Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_vanbaalenii_PYR-1
Gene IDProtein IDProtein DetailsSequence
229312735YP_952408.2 gamma-aminobutyraldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-MLAGSWIDGAPVNTRGPVHQVINPATGAPVAEYALAQPADVDAAVASARA
ALGGWATATPAERSAVLAKLAKLADEATADLVAEEVSQTGKPVRLATEFD
VPGSVDNIDFFAGAARHLEGKASGEYSADHTSSIRREAVGVVATITPWNY
PLQMAVWKVLPALAAGCSVVIKPAEITPLTTLTLARLAAEAGLPAGVFNV
VTGSGADVGTALAGHADVDMVTFTGSTPVGRKVMLAAAAHGHRTQLELGG
KAPFVVFDDADLDAAIQGAVAGALINTGQDCTAATRAIVARDLYDDFVAG
VAEVMSNIVVGDPGDPDTDLGPLITLAHRAKVAGMVERAPGEGGRIVTGG
VAPDGPGSFYRPTLIADVSEQSEVWRDEIFGPVLAVRSFTDDDDALRQAN
DTAYGLAASAWTRDVYRAQRASREIHAGCVWINDHIPIISEMPHGGFGAS
GFGKDMSQYSLEEYLSIKHVMSDITGVADKTWHRTIFTKR
161899025YP_956014.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTEQEYDVVVVGSGAAGMVAALTAAHQGLSTIVVEKAPHYGGSTARSGGG
VWIPNNEVLKRDGVKDTADAARTYLHAIIGDVVPAEKIDTYLQRGPEMLS
FVLKHSPLKLCWVPGYSDYYPETPGGKATGRSVEPKPFDAKKLGEDLPGL
EPPYGKVPMNMVVMQQDYVRLNQLKRHPRGVLRSLRVGIRSVWANTTGKN
LVGMGRALIAPLRIGLREAGVPVRLNTAMTDLYVEDGVVRGIYVRDTTAP
ESAEPQLIRARRGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAKANTGD
GILAAEKLGAALDVMEDAWWGPTVPLVDAPWFALSERNSPGSIIVNMAGK
RFMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLVFDQRYRDRYIFAGL
QPGQRIPKKWLESGVIVKADTLEELAAKTGLPVDAFKTTVQRFNGFARSG
VDEDFKRGESAYDRYYGDPTNKPNPNLGEISQGPFYAAKMVPGDLGTKGG
IVTDVQGRALRDDGSIIEGLYAAGNASAPVMGHTYPGPGGTIGPAMTFGY
LAALDIARKD
120407006YP_956835.1 ribonuclease P [Mycobacterium vanbaalenii PYR-1]MLPAQHRMTRSTEFGATVSKGTRAAQPDVVVYRLRSDQTADPGPRVGLIV
SKAVGNAVQRHRVSRRLRHAALAVLEDLDPSDRVVIRALPRSRDAVTPRL
EQELRTALERIRQRTGAPS
120407004YP_956833.1 putative inner membrane protein translocase component YidC [MycobacterMSFNWFSLDIIYYPVSAIMWVWYKAFAFLIGLIPGVDGPSNFFAWALSVM
FLVFTLRAILYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQ
KLQREHGFNPILGCLPMLAQIPVFLGLYHVLMSFNRTQTGIGRLGLSVEE
NRSLPNYFFSATDVGHFLDANLFGAPLGATMIQQHGLDAFTEFNRLSVIV
VGVPIMIMAGIATYFNSRASVARQSPEAAANPQTAMMNKLALYVFPLGVV
VGGPFLPLAIILYWFANNIWTFGQQHYVFGMIEKEEEQKKLEAIERRAAN
APAPGAKPSRKKKAGTDSAVAGPSDGAAGAESAGIDEAPSETPPAAESPT
TSAAQGGASNRTPRPGARPKKRKR
120407002YP_956831.1 16S rRNA methyltransferase GidB [Mycobacterium vanbaalenii PYR-1]MKHAEVPPPPEAAEAVFGPALEKAHLYARILAGAGVERGLLGPREVERLW
DRHILNCAVVGELLQPGERVADIGSGAGLPGIPLALARPDVHVILIEPLL
RRSEFLRETIEEIGIDCDVVRGRAEDRSVREEVGTTDVVVSRAVASLDKL
TKWSSPLLRVGGRMLAIKGERADDEVQQHRRAMAALGVSEVKVERCGGQY
VEPPATVVVGFQGVAKVSQSRSGRRHR
120407000YP_956829.1 parB-like partition proteins [Mycobacterium vanbaalenii PYR-1]MNNQARKRSGLGRGLASLIPTGPAEGGEPATLGPKMGAAAADVVLGGAPV
APPASTDVNPVGAVYREIAPSQIDPNPRQPRQVFDEEALAELVHSIREFG
LMQPIVVRATPGGEGESSDRYQLVMGERRWRAAQLAGVATIPAIVRETAD
DSMLRDALLENIHRVQLNPLEEAAAYQQLLEEFDVTHNELATRIGRSRPV
ITNMIRLLRLPIAVQRRVAAGVLSAGHARALLSLEAGPEAQEELAARIVA
EGLSVRATEEAVTLANRNGEAPPTAPRRKPIQMPGLQDVAEQLSTAFDTR
VTVSLGKRKGKIVVEFGSVDDLQRIVELMNASQP
120406998YP_956827.1 peptidoglycan binding domain-containing protein [Mycobacterium vanbaalMSSLRRGDRGGAVAEIRAALSALGMIDSPDEDLTTGKHVAADMFDDDLDH
AVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLNHQFGAPMYGDDV
ATLQSRLQDLGFYTGLVDGHFGLQTHNALSSYQREYGLYPDGICGPETLR
SLYFLGSRVTGGSPHAIREEELVRRSGPRLSGKRIIIDPGRGGSDHGLIM
NGPAGPISEADILWDLASRLEGRMTAIGIETFLSRSAHTSASDAERAATA
NTVGADMMISLRCAAHPSPAANGVASFHFGNSHGSVSTIGRNLADFIQRE
VVARTGLRDCRVHGRTWDLLRLTRMPTVQVDVGYITNPGDRATLVSATAR
DALAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELAVEQARRV
120406996YP_956825.1 thioredoxin reductase [Mycobacterium vanbaalenii PYR-1]MTSSETIHDVIVIGSGPAGYTAAIYAARAQLNPLVFEGSQFGGALMTTTE
VENYPGFRNGITGPELMDEMREQALRFGADLRMEDVDAVDLTGPVKSVTV
GDETFRARAVILAMGAAARHLGVPGEDTLLGMGVSTCATCDGFFFRDQDI
AVVGGGDSAMEEATFLTRFARSVTLIHRRDEFRASKIMLERAQANEKITF
LTNTQVTAIEGDPKVTGIRLRNTATGEESTLPVTGVFVAVGHDPRSELVR
DQVEVDDAGYVKVQGRTTYTSVEGVFAAGDLVDHTYRQAITAAGSGCAAS
IDAERWLAEHTEPGERSSTTTDDSDLIGAQQ
120406994YP_956823.1 Fis family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MGIFGGTHGRPEQQPRTDAELLAAHVAGDRYAFEELFHRHHRQLYRLAQL
TSRDPDDAADALQDALLAAHRTARTFRHDSAVSSWLYRIVVNACLDRLRR
NRSRACEELDDQAGPVVDPTGRVDTAIVVERALMRLPLEQRAAVVAVDMQ
GYSIAETARMLGVAEGTVKSRCSRARTKLAASLDCFTATAE
120406992YP_956821.1 hypothetical protein Mvan_6063 [Mycobacterium vanbaalenii PYR-1]MRGPARLLVAVLALLLAVAPVAASPVAAAQPGTVPFLRVQIDNITPDVVT
TTSNPLVTVTGTISNIGDRPVRDVVVRLERAKAVASSTALRTDLAGNVDQ
YQPVADFVTAAPELARGQRVPFRLAYPLRSGVPSSMRIDNPGVYPVMVNV
NGTPDYGAPARLDDSRFLLPVLGVPPEGDSDSASEALDSAVPPDTTRPVG
LTVFWPLADRPRLAAGAPGGTTPVRLIDDELAGSLAPGGRLDTLLTAVDF
ATGPEVDPGGNVTRTVCLAIDPDLLITVNAMTAGYVVNDAADAGPRTPTH
PGTGQQAAVDWLNRLKALARRMCVAPTTYAQADLDALHRVADPGLSAIAT
TGAAGILDQLLGVTSTRGASLVGDGPLTAPAVQLLSGHGPTVAIGAANLG
EPGETADGTAETADTVPMRYTPTVVAAPFDPAVGAALAGMGPTPESPSYL
NPALDVAVKQDSDVARRQDAIGALLWRSLNPDIGPRTQIVMPPLMWNLAP
ADAQAVLTAVASSIRAGLAVPRPLTALIDEATSAARDAPLPSGSLGNPRG
RFDNGVVSGISAATGRLWGFTAALTTDERTGLTGNQYTAPLREDLLRALS
LSVPPDARNGLAQQRLTTVGRTVEDLFNAVTIVNPGGSYTLATERSPLPL
ALRNDLPVPIRVRLDIDAPPGMSVTDMGEIVLPPGFLPLKVPIEVHFTQR
VAVDVALRTADGLPLGEPVRLSVHSNAYGKVLFFITLTGGAVLVLLVGRR
LWHRFRGQPDPADLEADPTRPDPIEVALAYDDERTTADPDERPAADPGKR
RAGTPAGGDDA
120406990YP_956819.1 metal dependent phosphohydrolase [Mycobacterium vanbaalenii PYR-1]MPDPTSDSELLAAAQVALNVHGGVLRELGRLFGDHGHQLYLVGGSVRDAL
LGRLGTDLDFTTDARPDQMLPFLRGWGDALWDTGIDFGTLGVAKGGDRLE
ITTFRADSYDQVSRHPEVRYGDNLADDLVRRDFTVNAMAVRITPGGPTEF
LDPLDGLAALRDQVLDTPSEPEVSFSDDPLRMLRAARFVSQLGFAVAPRV
RRALQEMAPQLSRITAERVAAELDKLLLGADPVAGLNLMVETGLGDVVLP
EIGAMRMAIDEHHQHKDVYQHSLTVLRQAMDLEGPEGPDLVLRWAALLHD
IGKPATRRHEPDGGVSFHHHEVVGAKMTRKRLRELKYSKQMISDVSQLVY
LHLRFHGYGDGRWTDSAVRRYVTDAGPLLGQLHKLVRADCTTRNKRRAAR
LQASYDDLERRIEELAAKEDLARVRPDIDGNEIMRILDIPPGPQVGQAWN
HLKELRLDRGPLEYDEAVAELLKWWNEKGRPNV
120406988YP_956817.1 hypothetical protein Mvan_6059 [Mycobacterium vanbaalenii PYR-1]MADAARVIDELRAESDDLDALVAALPAARWTLPTPAPGWTIAHQIGHLMW
TDRVALLSVTDEAGFAAVLAQASENPGGFVDAAAEELALTSPGELLADWR
ATRAALHDALSTVADGRKLPWFGPPMSAASMATARLMETWAHGLDVADAL
