAIDIARGRGWLGD
DVLGSGLRFDMHVRVGGGAYICGEETSMLESLEGKRGMVRAKPPIPAING
LFGKPTVVNNVLTLSSVPLVLAEGAQAYADFGVGRSRGTQIFQLGGNIRR
GGIVERAFGITLGELVEHYGGGTLSGRPVRAVQVGGPLGAYLPSDRFDLP
MDYEAFAEAGAMVGHGGIVVFDETVDMAAQARFAMEFCAAESCGKCTPCR
VGSVRGMEVIDRITAGDHREENLALLDDLCDVMTEGSLCAMGGLTPMPVR
SALTHFPDDFGPRQPSADATAAPLGARTEGPR
118472464YP_887529.1 molybdenum ABC transporter ATPase [Mycobacterium smegmatis str. MC2 15MTEVLKIDDVTFRRNGKQIIDGISLTVRSGEHWALLGPNGAGKSTLLGFC
AAVTFPTTGSVWVLGAQMGRTDLSVLRRSIGHVNPRHRLQYPLTVREVVL
TGITATVDTAARWTPSPEQIARAEELVDTVGLSARVDAEWPTLSQGERGR
TLIARALISDPRLLLLDEPTTGLDVAAREQLLETLDALDDTHPDMASILV
THHLEELPTSTTHAILIAEGRTVASGRAVETVTTDHVTTAFAHPVTVTYD
EGRWTARAKPGARML
118472463YP_886708.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium smegmMSTELIRSDAATLGAKIAAKEVSSTEVTQAHLDQIAATDDRFHAFLHVAA
DSALAEAARVDAAVAAGEQLPSPLAGVPLALKDVFTTTDMPTTCGSKILE
GWQSPYDATVTVKLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNT
ERVPGGSGGGSAAALAAYQAPLAIGSDTGGSIRQPAALTATVGVKPTYGT
VSRYGLIACASSLDQGGPCARTVLDTALLHAVIAGHDARDSTSVKADVPD
VVAAARAGATGDLKGVRVGVVKQLRGDGYQPGVLQSFNAAVEQLTALGAE
VTEVDCPHFDHAMAAYYLILPSEVSSNLARFDAMRFGLRVGDDGTHSAEE
VMALTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDR
AYENVDVLVSPATPTTAFGLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSV
PSGLSPDDGLPVGLQIMAPALADDRLYRVGAAYEAARGPLPSAL
118472462YP_886102.1 ISMsm1- transposase orfB [Mycobacterium smegmatis str. MC2 155]MIVDYIDAYRHRFGVDPICAVLSEHDMPIAPSTYYAAKARGPVSDAAWAE
AHAANAVHTVFWANRGLYGVRKMWHAMRHAGHDMGRDQVARLMRICGISG
AVRGKRRTITTASEQGAPRHPDLIERKWGLPVRPDQWWVADFTYTWTLAG
FVYTAFCVDVFSRRILGWRVMSTKATPLVTSVLEQAVFTRRRTDFRFTTT
GLVHHSDAGSQYTSLAFTDALRDSGIAGSIGSVGDALDNALMESAIGLYK
TELIDRHQSWTGRAEVERETAAWVHWYNTDRLHSSLSYQSPIDYEAQYRN
DAASTPEVA
118472461YP_890965.1 glycerol operon regulatory protein [Mycobacterium smegmatis str. MC2 1MPGTVQSVERAAAILQLLGIEDESLGLVQIAGALGLAKGTAHGLLRTLHG
VGFVEQDASGRYRLGPDLFHLGSTQLDLNELKARALNWADALAARTGEAV
RVAAFRAGRAVVAHHVFRADATAQVLEVGAIVPLHASALGKVLLAFDPGA
ARSLGALDSLTYRTITNRAQLQHELADTRDRGWAASVEEEQPGVASIAAP
VRDRGGYVVASIGISGDVERLCDHRARPLERLAELVVRAGRSVSREFGHG
REL
118472460YP_887659.1 hypothetical protein MSMEG_3352 [Mycobacterium smegmatis str. MC2 155]MSSRDASEGAGDRAPVSGIALLTLLALLFLGMVVLGIATGDVPIDNKALA
FAPVFYSLTVMGGLVAYFFGFIVLEAVLSRRGDPARGRERAALVILGLVS
GVFFVTCLLALPVVALGVAANGLGVGIALLWTVRGGARVYWVLLWVSFAL
AVIAGAWTAVAIQGAIV
118472459YP_886700.1 cysteine desulfurase [Mycobacterium smegmatis str. MC2 155]MTSTAGRQVYLDHAATTPMHPAAIEAMTAVLAGVGNASSLHGSGRAARRR
MEEAREALARLLGARPSEIIFTTGGTESDNLAVKGIYWARHDADPARRRI
ITTAVEHHAVLDAVEWLVAHEGAEVTWLPVDRDGAVSPAALREALQAGAH
DVALVSVMWANNEVGTIMPIAELAAVAAEFGVPMHSDAVQAVGQIPVNFG
ASGLAAMSVTAHKFGGPTGVGALLLRRDTACVPLLHGGGQERDVRSGTPD
VAGVVAMATAAGVAIENLADNSARVRALRDRLIDGVLSAIEDAQLNGARG
DARLPGNAHFTFHGCEGDSLLMLLDAKGVECSTGSACTAGVAQASHVLIA
MGADAVKARGSLRLSLGHTSTEADVDTALEVLPAAVERARQAALASAGTV
SR
118472458YP_889124.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MPANAAQSAARTRVEGAPSAAPGSQTLARGLSALQAIADAPGGLTVQQVA
DHLGAHRTIAYRLLATLSQFRYVAKGEDGRYRPAAALAVLGSSFDNNVRQ
LAIPTLRTLADELGTTVSLLVAEGDQQVAIAVIVPSQVYYQLSFHEGSRH
PLDRGAAGVALLASMPPRPGERDLVRQTREQGWVITHGEIEPNTYGLAVP
VRRRPPSPPTCINLISHREDVVLGGKDAVVRAARELSAILH
118472457YP_886181.1 thiosulfate sulfurtransferase [Mycobacterium smegmatis str. MC2 155]MSLPADPSPTLAEYAHPERLVTADWLASNLGRPGLAIVESDEDVLLYDTG
HIPGAVKIDWHTDLNDPHVRDYINGEQFAALMDRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLDGGRDLWVSHGRDTTLDVPTRQSSGYPV
VERNDAPIRAFKEDVLEILGKQPLIDVRSPQEYTGERTHMPDYPEEGALR
GGHIPTAKSIPWGKAAKDNGQFRSRAELEELYGFLTPDDETVVYCRIGER
SSHTWFVLTHLLGLPGVRNYDGSWTEWGNAVRVPVAVGPDPGSAP
118472456YP_890342.1 dipeptide transport ATP-binding protein DppD [Mycobacterium smegmatis MTTSANRSATAVLADPALKVDGLCVDIRSMSGTVRAVDHVSFEAHRGETL
ALLGESGCGKSMTATALVGLLEPVASVSAGTAHLGEVDLFSADRKTRRAL
AGTELAIVFQDALTALNPLYTVGTQLAEPFRIHQGLSVREARRKAVELME
RVGIPQPESRLHDYPHQFSGGMRQRLLIAMAVALNPTVLIADEPTTALDV
TVQAQIMALLRDLRTEYHMAVVLITHDLALVVEEADRVAVMYAGQIVETG
PVAEVFANPAHPYTKGLLDSVPVSAVRGEALASIGGAPPELSAIPKGCVY
QDRCPHVADICVTTRPVLEGEHRRAACHFSDRAAGGTGGEHHE
118472455YP_886020.1 hypothetical protein MSMEG_1643 [Mycobacterium smegmatis str. MC2 155]MGREEIADRIRTVLRPVATVSAGAALVLLVWAALLGLWSRLVSPRSMAEQ
DWYPTGLHRWGESLPNGLAIATTGVALVLLGAIAYSIRRGRTDGYRPAAP
AVWAAVLALLFFAFFTRGIPEYYSVVMGNYPVTTALPFGVTAWFLSVAGA
VATLLGASAFWRLRREHVRLVAVGAVIAVVAAAGVTVGALRSGDDGRFVD
ATRAPGAPGDSAPAFPGELGTRSFTVSVPDAFTDNPAQPVYSIAPGGQGF
VVYHAGRVTAYGADGAERWHYNRTGPGGVSVAGMRVFDDGQTVVMFVDDA
LVALDATTGEQLWSSMDPGLVYAVSQQSGFNLDSPFAIVREAAAWTRYDT
RTGTRMWTVPVPDERCEYPPREADTRNWVVTVSRCRSGEDVGIRVYVLDP
ETGQIRSDREIMRGGEDLMAIATPANDDGIFMQFAGAGAPASALSAMSYV
NVADDTVTALPEEFAGEPSFGPSGAFLATGPRGREVTRFGVDGRRLCTVT
DDVRGARTEVPGEGRGLAYASFDSGFVIADRLGGLRTFDATCAQTGGIPE
AAADIATDVAVSGFLPVPGAVLVLRRDGSALQIDGYTAG
118472454YP_886012.1 nitroreductase [Mycobacterium smegmatis str. MC2 155]MTLNLSVDELLTTTRSVRKRLDFEKPVSREVILECLDLALQAPTGSNAQG
WQWVFVEDEAKKKALADIYRSNAIPYLEQEAAERGDIRDQQQPKVRDSAR
HLTDNFEKAPVLLIPCLEGRPDGAPAGLSASFWGSLLPAVWSFMLALRSR
GLGSAWTTLHLLGEGEKQAAEVVGIPFDKYSQAGLFPIAYTIGTDFKKAK
RLPAEQFAHWDTW
118472453YP_884511.1 hypothetical protein MSMEG_0094 [Mycobacterium smegmatis str. MC2 155]MRKFGVATGMAVAGGLVAAVVGLPNPASADPGDQPWVNTLGPNVTVLKVS
NSVSRASER
118472452YP_885623.1 inner membrane protein YidH [Mycobacterium smegmatis str. MC2 155]MNDSETDTVETLIEPDYRFTLANERTFLAWQRTSLGLLAAAVAVVQFLPE
LTIPGLRHVLGMTVGAMAILTSMAGLHRWTQVDRAMRRDQPLPRVSVPTY
LAAGLSMMGLVTVALAITASLR
118472451YP_885779.1 hypothetical protein MSMEG_1393 [Mycobacterium smegmatis str. MC2 155]MRAHTTRILGTTAAAVAVLGLAACGSESSDTNTPSATAGSSGVNVEIGNT
INYMSVGTTADIDCADGKSLTVGGANNTLTVKGTCANVNIGGSDNKITFE
KIDKDLTVVGLNNTITYRDGDPKINNTGSGNSVSKG
118472450YP_884530.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKLKSLLVATAASALALAGCAVDNSEQDAEKPTIRVGYQTFPSGDLIVKN
NGWLEEALPDYNIKWTKFDSGADVNTAFVAGELDFGALGSSPVARGLSAP
LNIPYKVAFVLDVAGDNEALVARDGSGVNSIADLRGKRVATPFASTAHYS
LLAALAQNGLSPNDVQLIDLQPQAILAAWERGDIAAAYSWLPTLDDLRKT
GKDLITSRELAADGKPTLDLGVVSDKFATEHPDVVDTWREQEARALDVIK
DDPDAAAKAIAAEIGLSPEDVAGQLKQGVYLTPAEVASEQWLGSDGKPGN
IAANLQSASEFLAEQKQIPEAAPLGTFEDAIYTKGLPGAISK
118472449YP_884986.1 MmpS1 protein [Mycobacterium smegmatis str. MC2 155]MLKQAWIPLVLAVVLPVSGLVVWRLHEKFGSEDLNANAGAGIEIVQFNPK
ILVYEVYGPPGSTAQISYFDTDANVHSVNTTLPWSVTLSTTLPTVSANLM
ALGSNDEIGCRVTVNGIVREEKSANGIDAQTYCLVKSA
118472448YP_885489.1 urease subunit alpha [Mycobacterium smegmatis str. MC2 155]MTTIDRRAYARMFGPTRGDRIRLADSDLFVEVEHDHTVAGYELLSGAGKS
VRDGEGYRPSSKPSDGALDYVIMNAVVIDAVAGIIKCDIGIRDGRIVGIG
KAGNPDTMPGVTESMVVGSATTPIPAEGMIVTAGAIETHAHLISPQQTEH
ALSTGTTTLIGGSLGPSFEVATGGPRNLGMFLKAGDYTPMNYVPFGRGSS
DPAAVLEMVAAGAGAVKIHEDFGASPDIIDKTLQAADSADFAVHLHTDSI
NEFGFSETTMLTIGDRTIHLYHVEGAGGGHAPDLIRCVSFDNVIPGTTNP
TNPYTLGGLDEGVPMTMAAHLMNWESPEDIAFAEARIRPQTMVAEDLLHD
MGAISIFGSDTQGMGRVAENIANCWQLAAVMKQRVGRLPEEKTVAADNER
VKRYIAKLTINPAISVGADDHIGSVEVGKVADLVIWKPAFFGVKPQVVLK
NGYIAWAALGDAAGSISSSEPIIQRPNWAALGDAAADGGFVFMSSLAIDA
GVPERLGLRKHVLPIKSVRSLRKKDMVRNDALPHVEVDPRTFDVRADGVL
LTAEPAVSVPFSRKFLLR
118472447YP_885674.1 twitching motility protein PilT [Mycobacterium smegmatis str. MC2 155]MVIDTSALVAILTDEPDAELLEGAVADDPVRTMSTASYLETAIVIESRFG
EPGGRELDLWLHRASVALVAVDADQADAARLAYRRYGKGRHRAGLNYGDC
FSYALAKVSGQPLLFKGEAFRLTDVAAVH
118472446YP_888376.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSAVRTSPDITMALTVDGIRAAIQPALERLSATARFREDTRDYAYDDVYE
LAAHGVGLTGIARTEGGAGGTVRDVADLTITIARADSNVAQALRPTFLVA
HQIAARHDVPLRAVNLERLRNRALFAGTGNERNGGASGSVSTTARRVEGG
YVINGRKYYSTGGLYASYFSAQALTEDGTVVHFTVPVDRPGVDRLDDFDA
IGQRLTQSGSTQLTEVRVDDDETVVMADSIPDNPWRGSFAQLYLAAVQAG
IAARALDDAVQYVREKGRPIKHSSATRSVDDPYIRQTVGEIAARAQGARA
AVLLAAEALQNQRGLRREQARHAGAEAAVTVAQAGVVAVESALRAAELLF
DVGGGSITDRSLGFDRHWRNARTAANHNPRQWKLAVAGAYHLVGEEPPTT
GLF
118472445YP_884587.1 histone deacetylase superfamily protein [Mycobacterium smegmatis str. MTTMLIHHEIFAAHRTAAGHPERPDRYRAVEMALAQSRFDDLLRVEAELA
ELDVTRYVHSNAYVDALEAARPTDGFVYLDGGDTMMEPSTWEVVLRGVGG
TLQAVDSVLDGTAQNAFVACRPPGHHAETERAMGFCLFNNISIGARHAQL
KHGLSRVAIVDFDVHHGNGTQEIFYSDGSVVYASTHQMPLFPGTGATDET
GVGNIFNAPLRAGDGGDELREAFRDRIIPAVDRFEPELIIVSAGFDAHER
DPLGSLSMTADDFGWATRELMAAAERHCEGRLVSVLEGGYDLQGLRESVS
AHVDELVRG
118472444YP_890968.1 glycerol-3-phosphate dehydrogenase [Mycobacterium smegmatis str. MC2 1MTVGAYPLSPAHRAAALDRLASDEFDVLVVGGGVVGAGAALDAATRGLRV
GLVEARDYASGTSSRSSKLFHGGLRYLEQFNFSLVFEALRERSLVLNTLC
PHLARPVPFIYPLQTRFDRAYAGLGIGVYDVMGAGRGVPGHHEHLGRART
LESFPSGSPAIRGAIRFYEGQVDDARHTMMLVRTAAHFGAVCANSTRVTG
FVRDGERVAGVGVRDLDGGREFEVRAKQVINATGVWTDETQGMAGGQGQF
RVRASKGVHLVVPRSRINSSTGIITRTEKSLLFVIPWGSHWIVGTTDTDW
SLDLAHPAASRADIEYLLGHVNTLLADPLTADDVVGVYAGLRPLLAGESD
STSKLSREHAVASPVPGLTVIAGGKYTTYRVMAKDAVDLAVRGLGRAVPS
SCTERVPLLGADGYPAAWNARRRTAEDTGLAVTTVAHLLGRYGTLTDELL
EIIAHRPDLGVPLAGAPEYLKVEAYYAASHEGARHLEDVLTRRTRISIEV
ADRGVAAAREVADLIAPVLGWSQTDIAREIEHYDARVAAERESQHQLDDY
TADAARLGAPDVRVGVTQ
118472443YP_886999.1 hypothetical protein MSMEG_2662 [Mycobacterium smegmatis str. MC2 155]MVACASAAAAVGTVLGSAGIASAAPEGPSSPSQTVSELRAQGYHVVVNTV
GAGSLDGCAVKAIRPGQTFTRTDSGFPGAMDDLRTSVTAKTVYVDVTC
118472442YP_887132.1 hypothetical protein MSMEG_2801 [Mycobacterium smegmatis str. MC2 155]MRLPLGGDKRWPGMAIPGTVAAPRIFAVPSTSVGVRDGQ
118472441YP_888846.1 DegV family protein [Mycobacterium smegmatis str. MC2 155]MAVVVVTDSSSRLSRQLCERWGIRQVPLHILDGDNDLRDGVDAVPSDIHD
RPKVTTSGATPTEIADVYRRALADSGGDGVVAVHISAALSSTYSSAASAA
REFSHAVRVVNSRSAAMGVGFAALAAARAAGAGASLDDVEAAARAAAQRT
HAFIVVHRLDNLRRSGRIGTAASWLGTALALKPLLQLDIDGRLVLSQRIR
TASKAHSALVEQVLEEAGDRLVDVVVHHVDNPEAAEEIGKQLTERLPALR
SLEVADMGPVLAVHVGGGAVGVALSVDPES
118472440YP_885758.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MTALLEARGISRSFGHVRALDGADFDIDAGEVVGLIGDNGAGKSTLIKAL
SGSLELDDGEILFEGKPVHLATPRDANDLGIEVVYQDLALAPHLNPVQNV
FLGREIPRPGLLGRFGFMDEKTMRKQAAASFAELGATVRSLSAPVGSMSG
GQRQSIAIARAIAWADKVVILDEPTAALGVVQTKNVLETVKRVRDKGIAV
IFISHSMPHVLEVCDRIQVLRLGRRVATYPGQGTSVETLVGAMTGALDGR
AA
118472439YP_891061.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MATTALRGLHVLETLAGMRQPATLRDVAARAGLSESNAFRILQALENEGY
VHHLGRSGYRLASRALALATVIGPRPAMLRLMHPIVARLAAVSGEAAVVH
LRAGQFRVLVLGVPAPSGPIVDPAGVLGERSPLAAGASGRIILAYLTETE
LADVDLDGVTPEQLAEIRDRGYETSYGENHPGINGISVPLLATPDDPGAA
LIVLGSMTIAGPAERLPPRAVTRLVGPLLGACRDLSPRLAALLGPNPGAT
IDALDL
118472438YP_890072.1 C4-dicarboxylate transporter [Mycobacterium smegmatis str. MC2 155]MDTQQPPYRDPPPGGRVRRVKPNVFAVVMATGIVSIAAADHHLGVISAPL
AVLALLALPVLMYLTATRWRTFDIGDIDIVMSLYTYVAACAVLTARLHEY
GWSVWVFGPLATAGWVSLAPMVIRRMRRLGLTGMRDRARGLWELASVATS
GLAIVFMAGGNLFAAMSLWVLAMCVYVVMTGLVAWRGLVEPETRRNVPAD
HWILMGAAAIATLAGEHIHSTLHPGPIADAVLAVTVVTLGVASVQIVPLA
LTGWRQLNNWPAVFPLGMYSAASFAVAGETGWHPLVVVSQVFFGIAFAAW
LMAVATRVPR
118472437YP_889471.1 hypothetical protein MSMEG_5225 [Mycobacterium smegmatis str. MC2 155]MGTAPYGVRLLVGAAVTTLEEARKLPQTILTYPMTMASQAANLVMHVQQN
LAELVIKGDEALEQLFPPKDEQPEWATFDEDLQDSGDDDTAGDSASTSSA
NGQRRTEGRFALYSTGTPDSAESEPAARSSKSSEPSKPSEPETGEAPAVV
AEMDYDSLTLAQLRARLTSLSIGDLEALLAYEEAGRARAPFVTLLANRIT
RASAK
118472436YP_889651.1 radical SAM domain-containing protein [Mycobacterium smegmatis str. MCMTTGMGLRGDRLHRYVTAFCPHCHAEAPERPLADVQRLAAMLIERDGRIW
LERGCPTHGLVRTLYDEDPKILSYLEEWTAPTKAHTPDVAGNFDPVPSAY
LRGLPEMQTQHTCILLEDISEACNLRCPTCFTDSSPDLRNVVPVAEVLAN
IDQRLARENGRIDVLMLSGGEPTLHPQLPTLLAELVKRPITRILVNSNGV
RIANDDALLDLLTLHRERVEVYLQYDGLSAETHRHHRGGDLGRLKQQALQ
RLSEREIFTTLVMTATLGVNDHEIGAMVQLALDTPYVGGLTIQPQFGSGR
SGAIDPMERLTHTGVLKRMGPQTDGAVTWRDLTALPCSHPHCCSVGYLVR
DDSDRWRSLVSLIGAESLKDKLGLVANRIADTEIPRELRLAVQESLLGLL
SEQSSLSHPEIGDVWRNICENCDLGMSTLLTLASSTLPGRRRKIRRLLGE
RVVRLTVKPFMDMSTMIEERLIQCCVHVGTRSTEQHQCAPFCAVQAWPAL
SRQRLSLASQATMPALPLIEIR
118472435YP_891110.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MAETEPQVTELAGELQRVLSKVFSVLRRGDTHRGTAGDLTLAQLSILLTL
LEGGPIRMTELAARERVRTPTTTVAIRRLEKLGLVKRSRDPSDLRAVLVD
VTPQGLVQHRESLAARRADLAERLSKLSDEDLATLARALGPLERLAGQDE
DKKNERETPKPAEQTS
118472434YP_888810.1 cysteine desulfurase [Mycobacterium smegmatis str. MC2 155]MSTSEYRSLNAESDLPISADELSALATQLFAAGIRPGPDTPPQTAPVAPR
GNVPGTAHPVAPPTEFVAVPSAVWSVPAHTSPVPEPVAPQTDPLVPPGVA
DLTAFTVPGGIVPTLPGVLAGARTAVPAAESPDYYFLRDTRAHQPVPQFP
DRHEIFDVNAIRADFPILRETVNGKPLIWFDNAATTQKPQAVIDRLSHFY
AHENSNIHRAAHELAARATDAYEDAREAVRRFIGAAKAEEIIFLRGTTEA
INLVAHAWGGKHLGPGDEIVITHLEHHANIVPWQLLSRQTGAVLKVAPVD
DAGNLLLGEFEDLLGPRTKLVAATQVSNALGTVTPVETIVELGHRYGARV
LIDGAQSIPHMPIDVAALGADFFVFSGHKIYGPTGIGVLYGREDALAETP
PWQGGGNMIADVTLERSLYQGPPNKFEAGTGNIADAVGLGEAIRYVERVG
IERIAAYEHALLEYATPRLAAIPGVRIVGTAQEKASVLSFVLAGHEPLEV
GKALNAEGIAVRAGHHCAQPILRRMGLEATVRPSFAFYNTFDEIDVFIDA
VRRIAEGSV
118472433YP_890503.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium smegmatisMTTFKERETSTADRKLTLAEILEIFAAGKEPLKFTAYDGSSAGPEDATMG
LDLKTPRGTTYLATAPGDLGLARAYVSGDLEPHGVHPGDPYPLLRALAER
MEFKRPPARVLANIVRSIGIEHLKPIAPPPQEALPRWRRIMEGLRHSKTR
DAEAIHHHYDVSNTFYEWVLGPSMTYTCACYPTEDATLEEAQDNKYRLVF
EKLRLKPGDRLLDVGCGWGGMVRYAARHGVKALGVTLSREQATWAQKAIA
QEGLTDLAEVRHGDYRDVIESGFDAVSSIGLTEHIGVHNYPAYFNFLKSK
LRTGGLLLNHCITRPDNRSAPSAGGFIDRYVFPDGELTGSGRIITEAQDV
GLEVIHEENLRNHYAMTLRDWCRNLVEHWDEAVEEVGLPTAKVWGLYMAG
SRLGFETNVVQLHQVLAVKLDDQGKDGGLPLRPWWSA
118472432YP_891045.1 hypothetical protein MSMEG_6841 [Mycobacterium smegmatis str. MC2 155]MARVGFELRDGVHASHARTRRCLRPATIIQFPVRWIRTTINRC
118472431YP_889315.1 Mg/Co/Ni transporter MgtE [Mycobacterium smegmatis str. MC2 155]MAAVNRVYAARLAGLVVLGPDGESIGRVRDVVISISIVRQQPRVIGLVVE
LLTRRRIFVPILRVTAIEPGAVTLATGSVSLRKFVQRPGEVLVLGQVLET
RVRVEDPDLPELAGVDVVVVDLGIEQTRTRDWVVTRFAVRQQRRLGRRSN
VYVVEWQNVHGLTPSGLAMPDQGVASLLEQFEGQRPVEVAEALRELPPKR
RYELFRAFDDDRLADVLAELPEDEQADVLRGLNTERAALVLEAMDPDDAA
DLLGAMTPADAEVLLGRMDPEDSEDVRRLLAHSPDTAGGLMTSEPVVLAP
DTTVAEALARVRDPDLTPALASLAFVARPPTATPTGHYLGCVHLQRLLRE
PPATLVSGIVDNDLPTLSPEDSLAAVTRYFAAYNLVCGPVVDSQNHLVGA
VSVDDVLDHLLPDDWRETDEPELRVSGS
118472430YP_886453.1 56kDa selenium binding protein [Mycobacterium smegmatis str. MC2 155]MPTDPTFYRSPGHAVAADSEQLAYVVAFDPTGRKLDALAAVDCEPGSPDF
GKVVGWTELPIAGGELHHFGWSACSSALCHDGHGGNHGALERRYLLVPGL
RSSATYVLDTKPDPRHPMITHTIDATELAAKAGYSRPHTVHCGPDGIFMS
ALGGANGADGPGGVALIDHNTFEVIGPWEIDRGPQLFAYDVWWHRDFDTV
ITSEWAAPSMIEDGLDPADLLGHRFGHHVDFWSMSERKLTQRVDLGEQHQ
MVLELRPAHHPSHPWGFVNSVISTEDLSASVWLWHKDGEQWAVDEVINIP
AEPADADELPPLLRSFAAAPPLVSDIDLSVDDRWLYVSCWGTGELKQFDV
SDPFHPRETASVRLGGMVRHEPHPAAPDLALAGGPQMVEISRDGRRVYLT
NSLYSAWDDTFYPDGVGAWMIKLDADVTAGGLVPDDRFFLHGEDFRGLRV
HQVRLQGGDASSDSYCYPS
118472429YP_888665.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTSTATEPITYGSQRLAELIEKIGEGSLERERTGERPFAVIDLIKQSGLG
ALRVPREEGGGGATLRDLFATVIAIATADVNVAHILRGHFAHIEERLRLD
SELRQKGIDLALSGKLIGNASTEIGSTPAGGFTWQTRLTRDGDNYLLNGK
KFFTTGTLYSDYAEVLASDPTGASVITLVPTDHPGVTVLDDWDGMGQRAT
GTGTAIFENVPVAAEEVMEFAPPGADDEEQSLYHSGAFFQLYVTALEVGV
IHALRRDAVEHVHTRARSFAWAPHPVPADDPLLQREIGEIAAAAYAGEAT
VLAAAEALGRAYQADIDKTDPDLVLAHEASLQAAQAKIVVDALAQKAASQ
IFDVGGASIVRQAYLLDRHWRNIRTLASHNPSSYKAQAVGAFFTRGTRLP
GSGYF
118472428YP_887774.1 NAD-dependent epimerase/dehydratase [Mycobacterium smegmatis str. MC2 MRVFVTGASGFIGSAVADELIAAGHTVIGLARSDASAEALTRAGHEVHRG
DLTDLDSLRAGAASADGVIHLAFVHDFENFAGAVQTDSAAIEALGETLAG
SDRPLVVAAGVAGLPRGTTEDDAIPAGFPRLSETTALNQVSKGVRASVVR
LPPSVHGRGDYGFVPRLISIARERGVSGYPGDGSNAWSAVHRVDAARVFR
LALEDAPAGSRWHAVADEGIAVREIAETIGRGLGLPAVSVPPDQATAHFG
WLGGFFAVDANLGSALTRQRLGWEPTGPGLLADLDAGHYFESAAGQGLET
VTG
118472427YP_887357.1 thiopurine S-methyltransferase (tpmt) superfamily protein [MycobacteriMTGPTGSEFDFDALYRGESPAEGVPPITSVPWDTKAPKENVVAWEQAGLV
HGHVLDIGCGLGDNAIYLAQQGYRVTALDISPTALITAERRAADAGVDVT
FAVADATRLDGYDDVFDTVVDSGMFHCLSDDAKGSYAAAVHRATRAGATL
LLGAFSDANLQHDNWQAAWVSEDTLRSSLDDGGWDITSLTTETIRVPGAA
LAGSGDEGGADEFDAAFFLVQAQRR
118472426YP_885949.1 hypothetical protein MSMEG_1569 [Mycobacterium smegmatis str. MC2 155]MGLLLTSGRKLAQKSTFAANTRNQEVEPEFEACVELFADSRHEFTRGERR
RPGPTCGGRARRSRRDIRR
118472425YP_887676.1 transporter [Mycobacterium smegmatis str. MC2 155]MLLHTARSTRDAASETRSYPAVIALCMVITVIEGFNLIVYGSVVPMLLAD
ASLGVTDEQTGLIGGLVYIGAIIGSVAAPTLADRIGRKRVLVVAISVFAA
GAILTGCSVSALMLALARTVTGLGIGASLTTAMTVARNSAAAARASLAMT
VTMAGIPLGGVMAALLAVPILPAFGWRPMFFVGAGTGLIILVTVVFMAIP
TDTPQELAGRLCSTREKLAILFTGRGLVVTAIVAGCAIANMVSWQGLNVW
AAQAMVDLGFTLRTALLMTFVLTASAVAGSFLTAWAADRRGPAVVGIATA
GSTFVGLAGLLTLPASLVTVVGCVALMGIGGHSTMNLIHATTADIYPLPA
RASALGWSNGTSFVGSFTGPVVGGTAIATGGAHGLFEVFGAAAAVCFLSV
SALYVADRRGRRQPTAGTDQSANSETVAIAFR
118472424YP_890578.1 hypothetical protein MSMEG_6365 [Mycobacterium smegmatis str. MC2 155]MTINPDDDNIEILTGAAGGADTEGEGEGEGKSLTDLVEQPAKVMRIGTMI
KQLLEEVRAAPLDDASRNRLREIHQTSIRELEDGLAPELREELERLTLPF
TDDNVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQG
ALPPGIQVPGAQRGGATHPGTGQYL
118472423YP_885116.1 molecular chaperone DnaK [Mycobacterium smegmatis str. MC2 155]MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARNGEVLV
GQPAKNQAVTNVDRTIRSVKRHVGTDWNIEIDDKKYTPQEISARVLMKLK
RDAESYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA
AALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGDGVVEVRATSGDNHLG
GDDWDDRIVTWLVDKFKGSSGIDLTKDKMAMQRLREAAEKAKIELSSSQS
TSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRQPFQQVIKDA
GISVSDIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF
DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHAEED
RKRREEADVRNQAESLVYQTEKFVAEQRGAASDGGGSKVPEETLAKVDSA
IADAKKALEGTDISAIKSAMEKLGVESQALGQAIYEATQAEQPAGGSDNG
APGDDNVVDAEVVDDDAGKENK
118472422YP_886544.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFNLTKEQELLRDGLTKFLSSRYDLQTSRAAAKLGEGWQPDIWRGFAEE
LGILGATLPEESGGIGGGAVEAMVIAEALGHALVIEPFVDTVVVAGGLLQ
RAGGDAAQNVLEDLVGGAAVVAVAATEPTSGDNWYSVETTARRDGDEWVL
DGSKIVVVNALFATHLLVTARTSGDTTDKDGISLFLVETASAGSGFTAHH
YRTVDDRRASDLEFDGLRLPASALLGPEGQAGPSLELARDEGAAAVCAEA
VGGMRKVLADTVEYCKQRQQFGQPIGSFQALQHRMVDMHMEVEQASAAMY
LAVLNLDSDAVTRAKAVSAAKATVGRAARFVGQNAVQLHGGMGMTEELAI
GHYFKRLTALQYEYGSTAAHVSRYAELTRP
118472421YP_888730.1 AsnC family transcriptional regulator [Mycobacterium smegmatis str. MCMEAMDRMDEVDEAIVSLLEDDGRLTHRDIAHRVGLSRSAAAARVQRLIAS
GQVVVRGVVHPAVLGRGALAHVSVMVDGPAAPIAQILATRDDVAFLSLTS
GQFGLIAEARVGSVRDLDGVVATLRSLRGVVGVDTLTYVEVMRDVVGPVG
DVSVEVDDTDLALLRALQRDGRASYVELAEAVGLSPAGARRRVVRLIDAQ
VVRVGAVVRHSGQDRQSAMGLGIRLTGDAGEVLKTLTGMRSVIFVARTLG
RFDVLATVRAFSAAQLLEILDAVRGLAGVGVVESWVHLEVVKESYASGLQ
AG
118472420YP_890423.1 cysteine synthase/cystathionine beta-synthase [Mycobacterium smegmatisMTVSTVSRSGPREWVDNAVRLIEADATRSADTHLLRYPLPAAWCDDVDVA
LYLKDESTHITGSLKHRLARSLFLYGLCNGWICEGTTIIEASSGSTAVSE
AYFAALLGLPFIAVMTASTSPSKIALIEAQGGRCHFVEKSSEVYEEAQRL
ADETGGHYLDQFTNAERATDWRGNNNIAVSIYEQMRLERHPIPEWIVVGA
GTGGTSATIGRFIRYRRHATRLCVVDPENSAFYPSYAQGRPVETGASSRI
EGIGRPRVEPSFMPEVVDRMIAVPDAASVAAAHYASNVLGRRVGPSTGTN
LWGAFGLLAEMMREGRSGSVVTLIADSGDRYTDTYFDADWLASQGLDPSG
PAEILTEFERSGSWS
118472419YP_888057.1 ABC transporter [Mycobacterium smegmatis str. MC2 155]MSVRRPGSRAYLATTTRILRQLAGDHRSVAMILLVPSLIITLIYFMFDDV
PQRPGAPSPFNTACLIMLGVFPLIVMFLITSITMQRERVSGTLERILTTP
LRRFDLLAAYGTAFSLAAAAQATLACTVAFWLLGFHTEGSPLLVVGIAIV
NAVLGVGLGLLCSAFARTEFQAVQFMPLVIAPQLLLCGIIVPRAALPEWL
QWVSNALPASYALEALQEVGAYPDLTATAVRDISVVVGFAVLALCLAAAT
LRRRTP
118472418YP_885545.1 DNA-binding protein [Mycobacterium smegmatis str. MC2 155]MGKAKPNDNKALVDAMLGDLGSRIRMLRKERQLTTERLAETAGVSAGLIS
QIERGNGNPSFATLVQLAHGLQMPIGQLLEAPESKSVVVRKNERRRLDGH
GLANDDGGSYELLTPDLNGALEATWVVTPPGYDTSATPYHHHGEEFGIVL
SGTKDVYLDGIRHRLHAGDSIRYASNIPHWYVNPSETEECTAIWVSTPPT
W
118472417YP_886894.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAGTDAGTDAGTEASSTRERILAATAKVLGSNGTTKLSLSDVASQAGVSR
PTLYRWFSSKQDLLDAFVVWERRGYEQAVAQATGALPASERLDAALRVIA
EYQRSYPGLRMVDIEPEHVIRRLSQIMPLLRERLQRLTTGPDSDVAAATA
VRVAISHYLVRSDDADDFLAQLRHVARPRRRE
118472416YP_886763.1 chromosome segregation protein SMC [Mycobacterium smegmatis str. MC2 1MHLKSLTLKGFKSFASPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTLTIDNSDNALPIEYSEVSI
TRRMFRDGAGEYEINGASCRLMDVQELLSDSGIGREMHVIVGQGKLSEIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMAANLARLTDLTTELRR
QLKPLGRQAEMARRAATIQADLRDARLRLAADDLVRRQVEFQNTNQAETA
LRKEHEELTVRLQSATVELQAHEAAVAELTRRAEAAQQTWFRASALAERV
GATVRIATDRAQMLDSEPEMSSGRDPDALEAEAEEVAELEAQLLDELSEA
RIALETARAELAEREQIAADAERAHMAAARAEADRREGLARLAGQVDTMR
TRVESIDEGVLRLSVSIEEAAAKAEHAQAEFEDVQSRVGELDAGEVGLDE
HHDRTVAALRLADERVAELQAAERAAERQVASLRARIEALSVGLDRRDGA
AWLQKNHSGGGLFGSIGDFLRVQPGYEVAVAAVLGAAADALAAENFGAAA
AAVAALKESDGGRAAIVLGDWNAIGSSPQAALPPGATWATDLVSVPDRLR
GAVTAMLTGVAVVPDMAAGLALVSSRPELRAVTTEGDLVGPGWVSGGSDR
KPSTLEIASEIDKARAELEQAERQTSELGAALSGALAEQSARQDAAEQAL
AALNESDAAISAIYEQLARLGQEARGAHQEWQRLIKQRDELEAGRTKTVE
ELRELESRLSNAEQTPMFDIEPVDRQETVAAAEAARAVEVEARLAVRTAE
ERANAVRGRADSLRRAAAAEREARVRAQRAREAREYAARVAAAVSECGRQ
IAGKLSAVVAAAARSRDELATERQLRVNALGEIREEVTALNNRINTLTDA
LHRDEMAKAQAQLRIEQLEAQVLEQFGMSAGDLVAEYGPQVALPPSELEM
AEYEQAKERGEQVTAPAPMPFDRATQERRAKRAERELAELGRVNPLALEE
FAALEERYNFLSTQLEDVKAARADLLDVIADVDNRILQVFTEAYADVERE
FEQVFATLFPGGEGRLLLTDPSDMLTTGIEVEARPPGKKIKRLSLLSGGE
KSLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLISLFEQLREKSQ
LIVITHQKPTMEIADALYGVTMRGDGITTVISQRMRGQELVSNPS
118472415YP_889821.1 hypothetical protein MSMEG_5585 [Mycobacterium smegmatis str. MC2 155]MLPFVWHCVVLGETLVHCGAAALMGAARRAMHIAAAAAATHRTELVMTYS
DRWSKSTSEQRPGILSDQIRSENEELVVPREHAVTGLRRGGVDLDVAFRG
AVGGLAALDGAAAGHLALREQMRFLRVDGLGAGQRRQADRRRGTTDEQAT
GKRAHAKFHLWVLLEVVTGQRTTLCP
118472414YP_890634.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MAQRNRPQGHRPGPPAGARRRPRRPRPRRADRVTRARVLRRGPHPGPECR
RRTRRVVRHVVAHPGAARLGLCQRVGRGDHRRGFPAHPPAPTRHQPHAGV
GALGAAARGLPPLPGLQRGPGQSGDGPGVRLRVAAHRAAVAADHRPHSDR
RGRVRRVCPVGATSRLVAVAATYIAEMNGFTPADGDRDPRMRRPGTPRPS
GEPSQFIRRDPNYRPPQPPPRPAPPPPARRVPPPPPRQAPPPPPRRPAAP
PPAPPPPGRSPGQSPGQSSRPPRQFPPPPTRRKTSTPTAAAQSAPPAPTV
RKPRRRRRWGRIVLALLMIAVLAGAGAMIWVDTSLQRIPALAGYPERPAA
GRGTTWLLVGSDSREGLTPEQQASLTTGGDLGTGRTDTILLVHIPALGSS
TPATMVSIPRDSYVEIPGYGEDKINAAFALGGAPLLAQTVESATGLRLDH
YAEIGFGGFASLVDAVGGVTVCPAEPISDPLAGIDLPAGCQELDGRTALG
FVRTRATARADLDRMIHQREFMSGLLHRAASPAVWLNPLRWSPMMRAATG
TLAVDEDAHVWNLARLAWSLRGDPVTMTVPIGEFGSNGSGDVVMWDSDAA
PRLFEALRTDAPVPPDVLENAVN
118472413YP_889572.1 hypothetical protein MSMEG_5325 [Mycobacterium smegmatis str. MC2 155]MLSTVFGVHEDSAGLDAENADDIELDDYEAELDDEEANGQVISIRRANGE
EIVTIVAQADEWNVDLQPGGAVIGAFLGSRRDTPVWVNALENEIERDEDG
TYVIRID
118472412YP_888609.1 flavoprotein [Mycobacterium smegmatis str. MC2 155]MKWNAWGDPQAAKPLSDGIRALLQQALGVTDSPAQISPEDITLRPSALTA
ADRDALAAVVGEQYCRTDDTARLLHAGGKSTLDLLRRNTSGVQDAPDAIL
LPGDEDAVAAILRYCTEHRIAIVPFGGGTSVVGGLDPLRGEFGAVVSLDL
RRLDALHHLDEISGEAELGAGVTGPQAEELLGAHGFSLGHFPQSFQFATI
GGFAATRSSGQNSAGYGRFDDMVRGLRAVTPAGVLDLGRAPASAAGPDLR
QLLLGSEGVFGVITRVRVRVHPVPESTRYEAWSFPDFATGADALRAVVQT
GTGPTVIRLSDEAETGVNLATTDNIGEQSITGGCLAVTVFEGSPEHTASR
HAETRALLERLGGTSLGEVPARAWEHGRFGAPYLRDSLLAAGALCETLET
ATNWSNVAALKTAVTEALTATLAESGTQALVLCHISHVYPTGASLYFTVV
AAQRGDAAEQWRKAKTAASEAMVRNGATITHHHAVGADHRPWMTEEVGDL
GVAVLRAVKATLDPAGILNPGKLIP
118472411YP_886516.1 MmcJ protein [Mycobacterium smegmatis str. MC2 155]MPVRLGIGIPTTIGPPRAPELSRWCREAEERGASSLSCVDRLNYPNLDSF
LALAAAAAVTHTVRLLATVVVAPLRGNGELLRKQLANLHHFSGRRFDVGL
GVGRRDDDYVASDVDFSTRGKRFDAQLDRLFGTGEDKSPELPCVMFGGQS
PATLRRIARWGGGWVSAAGLGGLQSTIEFSQQVHEAWSSANRPGKPRLVA
LAYAAVGKQAATHARTHMQEYYGFLGTEGVDRLTRQVIKGHDQLTDARGR
LADAGFDELIVLPTSDSLDQLALLDESTA
118472410YP_889177.1 hypothetical protein MSMEG_4922 [Mycobacterium smegmatis str. MC2 155]MARRRRDKWRQTPPPLPPSLTSRRVETGPDGYDYEVRQVTASRATKTYRC
PGCDHEIRSGTAHVVVWPTGSASGVEDRRHWHTPCWANRDNRGPTRRWS
118472409YP_887685.1 beta-lactamase [Mycobacterium smegmatis str. MC2 155]MRAARTSATILLAILALVVPPPVTAQPLELAARLDRAIEARLAQMGAPGA
IVSLSIPGEIDYVKTFGAGDTATGVPMLVDNHHRIGSVTKTFTGTAILQL
VEQGRIRLSDPISRYVEGVPSGDVITLDLLGRMRSGLIDYTETGDFIERL
YRESPKGPDAFAVTPRELVESAFAQPLKFTPGSRYEYSNTNTVLLGMVVE
KVSGVPLGQYLQDNIFGPVGLSQTSYPGNGWLPGPYAHGYNRAPNDAIVD
TTLWNPSWADAAGKIVSNVHDMRTWTKVLGSGALLQPDTHAQRISNGSEV
VPGVDYAFTIFDVQGWRGHNGDIPGYATVAVYLPQRDATLVVFVNSDVPE
PHSAGQIADVVTTIATPDHVYAVGPQPPLMLEDTDDRPAG
118472408YP_884573.1 oxalyl-CoA decarboxylase [Mycobacterium smegmatis str. MC2 155]MTVAPTRDTEAASTDEPGALTDGIHLVVDALKLNDVQTIYGVVGIPITDL
ARLAQASGLRYIGFRHESDAGHAAAAAGFLTQKPGICLTVSAPGFLNGLV
ALANATTNCFPMVQISGSSERHLVDLQRGDYEEMDQLAAARLFAKAAYRV
SRAEDIGRGIARAIRTAASGRPGGVYLDIPAAVLGEVIDAEKAKKTLWRV
VDPAPKQMPEIDAVDKAIELLAGAERPLIVLGKGAAYAQADDTIREFVES
TGIPYVPMSMAKGLLPDDHPQSAATARSLALKRADVVMLVGARLNWLLGH
GDAPQWNPDAKFIQVDISATEMDSNQPIAAPLVGDISSVVETLLERSKPG
QISVAPEWRQELAAKSEQNVAKMSGRLEAALTAHPMKFLGALQAIRDVLA
DNPQVYVVNEGANALDLARNTIGMQVPRHRLDSGTWGVMGIGMGYAIAAA
VETGDPVVAIEGDSAFGFSGMELEAICRYNLPIVTVILNNSGVYRGDEAS
GSTADPAPTALRAQHEYMIKAFGGKGYQATTPDEVAAALREALASGRPAL
IDCVIDPSDGTESGNIAHLNPKGISTK
118472407YP_885286.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MSHAFDLVIRGGTVVDGLGGEPVVGDVAVRDGVIVQVGEVAGTGAREIDA
AGLLVTPGFVDLHTHYDGQAIWSDRLNPSSSHGVTTAVMGNCGVGFAPCR
AEDHDVLVDVMAGVEDIPGVVMTEGLNWHWETFPEYLDALAARRLDIDVA
AYLPHSPLRVYVMGQRGADREPATADDLARMRALAREAIEAGALGFASSR
LATHRTEGGRQIPSFEAAYEEIREIARGIADGGGGLIQFVPDIPAGGYQP
VLQQVFDAAGETGLPVTFSLLVLNAGEPLWREAMEMVEKANTSATSAAPR
VTAQVFPRPIGLMIGLELSANPFVLYPSYQEIAGLPLPERVAQMRKPEVR
ERILSDKPGGTPANPLVYLAQAWDWIFPLGPDANYEPDRSQSIAARARAH
GVTPLEEAYDLLLEDDGHAILLGALANFYDNSLDTVGDLMTREDVVLGLG
DGGAHYGMICDSSFPTYLLAHWARDRAEGRMSVPQAVRQLTSVPAQVAGL
ADRGRIAVGFKADLNVIDHDALRLHKPVVTYDLPAGGRRLDQSADGYVAT
VVSGEVIAENGVPTAARPGRLVRGRQSAPA
118472406YP_889215.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMIAVAVPEELVDAALRAAAELGRGVADVPAEVIARHAGMSRSTLLRRLGG
SRSALDQAVRARGTDPGGLPPVRVRAVGAAAELIGEIGLGAVTLEAIADR
AECSVPSLHAVFGTRDGLLREVFEQYSPVRDVEAFLLEDHGDLRDTVRAF
YGMLTRALDRPPRVVPAIFSEALARPQSPAVQAVVGHGAPRMLGLLAEWL
TGEVAAGRVRDLPVLLLAQQLMAPMLMHLFVRPTSANLAFVGLPDIDSAC
DVFADTFVRAVTTGESE
118472405YP_885768.1 MmpL5 protein [Mycobacterium smegmatis str. MC2 155]MSAPTDDTPTDAIAAPRHSAPPRPRLPWFLRTFAVPIILAWVAVVAILNT
VVPTLDEVGEMRAVSMAPNDAPSTLAIKRVGQVFEEYDTSSSVMIVLEGE
EPLGIEAHAFYDKMVADLRADTEHVQHVQDFWGDTLTASGAQSVDGKAAY
VQVYIAGDQGESLANESVEAVRKIATERETPSGVKAYVTGAAATSADQRA
EGDASMKLIEGVTFAVITVMLLAVYRSVITTLIVLAMVVLGLSGARGIVA
FLGFYNVFGLTTFATNMVVTLAIAAATDYAIFLIGRYQEARRAGEDRESA
YYTMFHGTAHVVLASGLTIAGATLCLHFTRLPYFQTMGVPLAIGMLIVVA
AALTAGPAVISVVSRFGKTLEPKRFSRSPGWHRVGTATVRWPGAILVCAV
VAALIGLLALPGYYTTYDDRRYLPDDVPANVGYDAAFRHFSQAKMNPDLM
MVETDRDLRNPADFLVIDKIAKALKNVHGIAQVQTITRPDGDPIEHSTIP
YTIGQSGTTQIMNNDYMQTNLDNLLKQADDLQTSIDSMTEMMNIQTELAA
VSQSMADKMAQTSDDTADVRDHLADFDDFFRPIRNYLYWEPHCYDIPMCW
SMRSIFESIDGINTMSDDFQELVPEMRRMADLMPRMVAVMPAQIQSMKNQ
KQTLLNQYQVQKAQQDQNMAMQENATAMSQAFDAAKNDDSFYLPPEAFET
DDFQRGMKLFMSPDGHAVRFTIIHQGDPLTEEGTARMDELKVAAADAIKG
TPFEGARIYLGGSAATYNDMQIGADYDLIIVAASALILIFIIMMVLTRAV
VAAAVIVGTVVLSLASAFGLSVLLWQHIVGIPLHWMVLPMSVIVLLAVGA
DYNLLLVSRMKEEIHAGIRTGIIRAMVGTGAVVTAAGLVFAFTMASMAVS
SLITIGQVGTTIGLGLLFDTLVVRSLMTPSIATLLGRWFWWPQRVRERPV
PSKWPTPIQRTPEEALS
118472404YP_886101.1 ISMsm1- transposase orfA [Mycobacterium smegmatis str. MC2 155]MAAPRKFDQETRERAVRMYEDRIAEFGGSKREARRHVGELLGINEATLRN
WVENRHGSGRPAAGAVMSSAGDKDAELAALRKENAELRRANEILKTASAF
FAAAEVDRRLR
118472403YP_886128.1 endonuclease VIII [Mycobacterium smegmatis str. MC2 155]MPEGDTVFHTAAALRAALEGKTLTRCDVRVPRYATVDLSGAVVDEVLSRG
KHLFIRAGSASIHSHLKMEGAWRIGHTKVAPHRIRIVLETADTRAIGIDL
GILEVLDRGTDMDAVAYLGPDLLGPDWEPRVAADNLAADPDRPLAQALLD
QRVMAGVGNVYCNELCFVFGRLPTAPVGTLKDPLRVVQRARDMLWLNRSR
WNRTTTGDTRNGRQLWVYGRAGEPCRRCGTLIQTDRGGERVTYWCPVCQT
AS
118472402YP_884572.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMLLRQLEYFVAVARERHFARAAEVCYVSQPALSTAIAKLERELDVTLIHR
GQNFEGLTLEGERLVVWAKRLLAEHDGLKAEAAALRTGISGTLRLGTGPT
VSTTTAIPVAAFCNLHPKANVSISSRLSSAELLRQLRDFELDAAIAHFGP
EDRAGLEVVPLYKERYVLLVSGDQLAPGTRAITWSDAAQLPLALLEPHMR
FRQFIDKAFAENGVTPSPQVETDSVASLYALVATGAWASVVPHTWLRAVP
QLGAARAVRLIEPETTAQISLAIHAGRGSAAARAFVNVAAGARLDDQFDL
QSEHWLLK
118472401YP_887833.1 hypothetical protein MSMEG_3530 [Mycobacterium smegmatis str. MC2 155]MNLRTRLRLGIRICIVAAVVAALVVVEYSTRSGVLWRLITFTYQANLMAA
AFYLWTLVSPRADTRAGLRGGVVLYVVMAGVIWNLFLAQVSMGYTPANVL
LHVVVPVLAVAEWLMAHGVQGAIRWWQPLTWLLYPAVYAAVALLVLSGAG
RRVPYYFLDPAAVGPWAVLTNIALLGVVFAGCGYALMALTRALAAGRADI
G
118472400YP_884873.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MRHADEVSPLFQRQRPTPSDPPEGTPEWFTAALEHRPQHSTIDFEGCRIH
LRTWGDPENPPLVFVHGGAAHSGWWDHIAPFFTRTHRVIAPDVSGHGDSG
TRSHYSLTKWAREVLAVAAAEGPAARPTIVGHSMGGWVTATAAMKYGADI
DSILIIDSPLRERAPEEGRLRNRRSDHPGYPSREEILARFRAVPAQDVTL
PFIDRHIASESVRQTDTGWVWKFDPAIFSGSLQGQTPAEQEILENTFAQI
PCRVGYLRCENGLVPPDMAEQIRSTLQLRGPFVELALAGHHPMLDQPLPL
VATIRTLLEFWSIT
118472399YP_885954.1 alanine racemase [Mycobacterium smegmatis str. MC2 155]MQTTEPMTPPAPLASAQTVIDLGAIDHNVRVLRELAGSADVMAVVKADAY
GHGALPVARTALAAGAAALGVATIPEALALREGGITAPVLAWLHPPGTDF
APAIAADVEVAVSSRRQLEQVTAAAAEVGRTATVTVKVDTGLSRNGVGAA
DYPEVLDVLRRAQADGAIRVRGLMSHLVHGDDPENPFNGLQGQRLADMRV
YAREHGVDYEVAHLCNSPAAMTRPDLAFEMVRPGISLYGLSPIPERGDMG
LRPAMTLKCPVALVRSVHAGDGVSYGHRWVADRDTTLGLLPIGYADGVYR
ALSGRIDVLIKGRRRRAVGRICMDQFVVDLGPDADDVAVGDDAILFGPGA
NGEPTAQDWAELLDTIHYEVVTSPRGRVTRTYLPAGQQD
118472398YP_890402.1 hypothetical protein MSMEG_6182 [Mycobacterium smegmatis str. MC2 155]MSIGDRRNGVPATVTSIPLVDPHAPKPDPSIGDLVKDATAQVSTLVRAEV
ELAKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFLAELLDTWLWRW
VAFLIVFAIMLVVTGALALFGFLKVRRIRGPRQTIESVKETREALTPGHD
KTPAQVDADAKPASDPSGW
118472397YP_886286.1 diacylglycerol kinase catalytic subunit [Mycobacterium smegmatis str. MRAVLIVNPNATSTTAAGRDLLAHALESRVSLTVAHTDHRGHAIEIAREA
TRDGVDVLIVHGGDGTVNEVVNGVLSECGSRPDADSAPAVSVVPGGSANV
FARALGISPDPIEATNQLVDLLSDYRNGNDWRRIGLMDCGERWAVFTAGM
GVDGDVVAAVEAQRAKGRKVTAGRYIRVAVREVLASVRREPSLTLHLPGR
EPVSGVHFAFVSNSSPWTYANTRPVWTNPDTTFETGLGVFATTSMNVWSN
LRLVRQMLSRKPRIEGKHLIRDDDVPTVTVTSDTPVACQIDGDYVGLRES
MSFTAVPAALKVVAPPCSRP
118472396YP_890517.1 glyoxylate reductase [Mycobacterium smegmatis str. MC2 155]MKVVVTRALPPATLSPLADVGEVWVSPHDRPLTDDELRHAVRGAHGIVSM
LNDRIDERVLAAAGDQLRVVANTAVGYDNLDVAAIARHGATATNTPGVLV
DATADLTMALLLDVTRRVSEGDRLIRSGQPWSWDIGFMLGTGLQGKQLGI
VGMGHIGRAVARRATAFGVRVVYHARRAQDDGIGRRVPLDELLATSDIVS
LHCPLTIETRHLIDAEALGAMKPGSYLINTARGPIVDESALADALARGGI
AGAALDVYEHEPEVHPGLRELPNVVLAPHLGSATVETRTLMAELAVKNVV
QTLNDSGPVTPIAVPSG
118472395YP_888172.1 proline dipeptidase [Mycobacterium smegmatis str. MC2 155]MTISRFSTDVYAQRLQTAAQAAGDAGLAGLVITPGYDLRYLVGSRAQTFE
RLTALVLPADGDPTIVVPRLELASLKESAVTDLGVAVRDWVDGENPYAMV
VEALGGPGRNAAVTDAMPALHLLPLADLLGVVPVLATDVLRRLRMIKDDA
EIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEAAF
IIVGSGPNGADPHHECSDRELRVGDIVVVDIGGPYEPGYNSDCTRTYSIG
EPDPEVARRYALLQQAQQAAVAAVRPGVTAEQVDAAARDVLAAEGLAEAF
VHRTGHGIGLSVHEEPYIVAGNNLPLERGMAFSVEPGVYFPGQWGARIED
IVIVTEDGAQSVNNQPHDLVVVPVR
118472394YP_890324.1 dihydropteroate synthase [Mycobacterium smegmatis str. MC2 155]MNPPSLTAQPGTPVQVMGVVNVTQDSFSDGGKFIDTDRAVEHGLALVAAG
AQIIDVGGESTRPGATRIDPGVEAARVTPVIRELAAQGITISIDTMHADV
ARAALEAGAHIVNDVSGGRADPGMAGVLAEAKVPWILMHWRSVDADHPHR
VPGYRDVVAEVRTELLAAVDAAVTAGVEPERLVIDPGLGFAKTAEHNWAL
LHALPDLVATGVPVLVGASRKRFLGTLLAAADGTPRPPDGRETATAVISV
LAAMHGAWGVRVHDVQASVDALKVLGAWTSGGQIG
118472393YP_890854.1 2-methylcitrate dehydratase [Mycobacterium smegmatis str. MC2 155]MRIMRIHDVRTRRSAEDFPRSEHLAWKIAQVAADPVAVDADVEEMVLNRI
IDNAAVSAASVTRRPVAVARAQAQAHRANAGATVFGIDGGYSPEWAAWAN
GVAVRELDFHDTFLAADYSHPGDNIPPLVAVAQHLGVRGADLIRGLATAY
EIQIDLVKGICLHQHKIDHVAHLGPSVAAGLGTMLRLDPETIYAAIGQAL
HLTTATRQSRKGLISSWKAYAPAHAGKVAIEAVDRAMRGEGSPAPIWEGE
DGVIAWMLAGPEHTYQVPLPEPGESKRAILDSYTKEHSAEYQSQAPIDLA
RRMRERIGDLDQIASIVLHTSHHTHVVIGTGSNDPQKFDPDASRETLDHS
VMYIFAVALQDGVWHHETSYSPERAHRPDTIELWRKISTVEDPEWTRRYH
ATDPAEKAFGARVEITLKSGEVITDELAVADAHPLGARPFAREQYRNKFV
TLADGVVDPAEQQRFLAAVDELASLKPGGLGVLNVRVDKTVLDKSPTIPS
GIFQ
118472392YP_885214.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MIDLLVAGGGPAGLATAIYAARAGLVTVVVEPRPGPIDKACGEGLMPHAV
RQLDRLDVHPDGRAFRGIRYLDGRHTAEARFRDGNGLGVRRTVLHAALAD
AAAAAGVRVVAGQVDTIIQTATTVCAAGFRARYLAAADGLHSPIRRSLGL
AHDESPRRRWGIRRHIQIAPWSDCVEVYWAPDARVNAEAYVTPVADDCVG
VAVLTSTRGSFAEHLAQFPGLAARLDGLPHGRDRAAGPLLQKVRGRVAGR
VLLVGDAAGYIDALTGEGMGLAFGGAELLVDCVRHNRPEEYDRRWLAMTR
RYRWLTAALLRGSGIRPVRACITPVAAALPGVFARAVNALGE
118472391YP_888921.1 sugar ABC transporter substrate-binding protein [Mycobacterium smegmatMRLSRLVAAAGVGVLMLGASACSSTGGKPDSSGGGDMGAGTADTPRFTVA
MITHEVPGDSFWDLVRKGAEAAAKKDNIELRYSSDPEAPNQANHVQSAVD
SGVDGIAVTLAKPDAMKPAVQNATDKGIPVVAFNAGLDAWQGMGVKEYFG
QDGYIAGQEAGKRLAAEGAKKVICVIQEQGHVDLEARCAGVKNTFPASEV
LNVNGKDMPSVESTITAKLQQDPAIDTILTLGAPFALTAVQSAKNAGSQA
KIATFDTNAALVDAIQNGDVQWAVDQQPFLQGYLAVDSLWLYLNNGNVIG
GNQPTLTGPSFIDKSNIDAVAEYAKNGTR
118472390YP_889393.1 sugar ABC transporter transmembrane protein [Mycobacterium smegmatis sMAATLTTGPDRIATPPARPKRQPLRVRRGERPNWVGALISCVWLAIIMVP
IYWIVITSLKSQSNYFATNPLLPSAESNFEQYVFVAQSGFPRYFLNSVVV
AAGTVVPTVLLAFMAAYAIVRGNGRFLRWANVIFLSGLAIPLQAVVIPVY
LIIIRLHLYDTLLAIILPSIAFAIPLSVLVLANFIRDVPGELFESMSIDG
ASEWSTLWQLAFPMARPALVTVAVYNGLTVWNGFLLPLVLTQSPDQRTLP
LALWSFQGQYSVNVPAVMASVVLSTFPVVVLYVLGRRQLVSGLTAGFSK
118472389YP_890754.1 anti-sigma factor antagonist [Mycobacterium smegmatis str. MC2 155]MNLSLNTAAENGSRSATVTVAGELDFMTTNKLVDYVSELLSTNQTLDDLR
LDCADLTFCDSAGLSGLLNIHRQTSPAGIQLHIDRRPPHLERLLDITGIL
EYLTATPDTSDSASGE
118472388YP_888348.1 amidohydrolase [Mycobacterium smegmatis str. MC2 155]MDDSYEALLQHFMPDRDSSERLGGRRLTHMDRVGIDVQVVSHGANNPGSL
NHHEATELCRTANDALAQDISEHPTRFRGFATIPLHDPHAAADEMRRCVN
ELGFVGTLVMGTCAGTFLDDDRYEPVLSAAEEVDRPIYLHPGLPPASVSN
AYYAGNWPGAVQWVFAGPGFGWHAEAGIHTIRMILSGALDRHPNLKMLSG
HWGEFVAGWLDRLDEVFAWCHHLDRPISQYYRDHVWITPSGMFNQNRLKF
ILAELGHERIIYSEDYPYVESESVSEFLESAELSEDQRASIAHRNAQNLL
HI
118472387YP_886084.1 ribose operon repressor [Mycobacterium smegmatis str. MC2 155]MTRKPVMADVARLAGVSHQTVSRVINGSPSIRPATRRRVEDAIAQLGYRP
NTAARALVTNRSGIIGIIGTNTGLYGPSSVQRAVEEAAREAGYFSSAVPL
ASVTHQAIRGAVEHLSRLSVEAIVMVAAQQDALTLVQSEDFGVPVIVVEG
DLSGAGLTVGVDQVGAARKATQHLIDLGHTAIAHVSGPPNFPEAAGRTKG
YLDAMLAARLVPHPDWHGDWSAARGYEIGEKIAAQREITAVFVANDQMAI
GLLHALHEAGVRVPDDVSVVGFDDIPEAAYLIPALTTIRQDFAAVGRRAI
SLVTAQLSGVETDTALLPADLVVRASTAPPPTTK
118472386YP_888288.1 oxidoreductase- zinc-binding dehydrogenase [Mycobacterium smegmatis stMSHTTIPSTMDGVYLPGDSTAVLKQFDVRPPGPGQVLLEMGASGICGSDI
GYIYRGYKGYRGIDGPAYQGVVAGHEPAGRIVATGEGVTRFGVGDRVLLY
HIVGCGLCDNCRRGFYISCSGDRASYGWQRDGGHARYVLAEERTCIPLPD
ELSFVDGALIACGFATAYEGLRRAGVSGDHDLLVVGLGPVGLAAGMIGRG
MGAATVIGVEPSTTRREWADSLGIFDATIPAGPDALDTITELTRGAGASV
TIDCSGSRAGRSLALEAAAEWGNISLVGEGNDLHTEVSDTLLHKQLTIHA
SWVTSLPTMSELATNLVRWNLKPETVVSDIFPLSQAARAYELAAGTSRGK
VCLVPDGNAA
118472385YP_886184.1 hypothetical protein MSMEG_1812 [Mycobacterium smegmatis str. MC2 155]MSGANDSTTVSGEVQADVTDEAKADHEAHIKVLRGEPTPEEMAALMAVLA
SAGGGPAEPVKKERNMWGHPVDKLRYSVFSWQRVTLLERTHMRR
118472384YP_885670.1 hypothetical protein MSMEG_1280 [Mycobacterium smegmatis str. MC2 155]MSNERAVATAIIRLMQGVVYRDADEDTWLTLERAGAGVRDHFATIGIDVV
VDDAEGYAYLRSRPSEDGEEELPRLVRRRALTYNVSLLLVLLRKRLVEFE
TSGGDGRLVLSTEQIVEMLRLFQADSTNDARVVDQAETTIRKTAEFGFLR
QLRGQRDHWEVRRILKAYVDAQTLSDFAAKLRQYAGAGAGDELNDLSDSR
TERASRGGISTPVRRDLQLGNVRRPGLAVHSRRRDRIADR
118472383YP_885990.1 extracellular solute-binding protein [Mycobacterium smegmatis str. MC2MKTALNVLAVGFAAVSLAGMVAGCSSSEGATPEPTGPAKVSPPAVLTADT
LKICAPNDGTPPSVYHDESGDLVGSEVDLGKALAANLGLKPEFVQSAFAA
VIPTLQAKQCDVIMAQLYIKPEREKVVDFVPYVYSGTGIAVSKAHPAAIT
GMDDSLCGKKVMVAVGTTAEVLSQEQSDKCTAAGKPPVDINRNNHADVSI
QQVQNGQVDAYLDTAETIGYYETKTGAQIQMAGEPFGTIKIGAATLKGNT
ALHDAIQQALQAIEADGTYDKILDQWGQSELSIQK
118472382YP_887538.1 hypothetical protein MSMEG_3224 [Mycobacterium smegmatis str. MC2 155]MEPSERIDHLRTRRAALGAGALFAGALAYLGFADPHRPGFLFPPCPFKML
TGWDCPGCGGLRMTHDLLHGDVAAAVVDNVFALVALPVLLAWAIVRRRSG
KPVFTVAVVAVILVSAAVWTVTRNLPGFPLVPTMLPS
118472381YP_886577.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMAKQPAAEKRQRRERGSINPEDIIKGAFELAEKVSIDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTDRALREFVVATPYVEAKDWRESLANHARTM
RKAFMGNPILCDLILIRSALSPRAARVGVQEVESAIAGLVEAGLSVEDAF
DTYSAVSVHVRGSVVLHRLYEKNRANDNAPGDFEEAMVIDPETTPLLAQV
TSEGHRIGAADEQNFEYGLKCILDHAARLIEEKPAKKTRRKVTAG
118472380YP_885554.1 nitrate/sulfonate/bicarbonate ABC transporter ATPase [Mycobacterium smMSTQPKLRLRNVTKQFEIRGEKDKFTAVEDISIDVAAGEFLVLVGPSGCG
KSTLLDLLGGLSSPTSGEILLDGVPVTGPGLDRGIVFQQYALLPWRTARK
NIEFGLEAKGLPASERKQRAEHYLELVGLQAFADRYPHELSGGMKQRVAI
ARSLAFDPEVLLMDEPFAALDAQTRESLQDELLRIWQATGKTILFITHGI
DEALYLGQRVAVLTSRPGRIKKIVDVDIDRSGEDVRSSSGFREQRHHIWS
LLHDEVQRAQTEEVSHA
118472379YP_889484.1 hypothetical protein MSMEG_5238 [Mycobacterium smegmatis str. MC2 155]MTTQPTPAPKPEKSRLLQDGRDMFWSMAPLVVACIVLAGMLGMCSFQGSG
PGAGPAPEYDAPAALQADAEALKIPIRLPVLPDGWQANSGGRSGIDGGRT
LPDGQHVRAVSSRVGYLAPSGMYMSLTQSDADESALVASMKPSSYAAGTQ
DVDGVTWVVYESEDPEAVWTTRLPGPAQIAITGAGGTDEYRTLASATQKQ
SPLPVQR
118472378YP_886666.1 periplasmic binding protein [Mycobacterium smegmatis str. MC2 155]MLTFRPLVGTALIAAAASLISGCGTSGEQPVTQPSMTTSVTKIADAGVLG
NQRRPDESCAPEPVAADPAPRRVRNATADGADIAETTEVAGDPQRIVVLS
GDQLDALCALGLQSRIVAAALPDGSDAQPSYLGTVVHDVPPAGDRAAPDV
AAIRAADPDLILGSAALTPGAFGELSDIAPTVFTGTPGAAWRDTLRAVGA
ATGRAGAADDLIAGFEDAARKTGEDNDAAHFQASVVQLTENTVRVFGADN
FPGDVLAAVGLDRPAAQRFTDKPYEEIPADSDDFSIADADIVYVSFASPA
ARDKADAVLKGDAWRKLSANRDNRVFVVNNEVWQTGQNIVAARGILDDLR
WVNAPIN
118472377YP_885312.1 acyl-ACP thioesterase [Mycobacterium smegmatis str. MC2 155]MTGTEKGSKDSSENSLVSTGLAKTMMPVPDPHPDVFDTGWPLRVADIDRN
GRLRFDASTRHIQDIGQDHLRQLGFEDTHPAWIVRRTMIDMIEPIEFPEL
LRLRRWCSGTSNRWCEMRVRIDGRKGGLVESEAFWININRETQGPSRIAD
DFLAGLRRTTDIDRLRWKPYLKAGSREDALEIREYPVRVADIDLFDHMNN
AVYWTVVEDYLYTHPELLAQPLRVTIEHDAPVALGDKLEIISHTHPPGTT
DKFGPELTDRTVTTLTYAVGEETKAVACLFSL
118472376YP_889687.1 hypothetical protein MSMEG_5449 [Mycobacterium smegmatis str. MC2 155]MSTGHLSRHAPRPDDVGAAPDDARMYPFIGTEAIAAGELTRGQLRWNYTA
IHPNVYVAKDVRRFLSTYASAAWLWTGRTGIIAGEAAAGLYGVRGIDPET
PIEMIGRRRRERRGVIIREERIDPAEVSTVMNLPVTSPARTALDLGRRLP
RSRALAHLDALAGITGVTIDEVLALADTYAGARGVRQARDIVELMDGGAQ
SARETQVRLILLDAGLPKPKTSLVLADDDWETFVPMGWPDAKVAVVIDDD
PDTSECGMVVNAAHDECLQRLGWFRVRVVPRHSPRSILYRVRRALMRRGA
LYPYNGSLAAGQDIQRGPPRPVPSSDAGIASTSIPES
118472375YP_885348.1 hypothetical protein MSMEG_0945 [Mycobacterium smegmatis str. MC2 155]MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK
118472374YP_888200.1 hypothetical protein MSMEG_3909 [Mycobacterium smegmatis str. MC2 155]MADLLNGIPRVDPTRKPTLMRRAAGWILSTELGSALHRHLMAPADKRLMH
LTGGRVHFGRGVMPLVLLRTKGAKSGVEREVTLAYFTDGDDVVLIASNYG
QAKHPAWYHNLIANPRCQLFAEGNANSGGVFVARPTECADRDRLYALVEQ
YASNFSSYAAHTKGIREIPVLRLTPERQ
118472373YP_888929.1 myo-inositol 2-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSDLRVAVLGVGVMGADHVERLSTRIAGVKVAVVNDFIETRAEEIAAGVP
GCRVVSDPLEAIADPDVDAVVLATPGPTHDKQLLACLEQRKPVLCEKPLT
TDVDSALDVVRREAELGVRLIQVGFMRRFDPEYAELKTLIDAGEFGQPLV
LHCVHRNAAVPPSFDSTMIVKDSLVHEVDVTRFLFDEEIASVHILRPTPN
PGAPEGIQDPQIAIMKTPSGKHVDVELFVTTGVGYEVRTELVAEKGTAMI
GLDVGLIRKGVPGTWGGAIAPDFRVRFGTAYDIEFQRWVAAVRHGIATGS
DDYTDGPTAWDGYAAAAVCAAGVESLAGGQPVEVKMVERASINGA
118472372YP_889335.1 dihydropteroate synthase [Mycobacterium smegmatis str. MC2 155]MFSTFCGRPVAHDRALIMAIVNRTPDSFYDRGATFTDEAAKAAAHRVIDE
GADVIDVGGVKAGPGSNVDAEEEITRVVPFIEWLRSTFPDRLISIDTWRA
AVAKQACAAGADIINDTWAGADPGLAEVAAEFGAGLVCSHTGGATPRTRP
FRVNYGISERGVVDDVIAEVTAAAERAVATGVQRDRILIDPTHDFGKNTY
HGLSLLRHVKDLVNTGWPVLMALSNKDFVGETLGVDLTERLEGTLAATAL
AAADGAAMFRVHEVGPTRRVLEMVASIQGVRKPARTVRGLA
118472371YP_890771.1 hypothetical protein MSMEG_6559 [Mycobacterium smegmatis str. MC2 155]MGSVFVAGAAAAIAAGPTAALLADAPSTLTDLTGTNQVILATPSGHGDAG
GGGGCDSGPGWNGCGGWNPVQGGWGHGCINGICGGWDGQRGWGG
118472370YP_887920.1 hypothetical protein MSMEG_3617 [Mycobacterium smegmatis str. MC2 155]MKALIGLAVGALAAGGIALATASPASAGCQGGWTPWGGGTTCDGPIAQDG
TFQRCVTAGALGFGGTNCYLLNVNNLAGNIPYVGP
118472369YP_890591.1 senescence marker protein-30 [Mycobacterium smegmatis str. MC2 155]MGTAINRDYSITVVADLKTTLGEGPLWDTEQQLLYWLDSADGRIFRATAD
GTQIRAWDVREKIGSMTLYRDGTAALTALENGLYRVDFETGEQTEVLELE
RDLPSNRLNDGKVDKRGRFVFGSMDTLEESRSGKLYSYGPDGTLQILDED