GVTRAPTARLRSIAHIGVRTRDFAFTVHGLTPPPEPFHVKLSAPHGAQWT
WGPEDAAQRVTGSAEHFCMLATQRRPRAALDVVAVGPDAEKWLTIAQAFA
GPPGPGRG
120406986YP_956815.1 hypothetical protein Mvan_6057 [Mycobacterium vanbaalenii PYR-1]MAQPEDPEDFVAPAAYRVRAGTMLLANTDLLEPTFRRSVIYVVEHNDGGT
LGVVLNRPSETAVYNVLPQWAKLATKPKTMFIGGPVKRDAALCLATLRVG
IDPAGVDGLRHVQGRVVMVDLDADPDSIAPMVEGVRIFAGYSGWTIGQLE
GEIERDDWIVLSALPSDVLVEPRVDLWARILRRQPMPLSLLATHPIDLSR
N
120406984YP_956813.1 hypothetical protein Mvan_6055 [Mycobacterium vanbaalenii PYR-1]MSEIARHWRVLAGGIGACAAGVAGVLGVAASTASAQPMIPQPALPAPATV
TQTVIVTPDTAPAALGQPGVTPATTGAAAVPAGVSAGVGAPAAPALPTRP
VSTIAPATSGTLAEFFAAKGVAMEPQSSRDFRALNIVLPKPRGWEHIPDP
NVPDAFAVLADRVGGNGLYSSNAQVVVYKLVGAFDPKEAISHGFIDSQKL
PAWRSTDASLADFGGMPSSLIEGTYRENNLTLNTSRRHVIATVGPDSYLV
SLSVTTSVDQVVAAADATEAIVNGFKVSVPGPAPVAPLPGTPALPLASAP
PPAPAVPTVAPAPQLLGLQG
120406982YP_956811.1 transposase IS116/IS110/IS902 family protein [Mycobacterium vanbaaleniMSVHVAPVTSSTIVVAVDVGKTSAVLSVTDATRHRLLAPSEFAMTGSGTA
TAAARAMAAAPAAVQVKVGVEAAGHYHRPVLDYRWPEGWEVLELNPAQVA
EQRRVQGRRRIKTDVIDLEAITELVLAGYGRPVTYRDVVIGEISAWAVHR
SRRVATRSATKNQLLGQLDRAFPGLTLALPDVLATKIGRLIAAEFADPAR
LAGLGVNRLIRFAATRDLQLRRPVAERLVAAARDALPTRDAVISRRILAA
DLVLLADLDDQIQSAETALALLLPRSPYATLTSVPGWAVVRASNYAAALG
DPKRWPGPRQIYRASGLSPMQYESAHKRRDGGISREGSVALRRALIDLGI
GLWLNEPAAKNYAHALKDRGKPGGIVACALAHRANRIAHALVRDHATYEP
ARWV
120406980YP_956809.1 hypothetical protein Mvan_6050 [Mycobacterium vanbaalenii PYR-1]MPHDTSFAPTQLAARAAYLLRGNDLGVMTTAAPLLYPHMWSWDAAFVAIG
LAPLSVERAVVELDTLLSAQWRNGMIPHIVFANGVDGYFPGPARWACSAL
SPDAPRTRHTSGITQPPVHAIAVQRILDHARTRGRSTRAVAQAFLDRRWN
DLVRWHRWLAECRDQNERGRVTLYHGWESGMDNSPRWDSAYANVIPGDVP
EYQREDNTIVTDASQRPSDMEYDRYLWLLEEMKAARYDDQLLSKVMSFAV
EDVFVSAILAVACQVLAEIGEDHKRPNSDVRDLYAWADRFRAGVIATTDE
RTGAAKDYDVRAERWIATETAAQFAPLLCGGLPHDRERALLRLLEGPRFC
GHPDLAYALIPSTSPVSRDFRPREYWRGPVWPVMTWLFAWCFARRGWAER
AATLRREGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
120406978YP_956807.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MTTAVSLTAKDIHLSFGKSAVLRGVDLDVAAGSSTAVIGPSGSGKSTLLR
TLNRLYEPDRGDILLDGRSVLGDNPDQLRQRIGMVFQHFQLFPHRTVLDN
VTLAPRKLKRLSGDEARELGMAQLDRVGLRNKADARPATLSGGQQQRVAI
ARALAMSPQVMFFDEATSALDPELVKGVLELIADLGAEGMTMVVVTHEMG
FARSSADTVVFMDHGQVVETGPPEQLFEAAETDRLRRFLSQVL
120406976YP_956805.1 regulatory protein GntR [Mycobacterium vanbaalenii PYR-1]MPKKYGVKEKDLVVSHVVEMVLTGRLRSGDRLDRNEIAHDLGLSRVPVQE
AVVQLEHDGIVSTRYHRGAYVERFDESTVREHHELYGLLSGIASARAAAA
SDPAVVDTLDGELTQMRGARDSRQFDNHADRFRTTINEQYAGPRLQAAVN
SSRTFIPRAFWQTYPQHRDRLLPSYEAELAAVRAGEPDAARAACAQRAEV
MASILLTELVRRGVLRAPQSQ
120406974YP_956803.1 hypothetical protein Mvan_6044 [Mycobacterium vanbaalenii PYR-1]MALVPLNLLVTHNGKSKRQHVTCVHKCADACSKPVPNKTDNEYFGDIAKA
VSRRSLLHAGGVAVLAVGAGSALAACSNTTEPAPTSSSPTAAATEPPAGM
NFASVAPNSEDAVVVADGYQQAVVISWGDPVLPDAPKFDVNNQTGAAQRG
QFGFNNDFAGLLPIDGQPGRFLLVTNFEYATPQFMFPGYDAEAPTRDQFD
VEIASMGMGVVEVERTPDGGLRPVMGRYNRRITADSPFAITGPAAGTDFV
KTQADPEGRTVLGTIANCAGGVTPWGTVLSGEENFHGYFGAPEGSPAPNP