ITVSNGPCWSPDGRTLYFCDTWTGEIWCYDYDLDTGKVSNRRTFARVDTS
GGGAADGATVDAEGYLWQALVYGGKIIRYAPDGTVDHVIDFPVLKPTSVM
FGGPDLDVLYVTSMARPPLPRFPEDGQLRGSLFAIHGLGVRGVPEPRFGA
118472368YP_887456.1 hypothetical protein MSMEG_3141 [Mycobacterium smegmatis str. MC2 155]MKDSSYSNRDELLTELRRAYEEGASIRSLVARTGRSYGSIHSLLRESGTT
MRSRGGPNHRSKQRA
118472367YP_885931.1 PduH protein [Mycobacterium smegmatis str. MC2 155]MIQVFTALTGTSGELAAVTRDVLAGIEEEGVPYAVTTVAEDVPVADLARR
AAMRSPLQVGVGIGAGGGVCVHHDMLEDPLPELSSADPADSAAARTLGHN
AARIVVGLPLKPD
118472366YP_889123.1 2-hydroxy-6-ketonona-2-4-dienedioic acid hydrolase [Mycobacterium smegMTSTAAAGTASAVEFESIWSDLQGVAFSQGYLDVPVGDRKIRTRYLHAGN
PQAPALLFLHGSGGHAEAYVRNLAAHAEHFSTWSIDMLGHGYTDKPGHPL
EVAHYVDHVIAFLDTIGAQRAHISGESLGGWVAARVAVDHPDRVEKLVLN
TAGGSQADPEVMKRIITLSMAAAENPTWDTVQARIKWLMADKSKDYDDIV
ASRQRVYRQPGFVAAMSDIMALQDPQIRARNLLGQAEYGSITAPTLVVWT
SDDPTADVAEGRRIASMIPGARFEVMPGCGHWPQYEDPATFNALHLDFLL
GR
118472365YP_888629.1 dipeptide-binding protein of ABC transporter [Mycobacterium smegmatis MAGMATAWLAALVLVFTACSTGERVDLGDEASGNLIAAIAGEPDQLDPQK
TSAYFSFEVLENVFDTLVEPDENLQMQPALAESWEVSPDQLTWTFHLRDG
VRWHDGTPLTADDVVYSYRRIIDEQLTNVDKFSAVTDVSAPDPATVRIVV
SHPTPNLLTNLGGFKGMAIVQRGNVESGQIATHPIGTGPFAFAGRKSGDS
ITLKANPHYWGPEPRVSGVTFRFISEPATALSALQAGEIDWTDSVPPQRV
AQLRDDDSLTLAVTPSNDYWYLALNEARAPWNDVRVRQAIAYGIDRDAIA
TATSYRTAAINQLAIPEGNPWFTSYDRYRFDLDESKRLLDEAGAHPENLD
MLVTSEYPETVTAAQIIADNLAPLGISVNIRTVDFATWLDEQNTGNFDML
MMGWLGNIDPDDFYYAQHHSNGTSNAQKFSDPEVDRLLDAGRVETDTAER
KDVYARAATRIADEVSYIYLYNPSVIQAWSNDLSGYVARRDGAIRFRTAD
LGRGGPE
118472364YP_886966.1 ribosome-binding factor A [Mycobacterium smegmatis str. MC2 155]MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVSGDLHDATL
YYTVLGASLDEDPDYEGAAAALEKAKGVLRTKVGAGTGVRFTPTLAFVRD
TVPDAAHRMEELLARARAADEDLARVREGAKHAGDPDPYRVGGAEDTDGD
TDGDER
118472363YP_888777.1 heat-inducible transcription repressor [Mycobacterium smegmatis str. MMGSADDRRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAV
LEAEGYITQPHTSSGRVPTEKGYREFVDRIDNVKPLSSSERRAILNFLES
GVDLDDVLRRAVRLLAQLTRQVAIVQYPTLSTSSVRHLEVVALTPARLLL
VVITDTGRVDQRIVELGDAIDEHELSKLRDMLGQAMEGKPLAQASIAVSD
LASHLNGSDRLGDAVGRAATVLVETLVEHTEERLLLGGTANLTRNTADFG
GSLRSVLEALEEQVVVLRLLAAQQEAGKVTVRIGHETEAEQMAGASVVST
AYGSSGKVYGGMGVVGPTRMDYPGTIANVAAVALYIGEVLGSR
118472362YP_885929.1 glycerol dehydratase large subunit [Mycobacterium smegmatis str. MC2 1MTTARNLGTEAKRQSERTKLLEERPVNLDGFVQEWPEVGMVAMDSAFDPE
PSVRVENGVIVEMDGRARADFDFIDQFIADHAIDVATTEQSMALPAVEIA
RMLVDPRVTRDEVIAVTGGLTPAKLLEVAKNLNIVEIMMGIQKMRARRTP
ANQAHCTSARDNPLQVACEAAEASLRGFSEVETTLGVVRYAPLVAMALQI
GSQVGSGGLLTQCALEEATELELGMRGITAYAETISVYGTESVFVDGDDT
PWSKAFLAAAYASRGIKMRFTSGTGSEVQMGNAEGRSMLYLEIRCILVAK
GAGVQGLQNGSISCIGVPGAVPAGIRAVAAENLIASAVDLECASGNDQSF
SHSPMRRTARLLPQMLPGTDFVCSGYSAVPNYDNMFAGSNLDAEDFDDFN
TIQRDLQVDGGLRHVNEAEIVAARRRAAQALQAVFRYLDLPAITDAEIEA
AVYAHGSRELIPRDVLEDLKGAQQVMDRNVTGLDLVKALESTGFADIAEN
LLAVLRQRVSGDLLQTSAIMTRDLKPLSAVNDRNDYAGPGTGYRPSGARW
EEMKRLRHVTSAENPELEVE
118472361YP_885661.1 hypothetical protein MSMEG_1271 [Mycobacterium smegmatis str. MC2 155]MSERKPSTLWSGGRSTTWGAYWDALFPPAMVTGWDDWKRGSTGVNVARRL
WDQREYLRRTYESVYGPDPLRWPSRHPGVVLDTVPIYSYAACLGCQWFDP
NGTASRPAAWRHEKSNGEFR
118472360YP_887082.1 hypothetical protein MSMEG_2751 [Mycobacterium smegmatis str. MC2 155]MRSSRRLDATTKATSGCARRDAAGTFVFAPASQHARRWQRAGQTARWGL
118472359YP_887580.1 sugar ABC transporter ATP-binding protein [Mycobacterium smegmatis strMATVSIAGVHKSFGKTKAVDDLSVDIADGEFFVILGPSGAGKTTTLKSVA
GLVDIDAGAIHIGGTDVTRVEPYHRNVAMAFESYALYPQKTVAENLASPL
KSGRTGQYTEAQRAERIDQVTTTLGINHLQKRFPRELSNGQRQRVALGRV
LVRPADIYLLDEPLSHLDAKLRASMRAELKQLGAMSNTTTIYVTHDYQEA
LALGDRIAVMRDGRLVQIGTPEEIWRKPADTFVAKALGQPEINLLDGVVD
DGRIRLGDGSFDVTVPAGVSTQRGDRVRVGLRPCDLHVTSEAGDLRGRVL
LAERLGRNIELTVTIGGTQLIVLTSGRHGVGEGDEVSMSIADTDIHVFAA
GDGDTPRLEQADSALEAAK
118472358YP_885401.1 hypothetical protein MSMEG_1000 [Mycobacterium smegmatis str. MC2 155]MPVDRADTSGSAADQMAFAHRGGAMTRIVLAALGVVVGGYGAVLLWDNPP
VILVRIVVWALVAVVVHDLVFAPVCAALGWSSRRLVPVRWQAPVALAALC
SVVLALLAIPVYGKPGLRPDNLSVLDRDYVRGLWWSLAVVWLCVPAYMGG
KALKDVAFKRSRQPLPVGQDEVVERERACDIEPQPPTV
118472357YP_886905.1 LipW protein [Mycobacterium smegmatis str. MC2 155]MAHRSGWTERLDPALREFAGARTDLSPETLAVVRASIDRRRRESAQTLDT
FGVAIAGGRAALGRRSVPVRIYRGGPSPAPVVVYCHSGAFVLGNLDVDQR
QCVELARRGQCTVVAMDYRLAPEHPYPAALDDAAMVLAWVAAQAGELDVD
PDRIAVAGSSAGGALAALLAQRSATGAAPPIVFQLLHQPVLDDRPTRSKR
EFVDTPGFDGPATVAMWRHWLAGRAAPDGAVPARATEISDMPAAFISCSE
LDPLRDEALDHARRLIDGGVSTELHVFAGTCHGFDSLLPEWEVSQELFTL
QGAALRRALR
118472356YP_888691.1 hypothetical protein MSMEG_4416 [Mycobacterium smegmatis str. MC2 155]MSVRDQRMLVAAYLPVLAFTAVLVAAKMSNPRRPRSLELLR
118472355YP_887424.1 binding-protein-dependent transporters inner membrane component [MycobMSRPRWLETLRITVLTVAFLFVLFPIVWVTLASFKSPAQMSEPFLFVFRP
TLDNWQAVLDSGIFAAAGRSALVGVVTVSISLIVGSMGAYVIAKYRAGGS
LTRFGMLAAQVVPPAVMVFPFLTMAHALRLTDTLAPVIFAHLSFVLPLVT
WFLIGFFEAVPPSLEEQARVDGFTRWQAFRMVVLPQVYPGIGAAGIFGFT
LSWNDLFYGLILAPGNAAILPVAIANFNTFRGVQIGTMSAAIMIAIIPVV
IASFFIQRRLVQGISGGAVKY
118472354YP_886846.1 IclR-family protein transcriptional regulator [Mycobacterium smegmatisMLDRFVSVLSCFSVHAPVATAADVRERTGLPPTTTNRLIRSLVERGILSQ
DPRGYKLSLRFVGWAEVAKAGSDLVEASTPILAELRDRSGESTGLALLDN
DCRYVINNCSSRRSIVFHTEIGQTLPLYAGSGGKVILAFTDHLPNLRRLT
KLASGTITSRAKLEKELEVIRERGWAYAQSEREDGLNSVAAPVLDASGLI
GSMTIGGPAFRMGEDRAEELGLMVLDAARELSLAIGYQGKYPPVRDTGDT
QNTTIRRR
118472353YP_886885.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MTALHTFPPERTAVVTGAGSARGIGRATVQRLARAGWHVAALDVDEAAVV
EFAREVDKDSRTTVFGYGVDVVDAESVDRAFTAIEAELPPVVGLAHAAGV
ASPVPFLELTLAEWNRVLDINSTGTFIVNQRAVRGMVQRGVGRVVNLSSA
SAQLGGGTYSKVPYSASKASVIGLSRAVAREVGKFGVTVNVVSPGPIDTD
IMGGTLTEERKAEMVEGLLVDRVGRTEDIAATIEFLLSEDAGFITAAVYN
VNGGLVVN
118472352YP_885088.1 UDP-glucose 6-dehydrogenase [Mycobacterium smegmatis str. MC2 155]MFGTGYLGATHAAGMAELGHEVIGVDIDPGKVAKLASGDIPFYEPGLRKV
LNDNLSAGRLRFTTDYDEAADFADVHFLGVGTPQKKGEYGADLRHVHAVI
DTLVPRLRRNAVIVGKSTVPVGTAADLAQRAALLAPPGVDVEIAWNPEFL
REGFAVHDTLHPDRVVLGVQPGSTRAEAAVRDLYGPLIADGVPFLVTDLQ
TAELVKVAANAFLATKISFINAISEVCEAADADVTVLADALGHDPRIGRR
FLNAGLGFGGGCLPKDIRAFMARAGELGANHALTFLREVDSINMRRRTAM
VELATRACGGSLLGANIAVLGAAFKPESDDVRDSPALNVAGMLQLNGATV
NVYDPKAVENSRRLFPTLTYATTVAEACERADAVLVLTEWSEFVDLDPAA
LDGTVRAKVVVDGRNCLDIDRWSRAGWRVYALGRRLERQNVREL
118472351YP_887118.1 hypothetical protein MSMEG_2787 [Mycobacterium smegmatis str. MC2 155]MSDDTAPARFTELTAGGRTVGSGDDELTTRFYAYPDDLRKCRVRANMIVS
LDGAATQDGKSGGLGGAGDRAVFNLMRETADVILMGASTVRIENYSGVQL
SVPQRQARQRRGQAEVPPIAIVTASADLEPDAKIFTRTEVRPLILTTAHT
VSDARRRLGGVAEVLDASGADRTRVDPARALQILAERKLFRVLTEGGPSL
LGLLIEHDLLDELCLTIAPVLVGGGAPRIAAGIGQARTRMRVSHLLTDDE
GYLYTRYVRG
118472350YP_887578.1 transporter [Mycobacterium smegmatis str. MC2 155]MTLQTSQPAPAAESVDRGTSGRPPEVPSWRRKLRPYILSVPAVLIVIGIL
YPFAVGAYYAFLNYAAVNPDPHFVWFENFKSVLGDQIFWQSVKVTAIFAV
LATVIETVIGVGLALLLNRSSLIGKIFEKVLILPLMIAPVIAGVIWKLMF
NPQFGILNHVLGLGNTFDWLSSTNALWSVILVDLWIFTPFVAILVLAGIR
SLPKEPFEASEVDGASWFYMFRKLMLPMLWPYILVAVIFRFMDNLKVFDH
IYVLTAGGPGVATRTLQIGAFEDSIINLDYSRGSTYMLLLWVIVFITARY
LVSVLGKAQRRAAGAES
118472349YP_885665.1 HNH nuclease [Mycobacterium smegmatis str. MC2 155]MTGASDPLLLGQRVVAILETGLRTATYKLATLMALIEHCVENLPTDPAAT
LAVPIPALAHRVLEIYWQQVRPFDGHELRQSTQPKARILAATKALRDAAA
TRRGGLSVDIARQRAPQAYHRAVDDITLCLAQQPLHRLQKLPGASRSDAF
LYDDSFLHDQVSRKTLRDHGDAIVLKPGVAHGLARLAGLLKPALEIMWVE
DVRRMNRFLDADVPDVAGHLFGRERTGLAVVREPFKEAFGPHCFYCGTHL
PANNPIDHVLPWSLVGIDGLANLVLACARCNGDKGGALPAVGIVDRVLER
DRTVLEEIASELQWPTQHPRVVAAARGIYRGQPAGVPTWAGYRRSEQLDI
RFPPWWADR
118472348YP_889328.1 hypothetical protein MSMEG_5079 [Mycobacterium smegmatis str. MC2 155]MELLTGFGLATAAGLNAYIPLLALGLLSRFTDLVALPAGWAWLENGWVMA
IVAVLLVVEIVADKIPALDTVNDTIQTFVRPTAGGIVFGSGTAAETAAVT
DPGAFAQSGQWIPVAIGVVTALVVSLTKTAVRPAANVASAGVAAPVLSTV
EDVTSVGLVIVAILLPVLVLVALVLMAWGAFRLWRWRRRRAKSTHPSPPQ
PLPPR
118472347YP_890585.1 membrane protein [Mycobacterium smegmatis str. MC2 155]MAETTAPRLSLGTQAFRFIVTGGLSAIVDFGLYVLLLAAGLHVNVAKTLS
FVAGTTTAYLINRRWTFQAPPSKARFIAVCVLYAVTYAVQVGINYVFYMA
WDEKPWRVPVAFVIAQGTATVINFIVQRAVIFRLR
118472346YP_884437.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MADTTRTDLSWTGVRVLRRTVSRNLKWLTSGTTLIALHQLCEVSVPVLIG
IIVDRAVATGSVEAILRWIAVLAALFVVLTVVYRFGARLLMFAIARESHL
LRVESSAKILDPLGIETDYKVGELLSISSDDADEVSYLLDYVPRIVGAVV
GTVVCGAVLLSIHLPLGLMVLIGVPVVVFGLQLTAPMIARRVEDQQAEIG
RATALATDLISGQRPLQGIGAQANAAARYRVASRRALTATLRAARIQSIH
SGAAAAAGALAAMAVAVVAAYFAIRGSMTVGQLITVIGLAQFLIEPFSLL
AVVPSWVAEARASANRVARVLSAPTRHSPVFAADPRDAAARLSVRNATHA
GLKNLSFDVEPGEFVAVLTSDVRDAGALIDLLSGYQRAEDKGTVLVGGRR
LDQIPLKERREHLLVEHHLSSLFSGTLETNLNVTGTDPRRGRVSVDDALQ
ASCAVDVVDLHPDGLAHAVVERGASLSGGQRQRWTLARALLADPAVLVLH
DPTTAIDTVTEQVIADGIRRLRTRAGRTTVVLTSSPALLAAADRVLLVID
GRLDSEGTHRDLVDAHSDYRDLVTR
118472345YP_889531.1 phospholipase [Mycobacterium smegmatis str. MC2 155]MDSKRALVLAGGGIAGIAWETGILRGIADESPETAQALLGSDVLVGTSAG
STVAAQLSSGLSLDELYERQVGDASAELAPTAGIGTISELFVDAMLTPGT
TKAQKLRRIGEIAAQTQTVPESVRREVIAARLPSHEWPQERILRIAAIDI
ATGELVGFDRHSGVDLVDAVAASCAVPGAWPPVTIGDRRYIDGGVSSSIN
LELAVDCQTAVVFIPAGQSAPSPFDPGGIAEEISEFPGAALSIYADDDSL
DAFGSNPLDPACRIPSARAGRAQGRREAREIAEFLEELAV
118472344YP_885351.1 hypothetical protein MSMEG_0948 [Mycobacterium smegmatis str. MC2 155]MSIAANIIGTHYRYPDYFEVGREKVREFSAAVKDDHPAHFDEAAAKECGH
DNLIAPLTFLAVAGRRVQLDLFDKFDVPINLERVLHRDQKLIFHRPIVVG
DKLWFDSYLDSVIESHGTVICEIRAEVTDDDGKPVATSIVTMLGEAEIDE
ADEISSQIAAARDAAIAKMVAGQKSSS
118472343YP_889957.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMPSAEEPQWLSPAEKEAWTGLVSLILLMPGRLEAPLRDVDLNLFEYLALS
HISEAPHRRIRMSELAFLANGSLSRLSNVVKRFEQRGWVTRSPDPSDGRY
TLAELTDAGYRLVMTAAPIHLRAVREFVLDPLTASEQQALARIAEKLRIR
PADLA
118472342YP_884485.1 hypothetical protein MSMEG_0067 [Mycobacterium smegmatis str. MC2 155]MSADYDRLFHSSEPGKPVDDATITVDRDAILKATAATPRVPAGEKPPADA
PSGAMPVAPTQTQSAATPSRTAEPQVPPPMPPPPATAPQWPQNSMLRAPQ
QQQFGPGARHEQPATLPPPAQRLAPGPAPSQLSDIDPEISGAWRAGQAVP
APAQPGPTSAASMGNHRAIDALSHVGVKTNVKMPSQRGWRHWLYVMTRIN
LGLSPDEIYELDLHNRIRRNARDSYQIGVFGLKGGVGKTAVTVSLGSAMA
KIRGDRILAIDADPDGGNLADRAGRQSAATIADLLADQELSRYNDIRAYT
SMNSSNLEVLSSEDYSGAQREFNDDDWKGATAVVSRYYNLVLADCGAGLF
QKATRGVLSTISGLVIVASASIDGARQAAVTMDWLRQNGYQDLLGRSCVV
INHVTPGKPNVDVEDLVQQFERHVPPGRVIVLPYDKHIAAGTEIQLDLLS
DTFQRRITELAAALSDDFDRLERR
118472341YP_886784.1 dienelactone hydrolase [Mycobacterium smegmatis str. MC2 155]MTITISTPDGPIDALLSTPTGSGPWPGVVIIHDAIGYGPDNELVSERVAQ
AGYLAITPNLYSRGGRARCITRMFRDLLTQRGRALDDILAARDHLKSLPE
CTGTVGVVGFCSGGQFALIMGPKGFAASAPFYGTPLPRHLDRTLDASCPI
VASFGRRDPLGIGAPARLRRVVEAKNIPADIKVYPSAGHSFANILPAQPL
LRVTGFGYDEAATTDAWTRVFAFFDEHLKPKTAGQA
118472340YP_885486.1 urease accessory protein UreE [Mycobacterium smegmatis str. MC2 155]MALGTGLRILDTIVGWSTDQPIAGRLHELRHRHAVEYVHLDAHDLDRKRL
RVTSDAGTEYAIALSRDVTLADGAVLLLDDDRAVVVRAGAPQTLTLRAVD
TAAALRLGFLAGHLHWKVDQHDDTLVVRLEAPRDDYTARIADLLASGRVQ
IT
118472339YP_887159.1 transcriptional accessory protein [Mycobacterium smegmatis str. MC2 15MPTSGPVPGVRSITARLAEELSVGEHQVAAAIHLLDEGSTVPFIARYRKE
VTGSLDDGQLRTLEERLAYLRELDARREAVLASIEEQGKLTDELRAALVA
ADTKARVEDIYLPYKPKRRTKAQIAREAGLEPLADRLLADPNLVPEEVAG
EFLNENVADAAAALEGARHIIIERASEDAELVGATREKFWSEGSLRTAPF
SEEAAKSPAAQKFRDYFEFSEPLEQMPSHRVLAVLRGEKEQALSLTFDGG
EDEAYQAMIAQALGIDMTSPAPATPWLATTVRLAWRAKLMISASVDARIR
LRQRAEEDAVAVFARNLKDLLLAAPAGTRTTLGLDPGFRTGVKVAVVDGT
GKVLETCAIYPHQPQKQWDQAKATLGALIARHGVELIAIGNGTASRETDA
LASELIADIRKSGANPPIKAMVSEAGASVYSASAYAARELPDLDVTVRGA
VSIARRLQDPLAELVKIDPKSIGVGQYQHDVTPGSLARSLDAVVEDAVNA
VGVDLNTASVPLLARVSGVTESLAEAIVAHRESTGPFRNRKALLDVPRLG
PKAFEQCAGFLRIRDGEDPLDASGVHPESYPVVRRILDRAGVTLAELIGD
TRTLRTLKPAEFADDRFGVPTVTDIIGELEKPGRDPRPAFSTATFAAGVE
KVADLKPGMILEGVVTNVAAFGAFVDVGVHQDGLVHVSAMADRFVSDPHE
VVKSGQVVKVKVVDVDVDRQRIGLSLRLNDEPDKGKRNDRRDGGQNRNQN
RGGGQRNKGGNSGGNKGGNNRGNKGGRRDQPMGSMAEALRNAGFGR
118472338YP_890389.1 hypothetical protein MSMEG_6170 [Mycobacterium smegmatis str. MC2 155]MSATGRGSNQASAAAPTRSPGNIRRRRRRGDTFRGTRRRRGREGQINNAA
ARASAATLTASPVV
118472337YP_887994.1 galactokinase [Mycobacterium smegmatis str. MC2 155]MGDTVTYAAPGRINLIGEHTDYNLGLALPIALPQRVVVRYQPDDSEAITV
SSAQESGDVVVPLDTTPGDITGWAAYIAGVVWALRDRGHRVEGGRMSITS
DVEMGSGLASSAALECAVLSALTHGSDMDRVEQARIAQCAENVYVGAPTG
LMDQLASLFGEPGRAMLIDFRELSVHQVPFTPETAGLTLLVMNSRAPHRH
AAGEYAARRASCERVAAALGVESLREVQDRGLDALDAVTDDEDFRRARHI
LTENQRVLDVVAALEQSDFATAGEILTASHASMRDDFEITTAHIDLIADT
AVRAGALGARLTGGGFGGCVIALVPEDLADSVAETVRSTVVAAGHPEPTI
SRAQAAPGAGIV
118472336YP_886947.1 cobalt transporter ATP-binding subunit [Mycobacterium smegmatis str. MMTDTAISIAALCHVYPDGHIGLDGVDLEVAEGERVAVLGPNGAGKTTLML
HLNGVLTATSGTVRICGVPVARNTLRDIRRRVGLVFQDPDDQLFMPTVAQ
DVAFGPANFGLAGEELAARVRHALELVSLTEHADRSPAHLSGGQRRRAAL
ATVLACDAEILVLDEPSANLDPVARRELAETLAALDVTMLIVTHDLPYAA
QLCTRAVVIDDGRVVADGDIGEILGDAHLLAAHRLELPWGFAVPERSRN
118472335YP_886787.1 regulatory protein [Mycobacterium smegmatis str. MC2 155]MIPTVRDVIGLPVVQAGDPEVVSAENLDCPVRWVHVSDMPDLAGLLHGGE
LVLTTGAGLAEAPDDYLERMTRAGAVGLVVELGTRVSRLPRGVSDVARSL
GLPLVLLHRQTRFVEITEAVHRLIVADQYEELAFAHRTHETFTDLSMRRA
SLADIVRAAADMINESVVLEDLSHQVLAISPRGEAATAVLAEWQRRSRAM
AEPWITTSVGPRTEEWGRLIIPHTPAAPARAKTVLERAAQALALHRMAER
GRSGLEHQAQSGLIEDVLGGRIADDREAAARAEALGLRAGGPYLPVTVRT
EAPAERLDPVGVQRRNIRILDAVTHSVRSQGHTAICSIRRDGEIGFVLAL
TPRRNLTADAALARLAEGLRESVTRSGVTTKVVVAVANNATAFADAVHGL
REAAHIAEVALPMAGTARLSGRAFVRASDVRLRGLITLMSDDPRVQTFAE
TELRSLLIHDADHGEDDMAVLRGYLELAGNKSALAKRLHMSRPALYSRLA
AIQRRLGVDLDDGESMTSLHVALLILDTHRSANPEPAR
118472334YP_889141.1 major facilitator family protein transporter [Mycobacterium smegmatis MATSTGVRVSPLRVAVASFIGTTVEFYDFLIYGTAAALVFPKLFFPQASP
AAGILLSFATFGVGFIARPLGGIVFGHFGDRIGRKRMLVYSLVGMGVSTV
LIGLLPSYAQIGLAAPVLLTVLRLCQGFAVGGEWGGATLMAVEHASADRR
GFYGAFPQMGAPAGTASATLAFFLASQLPDAQFLAWGWRLPFLFSAALIV
IGLVIRLKLTESPEFAAVVQNSAVRRMPIVEAFRRHWRQIVLVAGAYLSQ
GVFAYICVAYLVSYATTAAGIDRTAALFGVFVAALVAVAAYPAFGAWSDV
VGRKRLFLVGVALMAASVFPVFALIDTGSALLFGVALVLVFGLAMAPAAG
VTGALFSLAFDADVRYSGVSIGYTLSQVLGSAFAPTIAAALYAAAQSSDS
IAWYLVAVSAISVVAGTLLPSDRSAPEAAVVKG
118472333YP_887751.1 two-component system response regulator [Mycobacterium smegmatis str. MRVVVAEDEIILREGLCSLLAQEGFDVVAQADTADGLLAAVRDKNPDLAL
VDIRMPPRHSTEGIDAAKIIQQEFPRTAILVLSAHIDAQHAKELLRSGRP
VGYLLKSRVASKSVLLDAIRRVADGESVLDSTFVQELVSGARHNDPLDTL
TRREHEVLMLMAEGLSNAGIARRLVVAETTVEKHIGNILAKLNLIDGEDT
HRRVAAVLRYLEAR
118472332YP_885896.1 hypothetical protein MSMEG_1514 [Mycobacterium smegmatis str. MC2 155]MTGIPREGGGVEADMTDTTPAAGPKPDLGRYGSFGRGVTPAQAKEIEALG
YGAVWVGGSPPAELEWVEPILEATTTLQVATGIVNIWTAAPGPVAESFHR
IEAACPGRFLLGIGVGHREAHVEYRKPLDALTDYLDKLDSYGVPKHRRVV
AALGPKVLQLSAEHSAGAHPYLTTPEHTRSAREIIGPDAFLAPEHKVVLT
TDAEQARAVGRKALDLYLGLANYLNNFKRLGFTDDELAKPGADRFIDAVV
AYGTVDAIAARLSEHLAAGADHVPVQVLTSPDKLVPALAELAGPLGLA
118472331YP_885163.1 peptidase- M50B family protein [Mycobacterium smegmatis str. MC2 155]MNIRPLRQSVRPSPIFLLVIAVTAAGGALAWIAADTIRPLSYVGVFILVI
AGWLMSLCLHEFGHAFTAWRFGDHGVETRGYLTLNPLKYTHPMLSLGLPV
LIIALGGIGFPGGAVYLQTHWMTARQKSIVSLAGPAANLVLAVLLLGLTR
AFWDPAHAVFWSGIAFLGFLQVTALVLNLLPIPGLDGYGALEPHLNPETQ
RALAPAKQWGFLIVVVLLITPALNRWFFELVYWFFDFSGVSSYLVSAGGQ
LTRFWSAWF
118472330YP_889442.1 fasciclin domain-containing protein [Mycobacterium smegmatis str. MC2 MHTRTKTLGAAAAIAAIATSLPLAVTAYAEPETTTEAEPTVEIPDPQGPG
CDDFKKAVPSWKALNDVPVSQALAAIPEISTFNAAVSGGLNPAVNIDPVL
DNGPYVVFAPTNEAFAKLAPGQLDAIAADPAALTSLDYYHAFLGLLGNDD
VKGQRPTQQGAEIKVTGKGGDIEVNDTAKLVCGAIHAQNARIYLIDTVLD
PNNPPEALTPTVSGTSTTPTTTTETTEPAPAEAPESAETPEAMPAADAPI
G
118472329YP_889732.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSGFVETEEQQALRRAVAAMAANYGQDYYLEKARAGQHTTELWNEAGKLG
FIGVNLPEEYGGGGAGMYELSLVMEEMAATGCALLMMVVSPAINGTIISK
FGTEEQKRRWLPGIADGSITMAFAITEPDAGSNSHRITTTARRDGSDWIL
KGQKVFISGIDQAQAVLVVGRTEDHKTGNLKPALFVIPTDTPGLHWTKIE
MELISPESQFQVFLDDVRVPADALVGSEDAALAQLFAGLNPERIMGAASA
VGMGRFAIHKAVDYVKTRQVWKVPIGSHQGLSHPLAQNHIEIELAKLMMQ
KAAALYDAGDDLGAAEAANMAKYAAGEASVRAVDQAVQSLGGNGLTKEYG
IAAAVTASKLARIAPVSREMILNFVSQTSLGLPRSY
118472328YP_889332.1 DNA-3-methyladenine glycosylase I [Mycobacterium smegmatis str. MC2 15MTDGRVRCGWATPGSDGSTLYLDYHDTEWGRPLRDGDALFERVSLEAFQS
GLSWLTILRKRENFRRAFHGFDPERVARYTDKDIERLMGDAGIVRNRAKI
EATIANARAVEELDVDFGELLWSFAPPARPRPADMSQVPAVTPESTAMAK
ELKRRGFRFVGPTTAYALMQATGMVDDHVATCWVPPLRHGQDLRHAQAKA
GSSHTLRPG
118472327YP_890339.1 IclR-family protein transcriptional regulator [Mycobacterium smegmatisMSTDDAVSVRKVKSAVRTVELLEYLAARPDRPTRIREICAALDMPRSSAH
ALLRTLVAQGWVRSDEAGTQYSIGIRALLVGTSYLDADPYLPLITPFLDD
LRGELDETFHLARLDGYDVVYLATRESRQYVRTTNKVGRRLPAYTTALGK
ALLAERFGADLDAHVPQTLTPMTPHTITDRAVLDDALGEARVRGYATENE
ENTLGTKCFAVALRYRQPAQDAISASVPLSRLTPEHEREIVDALRMVCDK
VSRVVRPVANGDKWFA
118472326YP_888179.1 hypothetical protein MSMEG_3888 [Mycobacterium smegmatis str. MC2 155]MSQVSTRLVRLLNMVPYFQANPKVTRAEAAAALGVTGKQLDADLDQLWMC
GLPGYSPGDLIDFDFVGDTIEVTFSAGVDHPLRLTSTEATGILVALRALV
DVPGMVDPEAARSAIAKIESAVGSQRAVVEGITEDTSAEPGAAATVRTAV
RENRALTLEYYSASRDSLATRTVDPIRVVLVGDNSYLEAWCRSAEAVRLF
RFDRIVDAQLLDDPAAPPPPAVAAGPDTSLFDADPSLPSATLLIGAAAAW
MFDYYPLRDITERPDGSCEATMTYASEDWMARFILGFGAEVQVLAPESLA
TRVRQAAEAALQAYARCV
118472325YP_889580.1 formamidase [Mycobacterium smegmatis str. MC2 155]MPEVVFSVDHSKSMRDQAVPGHNRWHPDIPAAATVKPGSEFRIECKEWTD
GQIGNNDSANDVRDVDLAPCHMLSGPIKVEGAEPGDLLIVDILDIGPVPQ
TNGPNCGEGWGYSGIFAKVNGGGFLTDYYPDAYKAIWDFHGQQCTSRHVP
GVRYTGITHPGLFGTAPSPDLLAKWNERERALIATDPDRVPPLALPPLVD
GTLGGTASGDLLQAIANDGARTVPPRENGGNHDIKNFTRGSRIFYPVFVE
GAMLSGGDLHFSQGDGEINFCGAIEMGGFIDMHVDLIKGGMETYGVTTNP
IFMPGRVEPLYSEWLTFIGISVDHAENRNAYMDATMAYRNACLNAIEYLK
KWGYTGEQAYLILGTSPIEGRIGGVVDIPNACCSVFLPTEIFDFDIRPGG
KGPQKVDRGQVAVTS
118472324YP_886793.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMAPRTASKSSSPARTAKAAATRADFVRPKTAQQAVAEVLRRDITSGKLAP
GSWIVQESLAEQFGLSRIPIREALKTLEAEEYITYVPHSGYRVAKLGLDE
LLEVFRLRDLLEAELIRDAMPAVTDDIVDLMREQMDDMDRAAEKGDLIAL
GLANRQFHFLTFETSTLARTRRIVTQLWNTADAYRPLYAHLMDLSKVNTE
HILLVDAFVARDAERAVAINHEHRQQAIGHLHTVFGDEKSEDAS
118472323YP_884477.1 ATPase AAA [Mycobacterium smegmatis str. MC2 155]MVNHLAGMFGSAVGMMSNSRARALEIFTEITNYDESACDAWVGRIGCGDT
DRVTLFRAWYSRSNFGQLAGAAEISMNGVGARIPIGGIYSRDITYPINSP
LAITMGFAVHEASEGNYTDAMEALEDAPAAGSEHLVSWVRAVIYGAGQRW
TEVIDQVRGAERWPDKFLAAAAGVAHGVAAANLGLFTEADRRLTEANDTP
VAQACAPVIAWYLAMARRSQGNEESAQVLLEWLQANFPEPKVTAALRDPA
YRLETTTAEKIAARSDPWDPSSVVADTSARDKLLVEAQAELDRQIGLGRV
KEQIEAYRAATQMARIRAARGMKVAQTSKHMIFAGPPGTGKTTIARVVAN
ILAGLGVIAEPKLIETSRKDFVAEYEGQSAVKTSKTIDRALGGVLFIDEA
YTLVQERNGQTDPFGAEALDTLLARMENDRDRLVVIIAGYSNDIDRLLEV
NDGLRSRFATRIEFDSYSPDEIVEISKVIATANDSRLDDTAAKRVLEAAT
TLSQRSLNGKPALDIAGNGRYARQLVEAGEQNRDMRLARSLDFDSLGVDQ
LSEINGDDMAAAIASVHSRLNIGE
118472322YP_885777.1 LysR family transcriptional regulator [Mycobacterium smegmatis str. MCMSTMFSADNLRYFLEVARTGRLNDAARNLGVDHTTVGRRITALEKSIGER
LFDRSPGGWQLTEAGADLFPRAETVESAVIAAYETRTSAGPLTGTVSVAT
TDGFGAFVLAPRLADLRRRHPHLDIEMATATEHRSLSARHFDIAVTLEEP
PSRGVLVQALAGYDLRLYATPGYLDDAPPIDELADLARHTLIWYIDALLD
VAPLRILGLLPHKQRVAIQTNNITGHWLAARGGLGIAPLPQYIAESDPEL
TCVLPQEFSVRRRYWMVIPRELRQVGRVRAVAQFLNEVVNDNPYLMAPG
118472321YP_889161.1 ThiS family protein [Mycobacterium smegmatis str. MC2 155]MTVNVSIPTILRPHTGGQKRVTASGSTLKEVITDLENNYSGISERIVDAA
NPGKLHRFVNIYVNDEDVRFSGGLETAISDGDSVTILPAVAGG
118472320YP_887960.1 hypothetical protein MSMEG_3657 [Mycobacterium smegmatis str. MC2 155]MNEIPDVVNAVDVEAWRDEAADEVDVVVIGFGIAGGCAAVSAAAAGARVL
VLERAAAAGGTSAMAGGHFYLGGGTAVQRATGHDDTPDEMYKYLVAVAKD
PDHAKIRAYCDGSVEHFNWLEALGFEFERTYYPGKVVVPPGTEGLSYTGN
EKVWPYREQARPAPRGHSVPVPGELGGAAMVIDLLLKRAEELGVEIRYEH
GVTNLVVDDGAVAGVKWKHFGETGCVKARSVIIAAGGFAMNPEMVAQYTP
ALGAKRKTKHHGEVEPYILGNPNDDGLGIRLGVSAGGVARDMDQLFITAA
AYPPEILLTGIIVNNRGERFVAEDSYHSRTSAFVLEQPDQEAYLIVDEAH
MEMPAMPLIKFIDGYETVEEMATALGIPVENLTATLQRYNENARRGEDPD
FHKDPAYVAPQDSGPWAAFDLSLGRAMYSGFTMGGLTVSIDGEVLREDGS
AIPGLYAAGACASNIAQDGKGYASGTQLGEGSFFGRRAGAHAASRVRVG
118472319YP_888345.1 haloacid dehalogenase [Mycobacterium smegmatis str. MC2 155]MVFILDPKPDLLTFDCYGTLIDWDSALRVYMADLLRRKNLSVEPDQFYHR
WYYSHALRLLQGPFLIYRELLKQSIQAALHEYGADVDHSDGADCGDAMAE
AEPFPDTVDVLRQLAKTYRLAIISNSQDDIVCRAVDRMHNLFSVVITAET
TRAYKPDSALFELVLERAAVPVERTVHIAQSQYVDLPRSVPMGFRTIWIN
RNSQTLNDGTPAPDEILPDLRGLPALLNA
118472318YP_890417.1 diaminopimelate decarboxylase [Mycobacterium smegmatis str. MC2 155]MTDAPPRAGAPLPSPEELLYRREQIVADVVRQGFIDDLHPLCGVIDLDTL
DELMASLHAAYPADLPALHTIAAKAISLRPVLARFAAAGFGCEVASPGEL
ELALAAGFPAERIVFDSPAKTPTEIARALELGVSFNVDNFEELARIDAAV
ARNGRPRSVIGVRVNPQTGAGTIDAMSTATSTSKFGIGLADHRDEIIDAF
ATRPWLTQLHVHSGSQGMSLEHAAEGVRLTTDLAADIDARAGSRQIQRID
VGGGLPVNFRSDDVTPTFADHRAALQAAAPRLFDGTYTVVTEFGRALTAK
AGTVVARVEYTKVTGGRPIAITHAGVQVATRSIFAPEAWPLRVEVYDAHG
RRRDDPPRVQDVAGPACFTGDMLAVGRELPPVHAGDLVAVPDTGGYYFST
HFSYNALPRPAVYTVGTDQHGDRRWSLARRAQTIEQIVAEAGEPSLEPLT
FRPPNRPSD
118472317YP_886977.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MLAVLFAALLHAIWNSLAHAVSDRVVGFALIGVVDAIGGAALIALGGLPP
AAAWPYIIASATVHVFYNLLLLASYQLGEFSQMYPLARGTSPWLVAVVAL
VVLGHEMPLTELAGVLTISAGLIALVFVGGRPTRKDLPALGAATLTGVMI
AGYTVIDGVGVQQGPLLAYTGWMFLLQGPPLAIFAAIRRGPRLLGAVREC
AVPGLAGGAISLAAYTIVLAAQRTGALAPIAALRETSIVFGALIGALFLG
EKLGARRAIASAVVLAGVLLISLP
118472316YP_890433.1 GatB/Yqey domain-containing protein [Mycobacterium smegmatis str. MC2 MAELKDRLRADLTAAMKSQDKLRTATLRMLLAAIQKEEVSGKQARELSDE
DVIAVLARESRRRGEAAEIYTQNGRGDLAATEHAEARVIDEYLPTPLTEA
ELADVADTAIAQVAEQIGERPSMRQMGQVMKAATVIAAGKADGARLSQAV
RERL
118472315YP_888330.1 GAF domain-containing protein [Mycobacterium smegmatis str. MC2 155]MSVRSDPLRAWMSAVTAISRTVNAAEPLETVLDDIAQMGCDLVGFDYCGV
MLDDVTHEVMQIAGSSGLRKRYLDLVRSEGWLEIHPADFSADLPATKAYR
ELTTIVVPDVYAENSERLHRFAAAQGYRSVLTAPLRVGKDNVGILAGYFR
DPHDYEPEEIELAKLLAEQSANAIRTAQLRAAQQATINDLSAVNDELRRR
RASLDWADQQHRRLMRLVLNDIGMDGLVAALADMLQASATVLDSAERVLA
EASAGEYIDPPKLDRKTRSKWEDTGRYEALLIDRQAAETWLIPIVLSGEV
AGWLWVITEPSEPDAGRQRLIEHFALVVGLEILKQRHIVEVQERLCGDLM
VDLLRTSDVPPSTMLIQRAEALGHDLTTPHWLAVFAGEFGPKLDQVALTV
REAAPRQETLVGVYASSVVMLIPCDRDPLRIVQRTLTRITESSGGGRLAV
ALSPPVERLADYPVNYQTGVRTTQLRLAAGAGGLVDLRRVPLTSLLLLNS
TVPDQLRRFAENLIEPLESHDEQRETDLVATLRTWLVEGFSAAATGNRLT
VHVNTVGYRLAKIQSLLGLDLRKADVRLELQLAVIVWDIMRGEQA
118472314YP_887205.1 short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis str. MTNLLSGRTALVTGSSRGIGRAVAQRLAAEGAVVAVTARSYEPSPSVRAG
QATALPGTIGETIELIEAAGGKAFGIAADLEDAEQRAALVDQVIERTGRI
DILVNNAGFADYSIIEDMPMDTFDRTVEHYLRTPFVLTQAAVPHMRNQGA
GWIVNIGSVTGLAPVRPYREYNKSSGDVIYASMKAALHRFTQGVAAELLD
ANIAVNAVGPSSAVRTPGAASLIPDTFPTEPVEYLAETVLAMCHRPAAER
TGLVAFSLHYPWSQGLAVHSLDGRDLLPPLEPPASANPNILPAGI
118472313YP_884845.1 bifunctional uroporphyrinogen-III synthetase/response regulator domainMREPDWAPLTGFRVAVTSARRADELCALLRRRGATVTSAPAITMVPLPDD
DELRAHTESLITDPPDIVVATTGIGLRGWIAAADGWGLAGELTEALGKAR
IVSRGPKATGALRAAGLPEEWSPDSESSREVVRYLVEHGVDGRRIAVQLH
GATDDWDPFPEFLDELRVAGAEVVPIRVYRWHPAPPGGEFDQLVAGIAER
RFDAVSFTSAPAVASVLMRATELGLTEQVVSALRTDVHAMCVGPVTARPL
VRLGIPTSAPERMRLGALARHITDELPLLQSRTLRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRFDLLGALPGSGTDTHAVETAVL
RLRTALGDKSIVSTVVKRGYRLAVDDTDTEMARAL
118472312YP_884479.1 ftsk/SpoIIIE family protein [Mycobacterium smegmatis str. MC2 155]MTTKKFTPTIKRGPRLTPGEINVAPPDDLGIDIPPSGMQKALPWVMGGCM
LGMIAIMVFTGVRQLSPYMLMMPLMMIMGTVGFMAGGGSGGKKVPEINAD
RKEYLRYLAGLRTRVTSSASAQVAFFAYHAPHPDDLLSIIGTHRQWARQA
NSEFFAATRIGIGAEIAVDRLLKPNTSGELAGGQAAPAPHLEPVSHMWVT
KFLRTHGLIHDCPKLVQLRTFPTVAVGGDPEAAEGLLTSMICHLAVFHPP
DLVQIRVLTDNPEDPKWSWLKWLPHTQHQTDTDAAGPTRLVYTRPDGLSD
LTARGPHTADAAPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGAQRQAA
YKLKVEKDGKAEDRLPNQPWREVTRVADRMTPGQAGRIARKLAGWSITGT
IIDKNVRVQKKVSNEWHHLVGAQSVEEVTPARWRMYADTDRDRLKIPFGH
ELKTGEIMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVATHH
PDQINLLLTDFKGGSTFLGMEKLPHTAAVVTNMEEEAELVSRMGEVLTGE
LDRRQSILRQAGMQVGAAGALSGVAEYEKHRERGADLPPLPTLFVVVDEF
AELLQNHPDFINLFDRICRVGRSLRVHLLLATQSLNTGGVRIDKLEPNLT
YRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFRSVYT
GNNYVPAAPESSDREAKPKAQRQSQVRIHQFTTTPIFDTAVS
118472311YP_889448.1 hypothetical protein MSMEG_5202 [Mycobacterium smegmatis str. MC2 155]MGFLKQTAPQVDFEEWSKGTRAEKIRPMARHWAEVGFGTPVALHLFYVVK
ICLYVLGAWLVVLSTRGIDGFTAVADWWTEPIVFEKVVLYTMLYEVVGLG
CGFGPLNNRFFPPMGSILYWLRPKTIRLPPWPDRVPLTKGDTRTVFDAVL
YGALLVVLLIAIFSDGTGPLPALGTEIGVLPMWQIAAVLVLLAVLGLRDK
VIFLAARGEVYASFTVAFLFAGHGVDAILAAKLVCMVIWLGAATSKLNKH
FPFVISTMMSNNPVLRPRFIKRKFFEHFPDDLRPGRPSRWLAHVSTAIEM
LVPLALFFSHGGWPTALAATVMICFHFGILSAIPMGVPLEWNVFMIFCVA
TLFVGHADVGITDLSTPLPLLLLAVLVTTVTLGNLFPRKISFLPGMRYYA
GNWDTSLWCVKPSAAEKIEKNIVAIASMPAAQMERYYGSPETAQMYLYMG
YAFRGFNSHGRALFTLAHRAMAGHDEGEYVLTDGERIVSTAIGWNFGDGH
MSNEQLVDALQKRCHFEPGEVRIVMLDAQPIQRQTQNYRLVDAATGEFER
GYVKVADMVTRQPWDDDVPVHGVHSLSGERREHA
118472310YP_888444.1 3-hydroxybutyryl-CoA dehydratase [Mycobacterium smegmatis str. MC2 155MIRLEIAGAVARIVLDRPQKRNALSSQLLTELRTRLEDVAASDVRVVQLI
GEGPVFCAGADTVEFADTPPELVRRRWTRLGQQVFRAVAELPQTTVAVLA
GSAFGGGLELAMHCDFRVAADNVVLGLPEATLGTTPGWSGLGKISEIAGL
AAARKLALTGRPIGAAEALRLGIVDVVAADVHSAADSLVRDVLDTAPGAQ
SILKRALASSAPADAASLIDSLAGGYLAASGETHSRRH
118472309YP_890014.1 thiredoxin [Mycobacterium smegmatis str. MC2 155]MSSSMAAAVAVLIAALVLAYVIGRVLTRRSGRVRQTGPGSAVGAETDAVA
QAEAERNLTDLGLSRTGPTILHFSAEWCGPCAGVRRVVDQVCAELPAIAH
VEIDMDANPQAARRLSVLSLPTTFIFDARGHQRYRTSGVPRAADLRTAVE
PLLA
118472308YP_887199.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MAIPRLVPALDTEPADATALRAEVRAFLDEQRAAGTFTPAVDAWLCGWDE
KFTTALAARGWLGMTVPKEYGGQGRSFLHRFVVTEELLAAGVPVAAHWIA
DRQIVPSLLKYGTERQKQEFLPRIAAGQCFFGIGMSEPDSGSDLASVRTR
AVQVEGGWRLTGTKVWTSGAHRAHAFIVLARTAPVDPAHRHAGLSQFIVR
FDGPGVEVRPIISMNGGHHFNEVILDDAFVPDDMVFGQIGNGWQQVTSEL
SFERSGPERLLSTFVLLAQTTDSMARQQISRDADLGRLVARIAGLHHMSM
AVAGALERHEPADVPAAVVKVLGTTTEGDIADFADLHRGDDGALPQQARD
LITAAVDQRPGFTLRGGTNEVLRGVIARGLGLR
118472307YP_885473.1 hypothetical protein MSMEG_1077 [Mycobacterium smegmatis str. MC2 155]MRTERIRPPWWLKYVNKVMIGLSKVGVGGDKGPVVLTVPGRKTGKPRTTP
VTPMTVDGKRYVVGGLPGADWTANLRAAEEATIHQGRKAQRVRAVEMSVE
EARPLLREFPILVPTGVGFMKNAGLVTGPHPDEFEALAGRCPVFRLDPL
118472306YP_890876.1 ABC transporter periplasmic protein [Mycobacterium smegmatis str. MC2 MRQQKWSRWLIPAMLTAISLPLAACGGSAGSAAVDASSPPDINAAKEQAE
QFRTAGMPDDWINFGEFYQSVCDTYQLGCNGFAVQGVNRVDTDMSSAEEI
AAFKNETTNAPMCSDIGIAFGQVAETEGVLLNYTPKSAADLPAAYKAHDG
GWVATAVGVISIMTNTDVVPNPPRSFADLLKPEYKGKVSISNPVTSGTGQ
ATVFSTAAALSKNKGQFDLDAAMDYWAEFYKRGQRNEAEFSAASFERGET
PIRLAYDFVNIQAANLVKDKGIHTENVIPAEGGVWQPSATMCNKKTEDPD
LAKLVLDHTLSKEGQLTFAKVGARPVLYTLGKLDVPAELKANWLPESQYV
NVIQYPDDSWPDPSVVADRWENDVLTAGG
118472305YP_884550.1 virulence factor Mce family protein [Mycobacterium smegmatis str. MC2 MTEPPAPTAPLNKPKTPPYKLAGLILGLVGVLVLALTWMQFRGQFEDKVQ
LTVLSGRAGLSMDPGSKVTFNGVPIGRLASIDVVEVDDNPEARLTLDVDP
KYLDLIPENANVELRATTVFGNKYISFLSPKNPSAERLSASTPIRAQGVT
TEFNTLFETITAISEQVDPIKLNETLTAAAQALDGLGDKFGRSIVDGNAI
LADVNPRMPQIRRDITGLANLGEVYADASPDLFDGLDNAVTTARTLNEQR
GNLDQALVAAVGFGNTGGDIFERGGPYLVRGAQDLLPTSALLDEYSPALF
CTIRNYHDAAPKLAGALGGNGYSLLTNSLVVGVGNPYVYPDNLPRVNAKG
GPEGRPGCWQPITRDLWPFPYLVMDTGASIAPYNHFELGQPMFAEYVWGR
QVGENTINP
118472304YP_884874.1 CinZ protein [Mycobacterium smegmatis str. MC2 155]MAYTLEPAARPYAEAVIKNSRFIARLCRADSEAAAREFIGTARDVERGAG
HHCFAYVIGDDESPVERSSDDGEPGGTAGVPILNVLKARELVNVVAVVSR
HYGGVKLGAGGLVRAYGGTVAAAVDEADLRPRLRWEMLRLAADHADAGWI
EAELRRRGFEVTGVAYGDRAVLTLATRDTESLIAAIDQITSGRGEHTFAG
HVWR
118472303YP_886151.1 hypothetical protein MSMEG_1779 [Mycobacterium smegmatis str. MC2 155]MNGPSSRGASRGETILDARLHLLDRQLIDDDGAPVGIVDDLELDGIEIDK
PIATGTPAPRVTSLLTGQVVITRILGGAPPRSLLHEIPWDLVASIGVTLR
LRHTDLNFDAQWVEHWLRDHIVSRIPGGRHAAE
118472302YP_890193.1 glucose-methanol-choline oxidoreductase [Mycobacterium smegmatis str. MCPKWVFSTGMVQSMSTDQMTDELDVIVVGAGLAGSVAALTVARAGYSVG
VIECGPPRSQNRDPAPGKMRRAIARLAGRTLPRPGRWPVPLMRDRGGGRP
AKAMAAVLGFGPGGSSTVYGAALSRYRRSDFTAMRPPGALPREWPIDYDD
FRPFYARTEKLLRVAGAPDPLDPDDDAVLRSPPPLGPRDAALVKAMQAAG
LHPYRLHVGIDYLPGCSECLGDACPRACKADGNNRALQQAVASGASVFCD
ETVVRLEPLSGQLQVISREGGPAATSGVLRKRLARNVILAAGALNTPLLL
ARSSGLWRDGTAPPLLGRGLMFHITDILGLRAPSDVPNYGPQKTLAIRDL
YEVGEVQSMAMRVGTAPIASYLRAEAERLGLGWLGGGLEALRIPAAVAAR
FLGKAATFATVQEDYAYEANRVWEDPSHPERICFRYEVPDELRERSARGR
RIIRDRLRHLRPFFLSPLATPNLGHPMGTCRMGNDPAVSVTDAQGRVWGL
PNVVVADAATLPTSGSTNPALTVSANALRIAESLVNRMNEAALEPSPHHA
E
118472301YP_886308.1 ATP-dependent DNA helicase [Mycobacterium smegmatis str. MC2 155]MQARYSPVELSAALGLFPPTDEQAAVIAAPPGPLVVIAGAGAGKTETMAA
RVVWLVANGFATPSQVLGLTFTRKAAGQLLRRVRTRLARLAGAGLAPGSG
ASDESATVSTYHAFAGTLLREHGLLLPVEPDTRLLSETELWQLAYDVVCA
HPGHLDTEKTPAAVTAMVLRLSGALAEHLVDTDQLRDTHVELERLVHTLP
AGPYQRDRGPSQWLLRMLATQTERTELVPLIDALHQRMRAEKVMDFGMQM
AAAARLAARFPQVGEQLRQRFRVVLLDEYQDTGHAQRIALSSLFGGGADD
GLALTAVGDPIQSIYGWRGASATNLPRFTTDFPYSDGTPAPTLELRTSWR
NPPSTLHVANAVSEEARRRSVAVRALRPRPDAEPGTIRCALLNNVAAERD
WVADHLARAYHGAIGRGEAAPTAAVLVRRNADAAPMAEALTARGVPVEVV
GVAGLLAVPEVADLVAMLRLIADPTAGSAVMRILTGPRWRFGARDIAALW
RRAVELDDRPKGELGTADIVAQAAPDADTACVADAICDPGDAERYSPAGY
ERIVALGRELTMLRAHLGHPLPELVAEVRRVLGLDAEARAARPVAAGWAG
TENLDRFSDLVSDFAGHAGASVSALLAYLDAAVEVENGLAPAELTVSHDR
VQILTVHAAKGLEWQVVAVPHLSARVFPSTTQARTWLTDASDLPPLLRGD
RATESEIGVPVLDTSDIYDRKILSDKISDHKKSLDQRRVDEERRLLYVAI
TRAEDTLLLSGHHWGATESKPRGPSEFLCELKTILEEATAAGTPCGEIEH
WAPDPAPGETNPLRDQVVEALWPPVASADDHVHRGAQLVAAAMAGEVSAE
ADQEGWAADVDALLAERERPPQQEDTELPGQLSVSTLVELSRDPKAALTR
LRRRLPQRPDPHALLGTTFHEWVQRYFHAERLFDLDDLPGAVDSDSGRAV
EESLAELQDAFVKSPWAARTPVEVEVPFDMVLGETVVRGRIDAVFAEPDG
TTMVLDWKTGDPPETPEAKEHAAVQLAVYRLAWAAMRGCPPESVRAAFHY
VRSGQTVIPETLPGAEELVKLLAAAPTETAEEADRIT
118472300YP_888742.1 cobalt transporter [Mycobacterium smegmatis str. MC2 155]MSAPGGQRKPVVLLRPVPGDSVIHQLWAGTKLLSVAVIGIMLTFYPGWVP
IGFTAVLVLVVARLARIPRGVVPTIPWWMWLLVAFGALTATFAGGSPEFD
VGSMTIGLGGLLNFLRITALSIVLLGLGALVSWTTNVADIAPAVATLGRP
LGVFRIPVHDWAVTIALALRAFPMLIDEFRTLYAARRLRPRERPDTFRAR
HRQRVSGVVDLIAAAVTVALRRGDEMGDAITARGGTGQFSAAESKPRRLD
WVAFAVLAVVCGTALALELTVLGTSLPRRRG
118472299YP_886474.1 PTS system- glucose-specific IIBC component [Mycobacterium smegmatis sMSNAAKPEATQRKSGLRIPGFAQLQRLGKSLMLPIAVLPAAGILLRIGQP
DLLGRIESPVIGPFFKAMSAAGDALFSNLPLLFAVGVAIGFARKADGSTA
LAAVVGYLVVEAVFKTMSPIVLAGEVDKAGDQAQINYSVFAGIVVGLLTA
WLFDRYHTIQLPSYLGFFGGRRFVPIVVSLASLFVAFLMSYFYPIFDAGL
TALGRFIGGAGALGAFVYGFANRMLIPLGLHHIPNSYVWFIYGDYQTADG
QVVTGELTRFAAGDPTAGILTSGFYPILMFGLPAAALAMIHVANKRQRKV
AVGILSAAALTAFLTGVTEPLEFAFMFVAFPLYVIHAVLTGLSLAIAYLL
DIHLGFSFSAGLIDLLLYGTAPAAKNIPLLIAMGVVFFVVYYLMFRFAIT
KWNMRTPGREPESEFAAEEAANLGEGETSATAVTAGGAAGAAGTVAAPER
ADSEAEQLIAAFGGRENLVNVDACITRLRMEVADKTKVDHDRLRALGAAG
VLEVGNSVQAVFGTNSEALKNAIIDSL
118472298YP_889955.1 hypothetical protein MSMEG_5722 [Mycobacterium smegmatis str. MC2 155]MATYRVLNPKGDVVDTKDIESADDAHAWFVDQRADNTELGWRMEVEQGGE
WHFFDDTEGASK
118472297YP_889700.1 hypothetical protein MSMEG_5461 [Mycobacterium smegmatis str. MC2 155]MASDLRVDSGGLRAGAVSSELIAAELTVGHVGVGADSPTHAGVSAMDAAI
TAARARQSTRINAQAADMLAGALLFETADEDSAGGMAELM
118472296YP_887186.1 thioesterase [Mycobacterium smegmatis str. MC2 155]MSDPISVADPEHARALYEPLTQSVRRLVDLTIRSEADDDAVRRAHRLVDE
AAALLGSRVAPGSFGIRSDAAGRPMPWGNVAIGVRNAIAPPLDVHRDSDG
RATADLVLGAPYEGPPGQVHGGVCALVLDHVLGATAHHRHQTAFTGTLTI
RYVRPTWLGALRAEAWIDREEGSKTYAVGHLLGPDGEVTAQAEGVFIRPR
SAR
118472295YP_885391.1 hypothetical protein MSMEG_0989 [Mycobacterium smegmatis str. MC2 155]MNEQLSKTEIGKDALQESVEALATTVGEVATIVTTAVKDVASAIGGLATE
VFEIGDIARRAARAGAPESAAGDAEDTDIAE
118472294YP_887796.1 phosphodiesterase [Mycobacterium smegmatis str. MC2 155]MDVPKPESALPHLADVVPSVLAAMGVAAFETVAGIDLPSPIRGACVLLVD
GLGAELLDAHAAEAPVMAGLRHRTLQVGFPATTAAGLAAIGTGCRSGEHG
MVGYSFRVPGAGVINALRWRPHPWGEDLRSTVVPETVQPFPTTFERAAGA
GVAVRVVSGAEFAHSGLTRAVLRGGDYVGVHAIGDLGAAVADTVAGGGFC
WGYHSELDLVGHLHGPGSTAWLMQLRQVDRLVESIVETLPRDGLLAVVAD
HGMVTADPASVVDIDAHAPLLDGVDAIGGEPRARHVYTSDGAADAVLAAW
RDSLADTAWVLSRDEAIEAGWFGGRVRDDVRGRIGDVVAAARDSAVLVRR
AVEPMESSLVGHHGSLTPAEQRIPLLLATGLASE
118472293YP_888509.1 UDP-N-acetylmuramoylalanyl-D-glutamate--2-6-diaminopimelate ligase [MyMAMKLRPSRPVGHHLAPLAAAVGAVASENPAGSSSDLAAVHVTGVTLRGQ
DAQPGDLFAALPGASAHGARFAADAVAAGAVAVLTDPSGADLLAGTLDVP
VLVHPAPRSVLGEAAAIVYGRPAERLRVVGVTGTSGKTTTTYLAEAGLRA
AGRVAGLIGTVGVRIDGTDLPSALTTPEAPALQALLALMVERGVDTVVME
VSSHALAQGRVDGIGFAVGGFTNLSRDHLDFHPTMADYFEAKARLFDPQS
PNHAAAAVICVDDQYGVQMAARAETPLTVSTSGAAADWRVEKITTAGPGA
QEFVLVDPGGMHHQLGVGLPGRYNVANAALAVALLDAVGVSPEQAAPGLR
TATVPGRLESIDLGQDFLALVDYAHKPGALQAVLETLRAAEPRRIAVVFG
AGGDRDPGKREPMGRVTAELADLVVVTDDNPRSEDPATIRSAILAGARAV
ASDAEIVEIGDRRAAIDHAVAWAQPGDIVLIAGKGHESGQTVGDHTRPFD
DRDELAAALEASGKTRDRSS
118472292YP_889933.1 hypothetical protein MSMEG_5700 [Mycobacterium smegmatis str. MC2 155]MSGRHRKPTSSSSAKNVAKIAFTGAVLGGGGLGMAGQAMAATDGEWDQVA
RCESGGNWAINTGNGYHGGLQFSPSTWRAHGGTEFAPAAYMATKEEQIAV
AERVLASQGKGAWPTCGRGLSGATPRNVVAEPEPAPLDAPGVNGELPPPA
PVDMLAAPMPAPEGLPPAPEALPPAPEALPPAPEAPAPAPEALPPAPEAL
PPAPEALPPAPEAPAPAPEALPPAPEAPAPVAEALPPAPEALPPAPEAPP
APEALPPAPEAQIVDASLQVPADVPPAPPVEPAPPAPVDAVAAPENQNWD
QAPAPADQPQTWALHVGGPLPLDPVLPAPAPAPAPAPAPGAPAAVAAPAP
DPLAPAPNADVAPTPPEGVPHLASPENLPPGTTETPDQIPGQGPNMTYLR
EIWHAIQTQDISGKDALLALTQRPLTTPDVPGGAAPNRPVAPPPAPGDPA
LAPAPAPLGAPAPAPAPEPAPVGAPAPVGAPVPPPA
118472291YP_887730.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MKTFFITGVSSGLGQAFANGALAAGHRVVGTVRKDSDAAAFESTAPDRAH
ARQLDVTDDAAVTAVVAEVEKNIGPIDVVIANAGYGVEGIFEETPIAEMR
AQFATNVFGVAATLQAALPYLRERRKGHLMAVTSMGGLMAVPGMSAYCAS
KFAVEGMLESIRKEISGFGIHVTAIEPGSFRTDWAGRSMTRADRSIADYD
ELFEPIRAARLKASGNQLGNPVKAAEAVLAILDEPEPPAHLVLGSDALRL
VGAARAAVDEDIRRWEELSRSTDFADGAQLAST
118472290YP_888675.1 alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 155]MEENATTFTELSHTRAAIWRGGGDVVIESVPLPVLQTGEVLVRVRLATVC
GSDRHTVTGRRPQPCPSVLGHETVGEIVALGDGEPLAVDGNPLGKGRRVV
WSVTLPCGTCDRCVAGVTAKCRTLRKAGHESLYSAWPLSGGYAEHVVLPR
GMPVAVVADDIADALAAPAACATATVMAVIERALPVGGRRVVVIGAGMLG
LTALAAAADLGASTVTAVDPSAERREIAAHFGAEVTAESVNEIEECDVLL
EFSGKSAALQAGLRTLDVSGVAVFAGSVAPDGDIAVDPEAVVRRHLTLVG
VHNYEPRHLLQALNFLQRTKDRFPWADLVADPVPLDRIAGLLLDAPGPKP
RYAVAP
118472289YP_886799.1 transporter ATPase [Mycobacterium smegmatis str. MC2 155]MDRDGIRIEDVSVVFDVPAGKVTAVAGIDQHVPHASFVSIVGPSGCGKST
LLAVIAGLQKASTGQVRVAGKPVTGPDPSIGVVFQEDSTLPWRTVEENVA
FAMEMIGVEKAERRQRARKAIELVGLDGFEKSYPSMLSGGMRQRVALART
LAVEPEVVLMDEPFAALDQQTRLFLGAEIRQIWARTHQTIVFVTHDISEA
ILLSQQVWVMSYRPGSIIDVVDIDLPAERDASMVSTPEFNELQNRIWTSL
QAESMRGFKQQETATT
118472288YP_886569.1 AMP-dependent synthetase/ligase [Mycobacterium smegmatis str. MC2 155]MAHPLSQRIADVLDLDPDAGAIQFDGQWSCWGQIAALAGHIEKITGPARV
GIMLRNHPVHVAALLGVLAAGGTVVVINPARGDDRTRADLEALALPVVVG
LAEDLAHLMPAHSPRTTRVAIAGLDTEPVVTAAESPATDAGGPGVAVWML
TSGTTGPPKRVDLTYDMLARSVMGREPEKCPAPTELRRGVAIVNSPLVHV
GGVFRVLLCIAEARPFVLLPKFELQRWAAAVREHRPRAVSLVPAALRTVL
HSDLTREDLAGVRVVTSGTAPLSADDADAFTEKFGIPVLTSYAATEFGGG
VAGWTLPDHGKYWKDKRGSVGRANPGAQLRVVDENGAPLGPDEPGLLEVI
PAQMGPGSPWMRTTDLARIDADGFLWVLGRADQAIIRGGFKVMPDDVRAA
LESHPAVLGASVIGVADERLGETPVAMVELRGPATPDELAGYLQGRLARY
EIPTRITIVDAIPRTPSGKADLRAVRDHLESGG
118472287YP_889131.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDVRLTAEQQQLREAAAKLADDLGPGSVHELEDRGRIARLENTVAATEWR
TLRSDGASGVEVAIVAEEFARGLVDVPFLGPILADDLAQRLGRAVAVPDA
AAGTAGVDLTNSAAGVLQSPAELSELRAGDAARWHALALAATSADLVGAA
RGAHALAVDYAKVREQYGSTIGSYQAVAHLLAEGLALIEGSISVLRHAAW
GVDELEPDEAVRAGRIAKVYCARAARTVCETAIQVHGGIGNTWECLAHVY
LRRALTSTELWPVGLEDLEVSDLGFS
118472286YP_888209.1 hypothetical protein MSMEG_3920 [Mycobacterium smegmatis str. MC2 155]MTDEYAEFWASRAKTPETRARIRRWALLKRVFFGLAGLSSTASVTIIVVA
AIREVLGEPAPWWVFLAALAVLVVSILPWCLASFRLDVARYADGEETVGT
ITKIVVDKDTDPEALPAYDITIAARLPIGGIHRTCRVSERTAPKPGQRVR
FRHNTGDPDDLEDVLFLGFVDAPNTAQRGTMNP
118472285YP_887805.1 hypothetical protein MSMEG_3501 [Mycobacterium smegmatis str. MC2 155]MVARPTGEETMSHLALLAGSVMVGIVIAAGAVYDYQRRAARARNVSIRSH
VLSAVVLVLSSAVVGAQAVLYHDHRAFTIPYSTIAGLVGLTLLAILMRDV
VSSKRDSDTHEAGNPECRPPDHSPR
118472284YP_886834.1 decarboxylase [Mycobacterium smegmatis str. MC2 155]MEQTGIGVVVPYDFALDRELWRWVPEHISLHLTRTPHVPLSVTMEMAIYV
SNPNLLAQASASLHAVAPVVTAYACTSGSFVSGVTGETEIVAAMTQAGAP
AALTTSGALLTALRHLDVSSIAAVTPYTADLTSGLVSFLGEAGIGVTAAA
GLDLTTQIWTVPYEVTAELVRSIDRPDAEAIFISCTNLPTYDVIAKLEEE
LGKPVLSANQVTIWSALRAAGHKAVGPGQRLLAS
118472283YP_885147.1 hypothetical protein MSMEG_0741 [Mycobacterium smegmatis str. MC2 155]MTEGQCARIDFPSRIGVWWASDTWSMRDAQEVAREIEALGFGSLFLPETV
AKECLTQSAAFLAATERLVIGTGIANIHVRLPSAAEAGARTLTALYPGRF
VLGLGVSHGPLVERGMGGVYQKPLATMRTYLERMAALPEQIEPGAGRPPR
LLAALGPKMIELSGTHADGAHPYLVLPEQTRTTREILGEDKWIVSEQAVA
VGGDDADQLRRAHQHLEVYSGLPNYRNSWLRQGFDESDLVRGGSDRLARA
VVGMGSVDDAAKAVTAHLDAGADHVVVQVLGDTPTSDPRPVLRELAGAFG
LK
118472282YP_890076.1 amino acid permease [Mycobacterium smegmatis str. MC2 155]MTNPEMVEEQPQLRRVMGPGLLLLFVVGDILGTGVYALTGQVAKEVGGAA
WLPFLVAFLVATVTAFSYLELVTKYPQAAGAALYAHKAFGIHFVTFLVAF
IVMCSGITSASTASRFFAANFFTGLHLDWGKAGVVVLALLFMALIAAVNF
RGVSESVKLNVFLTFIEITGLALVILVGLWAFTGGSADIDFSRVVAFDTP
SDKGVFLAVSTATSLAFFAMVGFEDSVNMAEETKDPVRIFPKMLLTGLGI
AGLVYVVVSIVAVALVPVGVLAGSETPLVEVVKAGAPGLPIETILPFISM
FAVSNTALINMLMASRLIYGMARQRVLPPVLGSVHPRRLTPWVAILFTTL
IAFGLIFYVSAFANSSAIAVLGGTTSLLLLAVFAVVNIAVLVLRRDLREK
GTHFKTPTVLPVIGFIASTYLVLPFSGRPAQQYILAGILIAIGIVLFGIT
TIINRRLGISSKAQIDPTHLTDAP
118472281YP_887973.1 transporter small multidrug resistance (SMR) family protein [MycobacteMRKWALLLGAVVVEVTATLSLRASQDHALWLVPVVAGYVAAFVLLTLVLR
AGMPVGVAYGIWGALGTASTAVLAALLFGDPFTWPIVAGIGLIIAGVLLV
EFGSHEREARP
118472280YP_889508.1 hypothetical protein MSMEG_5262 [Mycobacterium smegmatis str. MC2 155]MIERPAARYGSREQPRLSRRWILIAVAALVLVAGVIVAVVAYQRFGSGEV
KGELTGYQLLDDETVQVTIGVERPDPSKPVVCIVRARSKDGSETGRREIL
VPPGSDRVVQVTAEVKSTRKPVMGDIYGCGTDVPSYLVTPQT
118472279YP_889346.1 hypothetical protein MSMEG_5097 [Mycobacterium smegmatis str. MC2 155]MLRPWSFSVTHADHFVNSIKPGRHAPIHESMDRKSVLDLMSPEGTFVRAA
MKSLDRLGVGAGSGEDAIADAGYPGFLHAFNAVRDPEEWGGNRGPINDQV
GTRYWEVVELRREGDFFRTGVCSYGSAIAVKTQDGYRSSGSKPIGSATWI
TFGPDPALAKDKQAVPPSNQRGPERAPVLDVFGSWVITDLNVLDAAKDLP
QCMSTLAPGTPSDAPKDYVVQTEPPPTLPPSPGWPDA
118472278YP_890037.1 lipoprotein YaeC [Mycobacterium smegmatis str. MC2 155]MTDQITPTSALDIEIEKKRRWPWIAGAATAVAAIVGGVVYANLANQDKAF
GTQLEVATWSTDIAAETLLDHIATEIAPDHGITIKPVKIDNLVEINRAVD
AGVVAGNFFEHQPFLNDAIAANGFELTLAAPTFTWDQATYSDKYDSWDEI
PNGAKIALRDDPAGQAIALLDLAEASQITLKPGKDTVEGLPQLSDIASNP
KNYTFVQVPIGQLARSLPDVDAVVVHISDVYAAGLTEDQIIDRHEAPKGS
EGGLVVSNKHLDDENVQKLIATFQDPRIGEYLETTDNALIRDTLGPVSR
118472277YP_888003.1 hypothetical protein MSMEG_3701 [Mycobacterium smegmatis str. MC2 155]MTGGPARTYNQAHIPRMRNGRRRISIYWTWSYPWESQRDPAAMENRFSTM
TEVRNVLWPSYETTEYDSAHFLQGIAGTLELFHRSTLAFQTLVGDVTGHP
VAVFQRIDQAGYRLPIDERILADCDTLMVFGLDHVLSEQEADTGEVEAIR
GWLRREGTCLLLAPHHDVGDTADFGRRQVEYLHHGDALVPRQQRFGQYTR
SLMRALGVPVHNMWGLRPATVAGTSEIAPLTAVRDLDGPGLLADVPTFNF
HPHLPHYQLTAPESDTLRVLGRQRVDLTRPHPFTEAGNTEFNALIWMPPD
GERAGDIVLVDSTNFTTLFGGTDSLKRLWHNLATMA
118472276YP_885867.1 methionine aminopeptidase [Mycobacterium smegmatis str. MC2 155]MINLRGRRKPKVVTQRTSAELDAMAVAGALVASALRAVKAAAAPGVSTLE
LDRIAETVIRDGGGTPSFLGYHGFPASICASVNERVVHGIPSADEVLAAG
DLVSIDCGAIVDGWHGDSAVTFGVGPLIPADEALSEATKAAMEAGIAAMV
PGNRLTDVSHAIEVETHAAEKRDDRKYGIVANYGGHGIGRQMYMDPFLPN
EGAPGRGPYLAPGSVLAIEPMLTLGTTKTVVLDDEWTVVTADGTRAAHWE
HTVAVTEDGPRILTQ
118472275YP_884713.1 hypothetical protein MSMEG_0298 [Mycobacterium smegmatis str. MC2 155]MPDKVPNKLPPEFADLEPFSGWCLGSEPERYAKRLASTMTEIQAFYDAIT
PRAEEAISYCDKFPLDDLPEDVLNLLHLLYSMVTVSFPVECWKQPRVPDS
GATWLDCVAEPVP
118472274YP_889130.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MDFRDSPEEAAFRDRLRSWLADNAASFKASGDDYWARQGEWHQALYGAGF
FGTSWPKEFGGQDLPPVYDVIVDEELARAGAPPRPSLGYLVVGLGHHGSK
ELQQRFLPGMINGTERWCQGFSEPGAGSDLASLITTATRDGDNYIINGHK
IWTSYSDVADWCLLLARTDKDVPRHKGISAFIISMHQDGIQQRPLKMING
VTTEFGQVTFDNAVVPASHMVGAPGEGWALAMTVVSHEREPSTLGYSARY
GKLVREMASRVEGRAPQDLAWAAVQAEMLRLHVRRRLSEQLDGLKHGPQG
SLDKLLMTWVEQSVGHAALAVSGTSDPELLSAYLYSRAQSVMGGTSQIQK
NIIASRILGLGV
118472273YP_885383.1 two-component system regulator [Mycobacterium smegmatis str. MC2 155]MRCLIVDDSASFRTAAATMLDSGGVEVVGVASNSAEAMVFCRELQPDVVL
VDIALGAESGFELTEKLLGDLEPRPPAVILISTYDEQDLSEMIASSPAVG
FVPKFALSVPAIQNLLATI