VDADRHDRYGVSLEPSELRWETFDPRFDLAKTPNEVNRFGYIVELNPWDP
TSTPVKHSALGRFKHEGANIHVTDDGTVVAYTGDDERFDYMYKFVSSRKV
QPGKDPAAMANNMAILDEGTLYVAKLSSDIPANEIDGSGKLPTAGAFRGT
GTWLPLLRSGPNGRAESLVDGITAQEVAVFTRMAADKVGATKMDRPEDFE
ANPATGKVYVALTNNSKRGAEGEAAADASNPRNDNKSGQILEITDNHAGT
DFTWDLLLVCGDPQAADTYYGGFDKTKVSPISCPDNLAFDSHGNLWISTD
GNALDSNDGLFAVALDGPNRGETKQFLTVPLGAETCGPVVTDDLVTVCVQ
HPGENDENSIDSPQSRWPEGGNGTARPSVVAVWKNGGQIGV
120406972YP_956801.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MADISDDELPHLDEFALLHENAEQVGVTEVPRAERIDAGPVSAVKFGDDA
PRVVFLHGGGQNAHTWDTVVVGLGLPALAVDLPGHGRSAWREDGDYGPKL
NAVAVEPMVRDLASDADLVVGMSLGGLTALRLAVTAPELVRRLVLVDVTP
SAPERHTEMTDAQKGTVALVQGERIFPSFEAMLEVTAAAAPHRDRKSLRR
GVFHNAKRLDDGTWTWRYDSIRTGEGFENLWDDVPRLTAPTTLIRGAHSF
FVNDDDADAFARTAPGFQRVHIVENSGHSVQSDQPLALIELLRGVLAD
120406970YP_956799.1 myo-inositol-1-phosphate synthase [Mycobacterium vanbaalenii PYR-1]MTASNDVRVAIVGVGNCASSLVQGVQYYKDADENATVPGLMHVKLGPYHV
RDVKFVAAFDVDAKKVGFDLSEAIFASENNTIKIADVPPTDVVVQRGPTL
DGIGKYYADTIEISDAEAVDVVKVLKDAKVDVLVSYLPVGSEEADKFYAQ
CAIDAGVAFVNALPVFIASDPVWAKKFEDAGVPIVGDDIKSQIGATITHR
VMAKLFEDRGVTLDRTYQLNVGGNMDFLNMLERSRLESKKVSKTQAVTSN
LSGSLAGKIEDKNVHIGPSDHVAWLDDRKWAYVRLEGRAFGDVPLNLEYK
LEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPIEAASAYLMKSPPKQLADD
IARVQLEKFIEG
120406968YP_956797.1 hypothetical protein Mvan_6038 [Mycobacterium vanbaalenii PYR-1]MASGSSGRRTSSTRAKDSDRNETCQLLDAALAEGQLSMTEHGERVKAATT
AATLGQLQDLVSDLQTARSLNVDVPVITKVINRRIPGVQAGWGIKAAIAG
VLVVLGIAIGWGLYGNTPSPLNFTSDPGAKADGIPATVLTAPKQLQSLGG
FNGLFEQMRKKFGSTMGYELDIHSDMAFLDRPDPQDNRRSLSYHYRGGWG
EPTGSPSTVDADARLVDLAKFDYEKTLGILRGAPETVGIARADVTDSWLR
ISPSEDPATPDAVIIEIIVNSDFGTGRIELYPDGSTLAIWPANR
120406966YP_956795.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MGARNPQHRKDDPVRRPGEGGVRRAPAPDDRHTTVIPPVRDGAPPPLRDP
IDAVKRALDGGARGERKNFGPPKQPPPSQPPPPPGRPPGGGGPPGGGGPA
GPRRSLREQINWKWVRRGSIIAAAVLILLPLLTFGMAYMIVDVPKPGDIR
TAQVSTILASDGSEIAKIVPPEGNRVDVDIDQIPVHVRDAVMAAEDRDFY
SNPGFSFTGFLRAAKNNIFGGDLQGGSTITQQYVKNALVGDARSGVGGLI
RKAKELVISTKMSSEWSKDQVLQSYLNIIYFGRGAYGVAAAAQAYFGKPV
EQLNVSEGALLAALIQRPSVLDPAVDPDASAVRWSWVLDGMVEIGALSPE
DRAGQVFPPTIPPDQAFTQNQTTGPNGLIERQVVNELMEIFDINEQTLNT
EGLQITTTIDPQMQAAAVDAVEEYMDGQDPDMRTAVVSIDPRTGGVRAYY
GGSDANGFDFAQAGLPTGSSFKVFALVAALQQGMGLGYQVDSSPVEVNGI
KISNVEGNSCGTCNIAEALKRSLNTSYYRLMLQLENGPQDVADAAHAAGI
AESFPGVEHTLSEDGQGGPPNNGVVLGQYQSRVIDMASAYATLAASGVYH
KPHFVQKVVNAEGTVLFDASQEDNTGEQRIDKAVADNVTAAMQPIAAYSN
GHALAGGRPSAAKTGTNQLGDTGANRDAWMVGFTPSLSTAVWVGTTDGTK
PLENKWGSPVYGSGLPSDIWKATMDGALDGTDNESFPKPEEIGGYAGVPQ
APPPPPSPSVTVPPPPSETVIQPTLEIAPGITIPWGPPTTVPVAPPVPGA
PPAPGAPPPAGAPGAPVPPGAPPPGPLPPP
120406964YP_956793.1 30S ribosomal protein S6 [Mycobacterium vanbaalenii PYR-1]MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAY
EIAKHAEGIYAIVDVKAEPATVSELDRQLNLNESVLRTKVMRTDKH
120406962YP_956791.1 30S ribosomal protein S18 [Mycobacterium vanbaalenii PYR-1]MAKSSTKRRPAPEKPVKTRKCVFCSKKGKNQDIDYKDTQLLRTYISERGK
IRARRVTGNCVQHQRDIAIAVKNAREVALLPFSSSTR