118472272YP_889041.1 hypothetical protein MSMEG_4784 [Mycobacterium smegmatis str. MC2 155]MSTTKMIAGAAILASATALGLLGAPTASAGEGWGINGTFAMSSNGEWAKI
NERYQKQPSTRGTWTVSTQCVSPTECTGTVTSDQGWSAPIYTNSGLWYVK
RVLPQWRYCADGTPIEGLQIYKFYPVGENAQVDVNSDEYAGEDTTTGPSG
SCGRNQWPAIRMPFYMKKI
118472271YP_889183.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium smegMRRALKCRTVDSPVGPLTLAGRDGHLVHLRMEDQTYEPSRDGWEVDDSAF
PEVVEQLAEYFAGERTDFELSLDLVGTAFQRTVWTALREIPYGQTCSYGE
IARKIGSPGASRAVGLANGHNPIGIIVPCHRVIGANGSLTGYGGGLERKR
MLLDLEKSRMAPALF
118472270YP_886958.1 prolyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYVRAVGPGIYSWLPLGLR
VLRKIENVVRSEMNAIGAQEILLPALLPRGPYETTNRWTEYGDTLFRLQD
RRNNDYLLGPTHEELFTLTVKGEYSSYKDFPVILYQIQTKYRDEARPRAG
ILRGREFVMKDSYSFDVDDDGLKNAYYQHREAYQRIFARLGVRYVIVSAV
SGAMGGSASEEFLAESEVGEDTFVRCVESGYAANVEAVITRAPEAQPTEG
LPEAKVYDTPDTPTIATLVEWANSASLPQFEGRTVTAADTLKNVLLKTRE
PGGEWELLAVGVPGDREVDEKRLGAALEPAEFALLDDADFAANPFLVKGY
VGPKALQDNGVRYLVDPRVVHGSSWITGADAPNRHVVGLVAGRDFTPDGT
IEAAEVRDGDPSPDGAGVLTSARGIEIGHIFQLGRKYTDAFSADVLGEDG
KPLRLTMGSYGIGVSRLVAVIAEQQHDQLGLRWPSSVAPFDVHVVVANKD
AGARAGAAELVADLDRLGHEVLFDDRQASPGVKFKDAELLGMPWIVVVGR
GWADGVVELRNRFTGETREIAADGAAAEISSVLAG
118472269YP_885327.1 carbon-nitrogen hydrolase [Mycobacterium smegmatis str. MC2 155]MMRIALAQITTGTDPSSNLELVESCTRRAADDGARLVLFPEATMCRFGVP
LGPVAQPLDGPWARAVRDIAARAGVVVVAGMFSPSDDGRVTNTLIAAGAG
VDTHYHKIHLYDAFGFTESRTVAPGFTPTTITVDGTPVGITTCYDIRFPE
LYVELARRGAQLITVHASWGSGPGKLDQWTLLARARALDTTGYIAAVDQA
YPGDEIAKAGPTGVGGSLVASPTGDVLASAGAEPELLTVDIDLDAATRVR
DTVAILDNRSALAGLS
118472268YP_889256.1 phosphohistidine phosphatase [Mycobacterium smegmatis str. MC2 155]MATLLLMRHAKSDYPDGVVDHERPLAPRGVREAALAGDWIRANAPGIDAV
LCSTATRTRQTLARTGIDAPTEYVEKIYDAVPGTVIGEINDVVSRFGTQP
DTVLVVGHEPAMSSVALGLDDGANVAVAEEISQKFPTSAIAVLRFDGPWD
ELALGGAQLVTFHVPR
118472267YP_887584.1 glutamyl aminopeptidase- M42 family protein [Mycobacterium smegmatis sMADDGFPRALLQELLSAYGPCGQEAAVRVVCRRELEPYVDGLWTDAAGNL
VGLLRGAPESADHVPPTRVMAHMDELAMLVKRVEPDGTLALTPLGTMYPA
NFGLGPVAMLGERETLCGVLALGSEHTTAESPRIWATKPDQGDKALDWPD
VYVFTGRTPDELRDAGIGIGTRVCIDRSKRTLVEVGDYLGCYFMDDRAVV
TALLQTARLLHGRDHRPPGDTYFVFTTNEEIGGSGGSYASRTLPGDLTLA
LEVGPTEQEYGTRVGGGPVVAYSDAQCVYDKDVADRLVQIGEKLGLDPQP
AVLGAFESDASHAKSNGQSPRAGLLCMPTLSTHGYEVIARTAVRAMADVL
VEFLADDRTRR
118472266YP_884670.1 phosphoenolpyruvate carboxykinase [Mycobacterium smegmatis str. MC2 15MTSATIPGLDTAPTKHQGLLAWVQEVAELTQPDRVVFADGSDEEYERLCA
HLVEAGTFQKLNPEKQPNSYLALSDPSDVARVESRTFICTEREIDAGPTN
NWMDPAEMRGIMTDLYRGSMRGRTLYVVPFCMGPLDAEDPKLGVEITDSE
YVVVSMRTMTRMGRAALDKLGDDGFFVKALHSIGAPLEPGQKDVPWPCND
TKYITHFPETREIWSFGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYFIAAAFPSACGKTNLAMLQPTIEGWRAETVGDDIAWM
RFGKDGRLYATNPEFGFFGVAPGTNWSSNPNAMKTIAAGNTVFTNVAKTD
DGDVWWEGLEGDPQHLIDWKGNDWTPESGEKAAHPNSRYCTPISQCPTLA
PEWDDPQGVPISAILFGGRRKTTVPLITEARDWQHGVFIGATLGSEQTAA
AEGKVGTVRRDPMAMLPFLGYNVGDYFAHWINVGKNADESKLPKVFFVNW
FRRGDDGRFLWPGFGENSRVLKWAVERIEHKADGKSTPIGIVPTAADLDL
EGLDVDPADVDEALAVKPEEWRAELPLIEEWFEFVGEKLPTGLKDEFDAL
KHRLSEEG
118472265YP_884958.1 chromosome replication initiation inhibitor protein [Mycobacterium smeMQIDGQQLAAFAAVIELGSFDAAAARLHVTPSAVSQRIKALEQRVGQVLV
VREKPCTATPAGVPLLRLAAQTALLESEALAEMGGGSSHRPRMALAVNAD
SMASWFTGVFRRLPDVLFDIRIEDQDLSARFLREGVVMGAVTTERTPVSG
CRVHPLGAMRYIPVASAEYMARYLPDGFNREAAAAAPSLAWNRDDRLQDQ
LVRKVFRRDVTRPVHFIPTAEGFGAAVRAGLGWGMYPEDLVDASFVPITE
HHLDVPLFWQCWKLDSPLVQAITDAVLAASARLRGRRTAAER
118472264YP_886216.1 4Fe-4S ferredoxin [Mycobacterium smegmatis str. MC2 155]MSENRRNSFYGPLEDPATDAGYDDEHPPRVGFFTDTSVCIGCKACEVACK
EWNGVPDDGFNLLGMSFDNTGNLGANSWRHVAFIEQPAPEPGRTTEDLGM
PGFERPGDATGPETRQDFRWLMASDVCKHCTHAGCLDVCPTGALFRTEFS
TVVVQQDICNGCGYCVSGCPYGVIERREGDGRAWKCTLCYDRLHDGLEPA
CAKACPTDSIQFGVLDELRERAARRVEELHERGVTEARLYGHDPNDGVGG
DGAFFLLLDEPEVYGLPPDPVVPTRDAGAMWRYAGMAAGALVGIAVSAFV
GRRT
118472263YP_885822.1 50S ribosomal protein L2 [Mycobacterium smegmatis str. MC2 155]MGIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDG
EKRYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPG
GGAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAE
QSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKPSDKLIVRRRRTGKKR
118472262YP_886456.1 acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase [MycobacteriMRVLRLAGTAHERGVAYGEHTRDEIRECIQVYQRWFESFANISWPAAREL
GKPYRDWLCATDPDLSEEIDGIAAGADLPVADIIALNFRTEIAYGASGLM
SASECTSLGVPPVSTTNGHVYLAENWDWLADTLPLTLMLEFEPVDGLRMV
TVTEAGMVAKFGMNSDGVGLCVNLLGSNVNRVGGSFHTLARGVLQSRSAL
EAVWSVTGSERGGSGNYVIGSSSGEIVDLEYSPSGYTLHFPDHGYVAHAN
HFLGKQAGVLDRTQILRNISPGSYFRQARAEHLLSDAVSSTGINVKEIQS
ILGDHQGEPEGICRHGGPVGTHQVLGRTNVSVVMDLTDLTMYLGHGFGCS
AAIEQYQLTAAQFSKV
118472261YP_885892.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MVEGDKRLGLTADEVLTTTRAVRKRLDYSRPVPRELVTECVRIATQAPSG
RNRQRWDFVVVDDPRLRSRVAEIWRRGLFAGVPGTGGRHEVSRMTSPEEW
RRIAAGLDHLAAHLHEAPMLLIPCVRVASRRELATVRGQAGAWGSVLPAV
WSFMLAARERGLGTAWTTCHLSYELEMAELLGIDADHVVQAALTPVAFTR
GTEFRPGPRADHRDFLHWNTWDGRSRAGRKTG
118472260YP_887935.1 6-phosphogluconate dehydrogenase [Mycobacterium smegmatis str. MC2 155MTASSTPSSTTGTAQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTD
ALLAEHGSEGKFVRSETIAEFIDALEKPRKVLIMVKAGEATDAVIDELAD
AMEPGDIIIDGGNALYTDTIRREAAIRARGLHFVGAGISGGEEGALNGPS
IMPGGPAESYESLGPLLEEISAHVDGVPCCTHIGPDGAGHFVKMVHNGIE
YSDMQLIGEAYQLLRDGLGMSAGEIADVFEEWNRGDLDSFLVEITAKVLR
QTDAKTGKPLVDVIVDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARAL
SGSVPQRKATVGLASGALGATPSDAADFIEAVRRALYASKIVAYAQGFNQ
IQAGSAEYNWNLTPGDLATIWRGGCIIRAKFLNRIKDAYDAEPDLPTLLA
APYFRDAVEAGIDSWRRVVVTATQLGIPVPGFASALSYYDALRTERLPAA
LIQGLRDYFGAHTYGRIDAEPGKKFHTLWSGDHSEVEA
118472259YP_887721.1 hypothetical protein MSMEG_3417 [Mycobacterium smegmatis str. MC2 155]MSNDIMTAERIVDAPAATVFGVLADPTAHHAIDGTGWVRESLDSAKLTTV
GQIFRMAMYHRNFGGMHYTVANRVEVFDPPIAIAWLPGEDTDDGTLKFGG
WSWRYDLESLAPARTRITLTYDWSAVPDAIRQHIGFPPFDPQHLDNSLKH
LAGLAEKGSAEVDVSSG
118472258YP_889852.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MMTDFTTDFSAIHDELRSVAADLLAKDSVDWPLLVQAGWVGLDAPESLGG
AGATFAEVAVICEELGRAAATTGYLGGAVLGVGALLAVAPNTSRDNLLTE
VVEGRTRVSLALPGDLVPGDPRVPFTVTTDGRVHGRAAFVPDAGDAHRLL
LPARDATGTTVLVDAAATVIEQPVLDETRRLAIVEADGAEARDVWPLEDP
HALARRAALAVACDSLGIAAAMLDATVSYASMRQQFGRPIGSFQAVKHAC
ADMLVQVTAARQLIAGAISAPDAHTVAKAKSYATEAAVGVAGKAMQLHGG
IGYTWESGVHTYLKRAALNRSLFGSPREHRTMLSARYRSAPG
118472257YP_890210.1 UDP-phosphate galactosephosphotransferase [Mycobacterium smegmatis strMMTAQISNFDSGFGTRQLVSMPKPNSVVAGTNMSIKLPPSSVFQRSKWQR
RYSSYLLMTDTLVIALSVGFAQLVRFGPTLNPPGYSKLYVPAFSILFAIA
WLVAMSALRTRSPRITAACVDEYRRVTAASFWTFGAIAMVSLLLKLDIAR
GYLAVALPVGTLGLLLERRLWHRHVARERVAGRYRTAVLAFGEIGAVTEL
VSELVRNPADGYDVVGVGVPRYGDARGEFVMVSGQRIPIIGGEAEMLDAV
HTCGADTVAIAGTEAFGVRGIRRLLWQLEPLGVELVVSTGAMDVALSRLV
MQPIAGIPLLHIEKPLYRNAKRFQKCLFDLSFAFAVLLITSPLLLITAIA
IKATSRGPVFYSAERIGVDGKLFSMLKFRTMVENADQMLDELEDLNESDG
LLFKIHDDPRVTRVGKVLRRLSIDELPQFINVLRGEMSVVGPRPPLRREV
EEYDCEILRRLLVKPGVTGLWQVSGRSDLSWDQAVRLDLSYVDNWSMIGD
ILIVAKTFGAVLRKDGAY
118472256YP_891122.1 hypothetical protein MSMEG_6928 [Mycobacterium smegmatis str. MC2 155]MRVLLVTAIVALLTMIVGPPDLLPRAAAHTDEARFLQIHIDRISPDLVTT
TSDSTVTVSGVVQNVGDRPVRDVVIRMEHARAVTSSTQLRTDLSGNLDQF
EPVAEFVTVATEMQRGQSVPFTLSYPLRAGDRPSLGVQQPGVYPVLINVN
GTPDYGAPARLDDARFLLPVLGVPPDQPTEAASAADNLNSVVPPDTSDPV
QLTVLWPLADRPRLAAGAPGGTTPVRLVDDELATELAPGGRLDTLLSAVD
FATGPTVDSSGQVRAALCLAVDPDLLVTVNAMTAGYVVNDGPDAGRFTPT
RPGAGQEAAIAWLNRLRGLAQRMCVAPTTYAQADLAALHRVGDRGLSAIA
TTSPADIVDRILGVRTIRGATLVGDGPLTRPALDLLTSQGNRTVAIGATP
VSTEETGTPQSADLTPLRYSPTVSVAPFDPAVGAALAGAGTDPVSPSYLD
PSLDIPVDHDSQIARRQSALGALLWRGLSPELTPRTQIVMPPLVWSLGPD
DAQAILTTIATTIHAGLAVPRPLGAVIAQGDALPAEPAQPAPEAFGNPAG
RFDDDIIGGIAGVTGRLWGLTSALTTDERTGLTGVQYTAPLREDMLRALS
QSVPAAARNAEARQRLGTVVRSVNDMFAAVTVVNPGGAYTLATERSPLPM
ALRNDLPVPIRVRLHINAPPGMTVTDMGEIELPPGYLPLRVPIEVHFTQR
VAVDVTLQTVDGLPLGEPVRLSVHSNAYGKVLFFITLSAGAVLFLLAGRR
LWHRFRGQPDRADLTPPGEHHDPLEVALAFGEADTSNTPDAADTPADGRR
118472255YP_889848.1 hypothetical protein MSMEG_5615 [Mycobacterium smegmatis str. MC2 155]MTELPDWAAPLDLAPHPEGGWYRETWRSELTVNQTSLPAGYSGPRSAGTA
ILFLLMPGQQSAWHTVRSAELWFHHRGSPLLLEIGEQQETATTHLLGPDI
TTGQQPQVLVPPGHWQRARPRDDEPTLVSCVVVPGFDFADFALAAPTD
118472254YP_890729.1 hypothetical protein MSMEG_6517 [Mycobacterium smegmatis str. MC2 155]MAALRVLLHRCSTYPLPGRQTPGDRNVLAATRFTATTRFAQKSAVE
118472253YP_890928.1 epoxide hydrolase [Mycobacterium smegmatis str. MC2 155]MTSDVTLVHDSAYFDDLKMHYVRAGAGEPVVLLHGWPQTWYAWRKVIPLL
AGEFEVIVPDLRGCGDTSKPSGGYDKKTVAHDVRRLVETLGHSAVHVVGH
DIGAAVAYAYAAQWPSEVQTMTFIESSLSGFGQEELMDVANGGSWHFGFN
MAGDISEDLVRGRERLLIEYWMRRTTVGVVDPTSVEPDALDEYARAMAQP
GGLRGSFALYRAIPQDRADNRELGRTKLAMPVLAVEGEHGQAGHSTETMK
KVADHVTSAVIARAGHYPAEENPAELAAALRGFLLGG
118472252YP_889734.1 MscS mechanosensitive ion channel [Mycobacterium smegmatis str. MC2 15MGTQVLMSETIKLESATNFAVTAAWAAGAVALAYGVGLGSNWLVQRVGGR
SAVLRDAAQLTRRPVRATLMVIAATVAVQRTSDEQARWRGWLDHSLVIAL
IATITWLIAALVMVAERQALTRFAGGDTGLTDADLHRRKVRTQVTLVRRL
VVAVVAVLGVAAALMTFPSFSDIGKTVFASAGVLSVVAGLAAQTSLGAVF
AGIQIAFSDAIRVGDVVVLEDEWGRIEEITLTYVVVHLWDERRLVLPCTY
FTTTPFQNWTRNATELLGTIELDADFTVPLDAMRVELDRLLRADPLWDQR
VGVLQVTDAVGGQVRVRVLVSAPNAGALWDLQCNVREGLVEWLQRTNPGA
LPRQRIEHESARDTRISDTAAGGYAQADSGLFTGNPEAERRGRSFDHADG
DDAKKTEPVPVAAGQTQC
118472251YP_890437.1 hypothetical protein MSMEG_6218 [Mycobacterium smegmatis str. MC2 155]MDAGPMKIRNLRWIVPTAVVIVVLAVLTVYLTAPRPGGRMDPDSTSPEGA
RALVTLLRDHGVDVITATGIDDVERDARPGTLLVAAQTLFLSGDDQLERL
SQVPGDLLLVEPTTKTREKLAPAIRPDDAAAFGGGEPDCDLPEARRAGET
QLGLSNTFRAAGDIPVQRCYDGAVVRYRDGNRTVTVVGTAEFMSNSGLLK
EGNAALAMNLAGDRDRVIWYSPQKFEGTSTGDRKLSDLMPDQVRWIVLQL
CVVVALFALWQARRLGPLVAESLPVVVRASETVEGRGKLYRSHRARDRAA
DALRTATLQRLLPRLGLTAQADQAAVAAAVAVRCGQDSQTVGYTLFGPPP
GTDDELVHLAHRLDDIERQVAHS
118472250YP_886597.1 bile-acid 7-alpha dehydratase [Mycobacterium smegmatis str. MC2 155]MSDDLEAIKRLKARYCRLLDTKDIEAWRTLFADDVVVTLDMAVSTGGADP
QTAPPLHGFDEFLPVVWGGVEHAATVHHCHTPEIDLTSGTTASGIWAMED
MLFFPDGSELHGAGHYHETYEKRDSTWVITSLHLTRTLLKFKAAQRDT
118472249YP_884561.1 HNH endonuclease [Mycobacterium smegmatis str. MC2 155]MSWGYPQTRVHPQIAVLRCRGGFTVGRFERMYEGLLVQIAEFSALSDLEL
EGQARGWAQAEASASAHKHAAMAELFIRATSTPSADERRWWFVDPDAAVG
AQLGAAQGITAWAALHQAQRGVALRDRLPKVNEVFAAGLVSEMIVRNICW
STALMLEPDKLALIDAELAAQISGWGKLTLKEIDNTIDDLILKHDPGSFR
RGRASRRGRYFDIGSPTDAPGVLTVTGRLQAHLGNAYDARIAELIEGVCP
DDPRTLNELRHDALGAILDHTTLACECEDPDCVRGREQSPRGHLVVHVIA
REDTVTAAQHAATTTNTPDDAPADTPAADTEPAEPAEPAEPAEPAEPAEP
AEPAEPVEPVDDPDIAPAASATETATDTTASPTGTDCDPESVSVTEFTDN
SSDTPSAFLDPDEHPLDRVPPAVLFGGGVLPAYALAEIINNATIRPLKHP
GDTAPEDRYIPSRALADYVRCRDLTCRFPGCDKPADRCDLDHTVPYPAGP
THASNLKCLCRFHHLLKTFWTGPRGWTDRQHPDGTIVWTSPSGRQYTTVP
GSHRRLSITELAAPTGALDLPATPIPTADPDLRGVKMPKRRRTRAQNTAR
TIAAERKLNDDLVAEHNKPPPF
118472248YP_888093.1 hypothetical protein MSMEG_3800 [Mycobacterium smegmatis str. MC2 155]MTDTVLFTVLCIACFGVATALRAAVARRGSDDVPPRDPKDTEASERLVTL
AELAAEFDEMLIRKGVMTSTQVSLMRTGIRSRGVVTGMRTTGVVREDFRE
VELDLMVSRTGGGQFAARQTTLIPLSSLHRVFPGSVVDAYYRPGDERTVA
VCVSP
118472247YP_889433.1 tetracycline-resistance determinant TetV [Mycobacterium smegmatis str.MRSPRPVAGWRVLAPFRIREYRLLIAAVTLSIFAEGMWSVVMALQVIAID
NDPASLSLVATCLGVGLVAFVLVGGITADRINQRTIIIAVEVVNFVTVAV
ISALALLGVLKIWHMAVAAGILGIAAAFFFPAYSAILPRILPPEQLLAAN
GVEGVVRPVFQRSVGPAVAGMVIGATMPSIGAVVVAVLFALGLALLVATR
PPAQPASEHHERPHVLRDLREGFAFVLKTPWLLWTVLFASMFVLVVLGPI
EVLLPFIAQDRFADGARAYGFILAFFGIGSAMGALTVSSRRMPRRYLTTM
MLMWGLGSIPLVIVGYTSSFPLMAAATFVIGVTDGAGMVIWGTLLQRRVP
TEMLGRVSSLDFFVSLAFMPLSFAIVGPLSKVVSMEVIFATAGLVPVAIA
AVAFTAARMHRDEVANPLL
118472246YP_889717.1 type I antifreeze protein [Mycobacterium smegmatis str. MC2 155]MPTYSYACTECDNRFDAVQAFSDDALTTCPKCSGRLRKLFGSVGVVFKGS
GFYRTDNRSDSGKSSSNGSSSKSSENSSSSGSSSSSSDSSSSSSSSSAAP
AAAASS
118472245YP_886149.1 UsfY protein [Mycobacterium smegmatis str. MC2 155]MGDTAKDPVDHARTTRPHAGETLKDTANIPALILLFLGGVSFVSCLFAFS
TSHETVGIVLAVVAALLFVVSGAWLVVEHRRVTHKERQWNAAHPEVHQSR
P
118472244YP_890383.1 hypothetical protein MSMEG_6163 [Mycobacterium smegmatis str. MC2 155]MTHDWLLVETLGSEPAVVARGSQTKNLIPISVFLRRNPNLMAIQSAIGET
VRAGQGLSSITPKTKRVIRTEVVRMTDGCIHGVHVWVGPANAEPPERLIP
GPLVWDLTTGVATDTPESIFNSGMDPAVEATDGRTFADDLPTRDLNPSEA
KVLSLVINPQPGTTICTTWDVTDFRGEPVTVGFVSRTMVETGPDGRDRTV
CRAMNWRSERDAAEVPADYLAQRILDGLARPDVHRALVDLKNWKLLKWLD
EPAPFIDWRNREGGASRIHPDDTAHMERMAAEFATGFTTAVLRMRTSGGG
WQSVHMTINRVELEPGTYAGLLALRLPSDAEIVGADSG
118472243YP_885345.1 hypothetical protein MSMEG_0942 [Mycobacterium smegmatis str. MC2 155]MSASTLFTDAMALTPAGDGIYDGALDEHWTIGPKVHGGAMLALCANAAQT
QIGGELQPIAVSGNFLWAPDPGPMRLVTTVCKRGRRISVVDVELNQGART
AVRASVTLGEPEHHVAPLLSFNPVSPLMAPEPPPEIAPIGPGHPMEHIVH
LAHGCDIRPALHTLGAREGGGPPVFEYWVRPKGVAPDVLFALLCGDVSAP
VTFAVERTGWAPTVQLTAYLRGLPADGWLRVMCTTVQIGEDWFDEDHTVV
DCEGRIIVQSRQLAMVPTAQG
118472242YP_885723.1 hypothetical protein MSMEG_1333 [Mycobacterium smegmatis str. MC2 155]MKNIALCFDQSGEQSASGADTNIKALLALLDDSAALTWYHCARKLPVYRR
VTAVSEARTAVVEAYNFLRDAWKPGDRIFLFGAGTGGHLAGELANLLGTV
GLVPATFDDPLGLVDYALSTYVLPRTPRTISDWHRVSSVTAGLLGDGTSS
VLVRFLGLWDATAIPGTHGEPGLLTNVEHGRHAVAIDAPHRVMHHDARLD
EVWFRGSHCDVTGGHGACAPLAEIALDWVLDGAVAAGLPARERDFAPGDV
EALAGSSPTVGIRRLPFDARVHASVGVYLRSHPKYWRRFPARIEWADTEW
SARGERLASAISHTPATEEATREELTAVAS
118472241YP_888957.1 alpha-amylase [Mycobacterium smegmatis str. MC2 155]MAQWWSHAVFYQAYPRSFRDSNGDGVGDLDGVTTGLDHLADLGVDALWLN
PVMVSPMADHGYDVADPRDVDPLFGGLDALDRLLDAAHARGIRVTMDLVP
NHTSSAHPWFVEALANPGRRDRYIFRDGRGPDGAQPPNNWVSVFGGPAWT
RVTEPDGTPGQWYLHLFDPAQPDLNWNNPEVFEDLEKTLRFWLDRGVDGF
RIDVAHGMAKPPDLPDMSVTDTALLRNSDDDPRFDNDSVHDIHRFIRRVL
DDYPDTVAVGEVWVHGNERFARYLRADELHLGFNFRLVKADYDAAEIRDA
IDNAMTAAALEGATPTWTLSNHDVVREVTRYGGGAQGLARARAMALVMLA
LPGAVFIYNGEELGLPNVELPDAVLQDPVWERSGHTERGRDGCRVPMPWA
GTAPPFGFSSTPDTWLPMPDEWAALTVERQLADPSSTLAFYRRAVQLRSA
RGEFDGSGIEWVDDQVFRRPGGLTCAFNTGTTPLPLPDGEILLTSGELVD
GMLPPDTAAWLV
118472240YP_884635.1 monoglyceride lipase [Mycobacterium smegmatis str. MC2 155]MVSSTRSEHSFAGVGGVRIVYDVWTPDTDPRGVVVLAHGYAEHAGRYHHV
AQRFGAAGLLVYALDHRGHGRSGGKRVHLRDLSEFVEDFRTLVGIAANDH
PTLPRIVLGHSMGGGIVFAYGARYPGEYSAMVLSGPAVNAHDGVSPVLVA
VAKVLGKLAPGIPVENLDADAVSRDPEVVAAYKADPMVHHGKLPAGIARA
LIGLGQSMPQRAAALTAPLLVVHGDKDRLIPVAGSRLLVDRVASEDVHLK
VYPGLYHEVFNEPEQKLVLDDVTSWIVSHL
118472239YP_888415.1 transposase [Mycobacterium smegmatis str. MC2 155]MDAYNDLRDIQIPTRKAAEVTGMHRSTATRRAKPAPAPADRAPRPVPVNK
LTESECTRVVEVLNSARFVDAAPMQVWATLLDEGSYLCSVSTMYRVLNAN
KLVKERRRLARHRKAVCPELVATAPRQVYSWDITKLAGPVKGVYYDAYVM
IDIHSRYIVGVHVHARECGQLAKEMMEQIFGTYGIPHVVHADRGTSMTSN
TVAGLLSDLGVIRSHSRPKVSNDNPYSESWFKTLKYAPAFPERFESIHHA
RDFMDRFVQWYNHEHRHSGIGLHTPADVFYGLAGGKDTQRRAVLADARAR
HPRRFGRDTAPKVIDLPESAAINPPKPAEQETETEAA
118472238YP_886817.1 fumarylacetoacetate hydrolase [Mycobacterium smegmatis str. MC2 155]MRVVGIRRTGSDRVEVAALTDTGDAVRVLAGLDEFWCDPTAHLAEEPAGA
VLPRDEVTLVPPVLPGAKVICIGLNYLKHVAEGSYGAEPLPEFPTLFARW
PSTLTVDGAQIPVPTDEEGLDWEGEVVAWVGRELSCATADEALDAVVGYS
TFNDVTARRAQKITSQWILGKNADRSGPLGPLVPAHDVGDLRDGLRVRTR
VNGTTVQDASTDEMVYTVGETLAHISRTLTLRPGDLLATGTPSGVGYART
PAWLLHPGDHVEVEVEKLGVLRNTIVASQRRPAHN
118472237YP_890934.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MTDVSRSDSGPFVPQDRPRTYRWRVVDIVVASVLAVAAGLVFVMWNIASN
PIGAPLSAALPGLQALLGGGWLFAGVLTALVIRKPGAALYGELVAATVSA
LVGNQWGVLTLESGLVQGIGAELVFAVFLYRVWNLPVAILSGAVAGLALA
INDLILWYPGSAAAFTLIYTVSAVVSGALVAGALSWYAVRGLARTGALSR
FASGRTAAR
118472236YP_885869.1 hypothetical protein MSMEG_1487 [Mycobacterium smegmatis str. MC2 155]MTQSEPHRIGPVDPDRYSTWDAAYVLGSLSSEERREYEAHLTTCPQCRAG
VAELSGMPALLSLIDLDDVRAIDGEQPDPPLRPEVLDSVMAEVGARRRRT
RWLTTSVAALAAVLLAVGIVVLARPEAFGLQRGTEQQTAQMLEMSKVAQT
PINASIALTGYTWGTRIDMACSYGDWGSKGAQPQDLGMVVVGRDGSREQV
ATWLGLSGATALPSGNTQKPMDDIAAIQMVSVADGKVLLEKKL
118472235YP_884490.1 IS1549- transposase [Mycobacterium smegmatis str. MC2 155]MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSP
PAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIE
PSSKADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGL
GPASLVLFDVSTLYFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFP
LTVEAFEGNRAETATMLPVINAFKAAHQLTDVTVVADAGMISEANQVALQ
SAGLSYILGAKIPFLPDVVREWRDKHPDEAIPDGLVLTQPWPATSSEKAR
GIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPVKRNRYIQLTG
ATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFRM
SKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTA
RRYRTVKIKAGTQTLTAADPLPEDLRAVLIKIRADGAH
118472234YP_887408.1 sugar kinase [Mycobacterium smegmatis str. MC2 155]MGILLTIDLGTEGARVGAFTEDGTALGSTHRPYLTHHPRPGWAEQDPRDW
WAAITAATRELLSGELCRAAGRVIAVAASTTASTVAVVDAAGTPLRPAIL
WMDARGAAESEQTARLCLQHPILEWSGGSDAAEWLLPKAMWLKKHDPDAY
RSAARIVEAVDYLTFRLTGRWVGSQMNAVCKYNYDTLAGRFPAELYAALG
MDDLIDKLPDEIVPVGGVAGPLADSAAADLGIDGRPVVAVGGIDAHVSLL
ACGGNVGGLVSLVSGTSSAIVTEVDRPTTSNEVWGPYPEALNPGKWLVEG
GQVTSGSVLKWTGESIIGVPRDELAGLIDQAAAVDPASHGLRALDYFMGN
RTPHREARLRGAVIGLTLGTTKAELYRAMVEAVACGTRSVIDSFERSGVP
CSRLVFSGGIERNTLWQQVTIDVLGRPAELVIGENLTLRACAVIAATGAG
IVPSLTAGSRLFAPRVRMLEPDPKRSLLYEQTFDDYQRLTAALRPIMCDT
VDGGSDAAAGARASFRVVR
118472233YP_885477.1 hypothetical protein MSMEG_1081 [Mycobacterium smegmatis str. MC2 155]MTVHRDLLLTPVSSARHPSADITDWTGTWVCVGLAEQLTEVGAILPATIG
QHAAHVRLTEAGPVAALNARPFGGCLSVPVHCGSTRNVRCPHRACAFSED
GPVLDDRTDPHGNARSEFVGRRTVDIPLAQWGSLLFVNVTMRTPRALPVP
DVTWDGLTLVDTGSDTVAGNWLQAPSRAVEQVTAACPWARTVTIAPNVVV
IRDDRDVLAVFSRPAGKYRSTMTWAVFANSKGSGALGAAAARVWGSSRGP
VA
118472232YP_890469.1 glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]MALPARSDSGCAVPVEFTSAEQAAAHIGANSLQDGPIGRVGLEIEAHCFD
LSNPTRRPSWDELSAVIADVPPLPGGSRITVEPGGAVELSGPPYDGPLAA
VAALQADRAVLRAEFARRNLGLVLLGTDPLRPTRRVNPGARYSAMEQFFT
ASGTAEAGAAMMTATASVQVNLDAGPRDGWAERVRLAHALGPTMIAITAN
SPMLGGQFTGWCSTRQRVWGQLDSARCGPVLGVDGDDPASEWARYALRAP
VMLVNSPDAVPVTNWVPFADWADGRAVLGGRRPTEADLDYHLTTLFPPVR
PRRWLEIRYLDSVPDALWPAAVFTLTTLLDDPVAAESAAEATRPVATAWD
RAARMGLTDRHLHTAALTCVRLAAERAPAELEESMTLLMRSVQQRRSPAD
DFSDRVVARGIAAAVRELAKGEL
118472231YP_884980.1 potassium transport flavoprotein [Mycobacterium smegmatis str. MC2 155MTTHVPVAVIGGGQAGLSVSWYLVRAGIEHIVIESKTPMHAWADTRWDNF
TLVTPNWHCRLPGYPYAGPDPDGFMTRDEVVDWLAGWLDTFDPPLRNHTQ
VTRLQNRAGGGFEVTLRDESGQSTLTCDHAVIATGGYPVPVIPSYAAQLD
ETILQIHSEQYRNAGTLPDGAVLVVGTGQSGAQIAEDLHLAGRRVHLAVG
GAPRVARFYRGRDCMTWLADMGVYDRPAQQYPGGQAAIEKTNHYVTGRDG
GRDVDLRQFATEGMRLYGTLADGKDSTLRFEPTLAEALDHADSVYNSICS
DIDAHIERNGIDAPPASRYEPVWKPETETTTLDLAAAGITSIVWAIGYRP
DYRWIAASAFDGAGRPMQTRGITNVAGLSFVGLPWMHTWGSGRFLGIDRD
ARHIAATIISSYHESVLRLAMKV
118472230YP_889024.1 low temperature requirement protein LtrA [Mycobacterium smegmatis str.MFAGTRAMRADAEGGRIQDVDEGARELPVQAHRLFRMSGRDPHEQHRVAS
PLELLFDLTFVIAFGVAASQLAHLIAEGHVAHGLTAFGFATFAIWWAWMN
FTWFASAYDTDDWVYRAMTMLQMVGVIILALGLPATFASIDHGGHVDNAV
MVAGYVVMRIALVAQWLRAAAQDRQHRTACLTYAAALVLAQLGWIAQIFV
QTTPMEFFATGAVLVAVEICGPLVAERRMGGTPWHAHHIAERYGLLAIIA
LGEGVVGTAASLTAAVGEQGWSTDAVLLAMAGTGLTFGLWWVYFLVPAAE
LLHVHRRLSFRYGYLHIFVFGAIVATGAGLHLAAYHVEGHSHLDAVATVL
AVAVPVAVFLVGMFVIYATLVGTVDRFYLVLLVVAAAPLVASVGLAAAGI
DMALCLLLVTAAPMIVVAGHEAGGHRRIGAKVAERIGGDQRGG
118472229YP_884651.1 transmembrane protein [Mycobacterium smegmatis str. MC2 155]MRNRLRVLAFDVAAPLAAIAALVYLGAALGWPTWWVSVCSILCLLIVQGV
VVNVVLACRDGVTLGTDDDGPGLRLAVVGVATAALVAAVVVGYLRWTAPD
DEFNRDREQVVRIASSVAEATATFTPQSPTASIDRAAAQMAPDRAEAFKN
EFATVAKDLTSRNVSAQASTVSAGVEALGPRAASVAVVLRGTQSVPGKPT
DNAVLALRVTLTKSDGRWLVDDVRPAHSR
118472228YP_886479.1 multiphosphoryl transfer protein (MTP) [Mycobacterium smegmatis str. MMTVGIVVVSHSRPLARAAVGLAQEMLHGKAVRISIAAGLDDTTLGTDASA
ILEAITSADSGDGVLVLMDLGSAVLSAELALELLDDDVRARTVLCPAPLV
EGLVVAAVAAAGDAALDEVAAEAAGALAGKAAHLEPATPPAPADDTAEPD
ELTGSFVVNNPHGLHARPAARFVAEVRRRDARVRIRNPRVDSPWVDGGSL
SRIATLAVRCGDEVELRVSGGQAHETLQHLLSLAARNFDEDHTEAPPAAP
ATAHTPIGAGPGMGVGPAYSARSQTPDVPDAPAADPAAEWRRLGTAIADT
RRTIGALRAATSRDIGEAEASIFDAHQLLLDDDALLGAARARIEQGENAA
AAWSQAVAALAAEFDALPDPYLQARAEDVRAVGDQVLRAMLGTEGDAAAA
SGVLVAGDLTPAEAAELDPQRVVAVLLAFGSPHAHNVILLRAKGIPVIVG
AGPGVLGIPDGTVVAVDATRGEFIVDPPADVREQFRHEAETLTRRRQAAL
QRAGEPAVTRGGRTVAVGANIAGVEDARAAAALGADHAGLIRTEFLFLGR