120406960YP_956789.1 DnaB domain-containing protein [Mycobacterium vanbaalenii PYR-1]MEPPPSEDFGRQPPQDAAAEQAVLGGMLLSKDAVADVLEKLRPGDFYKPA
NQLVYDAILDLYGRGEPADAVTVAAELDRRGLLRRVGGAPYLHTLISTVP
TAANAGYYAEIVAEKSLLRRLVEAGTRVVQYGYAGADGADVNEIVDRAQA
EIYDVTERKSSEDFVILEEILQPAMDEIDAIASEGGVSKGVPTGFTDLDE
LTNGLHPGQMIVVAARPGMGKALALDTPLPTPTGWTTMADVAVGDLLIGA
DGKPTRVVAATEVMVGRPCYEVEFSDGTVIVADAEHQWLTETRASRKSAQ
AAAVGYNRYKNQRTFAAVRTTREIGETLRCPTADRRLNHSVVNAAPIEAP
VADLLLPPYTLGAWLGDGTSRAAQITTADPEILMRIEAEGLVTVPLPGAR
MRYGLQLPTEAPAGTRECVVCGASFTPSTSQVRTCGRSCGGRARFVSEPV
AAPTCSHCGGPSCGLRLCQSCRNAVGTVQGRLRTIGVLGNKHIPTEYLRA
SEAQRRALLAGLLDTDGTVTNGGAVQFSVTSRRLAADVAELVVSLGYRCQ
VATKAVKGRTEASSTAYILNFSTTDSVFGLHRKDLSHKERRSKSSVRSNT
RFIVDVREIETVPVRCVEVDNDDHMYLASRSMIPTHNSTLGLDFMRSCSI
KHHLPSIVFSLEMSKTEIVMRLLSAEAKIKLADMRSGRMNDDDWTRLARR
MSEISEAPLYIDDSPNLTMMEIRAKARRLKQKADLRLVVIDYLQLMTSGK
KVESRQQEVSEFSRQIKLLAKELEVPVVAMSQLNRGPEQRTDKKPMLSDL
RESGSIEQDADMVILLHRPDAFESDDPRGGEADLIVAKHRAGPTRTITVA
HQLHLSRFSNMAK
120406958YP_956787.1 hypothetical protein Mvan_6027 [Mycobacterium vanbaalenii PYR-1]METSNAYGTFVVDGEALFDLPAPVSAEHTGIVHEFTEQTGAPVVFPYIRT
AVAALAAQLAVPASPLPVLRAGDVTLTHDDEAITEDEPSEFFMHGTVTRT
TGDGGQEHVAEFFMDEQTGMLTRIGGEGQTPDADDFLNLIAELPPPEGVT
AEWIVRNHGEAGIHQSLESLRQANGDAATDQMLAEVDEAVAHIEAEDAFD
SLHIAIKSLDASIATVLSTDTDASAARSVESADIPAALLDAAKQVRDSWI
RVQNALSD
120406956YP_956785.1 UvrD/REP helicase [Mycobacterium vanbaalenii PYR-1]MANLVIASNSKGMSKLDGSVKNKVYDFFEKLNADDTSPKLHIEPMKGAID
PRVRTGRVDLYWRAILFRIDDKSSGTTYIYMGTWPHDDAIKLAERATLRV
NPINGTLEGLIGEAPSPETGGPQTAPPVTAKPEPSYLAGFGYTQSDLTDG
LGIDSALAASAMAAPDEAALLEAAAAGLEWEGSALLDLATGISIDTIREK
HGFTDEPVDTTGDEDKRIIEALDRPASKMQFAFIEDDEELRRVIEGGDFA
AWRTFLHPEQRKYVDLDFSGAFRLSGGAGTGKTVVAIHRARRLARDNPNA
RIILTTFNATLAQGLKADLVALDPNVRIAEKPGDPGVYVGGIDALGRAVL
DRSRDVLTAAGKRIFGSGAMEFSAKRTSADAVWREVAQSVESGLDAKLAT
PAFLETEYVAVVLANRITTLEQYAKVARPGRGVRLSRQQRIAVWKLVEAF
RRQSQMDETLSFPEILALAAEALRIKSETDGTFLADHVLVDEAQDLHATH
WALLRALVSEGANDLFIAEDSHQRIYGSPIVLSRFGIKIVGRSRRLTLNY
RTTAQNLHFAVSVLSGAEYTDLEQAEESTSEYRSARNGPAPELIPCTDMA
DELEAVATKVKAWLTEDGVEPESIAILTRSQEERDRFVRGLGERGVTARS
LDKSAATPGQPLVMTMHRAKGMEFSRVILAGADDKHVPLPATLRSVPDEE
KGEAMLRERSLLYVASSRARDALVVTWSGKKSELLGE
120406954YP_956783.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MAFLTIQCLEKLFDRHHGRGSGLHRIDLDVERGEFISLLGPSGCGKTTTL
RCIAGLETPDQGRVELDGKVLFSSDRSSGRPPMNVAPERRGISMVFQDYA
LWPHMDVSKNVAFGLKGTGLTRAEISAEVQQALRSVRLWDHRDKRVSQLS
GGQQQRVALARALAPTPKIILFDEPLSNLDSQLREDMRLEIRDLQQRMGL
TAIWVTHDQEEALGLSTRVVLMNEGRVEQIGRPVDLWTEPSSPFVASFLG
TTTRITGEVVATEAGLALSIPQARPIPLPDGSLLRPGDRASIFVRPGAIA
LCDQSLTTQDTWKVPVLGQMFHGEHTMITVSFGGVHLRIRSDKFLDPQPE
FLDIQVDSSRLMAFRDE
120406952YP_956781.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MFERLRRSGRIVAALVLVASLAACSKGSPAAEQSLQSATEGTLTWYTDDD
AQEVDPVVRAFTEKTGIEVTLLATEFVAQRLMSESASNVATADVISFAGA
PSVLELEDAGYLAKLPASVSEALPRQDPVFVSKSGNWFSNQASSWGVFYN
TDLVDPAFRPTDFTSFLNPYWRGKFSVPISTNDSSIEGYYQIAQEPSLGK