RQAPDVDEQLAVYRKIAESLGDRRMTLRTLDVGGDKPLEFLPAAAELNPY
LGVRGIRLSLAHPDVFSDQLLAMAKLAQDIPLSVMFPMVTTLDELFAARR
LLDDAVRRAGPRPPTGLQVGMMVEVPAAALKSAAFSRHVDFLSIGTNDLS
QYALAADRNNDAVAGLGDTFDPGLLHLIAATCRGAAGAASVSVCGEFAAD
ARAVPLLIGLGVDALSVTPPAIPTTKEAVRAVDDRHATETAEAALAAAGP
AAVRDLLG
118472227YP_888012.1 hypothetical protein MSMEG_3711 [Mycobacterium smegmatis str. MC2 155]MTVVIPSAPTGYTLSRREFLSDEELVTSPLTDVCQIGFV
118472226YP_887166.1 ABC transporter permease [Mycobacterium smegmatis str. MC2 155]MLRYAAARIGQSLLVLLLAFTVIFWGVSILPTDPVSIFVAKGDGYFNPEI
VEQVKEFYGYDRPAYVQYFSQLNQLLHGQFGFSLSSGQAVTDRIGSVIGE
TLKLAGTATVLALAFALATLLLASTTRFEWLRTFIRSIPPLFSAIPTFWL
GLVVLQIFSVQLGLFSLFPDGSLASLLVPATVLAVPISAPIAQVLLKNAE
ATLALPHINTARAKGGSPTWVIRRHVLKNAAGPALTVTATTIGALLGGSV
VTETVFSRSGLGTVLLQAVSNQDISLIQGLVLLTSVVIVGVNLLVDLLYP
VLDPRVTKSQRQGFSTRLGRFT
118472225YP_888971.1 pyruvate dehydrogenase E1 component subunit beta [Mycobacterium smegmaMTQIIDRPAAQGDAPEPWGSILTPAAAQAPVPAVTELTMVQAINRALRDA
MAADERVLVFGEDVATLGGVFRVTDGLTESFGAERCFDTPLAESAIIGIA
VGFAIRGFVPVPEIQFDGFSYPAFDQIASHLAKYRMRTHGDIDMPVTVRI
PSFGGIGAVEHHSESTETYWLHTAGLKVVVPSTPSDAYWLLRESISSPDP
VIYLEPKRRYWAREAVDTTTPALPIGRAAVRRNGSDVTVITYGGLVATAL
SAAELAEDRGWSMEVVDLRSLNPLDFDTVADSVRRTGRAVVMHEGPRTLG
FGAELAARISEELFYDLEAPVLRATGFDTPYPPARLEKLWLPGVDRLLDC
VERAMEQP
118472224YP_888542.1 MmpS3 protein [Mycobacterium smegmatis str. MC2 155]MSGPNPTEPDANGSDLPDQTPGKHAVPEEPTQVSGTDPETGETEFYSQAY
SAPEAEQYTAGPYVPADVALYDYDNYDPASELVEGPPPRWPWVVGVTAII
AAIALVASVALLVARDDQTSNLATPRPSTTTSSAPPVQDEITTTTPPPVE
PPPPPPPSEEAPPPPPPETVTITEPPPAPAPPPSSEEPAPPPATTTAPPA
TTTTPPAGPRQVTYSVTGTKAPGDIITITYVDGNGNRRTLRNVYIPWTFT
MTPISNSDVGSVEASSLFLVSRLNCSITASDGTVLSSNANNSAQTAC
118472223YP_884736.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MLEQDMTDEEFEPYFAKAQEVSQFFREIGPKYDQENTFAYPSIEAFKKSG
LGALPVPRAFGGPGGNILHVSKVVTELSRGDSAITLAYNMHYIMLGIAGN
LMSEEQNKYWMGRVIDGELIFGPFSEQRAGFSGLADMKAVPQPGGGWRLY
GKKTWGTLCEAASIITTNATETDANGNLPETFEERVAAEKLFIGDFTVDE
NGAGDGIRIEKTWDALGMHATGTQTIVFDGYFVPEDGFVSVWRAGAFGTL
EWASLMFASIYLGMQQRILEEATNALAKKHLGATFGAIVAEDTAVKDVGH
IVDGIGDFASRVEWSRRVLHRTCEDLLEGRDKEWPAELRFPYLGLAKTFI
ADNVLHMSRHAMSMIGGSAFRKGTIFERLYRDSAASMFQPLNADQTRTYV
GQYLLEQAAAK
118472222YP_884674.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium smeMSENKIILVTGVTSGIGEAVAIRLAAEGHLVVGGARRADRLAALKRENLH
VRRVDVTDRADMAAFVDEAVSEHGRVDAIVNNAGIMPLSRVDTLLVDEWD
AMIDVNVRGLLNGIAAALPHFQRQGHGHFVTMASIGAHQVVPTGAVYCAT
KHAAWAITEGLRLELDPSIRVTTISPGVVESELAQTITDPDAAKAMEIYR
AESIPPDAIARAVSYAVNEPADVDVNEVIVRPARQR
118472221YP_890206.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MTCRLCGSQRLLSVLDLGATPPCEKFLAAGELDLPEPTYPLHLRLCEDCL
LLQIPALITPEDTFSEYAYYSSYSDSWVQHAKRFVDDAAARLGLGSKSFV
VEVASNDGYLLQHAVAAGIPCLGIEPSVNVGAAARDAGVPTLTAFLDEEV
AAKVRDDHGPADLVVANNVYAHIPDLLGFTRALRRLLADDGWLSIEVHHA
LNLVTLGQFDTIYHEHFQYYTVLSAMRALATAGLAVVDVEMLPTHGGSIR
LWAQREDVAGPQTQRVAEILAIEEEAGLHEVDGYLALRPRAEAVRHQLLQ
FLLDCRAEGKLVVGYGAPGKGNTLLNYCGIRPDLLTYTVDRNPYKHGRYT
PGTRIPIHDPAQIAKDRPDVVLALPWNLETELTEQLSYIWEWGGQLIFPL
PTLHSSAVFKPPLGGISA
118472220YP_885346.1 pyrroline-5-carboxylate reductase [Mycobacterium smegmatis str. MC2 15MSRIAIIGGGSMGEALLSGLLRAGRQVKDMVVAEKFPERAKYLADKYSVR
VTSVADAAENAHYVVVAVKPADVEKVIGEIAEAAANAETDTAEQVFVTIA
AGVGTAYYEAKLPAGSPVIRVMPNAPVIVGGGVSALAPGRFATPEQLKEV
STLFDAVGGVITVSESQLDAVTALSGSGPAYFFLMAEAMVDAGVAVGLSR
AVATDLVAQTMAGSAAMLLDRLDQVNAAGGAALDTTPAQLRATVTSPAGT
TAAGLRELERGGLRAAVANAVEAAKTRSEQLGITSE
118472219YP_890140.1 acyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MALNIADLAEHAIDAVPDRVALISGGDQLTYGQLEEKANRFAHYLIDQGV
KKDDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELKYLFENSD
MVALVHERRYSDRVANVLPETPDIKTILVVEDGSDDDYERFGGVEFYSAL
EKSSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIEDEYGLAKQAAANPPMVRYPIPPMIHGATQSATWMALFAGGTVLL
TPEFNPDEVWQAIHDHKVNLLFFTGDAMARPLLDSLLAAKDAGKEYDLSS
LFLLASTAALFSTSLKEKFLELLPNRVITDSIGSSETGFGGTSIVAKGQS
HTGGPRVTIDKNTVVLDDDGNEVKPGSGVRGVIAKRGHIPLGYYKDEKKT
AETFKTINGVRYAIPGDYAEVEADGSVTMLGRGSVSINSGGEKIYPEEVE
AALKGHPDVFDALVVGVPDPRFGQHVAAVVHPREGTRPTLAELDAHVRTE
IAGYKVPRSLWLVDEIKRSPAGKPDYRWAKDVTEERPADEVHANHVAANA
K
118472218YP_886724.1 5-carboxymethyl-2-hydroxymuconate delta-isomerase [Mycobacterium smegmMRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVR
LLAPILASKVIAVGKNYAAHAEEMGGVAPEDPVIFLKPNTAIIGPNVPIQ
LPADADPVHHEGELAIVIGRPCKDVPAARAAEFILGYTIGNDVSARDQQR
KDGQWMRAKGHDTFCPLGPWIVTDLDPSDVELRTEVNGQVRQRSRTSLLL
HDIGRLVEWTSAVMTLLPGDVILTGTPEGVGPIEDGDTVSITVEGIGTLT
NPVVRKGKK
118472217YP_886186.1 hypothetical protein MSMEG_1814 [Mycobacterium smegmatis str. MC2 155]MDGCARPAFRVPLSDDEMHFTHLFGYAPGDFGYLLLPLDGGGWRTPATIL
FARLPCPGLAVCQMSILMML
118472216YP_886751.1 integral membrane protein [Mycobacterium smegmatis str. MC2 155]MTVAASDTDRSVAEGPGGLVVGKPSAVWVLIAGVLGLAASLTLTVEKIEL
LINPDYVPSCSINPVLSCGSVMVTWQASLFGFPNPLIGIVAFSVVLVTGV
LAVAGVRLPRWYWAGLATGTALGAVFVHWLIFQSLYRIGALCPYCMVVWA
VTIPLAVVTAVIALRARAGDADAGPGNIVHQWRWSLVALWFTALVLLILV
RFWEYWSTLL
118472215YP_890150.1 hypothetical protein MSMEG_5924 [Mycobacterium smegmatis str. MC2 155]MSPTTVPRLRLLLTTGLAAAVVATAAGCQDAQLTADPATGKAPAASSSAA
TSSPQAKASDYSHLLLQAEDISIPPNTFTRRSTKVNPDGQDGASALYVNA
DDTRAIADTILIYPDVATATATLQQAVGAINTMVEGGTPQPHPVGTNGTV
ISGTAPDGSKAVTLLMFTQGRALVRLEFDSAIEDPVTEQTVTAIGRMQQI
ALRIGLPERE
118472214YP_889816.1 hypothetical protein MSMEG_5581 [Mycobacterium smegmatis str. MC2 155]MSAAEQEFSAYGPSHLVVLAIFVVGAALLVWAGRRQTEQQAKLLSRVLAV
LLIATFAVALAYKLARPHLDTSVPLQLCDVAELVAAYALWSQRHWAFVLT
YYWGLVLSSQALLTPDVGTAEEGAPDFPHHLFITFFVLHVLVVWSAIYLT
WGRRASLRWRDWRFAVIVTLAWFAVTFTFNTIAGTNYGYLNGKPPTASIL
DALGPWPFYLLVEVTIVVAVWALMTWPWVRIRQNADAKVP
118472213YP_884740.1 aldehyde dehydrogenase [Mycobacterium smegmatis str. MC2 155]MSEHYSMYIDGKWIDTDEVYEIRSPATEELVATVAKGNTASVDAAVEAAK
GAFAEGTWRRTPPAQRAAIINNVAERLGARADELAALQTRENGATIRITG
ALHVGLSVAQLQYLAAIAENYEWETPGPAIEPVAADGVVVREPLGVVAAI
VPWNIPLLTTVWKIGPALVAGNSVVLKPDEHAPLLALELAREFDAAGLPP
GVLNVVTGDGEPVGAHLSGHPDVRKVAFTGSTAVGKSILRQSADTVRRVT
LELGGKGANIILDDADIDMAVDGALFACMANNGEACEAGTRLLIPASRRD
EIVDKLLARASTLRVGDPLDPATHIGPVISQTQRDRILNYFRIAAEEGAI
AALGGKARSGPEFDKGYWIEPTIYLDVTNDMRVAREEVFGPVLVVMTYDT
DEDALAVANDTNYGLSAGVWGSEERATALARRLEAGMVWVNNWHIIHPAY
PFGGYKESGLGREGGPNAIDEYVEEKFIAVDRSGGIENKAFAIVIDPAGD
118472212YP_889951.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMDTRQRIQEVARELFAEKGVVRTSLQDIADRLGITKPALYYHFRSREELI
RSILQPLIDEGEAFVAEQERKRAADRASARELLEGYFDFHYRHRADLVLI
VSELTTLVDLGLIDQLLAWRARLGALVFGRTPTLEQSTRAVIAFGGLQDC
CLQFPDVPAEQLRTATVNGAMAALGL
118472211YP_888845.1 SpfH domain-containing protein [Mycobacterium smegmatis str. MC2 155]MDMLYSLGISAAAAVTLAWLAIRNIRVVRQYERGVVFRFGRVTKSIRQPG
LTMLIPIADRLQKVNMQIVTMPIPAQDGITRDNVTVRVDAVIYFKVIDPV
RAVVDVQDYMSAVGQVAQTSLRSIIGKSNLDDLLSNRERLNQGLELLIDN
PAVGWGIHIDRVEIKDVVLPDSMKRSIAKQAEAERERRARVITADGELQA
SEKLAAAADVMGNEPAALQLRFLETVVEVAAEKNSTVVVPFPVELLRFLD
RVTPHESARNGGPVPRVV
118472210YP_889236.1 carbonic anhydrase [Mycobacterium smegmatis str. MC2 155]MSVTDQYLANNEEYAKTFSGPLPLPPSKHVAVVACMDARLDVYRILGLGD
GEAHVIRNAGGVITDDEIRSLAISQRLLGTKEIILIHHTDCGMLTFTDDE
FKRAIQGETGIKPEWAAESFTDLEEDVRQSLRRIEASPFVTKHESLRGFI
FDVATGKLAEVTL
118472209YP_888144.1 aliphatic sulfonates transport ATP-binding protein SsuB [MycobacteriumMTVTSERSVTTAAELRGVNKWYGRHHVLRDVSLRIGRGEIVALIGRSGSG
KSTVLRVLAGLSTDHTGECHVAGAPALAFQEPRLFPWRDVRTNVSYGLTR
TRLPRGEALARADRALADVGLADRGDVWPLTLSGGQAQRVSLARALVAEP
QLLLLDEPFGALDALTRLSMRTLLLDLWREHGFGVLLVTHDVDEAVALAD
RVLVLEDGAVVHTLDIEDTRRSPGDPSPATERYRAELLEHLGVQL
118472208YP_886634.1 IS1096- tnpA protein [Mycobacterium smegmatis str. MC2 155]MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVADEDRW
CRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDA
SAAAEPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAE
GQRVLIADPARFDGVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGP
ARLLDMVEGRSKKAFADWLAQRPQEWRDRVDVVAMDGFSGFKTAATEELP
DAATVMDPFHVVRLAGNALDECRRRVQLATCGHRGRSTDPLYRSRRTLHT
GADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYREPDRTKGRTM
MAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR
118472207YP_889126.1 LAO/AO transporter ATPase [Mycobacterium smegmatis str. MC2 155]MPHGVVDVPELITVARGGSMRAVGRLLTLVESDRRGEVLAALGPATPRVI
GVTGPPGAGKSTTVGAMVGAYRERGLRVAVLAVDPSSPYSGGALLGDRIR
MAAHINDPDVLIRSMAARGHLGGLAAAVPAAIRLLAALSYDLIVLETVGV
GQSEIEIAAIADPTVVILNPGAGDAVQAAKAGVLEVADLVVVNKADRDGA
DQTVRDLRAETDVPVLKLVAAQGDGLHELIEAIEAHQRADTPERRRARAR
SQILSLAQTLLRNHADLDRLSAAVADGSSDAYTAAERLFAGSVD
118472206YP_889006.1 hypothetical protein MSMEG_4748 [Mycobacterium smegmatis str. MC2 155]MQQIFLGFAADIMPLPAVELTPAFAGAASPRPDGASLSTGREVLWHM
118472205YP_887616.1 zinc-binding alcohol dehydrogenase [Mycobacterium smegmatis str. MC2 1MVIGGGRFRLKQRADPVAGPHEVLVEVRAAGLNAADLQQARGDYPAPAGW
PADVPGLEIAGEVIDVGASVTGVAVADGVMALVGGGGHAERLAVPADLLL
PIPRDVSWEQAGGFPEIFSTAWDALVTQAQVGVGDRVLITGAAGGVGSAM
VQIAAVTGAHVVASVRRPELHAKVKSLGGESQSLTVVSPDDEADDGPFDV
IVELVGGADCLQRVELLRTGGRFLIVGVHTGATASLPMFTLMLARAKLIG
TTIRGRSHAEKALLARTIAGKVVPLLADGRIRVPIEATYGLDDYADAYER
LGAPGKFGKIVLTP
118472204YP_884626.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MHPADSHDRIRVTGARENNLKDIDIELPKRRLTVFTGVSGSGKSSLVFDT
IAAESQRLINETYSAFIQGFMPNQARPEVDVLEGLTTAIIVDQQRMGSDP
RSTVGTVTDAGAMLRILFSRLGKPHVGSPQAFSFNVASISGAGAVEFQKG
GRTVKERRDFNIVGGMCPRCEGRGSVNDIDLTALYDDSKSLNEGALTIPG
FSMDGWYGRIFRGCGFFDPDKPIKKFTKKELDALLYKDATRLKIDGTNLT
YLGLIPQIQKSFLSKDVEAMQPHIRAFVERAVTFTTCPECDGTRLSETAR
SSKIDGVNIADASAMQITDLATWLAGLEKKATAKSVAPLLTALRHTLDSF
VEIGLGYLSLARPAGTLSGGEAQRVKMIRHLGSALTDVTYVFDEPTIGLH
PHDIARMNTLLLQLRDKGNTVLVVEHKPETIAIADHVVDLGPGAGTAGGE
VVFQGTVDGLRASDTVTGRHLGYRAALKDSVREPDGALEVRGANTNNLHD
VDVDIPLGVLVVITGVAGSGKSSLIDGSVAGREGVVLVDQSPIRGSRRSN
PATYTGLLEPIRKAFAKANGVKPALFSSNSEGACPVCNGAGVIYTDLGVM
ATMESPCEECEGRRFQATVLEYTLAHRNIAEVLEMPVTEAVEFFGAGEAK
VPAAQKILERMADVGLGYLTLGQPLTTLSGGERQRLKLAAQMADKGNVYI
LDEPTTGLHLADVEQLLALLDRLVDSGKSVVVIEHHQAVMAHADWIIDLG
PGAGHDGGRIVFEGTPADLVAARSTLTGRHLAEYVSS
118472203YP_885797.1 amidinotransferase [Mycobacterium smegmatis str. MC2 155]MTISDDVIWNDRVRPDQHGPSADVAAPPARRSTVRHYAMTAPDHFTVEYA
INPWMDVTTPVDTQRALDQWRALHDIYRDLGHTVDLVPPRAGLPDMVYAA
NGGFIVGRTAVIARFAYPQRAPEADAYAEWAAALGLDPVFTQHVNEGQGD
LLLVGPNLLAGWGFRTDRRAHDEIAAITGLPVVSLELVDPRFYHLDTALA
VLDDTTVAYYPPAFSPDSRRRLQELYPDAIEVATADAYVLGLNVVSDGKN
VVMPAAATGFAEQLRHAGFEPIGVDLTELLKGGGSVKCCTLELHP
118472202YP_889600.1 hypothetical protein MSMEG_5356 [Mycobacterium smegmatis str. MC2 155]MIVAGLIAALSTIPWDGQGCDDVLPAWHEYIAFLLAVQAIFTGLATLVWL
LIASTPDDASPADPGDVTQPSISE
118472201YP_887807.1 hypothetical protein MSMEG_3503 [Mycobacterium smegmatis str. MC2 155]MPIGIGLAATAVISSLLTAFVVFTTLTTKLSKRDSVYAVGVRMLPDDPRS
AGQRPHASRAAVRMVNPYAFDQAGFVDSDARCRDTQTARAIGRTAGSLVV
ICLDRSGHFEYHGVRLTDKATLAARAEKTPQRMFLARNHGVDYAVSPTEL
LVTSGGAVVKREPMVEYREILSSSPVLVAPR
118472200YP_889646.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMGHGVEGRSTPAASLDAASAVKVAETLQALASPNRLLILTRLRESPCSVT
ELSAAVGMEQPAVSNQLRLLRTLGLVTGDRSGRNIVYRLYDSHVAQLLDE
AIYHIEHLRLGVRDGTA
118472199YP_890394.1 IclR family transcriptional regulator [Mycobacterium smegmatis str. MCMSVPPGTQTLARGLAVIRAVADGARDLRGLVEHTGLGRSTTHRLVQLLVH
EEFLRHVDGGYTLGPALIELGFKALHGNPLPVVARPFLEELSEQVHDTVH
LGVVDGDSVLYLEKLPGTRGAEMRSRVGHRMPLTRTGVGMALLLDSPERW
EELYIADEDRVTVPTVVRRGELAERCAEFCTRMQTYAKSGSAMDLEDNEP
GIRCVAAPVRDASKAIVGAISVSATRPYMPAARMRGLVPVVRRSAARISS
AMGYREAQAQ
118472198YP_887910.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MTQAQELSVDFDFRLDGKVALVTGAASGIGAAIASAYATKGARIAAVDLN
AEGAEALAAQLGGDRGAHRGFACDVADAASVQAAADAVAAEFGRIDILVN
SAGVARLAPAEELSLQDWDSTLAINLSGTFLMCQAVGKRMLEAGGGAIVN
MASQAATVALDQHVAYCASKFGVVGVSKVLAAEWGGRGVRVNTISPTVVL
TELGHKAWDGPRGDALKKLIPTGRFAYPDEIAAAAVFLASDAAAMINGAD
LVIDGGYTIK
118472197YP_886953.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium smegmMVPDDGLTTRARRNAPVLAVHTGPGKGKSTAAFGMALRAWNQGFRVAVFQ
FVKSAKWKVGEEAVFRELGRLHDEHGAGGPVEWHKMGSGWSWTRKHGSDD
DHAAAAADGWAEIKRRLAAEQHDFYVLDEFTYPLKWGWVDVDDVVSTLTE
RPGRQHVVITGRDAPQALIDAADLVTEMTKIKHPMDVGRKGQKGIEW
118472196YP_886871.1 carboxylesterase [Mycobacterium smegmatis str. MC2 155]MTGYEPIVGRYLTADIDGVPNRMYIEESGDGVPVVCLHTAGSDSRQYRHM
QTDDEVLSRFRVLAFDLPWHGKSLPPDRWWRREYLLTSELYIASVMAVID
ALDLEQPIVVGCSMAGSLVLELALTHGDRIGGVIGFSGAAKVEGRFDDWS
LKPDINSNQAVPSWTYGLMAPQSPEPARREVWWTYAQGGPGVYRGDTYYY
SNGMDLRGREREIDTARCPVYLFAGEYDYACSPEETEATIAAIPGARGGV
MRGIGHFPVAENYPLCKTYLWPALLDLADRRAGNGIA
118472195YP_888165.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMVRPSTPVRSPTDRRQPQRSDLRRTAILEALNEHLQKTGFDALNIAEVAR
QAGVGRSAFYFYFENKAAAVAALLEPMHEALLAANNILADLTRPPGERIR
ATLDAVLRTAEDHRYLFQAMLEARGTSGAVRDMWDAARESFVPTVSAVIT
AERESGRAPDGVDPKVLASLLMEFNDRLLERLIIGGPLTRRQLLEGAEAM
WMGAIYASEPEQTR
118472194YP_884753.1 enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis str. MC2 155]MLEITDQNRVRTIALARHDALNAFDEALYDATAIALQDAAEDGDVAVVIL
TGSGRAFCAGTDLKELHARATKNGFVPGKYGFNGLMAVLAEFPKPLICAV
NGVGLGIGTTILGFADLAFMSTSARLKCPFTSLALAPEAASSYLLPALLG
RQNAAWVLMSSEWIDAQQALEMGLVWRLCEPDQLDDEVRRHAELLASHPI
SSLIAVKRTLTAPHVEAVRAALAREDALLEELLGAPPNMAALAQFVGKRD
118472193YP_889108.1 enoyl-CoA hydratase [Mycobacterium smegmatis str. MC2 155]MAERPTPEEIILYDKDPETKIATITFNRPEFLNAPTSMARLRYADVLRAA
NADNDVKVVVIRGVGDNLGSGADLPEFMEGNDNPAVRLAELRLEDDGVGE
VTYPPRGTFRNGATISAWYANSQAGNRALQDFKKISIVEAKGYCYGWHFY
QCADADLVISSDDALFGHPSFRYHGWGPRMWTWVQMMGLRKFQEMVFTGR
PFTAAEMYDCNFLNKVVPRDRLEAEVDKYATACARNRPVDTVFQQKMFFE
IFKQQQGEYMGSLLSAFFESMGNGVANDSDDDLDMFESIDSGLSAAVNDN
DSRFPPEFRLSKKNRAKP
118472192YP_889280.1 hypothetical protein MSMEG_5030 [Mycobacterium smegmatis str. MC2 155]MPWWERYIGLPLLLLHDKVYKATDGRIGHRIPGGPATLILHTVGAKTGQH
RASSLAYARDGDDYLVVASKGGEPKAPGWYHNLKADPNVEINVGPKRLRA
TARAVFPDDPDFPRLWEIVNNMPGNKDRYIGYQKRTTRQIPVIVLTPVS
118472191YP_887488.1 L-asparaginase [Mycobacterium smegmatis str. MC2 155]MNPSAQVVLITTGGTISTSTDNAGVRRPTRRGAQLTAALTAPTAPTVSVV
DLMTTDSSHLTPSDWDAIREAVAKATDGPGGPDGVVITHGTDSLEETALW
LELTHTGDTPVVITGAQRSSDAPEADGPRNLADAIAVAASPDARGLGVLV
CFAGTVRAPLGLHKRHTQELDAFSGTALGTVADGTVELTEDKTRPVLGAL
SAAAAPRVDIVAGYPGADAAALDACVAAGARGVVLEAMGSGNLGAALTEG
VERHLRAGVEIVVSTRVPGGVIAPDYGPGRRLADAGAVVAPRLRPPQARV
LLMAALAAQRPVREVFSSWG
118472190YP_888733.1 acetolactate synthase [Mycobacterium smegmatis str. MC2 155]MSARNGGDVVVETLTALGVSHVFGIPGQNALGLFDAVRRSKLTFISSRVE
NNSAFGADGYSRATGDVGVLFLSTGPGALTALGALQEAHATGVPVLVIAS
QVPRAGMGLRRGMLHQLDDQKASAANVTKSTAVARDAAAIPSLIADAYEL
ALSAPAGPVWVEIPQDVLTEPTSVPPVSTLTVHPTYRSPRPELVDAAADL
LNGAQRPVILAGGGVRRSPGGPAALVEFAEALGAPVVSTVGGKGAIAFDH
PLSAASWIEDRHTTALLEDADVLVAVGTAMGEVTSNYFTFAPRGQLIHID
AEARVLQANHPALAMHADAAQALNALTPRVHPRDDAEGARTAAALRKAVQ
DRLSAQDLGTEQKLMRDLRTAVPASTHTFWDMTIAGYWAWSAWDPQQGEF
HSAQGAGGLGFAFPAALAAAIATGRRTFAVSGDGGAMYSIAELATARQHD
ADITWLVVDDGGYGILREYMTAEFGAATATELARPDFARLAESFGIPAHT
ATIDDVGDLVAASFEHDGPTVIVLPAVLQMFAPTHLPPKE
118472189YP_889899.1 hypothetical protein MSMEG_5666 [Mycobacterium smegmatis str. MC2 155]MAKDQDILAEVHRLVAEEQELRDKLQRKEISEDEEHQRLQHLEVALDQCW
DLLRQRRALRETGQDPREAEIRPAGEVENYKN
118472188YP_887588.1 hypothetical protein MSMEG_3278 [Mycobacterium smegmatis str. MC2 155]MNDLMFVRAVNGVASRLTRVPILGSLVRRGMIVIRYTGRRSGQTFETPVG
YRKVGDDRVVIRVEMPDRKTWWRNFLGEGSSITLVGLDGADRTGHAVAHR
DEAGKVSVTVQLDAR
118472187YP_886269.1 caib/baif family protein [Mycobacterium smegmatis str. MC2 155]MTSTDTYDPPLSGVKVLDLSSGPITAVGRLLADLGAQVTPVNLAGVTEAG
ATVGPRIGAVPVGTAINRFGLSTVDLDTSTADGARRWRELLADADILIEN
TRPGSDAEKALSAREIHADHPSLVILSVSDFGRDTAYRTWQATTPVLHAL
TSELSRSGIPGREPLVPPAPQLPYQVAAAQAAVMTVSVYLDRLRTGTGDL
IDFSVLDGAMQTLDPPFGTPGTASAGVPLAEQRRNWLAERQRYPIVRCKD
GYVRICVLAKRQWQGMFTWMGEPEEFADPKFNSLMERFMSPTLLPAIERF
CADKTRAELEAEGQRHGVPTAAVLTLTEALDTEQVKERGFFREVELANGF
TAPVPVGVSEVDGHRASALTAPRGTSAPPEGAPVLGGRARRDVGLPLEGL
RVLDLGVIVVGADTGRLFADLGADVIKIENSAFPDGLRGRLNMMSQTYAS
GHRNKRSIGIDLRSDEGRALAHRLAEDADVVLTNFKPGVAQALGMDFGSL
KKVNPGIVVVDSSAFGPTGPWARRLGYGPLVRAAAGFTDLWVYPDAPGEF
CDTVTVYPDHVAARIGALTALTLLLRRERTGTGGAVSVAQSEVMLSHLAG
EIAAEVLQRQGHARSDEPVHDAPWGLFPAEGEDKWVAVTVRDTTDWQALC
GVIGRADLAADDALNTPAGRDADRARIDEAVRAWTSARTATAAMELLQKA
GVPAGAVLHAGEVPNFGYYAERRAFREELHPHAAEPFMMENVQIHSDRVA
DPPLGQAPLLGEQTREIAAELLGLSDAEIDELIERGVLEMPQEVTAAQR
118472186YP_887334.1 hypothetical protein MSMEG_3016 [Mycobacterium smegmatis str. MC2 155]MGIKVALEHRTSYTFDRLVEIHPHVVRLRPAPHCRTPIDAYSLTVEPADH
FINWQQDAFGNHMARLVFPNRARELTVTVGLIADLKVINPFDFFIEDYAE
TVPFEYPRALREDLKPYLRPVDEGAEGSGPGELCAAWVSNFTMPPGTATI
QFLVALNQAVNADVGYSVRMEAGVQTPDHTLRTGIGSCRDSAWLLVSILR
QLGFAARFVSGYLVQLTSDVEALDGPSGPAADFTDLHAWTEVYIPGAGWI
GLDPTSGLFAGEGHIPLSATPHPESAAPVTGATGVCEASLEFSNVVTRVH
EDPRVTLPYTDAAWASIVDLGGRVDRRLADADVRLTMGGEPTFVSIDNQV
DPEWTTDADGPHKRERASALAARLKNVWAPGGLVQRSQGKWYPGEPLPRW
QIALYWRTDGLPLWTDAELLADPWSGKTREVAPDAAERLLSEIAAGLGLP
GTQVRPAFEDPLSRLAAAVRLPAGDPVGADEDLAEDGADARAELLARLES
PVDAPAAHVLPLHRADDGTGWASADWRLRRGRIVLLDGDSPAGLRLPLNS
ISWQPPRPSFEADPLAVDTDTEPAPGRRTATVVDADGAPTTALVAEIRDG
LLYVFLPPTAELDDFLDLVARVEAAAAAVGVPVVVEGYGPPTDPRITSTT
ITPDPGVIEVNVAPTASFGEQNKQLETLYEQARLARLSTESFDVDGTHSG
TGGGNHITLGGITPADSPLLRRPDLLVSLLTYWQRHPALSYLFAGRFIGT
TSQAPRVDEGRAEALYELEIAFAEIARLTATDAPQPWVLDRALRHLLTDI
TGNTHRAEFCIDKLYSPDGARGRLGLLELRGFEMPPHHQMAMVQALLVRS
LVAWFWDEPLRAPLIRHGANLHGRYLLPHFLIRDIADVAADLRAHGIDFL
TSWLDPFTEFRFPRIGTAVFDGVELELRGAIEPWNVLGEESTAGGTARYV
DSSVERIQVRLVGADRDRYVVTANGHPIPLLATEKSDVQVGGVRYRAWQP
PSALHPSITVDGPLRFELIDTATGTSKGGCTYHIVHPGGRSYDTSPVNAV
EAESRRGRRFEVIGFTPGKVDMSVIRERQARQSTDVGAPGILDLRRVRTV
LR
118472185YP_885879.1 acyl-CoA dehydrogenase [Mycobacterium smegmatis str. MC2 155]MYLSDLDDDERVIVETAAAFAEKRITPYALEWDDKHHFPTDVLREAAELG
MGAIYCREDVGGSELRRLDAVRIFEALSAADPTLAAFLSIHNMCAWMVDT
YGTEDQRKTWVPRLASMETIASYCLTEPGAGSDAAALRTRAVKDGDHYVL
DGVKQFISGAGTSDLYVVMARTGGEGPRGISTFIVEKDTPGLSFGADEQK
MGWNAQPTAQVIFEGVRVPAEALLGNTEGTGFGIAMNGLNGGRINIAACS
LGGAQAAYDKAVGYLADRQAFGAALLDEPTIRFTLADMATGLETSRNLLW
RAASALDANHPDKVTLCAMAKRYVTDTCFDVADSALQLHGGYGYLREYGL
EKIVRDLRVHRILEGTNEIMRVVIGRSVAGAARNQADAARPRATA
118472184YP_884683.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMPVQSEELRRRLVADINAGTPGAKLGSERDLAEKYGTSRSSLRQVLAALE
EAGLVHRVIGRSGGIFISHGQVERNLSDVVGVPAFLANQGYVAGTRILST
RITTPDQTTRTALRLGPGEYVVEIQRVRLADGSPISLEQAQFPAEKFPGL
LEQQLGGSLYEVLESQYGLVPGRADERIEAVNATSNEATLLGIKPKAALL
LITRVTFDQTGTPYEFSRDLFRGDRTALAVTAKGRGIAAASNSGTDNRTA
SVTLHRQVG
118472183YP_890181.1 protein-tyrosine kinase [Mycobacterium smegmatis str. MC2 155]MNLKSFVAAAQRFWSTYLLVAGLVLIVGAAAIMMLPVTYVSSARLMVSIE
GSTTAAAYQNEEVAIRRIRTYIPLLKSDVVTQRVIDKLGLPMTAKQLAEE
LSATNVPPKTSLIDIRISDSSPQRAELIANTVAREFVAYTAAIETATGED
DQKVQTTMVSDATPARRDPVERALLYLLAALAALLLGGAAVWLRASREQL
DADSDDPVGRAPKAAQTVEGS
118472182YP_886716.1 ketol-acid reductoisomerase [Mycobacterium smegmatis str. MC2 155]MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDSGVQVKVGLKE
GSKSREKAEEQGLEVDTPAEVAKWADVIMLLAPDTAQASIFTNDIEPNLE
DGNALFFGHGLNIHFGLIKAPENVTVGMVAPKGPGHLVRRQFVDGKGVPC
LIAIDQDPKGEGQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVL
CGGTEELIKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLIYEGGIARMNY
SVSDTAEFGGYLSGPRVIDADTKKRMQDILKDIQDGSFVKRLVANVEGGN
KELEALRKANAEHPIEVTGKKLRDLMSWVDRPITETA
118472181YP_885200.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MIELAGLTKLYGTHRAVDDLSFTVEPGVVTGFLGPNGAGKTTTMRLILGL
DHPTSGTATIDGKRYRELKNPLRTVGALLDARQAHPNRSARSHLRWIAAA
NRIPASRVDEVLEMVGLASAADRNAGALSLGMSQRLGIAAALLGDPPVLL
FDEPVNGLDPEGIHWVRTLMRELAGEGRTVFVSSHLLAEMANTADRLVVI
GQGKLIASTTVTEFVNGSDADTVRVRSPQLETLRDVLSDAGLDVVTEPDG
GALNVHGVAIEVIGDLAARNAITLHELSRRQASLEEAYLKLTDDAVDYRA
VQP
118472180YP_885367.1 porin [Mycobacterium smegmatis str. MC2 155]MKAISRVLIAMVAAIAALFTSTGTSHAGLDNELSLVDGQDRTLTVQQWDT
FLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWS
LGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGP
GIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDS
VTTYGEPWNMN
118472179YP_888520.1 serine/threonine protein kinase [Mycobacterium smegmatis str. MC2 155]MEQQSDPLVGSLLDGRYRVDMPIATGGMSTVYRGLDTRLDRPVALKVMDS
RYAGDEHFLTRFQREARAVARLKAPGLVAVYDQGLDRRSERQYPFLVMEL
IEGGTLRELLTERGPMPPHAVAAVLEPVLGGLAVAHRNGLVHRDIKPENV
LISDDGEVKIADFGLVRAVAEAKITSTSVILGTAAYLSPEQVATGDADPR
SDVYAVGILTFELLTGTTPFTGDSALAVAYQRMDHDVPPPSTRIAGVPRQ
FDDLVRRAATRDPAGRYADAGEMVAALDVIIDELGLPPFRVPAPRNSAQH
LAATRFHNRPQPDLETTAEVAPPPPAPATVPRQHTREITRDQQDWAPIPA
APADDEYAGEYDEYDYSTVSGQFAGIDMAEFYWARQRAKRMVLMWVIAVL
TVTGLTAAAAWTLGSNIATLIQ
118472178YP_890814.1 NADH:flavin oxidoreductase [Mycobacterium smegmatis str. MC2 155]MHPFRQAVEARDTDAMTALLADDVVFTSPVAYKPYPGKAITAAILRGVLR
VFTDFRYVREIGDPNGRDHALIFEAKVDGKTVNGCDFIHTDDEGLIDDFM
VMVRPLSGAQALAEAMGAQFDRIQREALGEA
118472177YP_890976.1 halogenase [Mycobacterium smegmatis str. MC2 155]MRAQISHLDPTTREALATRIRNQLSRADATSTDHDVAIVGGGAAALTLAL
QLRRERPGTRVVMIAPEVRPVPEMTHTVGESTVEISAHYLRDRLDLADHL
NTAQIRKMGLRMFFSHNGNTDITERMELGGSSFVPQVTYQIDRGRLENEL
HRRCVAAGVQVLCGRVRSVDLTTRTLTYQCDDATATTTARWIVDASGRNR
LLGRELDLKRTTGHHCNAAWFRVATEIDVGAWSDDPAWQGRLVEGERAMS
TNHLMGDGYWVWLIRLASGATSVGIVADPDHHAFDRFNTLDKAKAWLREH
EPQCAAVLADHEHQIRDFRVMKHYSHGAAKVYDGRERWCLTGDAGIFLDP
LYSSGLDLVAIGNGLIADMITRDLDGEDVSARAQISDTLYRSLTDMWLRV
YQDQYTLMDTPAVMSAKIIWDVAFYWGFIGLLYMNNRYARVADDPEFVPQ
LEGLIALSNRMQSFFREWAAVEDRATTVPFVDLYAPLNFMVSLHTAMAEP
SVDFTGQFATNATVLRQLAGQLAETVLAHKASRFDDDGVVRMVQAWQRDS
LLRDLRATYRREQATNPLSSDWIITASPALATG
118472176YP_886687.1 hypothetical protein MSMEG_2341 [Mycobacterium smegmatis str. MC2 155]MKKAYTALVAITVGAHFGYLLYLPSGGFLALRWPRTLAFHVPTVIWGAFV
VALRLRCPLTHLEQWARVRAGLKPLPADDFIDHYADGVLYPANRTGAAQA
AAFTAAALSWVLLFARRRRITSALTSASRMKTPAAR
118472175YP_887554.1 hypothetical protein MSMEG_3241 [Mycobacterium smegmatis str. MC2 155]MTEPQRAVIARVTADLTAVSAYLNRMAGDLATLDRLVAQQSAAPRPEAVA
PQWSPQAPQQPPRQWTPQPVAPVAPVAVPARQPDTPPKPRSEGWIGKVLA
MAGVAVTLVGVVSLLVLAAQAGILRPEVRVAAGAALAVALVAVAMWLDRR
PGGRVGAVALAATGVAAAYMDVIAVTAIYEWVPAPVGLALAGVVGACGLM
LARWWGSEQLGLLVFVPLIALAPVITDGVTLLLIGFMLALSAASLPVQFG
RDWFWLHAARTAAVTIPLLVALVSAAIGGREDLRLALVCALAAVPALVGG
VTVSRFSTRPVATTVVSALGTVPLLCVSATADRVPAVLLIAGLAAAALAV
AAIGDRLPGIGAPVRRVWAATSAAAALIAVLVAFDGTVAAPVLLAMSIAI
AVGGQRDPVGRCAAIGFALIGAMFYLDHAAPAMLVEATPLDGPTVASVVI
GSVMLIGAAAANGWTWSRTVSDTEVVRLVWVAVSAVIGYAATALTVTVGV
ALGGAEVGFLAGHMAATLSWIVAAALAFGYAARRPGASRSVLIGGGLVLV
AAATGKLFLFDLGTLDGMYRVVLFIVGGLVLLGMGAGYARFLAQQSDGRS
DAQPGTDHEAHST
118472174YP_889286.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MTNAALAELVTELPEGTVVTDPDILASYRQDRAADPNAGMPLAVVRPHRT
EEVQAVMRWASANKVPVVPRGAGTGLSGGATAIDGGLVLSTEKMRDISVD
TVTRTAVVQPGLLNAEVKKAVAEHGLWYPPDPSSFEICSIGGNIATNAGG
LCCVKYGVTTDYVLGLQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGSEG
TLGVVTEVTLRLLPPQNSPCTVVATFDSVEAAANAVVTITGKIRPSMLEF
MDSVAINAVEDKLKMGLDRNAAAMMVAASDDRGAAGADDTEFMARVFSEA
GATEVFSTSDPDEGEAFVAARRFAIPAVEAKGSLLLEDVGVPLPALADLV
SGVEKIAAQREVMISVIAHAGDGNTHPLIVFDPADEAMTARAQLAFGEIM
ELAVGLGGTITGEHGVGRLKRPWLANQIGPDAMELNHRIKRALDPDNILN
PGAAI
118472173YP_887848.1 hypothetical protein MSMEG_3545 [Mycobacterium smegmatis str. MC2 155]MMIVKTTTTRFVAAALTVGALGFGATAFGTPVASAGPAAPVPLKPGDGGC
FPFCDGGPGKPGGPGGPGHGGPGGPGGPGHGGPGGPGGHEGPGGPGRHDG
PGPGGPGGPGRHDGPGGPGGPGWHDPGHGPDKGPWWANNRHDWWDDRQGP
PPWGWGPPPPVHWNGGPLPHTINYWGYNLNPVWHDGFRQWGVWLFGIWIP
IFGVGFN
118472172YP_887826.1 linalool 8-monooxygenase [Mycobacterium smegmatis str. MC2 155]MVMSDSALHLPAGFDFTDPDIYAERLPVDELAELRRVAPIWWNAQPIGAG
GFDDGGFWVVTKHKDVKEISLRSDVFSSLEKTALPRYPEGTVQDQIEQGR
FVLLNMDAPHHTHLRKIISRAFTPRAVERLRDDLAERARAIVRAAAEEGS
GDFVEQVACELPLQAIAGLMGVPQEDRRKLFDWSNQMVGNQDPEFVANDG
ASAAVELITYGMQLAAQRAAAPGDDLVTKLVQADVEGHKLSDDEFGFFVV
LLAVAGNETTRNSITQGMMAFTDHRDQWELFKRERPVTTADEIVRWATPV
TSFQRTALADTEVSGVRIKKGQRVVMFYRSANFDEDVFTDPYRFDILRDP
NPHVGFGGTGAHYCIGANLARMTIDLIFNAIADEMPDLTPISEPVRLRSG
WLNGIKHWQVDYRGDAAKHRAAQASSQADR
118472171YP_887226.1 oxidoreductase YeiQ [Mycobacterium smegmatis str. MC2 155]MNLLKLGSYGTAVPPRPDPNALTVGQVHLGLGAFHRAHQAIYTEDAMRHT
GETHWAIAAFTQRSGAAATRLRPQDGLYTVTERGAAASPPRVVGALREVG
DGSADPTAMVERICDPAVHVVTLTVTEKGYCLDPATGGLDFDHPRIADDL
HSGAPRTVPGVLAHAIARRARSGAGPLTVISCDNLPHNGRLLQQIVHEFS
DAAGLSVDDGATVTYPSTVVDRIVPATTDEDIAALSRSIGVRDQAPVMCE
PFRQWVIESRFAGPVPAWSAVGTQLVDDVAPWEQLKLRVLNAAHSTLAYL
GLRLGYRSIAEAVHDSVLADICRRLFADDVRPSLDAPAGLEVGDYGESVL
ARFANTALPHTTLQVASDGSQKIGPRLLRTVSARAGQGTPARWAALGIAG
WALHVVDPVDADGQPTALADPRADELTAMTAGLPVGAAVRRLVTEPSIVG
ADVAQRRDFADYVVGVAEDLHRHGADALRAQVR
118472170YP_885680.1 dihydroxy-acid dehydratase [Mycobacterium smegmatis str. MC2 155]MASSSIPLRSRTVTHGRNMAGARALLRAAGVAREDFGKPIVAVANSFTEF
VPGHTHLQPVGRIVSDAIRAAGGIPREFNTIAVDDGIAMGHSGMLYSLPS
RDLIADSVEYMVQAHKADALVCISNCDKITPGMLMAALRLNVPTVFVSGG
PMEGGRATLVDGRVRTGLHLIDSMSGAADPTTSDEDLARIEEAACPTCGS
CSGMFTANSMNCLVEALGLALPGNGSLLATHTARKALYQNAGRTVMELAE
RYYDQGDVSALPRAVASRAAFENAMAMDIAMGGSTNTVLHLLAAAHEADL
DFAITEIDEISRRIPCLCKVAPNGSYLMEDVHRAGGIPAILGELHRAGLL
AKDVHAIHAATLDDWLDAWDIRAADPSDAAVDLFHAAPGGRRSATAFSQS
ERWESLDLDAMAGCVRDVDHAYSPDGGLAILTGNLAPDGAVVKTAGVDEN
LLTFTGPAVVVESQEEAVDAILGDRITAGDVLVVRYEGPRGGPGMQEMLY
PTSFLKGRGLGKSCALITDGRFSGGSSGLSIGHVSPEAAAGGPIALIRDG
DRVTIDIPSRTVTLDVDGDELARRRDELLASGGYRPRDRVRPVSAALRAY
ALLATSADRGAVRDVDNVVSDR
118472169YP_889146.1 alkylhydroperoxidase [Mycobacterium smegmatis str. MC2 155]MSIDNIKSALPEYAKDLKLNLGSIANTTELTEQQLWGALVATAAATKNAR
LLREISEDALDILSEEAYNAALGAAAIMGMNNVFYRTKGQLDGKYDDLRA
GLRMNIIGNPGVAKEDFELWSLAVSAINGCGHCLAAHEKTLRDADVARTT
IFEAIRLASIVSGVAQALLTADTLAAV
118472168YP_887533.1 indole-3-glycerol-phosphate synthase [Mycobacterium smegmatis str. MC2MSSATVLDSIIEGVRADVAAREAVISLDEIKERAKAAPPPLNVMAALREP
GIGVIAEVKRASPSRGALASIGDPAELAQAYQDGGARVISVLTEQRRFNG
SLDDLDAVRAAVSIPVLRKDFIVRPYQIHEARAHGADMLLLIVAALDQPV
LESLLERTESLGMTALVEVHTEEEADRALKAGASVIGVNARDLKTLEVDR
TVFSRIAPGLPSNVIRVAESGVRGTADLLAYAGAGADAVLVGEGLVTSGD
PRSAVADLVTAGTHPSCPKPAR
118472167YP_887688.1 ArsR family transcriptional regulator [Mycobacterium smegmatis str. MCMVSTDSFAVLAEPARRDILDQLRLGESSVTELVARLRLSQPSVSKHLKVL
REAGFVSTTFAAQRRIYRLELTRLKVVDEWLNGYRAMWTHNLDAFEEHLN
TTSQRQEPARVHYRHH
118472166YP_889490.1 DevR family transcriptional regulator [Mycobacterium smegmatis str. MCMIRVFLVDDHEVVRRGLIDLLSADPELDVIGEADSVSQALARIPAAQPDV
AVLDVRLPDGNGIELCRDLLSHMPNLRCLMLTSFTSDEAMLDAILAGASG
YVVKDIKGMELAQAIKDVGAGKSLLDNRAATALMSKLRGDAERSDPLSGL
TQQERVLLDLLGEGLTNKQIAARMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFASKLDRRN
118472165YP_889081.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMVASPRNTEADRGQRRATFQRANSHTTKQMLVHAAMALWRTNGYANTTVA
EICRGAGVSKALFYFYFPRKEDVLFEVGVMSTRSAQRTIAKLLADDYDVM
TVVGAALTALERSMSSNPRELVIETILEGYRHEHRLLATGENRPDLDGGM
FTTLFARAVADGKLPAGTDTDRLAHLAMMMVSEGARHWAAGAFGARSFAD
VVASDIATLIAGSTGRRRP
118472164YP_888467.1 short chain dehydrogenase [Mycobacterium smegmatis str. MC2 155]MGSRTASLGGKVVFITGGGAGVGAEVSRRLYRKGAKLMLVDVDADALKAH
ADTLGEDVATAVADVRDLAAMKAAADAAVERFGGIDVVVANAGVASYGSV
QQVDPEAFKRLLDINVLGVFHTVRATLPSVIERRGYVLIVSSLAAYAASP
GLAPYNASKAAVEQFANALRLEVAHRGVDVGSAHMSWIDTAMVNDSKADL
STFGEMLSKLPPPLSSTTSVSACGEAFVKGIERRARRINCPGWVEAFRWL
KPILSTRLGELPVLRFVPDLLPRMDAEVAALGRSSSAHTESIEKR
118472163YP_886591.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMASPATGGGRPRRERGSITVDEILSGAFEVAREVSVDNLSMPQLAKHLDV
GVTSIYWYFRRKDDLLDAMTELALREYDFGVSSIDAGSWRESLRAHAHRM
RDTIQQNPILCDLILIRGTGGTPAARHALEKIEQPVAALVQAGLSPQQAV
QTYSAIQVLVRSSAVLHRLQNRASTVPLPRDHWQQVIDPQTMPLISSLTG
DGYRIGAADTANFDHILDSILERAEHLTASPRDSSPRADTILRENH
118472162YP_888148.1 hypothetical protein MSMEG_3857 [Mycobacterium smegmatis str. MC2 155]MTTPTAAATRRRNRPQPCRWCGREVPDAQMGRRRQYCRQSCRQRAYEQRA
MVKGTSLAPDSVVLTAEEAAQLSDRVYQVRCAAEDVAIAVDEGAEPHELR
QLCDALLEAAKAADGWR
118472161YP_891135.1 inner membrane protein translocase component YidC [Mycobacterium smegmMFNFFSLDIIYYPVSAIMWVWYKAFSFLLGPTNFFAWALSVMFLVFTLRA
ILYKPFVKQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQKEHGF
NPILGCLPMLAQVPVFLGLYHVLMSFNRTQTGIGRLGLSVEENRSLGNYV
FSATDVQHFLDANLFGAPLGATMIQQHGLEAFTEFNRLAVIIVGVPIMIL
AGIATHFNSRASVARQSVEAAANPQTAMMNKLALYVFPLGVVVGGPFLPL
AVIMYWLANNIWTYGQQHYVFGKIEKEEEAKKAEMLERRAANAPAPGAKP
NRMKKAQPGGQAGAEGEAGSATELTGESSGTSEPTTDSGATGASGTSGTT
PTNRTPKPGARPKKRKR
118472160YP_887879.1 alpha-amylase [Mycobacterium smegmatis str. MC2 155]MTMPDWVTHAIWWQIYPLGFVGAHPADPPPGPEEHRLRRIVEWLDHAVEL
GASGLALGPVFASRTHGYDTTDHLRIDPRLGDDADFDHVVAEAHRRGLRV
LLDGVFNHVGTDFARYRQALGGDADSAAWFRHRDGKFEVFEGHGELIALN
HDNPEVVNYTAGVMRHWLGRGADGWRLDAAYAVPDRFWAQVLPIVRSDFG
DAWFVGEVIHGDYAATVAASTFDSVTQYELWKAVWSALNDGNFHELDWAL
QRHNDFLASFVPMTFVGNHDVTRIASQLSDARHLEHALVILFTTGGIPSV
YAGDEWGHQGVKEERRGGDDAVRPEFGERPGPDAPGADVLRLHQYLIGLR
RRHPWLHSATTTPLLLTNTQYVYRSAGAAGALVVALNLDDAPLRVALPEL
GLASGVVVAGSKAPPQEQIEVTEVPPHGWLVIEPR
118472159YP_887769.1 fatty-acid--CoA ligase [Mycobacterium smegmatis str. MC2 155]MDSGSRTQYEAPTGLLRIEDCLDADGGIVLPPGTTLISLIERNIANVGDS
VAYRYLDYSHGELQVAELTWRQLGVRLRAVGAAVQQVAARGDRVAVLAPQ
GLDYVIGFFAAIKAGTIAVPLFAPELQGHAERLDTALSDARPTTVLTTAA
VEEAVTGFLDKLSGKQPHVVVIDEVPDSAGADFAPVPVDVDDVSHLQYTS
GSTRPPVGVEITHRAVGTNLLQMILSIDLLNRNTHGMSWLPLYHDMGLSM
IGFPAVYGGHSTLMSPTAFIRRPQRWIQALSDESRFGRVITAAPNFAYEW
TAQRGVPEHGDEIDLSNVVLIIGSEPVSPSAIADFNKAFAPYGLPATAFK
PSYGIAEATLFVATIAPAAQASVVYFDRDELAQGRAVPVAGDAVDAVAHV
SCGQVARSLQAVIVDPGTGEELGDGTVGEIWLHGNNIGRGYWNLPEQTRE
TFGATLRARLRDGTHSGNAPADARWLRTGDLGVYRDGELYVTGRIADLVV
IDGRSHYPHDIETTVADASPLVRRGHVTAFTVAAQDVPGASDGQTQDGLV
VIAERAVGTTRADPQPGIDAIRAAVAHRHGVTVADVRFVPAGAIPRTTSG
KLARRACRAQYLEGKLGAH
118472158YP_889535.1 hypothetical protein MSMEG_5289 [Mycobacterium smegmatis str. MC2 155]MRLVVVPGPTHQNRRCQQPFLLVRPNVSRRRAHMSSKLVDRHAARQTASP
ISLRAPRVHTPIPLPPCATI
118472157YP_890004.1 LytR/CpsA/Psr family protein [Mycobacterium smegmatis str. MC2 155]MNDPVDDDAEPTGNHADGVTVADLIAKVAGSDGATPRRSRRRRAAEPDPE
PEFEAQAEPAPKPTPEPEILPVAPEPPASADPTEVLQAIRYDEYPGDHAG
EYPGDHPDAAYAGAADPNLDAIFEPAFAPMPFAGVTAAHPDLDSCDTEII
PAVPAADEHADLPDTHRDSWRRRTRPQHAGTDDFDEPHRRHPNRKAMIVG
RAAAAMIAALTLVLTGGAWQWQSSKNDSLNKVAALDLGSRDILDPNAQFG
DENFLIVGMDSRFGENSQMGAGSTDDADGARSDTIMLVNIPASRERVVAV
SFPRDLAITPMKCEPWDPETGTYGPIWDEASGTYGPDEVYTETKLNSAFA
FGGPKCLVKVIQKISGLSVNRFMAVDFAGFSKMVDALGGVEVCSTTPLED
YELGTVLANAGRQIVDGHTALNYVRARQVTTEYNGDYGRIKRQQLFLSSL
LRSLISKDTFFSLSKLNNVVNMFIADSYVDNIKTKDLVDLGQSVQGVNAG
RITFVTIPTTGYADEWGNEQPRMDDVRALFDAIINDDPLPGEKNPDNTPV
PGTPESTTNTAQAPQSTSPAPQPAHAAPAPGSAEMVDTVTTEPQQVTVKV
SNSTGQSGLAATAAGELEQHGFNVTTPDDYPGPLDATTVFFSPGNEEAAA
TVASSFSNAAIERVAGLGDVVQVVLGTDFMAVNPPSPSGSAIQVKLVRGT
SSTPTQLPEDLSVTNAADATCE
118472156YP_891031.1 hypothetical protein MSMEG_6827 [Mycobacterium smegmatis str. MC2 155]MLLPESPDRSSEGSMGGEWLPEAAVNHTGLLDVGDAVEKRCGTYPK
118472155YP_890866.1 alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]MNAAIRPVISAIAMLTVAAGVAVVALLGDDARSVAAPAPGAKPTIVLVHG
AWADTSSWDGELTVLRGQGYDARAIANPLRNLTTDAASVASFLHTVDGPV
VLVGHSYGGAVITEAAAGNPDIKALVYVDAAAPDVGETNGSLSGADSVLK
KLPDHQLFDQVAGPVGETDLYLRRDIFVNHFAKDLPQDQATELWATQRTA
ATAAFDTPATQAAWKDIPSWYFISTGDEIITPTAEHAMAQRAHSAVTEFP
GGSHLTLVSHPDAVTDVILAAARSVR
118472154YP_886554.1 formyltetrahydrofolate deformylase [Mycobacterium smegmatis str. MC2 1MMAQEYPKANALPAQDVGRLLLRCADRPGLVAAISGFLTAAGANIVSLDQ
HSTEQAGGTFIQRTIFHLPGLTAVRDELERSFREQVAGPFEMDFTLTEAA
KPKRVALMASREDHCLLDLLWRNRRGELPMSVVMVIANHPDLAEQVRAFG
VPFIYVPATKENRAEAEQRLLELLRGNVDLVVLARYMQILTPEFLDAVGC
PLINIHHSFLPAFIGAAPYRRAKERGVKLVGATAHYVTEDLDEGPIIEQD
VVRVDHRHTVEDLVRLGADVERLVLSRAVLWHCEDRVIRFGNQTVVF
118472153YP_889291.1 acyltransferase [Mycobacterium smegmatis str. MC2 155]MTLSGSVQDPAQGGLESVGAPERVGSLTGIRALAALLVVLTHAAYTTGKY
PQGYLGLVWSRAEIGVPIFFVLSGFLLFRPWVKAAATGAPAPSVRRYAWH
RVRRIMPAYVVTVLIAYLVYHFRTAGPNPGHTWEGLFRNLTLTQIYADNY
LYSFLHQGLTQMWSLAVEAAFYVVLPLLAYVLLVLLCRRRWRPGLLMTGL
VVAAAVSPVWLVIVHHHGADLPDGARLWLPTYLAWFVAGMMLAVLGQLKV
RGYAMVCVPLALVCYFIASTPIAGEPTTSPAKLSEALFKTAFYAVIAALL
VAPPALGDRGWYTRFLASRPMVFLGEISYEIFLIHLIIMELVMVEILQSP
VYTGSMFNLFVLTMAFTIPASWLLHRFTRVRS
118472152YP_888351.1 hypothetical protein MSMEG_4066 [Mycobacterium smegmatis str. MC2 155]MEIDFRDDRIGGFNYEFFRTISSPVAEMGETLGVAYRIKDGDIESWLTNF
SDAAKRIHERAVAYAENGIAASASRAFMRASNFYRSSIFYAVESDPRREE
YWRISRDCFRRAMELRSAPVRTVGIPFGGAVLPGYFFSAGAENRPTLIAI
GGFDSTAEEVVAWIGLEAQNHGWNCLVFEGPGQWGALYDNPGLTMYPDYE
RPVSAAVDFACSFSEVDPERVALVGFSLGGYLAPRAFAFDSRIKACIANS
FLPSVLEPWTGLWPPSLAGLRGDAFDAAFAEASETNPGAAWTFDHGQWAL
GFDRPSGFLDIWRDYTLFDHVERFDRPFLSIFGESELAKFEHGSGIGKWA
NRMLDFFADTPSYCETYVFTDEEGGSTHCQMGGISQGAAVTMSWLENVLG
DGAARAEQNISEGNKIMHPELGRIMRSTFGDEIEDGLKRLAVKPSGRPMA
I
118472151YP_887057.1 recombinase A [Mycobacterium smegmatis str. MC2 155]MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLD
VALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHA
LDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAA
LVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREK
IGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVK
NKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQL
GQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF
118472150YP_888417.1 dTDP-glucose 4-6-dehydratase [Mycobacterium smegmatis str. MC2 155]MRIFFAGASGLIGRHVLPLLIDAGHTVGAMTRTADKAGHLEASGALPIVC
DVFDRPSLDHHVRAFAPDLLLHELTDLPDNLKDLPADSALNARIRDEGTR
NLIAATTELAKVKIVAQSVAWSMAPGKESAAVGVLEKSVLAVGGVVLRYG
LIYGPGTYFERQLPPTPRVHVDTAAVRTVEALDAPSGVLTIVDE
118472149YP_886709.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium smegmMTAATTAELVDFDDVVARYEPVMGMEVHVELSTATKMFCGCANRFGAEPN
TLVCPVCLGLPGALPVLNEAAVESAIRIGLALNCEITPWGRFARKNYFYP
DQPKNYQISQYDEPIAVDGYLDVPLEDGTTWRVEIERAHMEEDTGKLTHL
GSDTGRIAGATTSLADYNRAGVPLIEIVTKPIEGAGARAPEIARAYVTAL
RQLMRALDVSDVRMDQGSMRCDSNVSLKPKGAKEFGTRTETKNVNSLRSV
EVAVRYEMRRQAAVLDAGGTVTQETRHFHEDGYTSPGRSKETAQDYRYFP
EPDLEPVAPSPELVERLRTTIPELPWLARKRIQDDWGVSDEVMRDLVNAG
AVELVAATVDHGVSSEAARAWWGNFLVQKANEAGVELDELPISPAQVAAV
VKLVDEGKLSNKLARQVVEGVLAGEGEPEQVMTDRGLALVRDDSVIQAAV
DEALAANPDIVEKIRGGKVQAAGAIVGAVMKATKGSADAARVRELVLAAC
GQS
118472148YP_890082.1 hypothetical protein MSMEG_5855 [Mycobacterium smegmatis str. MC2 155]MTSRFARLTRDELATLVPELLLMGQMIDRSGMAWCISNFGREEMVQIAIE
EWAASSPIYTKRMQRALGYEGVDVITIFKGMQLDIGAPPQFMDFRYTVHD
RWHGEFHLDHCGALLDVEPMGDEYVRGMCHDIEDPTFDATALATNRRCRV
RPIHRPPRTPADRHPHCAWTVTIDESFPEVDFIPALDVIGRTRAAQLELD
PIDPDDEGHADYSGPLVSDLDFSAFSHSALVRIADEVCLQMHLLNLSFAL
AVGARAGADTALATEICTKQLIGVAGLGAERIHRALDLPGGIEGAVRVLE
LHPMFNPAAYVSAEFGPDTVSVQRSAAHEDRAWIALTGPAETRPLQAVVA
AVDPHLDVEVVGTDEHWSARIVETATAAKEFGEVAVAKISGGASFEFQPR
RSLPLTVV
118472147YP_886097.1 hypothetical protein MSMEG_1723 [Mycobacterium smegmatis str. MC2 155]MIASVDTIVTIALFVALIPAVGAAFMIGIHLMMLGDNISADRPRRIWGIY
AGVIGVPLSAVAIYLTAAVLAWKAHGLTFYYPLIGLAAGAAAVVGISALA
DKLARRR
118472146YP_884571.1 transcriptional regulator [Mycobacterium smegmatis str. MC2 155]MTETPTAISASWLAQAVVDASSEAIVVTDKAGDIVLWNDGAARMFGFTAA
DALGQSLDLIIPEKQRDRHWKGYHQTMATGVTKYGDSMLAVPATHKDGHR
LSIEFSVALLRDDTGEIVGISAIMREVSERRAAERALHARIAELQNELNE
VRAGLS
118472145YP_884947.1 intracellular protease PfpI family protein [Mycobacterium smegmatis stMTHALDGKKVAILATDGVERRELVEPREALEQAGARTELLSLQTGSIDAR
DHDLEPAGTYTVDRLVSEAKGDEFDALVVPGGTVNADKLRSDAKAVAFVH
DFVNSGRPVAVICHGPWTLIEAGVAKGRTLTSYASLRTDLRNAGATVLDE
EVVVDGNLITSRSPEDIPAFNKALIDALAQQPQAQAQQ
118472144YP_885650.1 hypothetical protein MSMEG_1259 [Mycobacterium smegmatis str. MC2 155]MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAPPILIG
DPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQM
DGVGTSIIGRPRPLSRHRRADDLYTLNCEEPVKPFVAP
118472143YP_888178.1 twin arginine translocase A [Mycobacterium smegmatis str. MC2 155]MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQAES
KGDEPKPATPIASERVDTTAPEQQSTDRHTA
118472142YP_887291.1 permease- cytosine/purines- uracil- thiamine- allantoin family proteinMSTRPIEPVAAGDDSPPEQSAAVPFDAHGIEPIAPTDRDCSPAELFWIWC
GANIAPINWVLGALGITLGLSLVETLIVVAVGNLLGCAVFGVFNVIGHRT
AVNQMVLGRAPFGRMGARIPGLVQFLLTMGWVGVNTWVVLDLVLAVFAEF
GVTGGLWLEVVVAAGIMVIQLALALYGFYAIRSFEKYTVPATAVVMAVMT
ALAFAATDVQWSLAGHAMTAGEKFTAVTQLLTAIGIGWGLTWIPYASDYS
RFVRVGASSRSVFWASSLGMYVPTVWLAAVGACLASAGTGSDPSALVVST
FGIMAVPVLLLLVHGPIATNILNLYSCSLAALSIGVRMTRWKVTLLAGAV
ASVVLAVFVQADSFAHAFDNWLVSILVWISPWAAIMLVDYVVLRRGALDV
TSLYREDSARWNHAGLVSLAVGIVAGWSWQYGLVPAMQGPIATSFGNTDF
SWLSGSLVAGGLYWVLRRRATGR
118472141YP_889222.1 oxidoreductase [Mycobacterium smegmatis str. MC2 155]MMGDFDLRGLTRPVIVAPMAGGPSTPALAAAGSNAGGLGFIAAGYLTADA
LAERIKATRELTSEPIGVNLFAPQPSAGTPEQIAAYAQALAGEAERYGVA
LGEPRYDDDAWAAKLDVVADLRPEVVSFTFGLPDDDEVKRLRQAGITTVA
TVTSYDEAEQADGRGVDALAVQGPNAGGHRGTFDPAAAPATQSLEELLDD
VVAAMDMPVIAAGGLVTADDVAGVLAAGAVAAQLGTAFLLAEEAGSSDVH
RAALQNPEFTETVVTRAFSGRYARGLRNRFVVDHEAQAPFGYPEVHYLTS
PVRKASVAAGDPHATNIWAGTGFRAIGPGTVAEIMGRLVP
118472140YP_889868.1 hypothetical protein MSMEG_5634 [Mycobacterium smegmatis str. MC2 155]MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTV
IESIVEVKGMLNRVRWTLVHYKPPQALTLNGDGRGGVKVKLIGKIKPTDN
GATVGFDLHLGGPALFGPIGMVVAAALKSDIQESLNRFKQLYAPSAT
118472139YP_886201.1 transcription factor WhiB [Mycobacterium smegmatis str. MC2 155]MSYESGDFDRVVRFDNRLLGSVSHAPHIDTGSTPTGAAGRPQLSLVPDSF
DVAPEAEEDQWQERALCAQTDPEAFFPEKGGSTREAKRICQGCEVRDACL
EYALAHDERFGIWGGLSERERRRLKRGII
118472138YP_889694.1 PE family protein [Mycobacterium smegmatis str. MC2 155]MGRLLHSLSTAFLVFVAVVVLCVSTSMPTAAHLLLNHPHALVIGGTGTPV
PPPEYVNGQTDNYIGAEFPGEYRYAVHTPQNFWPVYGSMSFDESTVAGLA
ALQAEMAKEGHFGSPLVILGYSSSTRILTADKNRRIADGDYAVDINYVLV
SDVAKGNGGVMARFPGWHIPILGVTFDGATRTDSDGYAFDTKSISFVHDG
WSDFPVYPLNVLALANAVAGIAVLHPTYPELDRPDLVPVGSTGDTEYFVI
GTDIMPLLMPLETIGVPRPILLAVDEPLRVLVEAGYRRDIAPGAPTPARL
IPIVNPITLTRNFIAAIPVGVDDAMEELGHGRPLGTQPSGVFGVGGEDTE
LKGLPAGVISLAKPTLPVSSHTTVVEKTERKDLAKPAAEPEPVVEDEPAV
EDETPVADTKKASPKPLRPKVRGPISFDAPKLPTIRKATGDRPLKRLLSA
LTPKRPKPASSHDAGPAAGNKDTDNADKPAARADDAA
118472137YP_887239.1 aldo/keto reductase [Mycobacterium smegmatis str. MC2 155]MTVAPLRTDRRRLGSGGPEVSAIGLGFMSFRAGSGPDDEKQAKDIVDAAI
DLGVTLFDTADIYGPEHSEVLLGKAIRGRRDSLVIATKFGNRLDRGTSTD
GRALDGRPEYVRSAIEGSLRRLGVDHVDLYYQHRVDPQVPIEDTVGALAE
LVQAGKVRHIGLSEPGPQTLRRAHAVHPVAAIQNEWSLFTRDIEDETVPI
ARELGIGIVPYSPLGRGWLTGRVQSRDNISGTHRDHPRFSDEAFDRNRAL
ADTVVTVAGELGVQPGQVALAWVLSRGQDVVPIPGTRHVGFLRENLCAVG
IELSDDHLRRLEGIAGQVAGHRSARPEHLGTEAPQADSGVQNR
118472136YP_887625.1 dihydrodipicolinate reductase N-terminus domain-containing protein [MyMKVTYMSDIRAVVYGVGAMNSIVAGMLLDKGVQIVGAIARSPQKVGQDLG
DLLGLGRQLGVAVSDDAAEVLEQTHPDIAVIAVNSYLTDAVEQLRICAEH
GVNAVTLSEEMLYPWETSPELSAELDALAKSTGATLTGTGYQDTFWVNMI
ALLMGTAHRIDTVRGKASWNVDDFGPELATAQQVGRTVAEFDEWVRGAQR
PPTFGRNVLDALVADTGLTVKSITTATRPDIASAAMRSEALGIDLAPGDV
IGFTDIDRIETEEGPVFEFEMSGRVYGPGEGDINEWTIEGEPNLFLSNGT
VPTQTTTCTQMVNRIPDVIAAPPGIVTVDRLPRLRYRPQF
118472135YP_887741.1 esterase [Mycobacterium smegmatis str. MC2 155]MVRTHTVAAGETLSGLALRFYGEADLYPLIATASGIPDPGVIAVGQRLIF
PDFVRHTVVPGETLSDVAARFYADAALAPLIAAASGIAPTTDAEAGQRLV
IPDITRYPVVAGDTLSALATRFYGDSAFYPLIAAVNGIPNPNVIEVGRVL
LIFAGRSDGFGLRIVDRNESDPRLWYYRFQTAAVGWNPGINVLLPDDYRT
SGKTYPVLYLLHGGGDQDFRTFDFLGIRNWTAGKPIIVVMPDGGHAGWYS
NPVASFVGPRNWETFHIAQLLPWVEANFRTYAEYDGRAVAGFSMGGFGAL
KYAAKYYGHFASVSSHSGPASLRRDFGLVVHWANLTSAVLDLGGGTVYGA
PLWDQARVSADNPVERIESYRNKRVFLVAGTSPDPLNWFDSVNETQVLAG
QREFRERLRAAGIPHEAHEVPGGHIFRPEMFIRDLDGIIARLRPAAAVEV
118472134YP_890391.1 hypothetical protein MSMEG_6171 [Mycobacterium smegmatis str. MC2 155]MPSSRKAWLSAAAVLLDASAARRCADRGLPRRDRVLVIGCDEPGPADWQA
AIAVGAQHVVTLPRQDTDLVAALSVVDEGGGHRGPVVAVVAAKGGAGASV
FAAALALSAPGALLVDADPWSGGIDLVLGSEDQPGLRWADLALQGGRLGY
GALRDALPRRGEISVLSGGRAGVDITAAALHAVIDAGCRGATLVVCDVPR
RSTDAAEAALEAADLVVVVARADVRSCAAAAAAGSWIATCNPNIGVVVRG
PAPGGLRAAEVADIVDLPLLASMRPQPGLDEALERGGLRLTRRSPLATAA
RRVLGVLAQHPVREAA
118472133YP_889066.1 hypothetical protein MSMEG_4810 [Mycobacterium smegmatis str. MC2 155]MTATGSTVGGPTLKRGEKTIEINGGNVVYEMLGKEGDVIALTPGGRFSKD
IPGLRPLARELVKGGYRVLLWDRPNCGRSDVQFHGQSESHMRAETLYTLI
SKLGVGPCIIAGGSGGARDSMITAMLYPEIVTKLVVWNIVGGVYGSFVLG
GHYITPSILAVRGLGIEGLLHVPEWRERIEQNPANRQRFLDLDADEFLKV
MLRWLNAFVSKPGQTIPGVPDEMFDNITVPTLIIRGGENDWDHPKRTSLE
VNCLIKGSTLIDPPWPEDAWERAGEKFARSGGKKFCLFDTWVQAAPAILE
FLK
118472132YP_890249.1 acetoacetyl-CoA synthetase [Mycobacterium smegmatis str. MC2 155]MTAPQWEPTQSDIDSARVTDFARYVESRTGVSAPDYQALWRWSVEDPGAF