EFLTALGDNDPVISGSSGQGVSDVIVGNQIGGITNDNAVWQQIAKGAPLA
FAYPPGGTTFSQKYNALVANAAHPKAAEEFLEFLVTKDAATLLSASTGKL
STFPGIPSTPPGRPTISDGKFFPLPDPQALVDAQPTMAPFLKEALNE
120406950YP_956779.1 HpcH/HpaI aldolase [Mycobacterium vanbaalenii PYR-1]MRKPAADTLRVSNTVLDVLKRGDVATALSIRLVRTPEIVLLARSAGFDAV
FVDLEHSTITDDATSQINMTALAAGITPLIHVRSAYAETIGAGLDGGALG
IIVPHVDSVEDAEAAVKAARYAPRGERGISSALPFFDFRAVQPEAATAAV
DAATLVIAMVESQTALDRIDEIAAVDGVDVLLVGANDLTADIGVPGHHGS
PEAWAAYRRVIGAAEAAGKFAGIGGVPIEGGVLREVIQAGMRFVSAGPEI
RHLGRAVTAWNHEVRSAM
120406948YP_956777.1 hypothetical protein Mvan_6016 [Mycobacterium vanbaalenii PYR-1]MPSATWLHNPMAPHGRIPVLSVLILINQTVGVVCQFVQGTDPRFPLLYFS
VNSAVLAAVAAALTLIGYDGAWYRRIRLAAVVGVLMSAVVYAAVIAPATP
TGSWFQPNDDLPVRMAVLLIHGVAPVLVTAEYLLRPTPLSARASTLWGYA
WPLAYLAGIGILTAIVGPDTVPYPFLRPSVTGWPTVAGAYVALLALVGVL
GWLVGTSAGRADSRMRGTVS
120406946YP_956775.1 hypothetical protein Mvan_6014 [Mycobacterium vanbaalenii PYR-1]MTDTEKAADRLFLLVDDHGRRDRQFTREVAGGNLEVEVVDEAVALKDMRT
DLMLFDGAIVDFHLDTPPGSDYTCLQYPCVAEDCPELDATENTSAEYIAY
LREEHAWHTTAGIRTVDVTTGLGAMLYIKQHAPDVELYGICALSAKHSIM
FLCAAHMWLGASAINADNPSDLIRRALVSPDGENPLPIHNQLRAAAEGFE
KLTNSLDFLTRPAEAIDYLGEYMKCGQSGARAELLKILQSRTAERLTLEG
DIYVEMVCRWQGALARILTAFGEDVSGWPDLRTVTDARYWNKHNPVLDFL
KNKNFQTFFTAADVRAALDYYRANQKRQALEDPLGRY
120406944YP_956773.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMINSEIRISGNAELTTRETVAAEVAIEWLAAHPHVEVTAVDLSKTLQQFI
TELFLTGGRRQREALSGHAVAVLDQIGVHPEEFAPVRTFAKSADMPVAYG
AMVGRVAEALAPLAAAVQLSRIPVTNAAVGIIEPDEGLDRRQLRGFVVGQ
VRPHAQQMHARVGAGETVDGYLQLILADIGALATAVVESARAKNARPTRL
DDELAERTTHFVRTHRAALMGYATPRFGQDADDIVATALLKVAVQFRNNP
KLRIGFAYGKAAVDNAAKDLFTKRKARQGRDILDPELLEWAAGTHDDAAD
VEEVDVMLRMVLSAAAELADEQLGPDACLARETLLQFFLVDPHEIDPRKA
RLTERALHLTTANEGNGFRTELGEIAAALGAEDPAIKRITELAVAALRAQ
ADKSRRPGPAGGELAA
120406942YP_956771.1 hypothetical protein Mvan_6010 [Mycobacterium vanbaalenii PYR-1]MVLDDDQELDYSGRPDAGARHLAFVEGGHFRTIHLLDIENLIGGSADDEA
LIAKALHTYEADADPKPKDTLVVGVPADCYSHLYEISTLPAGLADRGCNF
AFQIVVGGAPPHGVDQALLTAVDLIRRRSSGAFAHDYGRAKFATGGHVWS
ALAEELRAEGVRTSTPGTEGEHIESVASPASDVVGLNPEPAAATRTIHVI
DIENLVGGWADDERLIATALKAYEDETPPVAEDTVIVGIRANFHPQLHAV
RRRPPGSKKRGCRFDFTIVVGHNGKNGADQALETAVALMRMRREAVLTED
YDQASIASGDFGFAALAADLQSEGMSIVHTVGRGDSSYDWHITVEADERE
ITEIVNARFRQLYPHGRDHL
120406940YP_956769.1 hypothetical protein Mvan_6008 [Mycobacterium vanbaalenii PYR-1]MVDVAFDGFEERWWADLQPSGPTNRPQLVKSFARLSLERFKRGASTRLRI
DVEALTNQLNGFAVELVKKKWAKSSFTPDGVRVMQARVKEELGHQEDLLG
WARVLDSLGRICDPLAHYVVSHYPPLYDLRPTGLPRNVMSGLKDSARYNA
CTALRKGLLVGLGTTGPLFESRERVDSFIAALATESIPDAELHEREVILA
FAGELEAYARRLAADPWHVLNREPDLVQTDVSVIAATIAETASCLRARYA
DEVPTLDECAALADTLMTLVDGHIRAVTKQIVAIESAVIDRRGSSSRTLD
KLKAQSEHFGGARSSTRDELVVLLSRGHTKTEHDAYAMFFARVAGAERRR
YAEKWRKPVELPEAGGTSPQDSVYSRFEETVVAERADLPGGFGEIRDGHN
AGEFDAVVALFGNGVTELEEIEEFCAQQWPTYQETAVAEDIDVFMEHIVE
IMRWTAIRSGLI
120406938YP_956767.1 hypothetical protein Mvan_6006 [Mycobacterium vanbaalenii PYR-1]MPFQPVELIVECTLGAAPDGNATMSVQASLGPDEESAAKVSPLGLWADMA