WAAVWDYFDLGERPDQVLTTGEMPGSRWFPGAKLNYVDQVKRNARTDRPA
ILYVAEGGAVTDISWKELLGRTAAFADALVSLGVKPGDRVAGYLPNIPEA
IIAFLATASIGAIWSGCGQDYTAKAALDRLGQLEPTVLVTADGYHFAGKT
HDKADDIAALRDGLPTLKASVLVSRIGEARPDWLDWAQLSAPGPRELTTT
AVDFDHPLWVLYSSGTTGLPKGIMHGHGGVLIEHLKAVALQNNIGPADTF
FWYTSPSWMMWNFQVAGLLVGATIVCYDGSPTYPKADALWDVSAKIGVTV
LGTSPGYVLACSKAGAVPRKEHDLSALKVVGITGSSLPPSSALWLRDNVG
ERVQVSSISGGTDVVSAFIGGAPTVPVWPGELSAPYLGAAIDAWDENGKS
VRGEVGELVITKPLPSMPIAFWNDPDGSRYRAAYFEMFPGVWRHGDWITL
TEHGSVVVHGRSDSTLNRHGIRMGSADIYQAVERIPEIVEALVIGAEQPD
GGYWMPLFVVLADGVELTDELRDRIKSTIRTEVSPRHVPDEIIAAPGVPH
TRTGKKLEVPIKKLFQGADPAKVVDRSAVDNPDLLQWFVTQRRR
118472131YP_890547.1 hypothetical protein MSMEG_6329 [Mycobacterium smegmatis str. MC2 155]MESVRVQLQGKRIKAYGRIVAAATESHPAFSASYDLVTDETGATKRLSLT
VTLAERERQLSIARDEESQWLVQDHSQTKKSDFGGALDVDVIFSPFFNAL
PIRRVGLHTRTDSVSLPVAYVRLPELSVETVNISYSSGADGIKLHSPVAE
TTITVDSEGFILDYPGLAERI
118472130YP_889614.1 ectoine/hydroxyectoine ABC transporter ATP-binding protein [MycobacterMVRFENVVKRFGDKTVLDGMNFSVAPGERVTLIGPSGSGKTTILRLLMTL
ERVTDGVIWVDGEPFTHERRGGRLVPASEKYLRRARRRIGMVFQQFNLFP
NMTVIENLMEAPVSVLGLSKEQARARGTELLDKVGMTDFVDAHPTTLSGG
QQQRVAIARALAMEPDILLLDEVTSALDPELVVDVLGVLRDIADTTDITM
LIVTHEMHFARDVSDRVLMFDKGVIIEDGPPSKIFNEPEHERTRTFLRAV
LEER
118472129YP_889839.1 cytochrome bd ubiquinol oxidase subunit I [Mycobacterium smegmatis strMVFTETLLLLAADGEPPGLLPARQQMAFSLGWHIVLACFGVAFPTMIFVV
HRRGIVRDDAVALGLAQRWAKVSAVLFAIGAVSGTVLSFEMGLLWPGLMG
RFGDVLGLPFAFEGLSFFVEAIFLGIYLYGWGRMPPRRHLLTLIPMGLAG
IVGTFCVVSVNAWMNNPAGFRIVNGEVVDIDPWRAMFNSGVWLQFAHMWV
AAFMLVGLVVSGVYAFGMLRGRVDTHHRLGFAVPFTFASVAAVAQPLIGH
VLGMRIHDTQPAKLAAFELAQTTEGPAPLRLGGVLIDGEVHWALTIPRLG
SIIARNSLDAPVPGLDGVPRSDWPPVNITHLAFQSMVGIGTLLAAVAVVY
WLARWRGRDLLANRWFLRLSVITGPLAVLAVESGWVATEVGRQPWTVWKV
LTTTEAASQSSGLWWSYVIVLVVYLGMTIGAVVVLRSMARRWRAGETDLP
SPYGPPRTEARS
118472128YP_890356.1 hypothetical protein MSMEG_6135 [Mycobacterium smegmatis str. MC2 155]MADADSWSELTDGAQDAAPTVRISASDLAQARRKRTRIKAEDDTVAVILD
VTVAVANDFRSARRLEVAADVPAGDAVVRYVGTADGLAGLIEDIASAGVA
DGVTLIPAGDQNLHALGADVLHRLELRGQARRAS
118472127YP_884901.1 ABC transporter ATP-binding protein [Mycobacterium smegmatis str. MC2 MEVVGIDKEYPAATGPIQILRGLSLRADRGEFVSIVGPSGCGKSTLFNII
TGLVPPTAGSVLVNGEDVTGSTSRHIGYVLQKDLLFPWRTVLENVVLGLE
VRGVRKKDARTRARSLFATYKLEGYEDKYPSDLSGGMKQRAALMRTMVTD
PDIILMDEAYKALDYPLKIALESELLETARTTGKTVVAVTHDIEEAVTMS
DRVYVLKARPGEVVSEFPIDLGTTSTDINERRLAPRFNEFYEKIWRGIGQ
KPGAA
118472126YP_888423.1 hypothetical protein MSMEG_4143 [Mycobacterium smegmatis str. MC2 155]MSAYVISDIEIVDPAAFEEYKTLSPPSVAKYGGRFLARGGDLEILEGDWV
PQRLAILEFPDVDAARAWLESVEYAPAREVRQGAAKTGLVLVSGVPG
118472125YP_886560.1 3-ketoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MLTGQTAVVTGGAQGLGLAIAKRFISEGARVVLGDLNSEATEAAVEELGG
SEVAAAVRCDVTSSADVDALVQAAVERFGGLDIMVNNAGITRDATLRKMT
EEQFDQVIAVHLKGTWNGTKAAAAIMRENKRGAIVNMSSISGKVGLIGQT
NYSAAKAGIVGMTKAAAKELAYLGVRVNAIQPGLIRSAMTEAMPQRIWDE
KLAEIPMGRAGEPDEVAKVALFLASDLSSYMTGTVLEVTGGRHV
118472124YP_884710.1 oxidoreductase- FAD-binding [Mycobacterium smegmatis str. MC2 155]MAAMETSTAPLDEPAGLTDADGFTPLRVKDVIRETTDAVSLILDVPELIE
DRFRYTAGQFVTVKTTIRGEEHRRCYSMSSSPHVGPDLRITVKRDRDGVV
SNWINDTAAAGDRLLTAPPDGRFVLTTADRDVVTFAGGSGVTPVFSLVNT
TLATTGRRVRMFYANRDADSVIFRDALTRLTDSHSDRLHVHHHLDTRDGV
VSARHITEFLGASTVSTAEADFYICGPAPFMDTVERVLLDAGVPAQRVHL
ERFTVTPADPAVEAESAATEEVTIVLGRTTVTQPYRAGTTLLQTARLAGL
KAPSSCEVGTCGTCIGQVVEGSARLLNNDALDDDEIAEGWVVTCQALPTS
HTVKVVYE
118472123YP_884514.1 methyltransferase [Mycobacterium smegmatis str. MC2 155]MDTALRRAMDLLIDPPAEPDFSKGYLDLLGRGDSTAPKNTGLIQKAWASP
LGSKLYDRAQLLNRRLVASTRPPVEWLRIPPGGTVLDIGCGPGNITAQLA
RAAGLDGLALGVDISEPMLARAVAAEAGRQVGFVRADAQQLPFRDEVFDA
ATSLAVFQLIPDPVAAVSEIVRVLKPGGRVAIMVPTAGAVKPVTFLARGG
ARIFGDDELGDIFENVGLVGVRVKTHGFIQWVRGTKL
118472122YP_890261.1 2-hydroxy-6-ketonona-2-4-dienedioic acid hydrolase [Mycobacterium smegMVTATQEITFESTSRFADVQAGELAMRLHYHEAGDPSAQTIVLLHGGGPG
AASWSNFGRNIAVLAEHFHVLAVDQPGYGLSDKHTEHEQYNRYSAKAVRG
LLDHLGVEGRVPLLGNSLGGGTAVRFALDYPDRAGKLVLMGPGGLSVNLF
APDPTEGVKALAKFNVEPTRENLEAFLRIMVFDQKLITPELVEERFAIAS
TPESLAATRAMGKSFAGADFELGMMWREVYKLRQPVLLIWGREDRVNPLD
GALVAVKQIPRVQLHVFGQCGHWAQVEKFDEFNKLTIDFLGG
118472121YP_886855.1 peptidase M23B [Mycobacterium smegmatis str. MC2 155]MKWKVMRIMAAVVCAGLFWAVPADAETVRFRWPLDPRPAVTRAFDAPSPN
WQRGHRGVDLAAGAHQPVYAAGPGTVVFAGELAGRPVVSIAHPGGLRTTY
EPVRAHVRVGRTVAAGQSIGTLDEGHSGCPVAACLHWGAMWGPASRADYV
DPLGLLAAVRLKPLQTGLQSAR
118472120YP_885498.1 O-succinylbenzoate synthase [Mycobacterium smegmatis str. MC2 155]MTNGVPALDDILERLHVVALPMRVRFRGITVRELALIDGPAGWGEFGAFV
EYEPPEAAAWLSSALEAAYRPAPAALRDRVPINATVPAVSAERVPEVLAR
FPGARTAKVKVAEPGQSLADDVARVNAVRESVPVVRVDANGGWSVDDAVE
AAAALTADGELEYLEQPCATVEELAALRARVDVPIAADESIRKAEDPLRV
VRAHAADIAVLKVAPLGGVARMLDIAAQIDIPIVVSSALDSSVGIGRGLL
AAAALPELRHACGLGTGGLFVDDVAEPRVPVDGCLAVEPAVPDPARLAAL
AAPEPRRQWWIDRVCACHALI
118472119YP_889738.1 hypothetical protein MSMEG_5500 [Mycobacterium smegmatis str. MC2 155]MCQQCLRGCRTDTGGERGGGCDDGSGDRGSLCLLETVRGWLCHEALRLCV
118472118YP_888284.1 MmsAB operon regulatory protein [Mycobacterium smegmatis str. MC2 155]MDESTAAWIADGFVGQRMLAVPRPVVDHALGAPVTRRLLVTDAGFFPRAT
RHGRSRSRGATEHVVMVCTAGAGWCRTEEGAFDVGVGDAVLLPKGRAHMY
GAAESDPWTLWWMHVTGSDSAELIAAARVSPVSPVVHLVDPAPATSLISQ
VIDMLADASTTAGLIGAAGAAWHALTVIAATGRQRSTGEADPVDRALEHL
RSTSPRRTDVAALAAIVGLSTSHLNALFRQRTGIGPLEFQQQLRMSRARE
LLDTTTLTIAAVARAAGFNDPLYFSRQFAKVHGQSPSAYRQRHQN
118472117YP_886469.1 chorismate mutase [Mycobacterium smegmatis str. MC2 155]MLASVALAALAGVGTPHATADDASPLVPLVDAAAQRLQTADPVAASKFRS
GGAIDDPDREQQVIAAVTGDATRHNIDPGYVHDVFRNQIDATSSVEHTRF
AQWKLDPAAAPSSAPDLSESRQKIDTLNRTMVDEIARQWPVLHSPVCRPD
LDRALDAVATARGFDPVYRHALEYATHSYCR
118472116YP_889011.1 antioxidant- AhpC/TSA family protein [Mycobacterium smegmatis str. MC2MPPTPRLQAGDTAPAFSLPDADGNTVSLSDYRGRKVIVYFYPAASTPGCT
KQACDFRDNLAELNDAGLDVVGISPDKPEKLAKFRDKEGLTFPLLSDPDR
SVLTAWGAYGEKTMYGKTVQGVIRSTFLVDEDGKIAVAQYNVRATGHVAK
LRRDLSV
118472115YP_888051.1 hypothetical protein MSMEG_3754 [Mycobacterium smegmatis str. MC2 155]MILFSAGPFSVSNSVRNPVRKMAEKACDYGWSGTGQYPFGDSAGRKAHVV
GDSQGGEERRPRRAASNRASNNQRGNRSFDPRSRDRRPPRSSGPGRARPA
QPESAEDSQDSAPRLSADIEARQLAPEVRRELVTLDKATADYVARHLVAA
GNLLDEDPETALAHARAARGRAARIAAVREAVGIAAYHCGDWAQALAELR
AARRMGSKSPLLPMIADCERGVGRPERAVELARSPEAEALTGEDADELRI
VVAGARADLGQFEQALTLLSTPPLDPTSRGQTAARLFYVYADLLLAVERT
DEALQWFIHAAEADVEGVTDAEERITELS
118472114YP_886798.1 hypothetical protein MSMEG_2458 [Mycobacterium smegmatis str. MC2 155]MSWFPKVLAVAGTAAALVLGSTACADESAGPTSDTSTLSISATGVDSLPF
MAILQVGIDKGWFKEEGLDVDLYSGGGGGNTLRVVTSGDADMAIAGNTSV
ILAAQQPNSNLKVIAPWFQINDFSWISPPGRQLEGATLGFSSAGSSTELI
VKGLERELGVKSQAVGPMGDNWTAAKAGQITAGWAMQPFIADKQATENAE
VLVDSREVIGDMPADLVAINTEYAEQNPDNVRKFFTVADRLNKWLVDNTD
EAADAIAPLVGVSPEIMKSAFESNPDLAKGYSLKVDAEGLRNLSELMVAA
GQIPEPIDWASTLDQQYLPDDARAEL
118472113YP_888952.1 HNH nuclease [Mycobacterium smegmatis str. MC2 155]MAVSRTRSARYARRRKRRLDAVVNDLTPAQWEAIKQAWGGCAYCGATGGP
FQKDCVMAISRGGRYTVDNVVPACGSCNASKCNDEVTGWLRRKRLDERRF
LTRYVEIRARLTAQFA
118472112YP_890340.1 hypothetical protein MSMEG_6119 [Mycobacterium smegmatis str. MC2 155]MTVAGYAVVAAAILLASCMQASIGFGMGMLAAPVVAIVDPALIPGTLIML
ATAVTLLVVIRERESIDLSGTGWALLGRVPGTVLGALLLMALPEKALAFA
LAAVVLTGVAVTSLGWMPAPHRRNLVLAGATSGVLGTATAIGGPPMALVW
QNSTGARLRGTMSGFFLVGSVLSLAVLAATGAIDRHTLVMFALLIPAVAV
GYALSRWVNRHLDRNRQRRAAIAISTLGAVILIVRQLMGG
118472111YP_885084.1 cytochrome P450 [Mycobacterium smegmatis str. MC2 155]MTPPEGLGLALFRPECIQDPYPLYRRMLDTAPVHPIADSGFYAVCGWDAV
NDAIARPENFSSNLTATMTYQADGTVGAFEMESLGGKSHVLATADEPAHT
AHRKALLPQLAARRIRAFEPFILETANSLWHSHLHDGHIEWMSAVANRLP
MMIVGRLIGVPDADVDKLVRWGYSATQVVEGLVGQDQLTQATVAVMELAG
YITDQFRHAAQDPQDNLLGDLATACATGEMDELTAQSMMIILFSAGGEST
ASLIGSAAWILASRPDIQEHLRAKPELLGAFVEEVLRYEPPFRGHYRHVV
HDTTLGGVDLPAGSRLLLLWGAANRDPSHFDAPDEFRLDRSSAKSHLSFG
KGTHFCVGAALARLEALVVLRHLLHNTANITAGDTGPWLPSLLVRRLAHL
ELVTT
118472110YP_887593.1 hypothetical protein MSMEG_3282 [Mycobacterium smegmatis str. MC2 155]MIDGGGGVWPGQRGPPQVQPEWLWVNLRGFSRRSQAIPQRFNIFTMDSFV
LQRYKHANPL
118472109YP_886901.1 oxidoreductase- zinc-binding dehydrogenase [Mycobacterium smegmatis stMWSYRLVAPYVFERSDLRAPSPDALTDGQVLLSFSAAGICGSDIPGFRGT
QGKLPGDTGASAAQMPGFPIHEIAGEVLASRHPDHRVGDHVVGWASGFDG
LMEQVIADGDGLVSYDPALPPRLAVGLQPLACVLCAVEQLPDLDGRHVAV
IGQGSIGLLFSYVAKALGAARVTGVDPLDRSAIAARFGIDTPVRATSDRW
VTHLDPDDRADVVIEAVGHQVATLNHALTAAAFGGTVFYFGVPDDDSYPI
SMRTMLRNNLTLKSGVTTDRQRVLRRADTFAREHPHLLPGYVTHTFGVDD
VQAAFELACRPVPDRVKIVVAR
118472108YP_886931.1 asparagine synthase [Mycobacterium smegmatis str. MC2 155]MCGATGEVRLDGRTPDIGAVSAMAETMSSRGPDAAGVWSQGRVALGHRRL
KIIDLTEAGAQPMIDPELGLAVCWNGCIYNYKELRAELSGHGYRFFSHSD
TEVLIKAYHHWGDRFVEHLKGMFAFAIAERDTGRVLLGRDRLGIKPLYLS
ETGDRIRFASSLPALLAGGGVDTGIDSVALHHYLTFHSVVPPPRTILRGV
KKVPPASIVAIEPDGTQRTTVYWSPDFSRRAERADWSERDWEDAVLQSLR
EAVERRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLKTFSIGFESVNG
VAGDEFKYSDIVAQHFGTDHHQIRIDTARMLPALDGAIAAMSEPMVSHDC
VAFYLLSQEVAKHVKVVQSGQGADEVFAGYHWYPPMAEPAAASLDGAVNS
YRGAFFDRDSAGVASLISDAYRVDGDPSGVFVTDHFGAPGAETGVDRALR
LDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPELKTAH
GGKGVLKEAARRVIPAAVIDRPKGYFPVPALTHLEGPYLNMVRDALYAPE
AKERGLFRPEAVERLLADPNGRLTPLRGNELWQIGLLELWLQRHGITGSA
A
118472107YP_885522.1 hypothetical protein MSMEG_1128 [Mycobacterium smegmatis str. MC2 155]MADKSGKTLRKPSLSLKERRAIKRAKAEESTPIIRKRKG
118472106YP_888794.1 binding-protein-dependent transporters inner membrane component [MycobMTIAGTRNGPTTAGEVSWQRRCAPPITAILIAIALWWSATSVLSGPESVL
RQTAPQHVVPALSGLLERQVLLGDLGVSLWRLSIGLAVATVIGMPLGLLI
GSSRIAERAGGPIIAFLRMISPLSWTPIALAVFGIGNQPVVFLVAVAAVW
PVLLNTAAGVRAVDPGLLNVARSFHATRWEMMLAVILPAIRTHVQTGIRL
ALGVAWIVLVPAEMLGVRSGLGYQILNARDQLAYDQVVAVIVVIGILGFL
LDTTARWLLNPARRA
118472105YP_888471.1 hypothetical protein MSMEG_4192 [Mycobacterium smegmatis str. MC2 155]MARAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDKRVISVVLEKQQVAVL
AERIDALLLEVNRRFGTPIPPDTGEIQDLRPLITPVDAEFRVGTMGLGWD
SEAQTIVVELLAVSDGEFDASVVLDDAEDGPDAVRVFLTPESAREFAARS
NRVISAGRPPCPLCEEPLDPDGHICVRTNGYLRGAAAEAEDDFGG
118472104YP_889273.1 flavin-containing monooxygenase FMO [Mycobacterium smegmatis str. MC2 MTQTTAAPLATLSPQERVDAWLADFESALAARDIERVVSKFAVDSFWRDL
VAFTWNIKTVEGHEGIADMLSARLADTDPSGFKTTEPPTEDVDGNTVITS
AFIEFETATGRGNGHLRLRSDDTGDRAWTLLTTLQELKGHEEPKGPKRVL
GAVHGSDPDRRSWAEKRLDEQLTLGYSEQPYIVVIGGGQGGIALGARLRQ
LGVPAIVVDKHERPGDQWRKRYKSLCLHDPVWYDHLPYLPFPPNWPVFAP
KDKIGDWLEFYTKVMEVPYWSSTTCLSASFDENEKRWTVEVDRNGEKVTL
RPTQLVLATGMSGKPNIPTLPGQDIFRGDQHHSSQHPGPDRYVGKRAVVI
GSNNSAHDICKALVENDVDVTMVQRSSTHIVKSDSLMDLGLGDLYSERAV
AAGMTTEKADLTFASLPYRIMADFQKPIYDAIRERDKEFYARLEAAGFEL
DFGDDDSGLFMKYLRRGSGYYIDVGASDLIADGTIKLAHGQVERLTEDSV
ILADGTELPADVVVYATGFGSMNGWAADLIGQDVADKVGKVWGLGSGTTK
DPGPWEGEQRNMWKPTQQENLWFHGGNLHQSRHYSLYLALQLKARYEGMD
TPVYGLQEVHHLS
118472103YP_889835.1 hypothetical protein MSMEG_5601 [Mycobacterium smegmatis str. MC2 155]MNAVSADPVLNFEVYVLMTMRNRMTNKKDQLRATLSSHGFSVKDAERVHR
QLAESLGDEASRYSVLKESLGARADTARSFGFSSILWPNFDFEAEANDAG
LLESARYRHVRNRSDLPNSPRELALWSVDATEFIGHFGPMTGGEQWPLFH
ELLPAYEEYEFQWDGRRYGAGFSWGLFMYAAEYWD
118472102YP_886502.1 hypothetical protein MSMEG_2145 [Mycobacterium smegmatis str. MC2 155]MWCRYPDQIESDLKIHCHGTDIRWWHRGDRDERGCLKLSSRLLLNLIRGL
PEDSEFKTHAAEPFGRGGDWSILKKMTAALHNEVAAYRASKYAGTPHEYE
YDVFISPSEARERAEEEAAEEEFHDREFGKLLSIFN
118472101YP_886882.1 ribosomal RNA large subunit methyltransferase N [Mycobacterium smegmatMKQQLVFEAPRRAMPPQHLADLDETARAAAVTELGLPAFRAKQLANQYYG
RLIADPQQMTDLPAAVRDQVAEKLFPTLINPVREIQCDAGETRKTLWRAI
DGSTFESVLMRYPQRNTVCISSQAGCGMACPFCATGQGGLQRNLTTAEIL
EQVRAASSTMRAEHFGRTAGTAGGGRLSNIVFMGMGEPLANYNRVLGAVR
RIIAAPPNGFGISARSVTVSTVGLAPAIRKLADERLGVTLALSLHAPDDE
LRDTLVPVNNRWKVSEVLDAARYYADTTGRRVSIEYALIRDVNDQPWRAD
LLGKKLHGALGPLAHVNVIPLNPTPGSEWDASPKPAEREFVKRVRERGVS
CTVRDTRGREIAAACGQLAAEG
118472100YP_887062.1 glutamate transport ATP-binding protein GluA [Mycobacterium smegmatis MGSPGEQPQVDGAAQSDVPMISLQGVNKHFGQLHVLKDINLDVGKGQVVV
VLGPSGSGKSTLCRTINRLETIDSGTIMVDGKVLPAEGRRLAQLRSDVGM
VFQSFNLFAHKTILENVTLAPMKVRRFAKDKARENALALLERVGVANQAD
KYPAQLSGGQQQRVAIARSLAMNPKVMLFDEPTSALDPEMINEVLAVMSS
LASEGMTMVVVTHEMGFARRASDRVVFMSDGAIVEDSSPAEFFDNPKSER
AKDFLGKILHH
118472099YP_885291.1 hypothetical protein MSMEG_0888 [Mycobacterium smegmatis str. MC2 155]MTRWWPPVGLAAMVLLGGAVRHGTTPIDAWFGHLGRELGRPLRRAFLYFT
EPWLVAGVLLAVIAVALYRGQRWFALAAAISPPVAVLLAQAFKRIFGRYR
GDALAYPSGHTAFLVATLCLLVVAAGFALWAVAAAALLGLLGMFGQAIMH
HYFTDTVGAALLATSVVGVAVIVLDRCQPRCDVGHKP
118472098YP_888651.1 3-oxoacyl-ACP reductase [Mycobacterium smegmatis str. MC2 155]MSTLTDKPVVVITGAGSGIGAAIAALLRERGWAVASISREPAPDNDLWLI
ADVADEREVTDAVVTVRDTLGRIDAAVVCAGHYQETPALDIDQPSWERML
RVHVGGLAHVCRAVLPDMREQGRGRIVGIASERAIGGGSNDAHYAAAKAA
ALSLLRSIAVEVAPDGIIVNAVAPGPCDTPLLPPDSWERAEEFVQTLPAG
RIALPTEVAEMVRALLEEDMNLCGEVLSVNSGTVI
118472097YP_887683.1 hypothetical protein MSMEG_3377 [Mycobacterium smegmatis str. MC2 155]MPKHRMPATSGAQKPVKKILAGVLVMTGIGGAGLLSTPTNREAAVAVEQQ
PALEAAVAPVVAPAPAPVAAPAPVAAVTKDSDAQAVVRAIVAQGQAAGLN
EDQIKTIIATAKIESGFRPAVSGGVQAYGSRGTRADEVIGLFQEKASFGT
VEERQDPNKAIARFIVRFNDAFRKYGTSDNVLAATLAQNPQLRKYRSGGV
GTHYYNTVRAAMGAAADLYNQATAATL
118472096YP_887989.1 hypothetical protein MSMEG_3686 [Mycobacterium smegmatis str. MC2 155]MIRELLVATAVAGAALATASAAAADDDSNMYFDEPGRYSTDVPGMSYEAH
MGAPCFSWDRNVFGRGPGGVAMQCKWIPNQWPPVSTGFWTYSYPLHGVQD
IGAPCPGPQAAAQSPDGRPMLCLGERGWQPGVFTGDGFFPV
118472095YP_891042.1 haloalkane dehalogenase [Mycobacterium smegmatis str. MC2 155]MPGSEPYGRLQYREINGKRMAYIDEARGDAIVFQHGNPSSSYLWRNVLPH
TEGLGRLVACDLIGMGASDKLDGSGPDSYHYHENRDYLFALWDALDLGDR
VTLVLHDWGGALGFDWANRHRDRVAGIVHMETVSVPMEWDDFPDEVAQMF
RGLRSPQGEEMVLENNAFIEGVLPSIVMRTLSEEEMIHYRRPFLNAGEDR
RPTLSWPRDVPLAGEPAEVVAVIEDFGEWLATSDIPKLFIRADPGVIQGK
QRILDIVRSWPNQTEITVPGTHFLQEDSADQIGEAIASFVREIRAGDNLH
REAAPEMNSAS
118472094YP_886659.1 hypothetical protein MSMEG_2311 [Mycobacterium smegmatis str. MC2 155]MIAAVATMMAVGCRGIGNAEKPDRTGRQQRNADVVRDAFARGVGDQNSFY
SILTDDVEWTVARAGWETTYSGREEFLRDGAGPILARLDGPIQADVRDLV
TEGDKLVAFWRGTATARDGQPYVNDYVWAMTLRDERVARVTAYLDFVVLD
ELLTRVTPADGATAHSAAARG
118472093YP_889921.1 MarR family transcriptional regulator [Mycobacterium smegmatis str. MCMKHLDARVASDLALAVIRFARQLRSQRSDSKVTLTQLSALSTLAKEGSMT
PGALAVRERVRPPSMTRVLTSLAEQGLVVRTAHPADGRQVMVSASAEGVE
LVEAEQRASQEWLLTQLGKLDPDQRQTLIAAADLMSAMVDEKV
118472092YP_885408.1 transporter [Mycobacterium smegmatis str. MC2 155]MTVWDVVLLVFAGIAGGLTGSIAGLASVATYPALLVVGLPPVAANVTNTV
AVVFNGVGSIAGSRPELAGQGAWLKRIIPVAALGGVAGAALLLSTPAEGF
EKIVPFLLGFASVAILLPRREHRSARVANHRDHLIRTGVEAAAIFLITIY
GGYFGAAAGVLLLALMLRAGGATLPHANAGKNVILGVANLVASAIFVVFA
PVYWPAVVPLGIGCLIGSRLGPIIVRHAPSTPLRWLIGVAGIALAIKLAL
DTY
118472091YP_884773.1 hypothetical protein MSMEG_0360 [Mycobacterium smegmatis str. MC2 155]MNRFVVPSAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPASSVLNR
VEYGDRS
118472090YP_890540.1 bifunctional wax ester synthase/acyl-CoA diacylglycerol acyltransferasMNRMQLMSPTDSMFLIAESREHPMHVGGLALYDPPDDAGPEFVRELYEEM
VRHTDFQPVFRKHPATLLGGIANVGWTLDDEVDLDYHLRRSALPSPGRPR
ELLELTSRVHGTLLDRHRPLWEAYLIEGMADGRFAVYTKVHHSLIDGVSA
MKLVERTLSEDPSDTTVRVPWNLPRRESSRRAGSSSLARTATGAATSLAA
LAPSTIRLARAALLEQQLTLPFGAPRTMFNVKIGGARRVAAQSWPLERLR
RIKAVTGATINDIVLAMCAGALRAYLAEQDALPDRPLIAMVPVSMRSEHE
ADAGGNMVGSILCSLGTDVEDPADRLAVIRRSITDNKRVFSELPRLQALA
LSALLIAPLGLTTAFPGFVDATAPPFNLVISNVPGPKKPLYWRGARLAGN
YPLSIALDGQALNMTVVSNAHNLDFGLVGCRRSVPHLQRLLGHLETSLKD
LETATGA
118472089YP_884633.1 3-demethylubiquinone-9 3-methyltransferase [Mycobacterium smegmatis stMPVKINASIVPNLWFDREAEEAAEHYIAAFGGNGRILNKIAAHPDAPSPQ
DVPVVVEFELVGQRFVGINGGPQFTFNEAVSLEVRVAGQEQLDQVWAALT
EGGEELPCGWLKDKYGLAWQVTPSEYYDMVTKGDEEANNRLMTAVLSTHG
KFDLAKLQAAYDNA
118472088YP_889897.1 hypothetical protein MSMEG_5664 [Mycobacterium smegmatis str. MC2 155]MTTKPEIEFPDGPAPTELVITDLVVGDGPEAVAGANVEVHYVGVEYDTGE
EFDSSWNRGESIEFPLRGLIQGWQDGIPGMRVGGRRKLIIPPEQAYGPAG
GGHRLSGKTLIFVIDLLATR
118472087YP_890552.1 hypothetical protein MSMEG_6335 [Mycobacterium smegmatis str. MC2 155]MVLHGRDVRLATADTELPADVKAVGLQRLGVDLGDDLRLREIGRADPDGL
EVTRDLAAAQGIRTASTGRQRREQGQHEQKDCQGSVLH
118472086YP_885928.1 coenzyme B12-dependent glycerol dehydrogenase small subunit [MycobacteMSEPVLDPAVDYPLSLNRKDLLTTPNGKPIDAITMDAVMSGEVSASDLRI
TPETLRLQAQIAEGVGRKQLGANLRRAAEMTAISDERVLQIYNALRPNAS
TKAELDAIAEELETQYGATMLAGLVREAADVYERRDILATSE
118472085YP_884536.1 transcriptional regulatory protein [Mycobacterium smegmatis str. MC2 1MTSAANNGTSRREELLNVAAKLFAARGYHGTRMDDVAEAVGLNKATVYHY
YASKSLILYDIYKSAADFTVEALHDDPTSSARETIYHFTRRLMVGIANDL
ERAAVYFQEGPYIAEWFTEEQVEYIRHSEAQVYEHVRDVIDRGIASGEFY
DCDSHVLALGYIGMVLGAYRWLRPHGRRTAKEIAVEFSTALLRGLIRDEN
IRVESPLGIDVQAGSEEQR
118472084YP_885891.1 TetR family transcriptional regulator [Mycobacterium smegmatis str. MCMARHKEFDPDVALDTAMRVFWRSGYAHTSTEDLVTELGIARASLYGTYGS
KRGLYLAALDRYLTGGGDPAQLVASAASGLDAVRALLESAARQPDQGLPP
GCFSVNATVEHGDTDPEIGARLERNRERMETVFRDALLRARAEGDLDTRL
CDDSEISSTATLLTTVLNGLQVLSRAGADQRGRIARTVESALAGLRAR
118472083YP_884834.1 hypothetical protein MSMEG_0421 [Mycobacterium smegmatis str. MC2 155]MVATSRSERDAHHVSEGRGARCAFPVPFRQGGVEASRQAVSRIGKQLR
118472082YP_889054.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMSGPLEGIRILEVAMYGFVPSAGAVLGEWGADVIKVEHAVTGDPQRGLRQ
TGPLRVDGDPNPNIEHANRGKRSIGLDMSVPAGREVLLELARRADVFLTS
FLPGHREKFGIDVDDIRAVNPKIIYARGSALGPRGEESVKGGYDMTAFWC
RAGAAATITPPGIEGMIGPPGPAYGDTISGTNLAGGIAAALFKRERTGEP
SVVDVSLLGSGLWAMGHTIALTSHLNELMVQPPPGVHGSPINPLVGLYGT
ADGRYISFVMMQPTKFWADVCRHMDLEHYIDDPRFATAESIAENTAAAVD
ILTEAMKKRTLPEWSERFATLAGPWAPVQDTLQAAQDAQIRANEYLVQAG
ELELVTNPVQFDVSAPSPGPAPGFAEQTDDILAELGLDWDRIIELKTAGA
VT
118472081YP_885007.1 GntR family transcriptional regulator [Mycobacterium smegmatis str. MCMRAHELVLERIERDLVAGAITVGDRLPPERALAESLSVSRASVREAIRVL
EAMGVIRTAAGSGPDAGAIVTADAATSIGSALRLHTATRALPIEDLVSTR
ILLEASALRDAAALSPRPDLAGINARLDAMDDPDLGPEEFHRLDAEFHVA
LTALAGNVVVEAMMAALRGAIQGYILAGVPRLADWGGVAANLRCEHRRIV
TALSRGQGNKAAELARAHIEGYVDLIKS
118472080YP_888450.1 ribose transport ATP-binding protein RbsA [Mycobacterium smegmatis strMSPSASAVAPARTGLVQASGISKHYAGVAALDDVSVTLEPGKIHALVGEN
GAGKSTLSKILSGFETSDAGTITLDGRPINPKNPTHAAALGIGIVHQELS
VIGSISVAENVLVNAEPSRWGVIDRRALAQQATAYLRRVGLDIDPRRQAG
ELSIAEQQLIEIARILAQDAKVVFFDEPTSSLPQNDSVRLLGLLRELRDD
GAAVVLISHDLPEVLEYADTVSVLRDGRHIVTAPAAEFTEDSLIKHMIGR
NLESMYHRNDESAAAPQTPILKVSGISAPGVKSATLYVSPGEILGIGGLV
GSGRTELLAAIFGASTITGGTMSLDGRPHRPTHPRDALDAGIALVPEDRK
NQGLHLGLPISTNIELASLAAMSTGPWLRRRKGAEIVDRFFKELRIKAAS
AAMPVGALSGGNQQKVALAKVLATRPRVLLLDEPTRGIDVGAKAEVHRLI
RTLADEGLAIIMVSSVLPELIGASDRIVVMRAGRTVGEVTRADASEEAIM
RLAFQGAVSDD
118472079YP_887793.1 hypothetical protein MSMEG_3489 [Mycobacterium smegmatis str. MC2 155]MSRLTTFLVAVALLVGVFVNVPTQRYVTSGLDPKIFHIAVIGDSYTTGAA
EGGQGAKGWPTLAWQTLARRGVQINADVVAEGGAGYVVRGNRGSIFADLT
PRAVKPDDSLVVFYGSRNDKDADPVAITRMSHDALALAQRIAPTARMLVI
GPPWPTADVPVSVLRIRDILRDQAEQVGASFYDPIAAGWFVGRPDLIGGD
GIHPTDAGHAYMADKIATIIGDELPRWV
118472078YP_888499.1 hypothetical protein MSMEG_4223 [Mycobacterium smegmatis str. MC2 155]MPKHHRRGSSSRAEYEHSRFQYPDHSNAVAGRRLSAA
118472077YP_885232.1 immunogenic protein MPT63 [Mycobacterium smegmatis str. MC2 155]MKISQLTIAAAAALAISGAAGTAGMATAFAEAAQAAQVSANPLGSQARLE
NGDVVQAWTISDLKPSSDPIPYAVQGTLWEATATDEAVSGSVIPIVSNLN
ARAANGENYRVLFQVATPQGVNPSTLAPGQKTTGKVYFDVTGEAPTTVVY
NDGERDLLAWSQTAASTTSPRPAATGSGTSASTPARTAPVTTAPASNTPA
TELVPESPAVAPTGAAPAAAPGAGAAATDIPGSTVPPLAEDAADEALAEE
LTEDLPDELSQDSVTPGESVGTPLPAAVQQAPAAPAPGQPAPAAPGAQDI
PAAPAGEVPAAPVTPAPAAPVDGSTTPTVPAGSDAPLTAGGIPTLVPAAN
PGAPTP
118472076YP_890757.1 phosphoglycerate mutase [Mycobacterium smegmatis str. MC2 155]MTTHTRRTAAVAALVVALVAGMLTAPNAVAQRIITLTLVRHAQSEGNASG
LIDTSTPGPPLTALGREQAETAAQKLAAGHTFDGIYASTMIRTQQTAQPL
ADLSREPVTVLPGLREIEAGIYEGQPEALAGFTYYEAPTRWLQGDRTARI
PGSIDGDEFDARFDEAVREIYDSEDTDPVAFSHAGAIMTWVAMNVDNPDL
GLLSRHPLGNTGHAVVKGNPTGGWTLVDWGGINTE
118472075YP_890900.1 glutamine-binding periplasm