QRSDRRFQLGKSIFDRSGAGPLLGKAIATANHRGCWLRVVLRFLPPGGAE
PDSLRGDVKTQWEGLVSAPWESMFVDLGGDHFQPVALALLDEPKVSIVRD
VPQNHSLLFALGSGSQPTYLHIDGTNDGSSTIAFQQGERVLVQKGEAASF
DDAKDIVDGCTSTIAVLHLTAHGEDGEIQIHDDWVGARKFATLVKRAKPG
LLMLSVCNSTQDPEEGMVSFLEKIALPAFVGMQEPITVFANSRFVTAFFS
ALDAGGSLDESMHSGRMALLRSGPESGSPTWSVPVLYMNQETRKTPYLWE
RRDPTPLLEFESIPTVSLICARRTSDGEIRLLRRRSHGGFVWTDEPGGAV
SLSPDGRLAAVLDSGMLWITTLGREGEFWDWPAVTLKAEDMNAEAKLLAV
AAEGPDRATCLLSHESATVVVRVSTEGAVDQLRTLKDHGSYAGVLHAGTA
LLVNGGVRDIHTCEDFSQLEDVWAVDATNAGGQLRVAAVGTDKAGDRTVY
VNGRRVLTLRPDAMAVGLIRELARDPTPTNLAVLSRGPAGMSLEEIQIPE
ADVWSTERWL
120406936YP_956765.1 hypothetical protein Mvan_6004 [Mycobacterium vanbaalenii PYR-1]MGFRIEREEADLLYFPQWSDYLKHRADAGDRSLCRVLRKNTAELNKLVVG
PKDRLQTKGEEQLKAAEDAGHDTRALAKQVELLKEKLEAPRRRAAFPWIT
PVLGTGCLSTSEFSGRDDVGLMPARLQQEAASWRLDERHSGGHSVDVTVL
DFTRNLVQSRAPQAEVKDGVPGVNRADPDPSTVALAAHAAWVSALLTKLF
HHVAALTSRPIGHQDEQTSLPGNQNWDAEEIRKNLVAPLVLNLEIFVEQV
GKYEADALDFLNEYLEKLVSRVRRVEFSLVDVELLTEITWHLMMRDNERY
AGWSDLLALVGIKSGSYGPHRRGPLLADLGAEDGLMAWLIGGLEKTTQNS
WQSRLADASSDREKFYNAVADMVIAQAKLDARRFDRSTIDADRYLPGVAF
VTSFDLELEMALHAKKQKFVLVAPFELWRGEGTQRRAYLAWFYRIVDVPS
TGPSLDWIRGQGNWRLLRESALRANDAPESTLRGMPFVVRLTGCPLVRGL
EVDTTTTEHLIDAQFPGASEGILDVGHAVLVDEHTSLHHWTAELRETIRL
PRELVAHEEGKAQVNGDRRFWMLLGVQITDDAVRHRVAAVVAAHSIRGEK
SNPRSADDRPHAALELPWTGVVVNHRSQPAQRDIFQWQGLDVVGGRHNDV
QKSLRHYTSHLLQPETRPVLDETCSLGPGDNCEDDS
120406934YP_956763.1 hypothetical protein Mvan_6002 [Mycobacterium vanbaalenii PYR-1]MTPEHLYKAVYELFAADDEASSRRILATVDSQWPAMHGRITTHDAETSRL
ASLAAVKVAEHGLAAQWRARALSRFAGTGWVEGVATRIMSDALVELARAN
DDYPQGQFLDVMVPAPSALAVLDEIEPFTVGDGSGINLSRSSPSPALLAR
FLHEKRGFFLLVGGDYSAALESYRRALDLPDLNLRGHLKVRLGIALVEYV
SAVKSGEHVDGHPTSALVAEAEASNDVGLTDLINIGRFNAGEIDAGTLRV
KPYEVL
120406932YP_956761.1 radical SAM domain-containing protein [Mycobacterium vanbaalenii PYR-1MDGDFTPAQQLKFALLDEGLALHGSAWTALRELNGTRSLSPHDYASTSGV
ILELDDDVWVNAPIEAFNPNFVTQSPYQLLYDNGFRVEGQGLVSRATFWP
QPAYHSTTGPWGPWNNFVVTHGDRGRLSPLRSCAMTCTFCNIPYDDAIDV
YSLKPVDALLAAAHLAIDDPIQPARHLLISGGTPKPKDIGWMREFYERML
TEFPNIELDIMMVPLPGLFDLPRLAALGLHELSINIELFNRDLTREFARQ
KYNQGLALYLDFIEAATTELGVGRARSMLMVGLEPVEDTLAGVRAIAERG
GTPVLSPFRPDPATPLRQLKPPSAETMIDTYLRARDITEEHGVALGPDCP
PCSHNTLNFATDSAGALHYQRDRPRMLGAC
120406930YP_956759.1 hypothetical protein Mvan_5998 [Mycobacterium vanbaalenii PYR-1]MTIDSYSWRGSAVPGRPTQWVDGPSNMRVAIAAGAPAVIVGVDTPTGTTP
DALREMLPKLVDDADWVQRALAGGSPELNPPATAAVHTLALLDDAKVVDD
AMLTAQLIDLDKALTLQELGADSEASGIVAELPNATVEVVELLHDAGVAT
EFSNSLCRLIDLALPWYEHRDALEALRADIGDPKSASGTSVEAEIPLRDA
LDLAPPPGFLAGERTGEAKPEAPEHISLLARRYARLATAAARVPDIDPND
IAQRLLGQLPRETEQQDVEADQVMVAFLETCTIENAEPAPMLSELVTVLL
MMRRDLGGALEHALARDANQLT
120406928YP_956757.1 hypothetical protein Mvan_5996 [Mycobacterium vanbaalenii PYR-1]MTETHVDVVESITLSQAGALVSTMAHEQSLLLLSPPGVGKSDVTYQTAAA
AGLECRSLLGTQIAPEDVSGIPRIVGERSVFCPPRVLLPESPEPFCLFLD
ELPASSPDVQKAFYSLLLERRIGEYRLPAGSWVVAAGNRAQDRALVRALS
TALVNRVVVLNVRVDLHEWLVWADANTVRSDIKAFINFAPDALARPVPAE
PVPFSTPRSWASLSRALDLVEQKGILDNSLRRALAFGRVSAQDAAVFCAL
AENNIAPPEPLHAYLTGAAELPAEDSARWFVLNWIREQVERVYIPDPYAY
NYRLELVPDYHPEPDPALAGVTPDHVNRFLLGLPQEHRFAVLVDTIERWS
HLGADESLLQTLVDVTGIY
120406926YP_956755.1 UBA/THIF-type NAD/FAD binding protein [Mycobacterium vanbaalenii PYR-1MMRKQAHTAKAAEAVAGTPWSITDMVLDIIDRELAVPAPERGAALIAVRD
SRLIVDVVSDPRPGESVSYWHSDQLRRRLSDYLTDNPTRRYVGTVHSHPG
GYAEPSGPDHQAFANMLATNRAIRDAIFPIVVQAPRDGLGSVLRLGDKHL
ADLPHGTFAGYSAHPTDAGLVVRPAPIHVVPAGAHAAVVADALTRHLGQP
VTVRWGEPLTVSGTAWLTAQFMIDTRTIAGVALGPSYPMTPPMVWAAESA
SPVFSSWPISATGDHLAGAVSAVLQHQTPPVAAVRAGIRERLSVHLPNQI
DAHVLLIGAGSVGSNAAEMLIRSGVKRLTVVDFDTVEPANLSRTVYGSGD
LGQLKTAALADRLTAIAADVEITQLTCPLQELTGEVLDTVDLAFLASDDM
AGEGWLNHELYVRAIPSVSVKVFAGAEGAELAYVLPARNTACLRCMMGAV
GSGDRGDADYGTGRINGSPALGPDIAAAAARGVKVALALTQTDGPLADWL
DELVSRRLTYFLSSNVAGWTYTEFARAGSLPFDGLWLTAPGRPECEICGM
ERVSDTQPAHVAAFTTSPPQGIGDVDTDDHRHGEDN
120406924YP_956753.1 dual specificity protein phosphatase [Mycobacterium vanbaalenii PYR-1]MDRRQPDLSLIAPRLWVGAAVDGVDDRIALRQARAIREVGVHVVVDCRLS
ADDSDLWAAVGDVEYHRHGIEDSGHPIPPSWFTHGVEFVMDRWQIRGRGV
FVHCEEGVNRSPCLVLAVLLVVGLSPQQAVERIVGARPTAGLRYAADAMS
WFGLFADAEDAEFTPPQQPHPSKPAATAAPMTKRTTAATTIPMATNTNPT
TTATTNAAIATTEAIAPAIHTRSQSRFALRNPRVITAVATITSAAITATA
ITAPGWSFHVRTRENRSDPPRKALAANTATTSRTSRSHDASVTVHVTGTP
TLSQRVDPRSIAPNASAGLAVGRTADDLRRSGVADRNTAGTISTAWLAPG
GGVFKSMAIPLTTAAFAFTAPHRSPDWTGGSVVAVLITELKEAAVTRTGL
ICLTPASELRELLHAGRRQLIVTFRFYHCDYYRNVTIVAVRPAEEGTQRV
DCMFRNGDVITLLLPTEESGPNVIGIVNPGRMAPKVVALKAPPPLQIRAL
EEHLRWQEHQILWGPPNPTADGPFTQHPRLGGLARTVREQIADHIGSGRP
IMAIKVLRDSCPGMSIGDAATVVEAQRLYGGD
120406922YP_956751.1 Mn2+-dependent serine/threonine protein kinase [Mycobacterium vanbaaleMAAPIDVTQLGAPEMLDRGSFGTVYRLPSYSLPGFPNLAYKEYAATPTTG
EVANLSALVDFRTRLDPVKRRILDAAAAWPLRLVTRNGTVCGFVMQLIPA
QLFGTQTLPSGATVRLPVKAQWLVVDPAKADAAGIAVPRAHDLPERIMLC
AKLAHVFGMLHRAGLVYGDLSLNNVMFSAGVPPRMMVVDCDAVQHPRVPS
IGQAHTDDWLPPEAAAGSRAQDIASDRYKLALFILRVLTPGPHASQTVDP
DRADALLDPQGSTMIRDGLATDRRRRPSAKDWYTYLTARLHQLTSPPRFT
AVAVDTAVVPVGSVVTVSWQVTDGTRVTVTAADGHSMTEDAATGQCRMAA
TRSGPFTLHAVNRYGETTLDTEPVIVLSPPTIERIDVPPINVPRIDTGEQ
HLGAALAAVREHPAVSAGSFTLPDLGPLRPMSTVALPEVLTRPGLPAPAP
TGSGSALAAVTDLLTALRADADAIVARAQVAAAGAADDRGESVSMP
120406920YP_956749.1 von Willebrand factor- type A [Mycobacterium vanbaalenii PYR-1]MTAATQHASRTADDRYVVLPFWLVCDVSASMGPHIGTLNQSLRDFRDSLA
TNPVLADKVQFGVIDFSDTATEVIPLGDFSSADLERHQLRTRGGTSYGQA
FTTVQQIIERDLAAGADRFRYFRPAVFFLTDGQPTDRHWREAFRDLTFFD
QASGQGFRSYPLFVPFGIGDADAATLAELVHPQDRSVLFMANTGTTPATV
IAKMTQAMLTSMLASGRSALSGAPQHVLPTQDELGPEIRAYPGGDFVT
120406918YP_956747.1 hypothetical protein Mvan_5985 [Mycobacterium vanbaalenii PYR-1]MNHPTLLEGQPEDSADIAEYVDAEDFWTRHYAISNADEVRSVSEQNVARI
QLVADAVAAGEYSLAKLTASRIAHIREDPEETLLEQLTARVIAEEGGVQP
LVHLLAITGGPSRAVGVKGSPRPFGNAPRGCHVIPTRCSPQALGTS
120406916YP_956745.1 hypothetical protein Mvan_5983 [Mycobacterium vanbaalenii PYR-1]MGARLRLDRAKLEYELNGTDVRHDVEWVSLLYRKRDVIEGHLWDPYEIKP
FTDQIPFALTELKWFADHVGAAPPDQRRADEVHNRYVRYPVLLGPVPYPR
PVVGPVQLAIHRDRNRGTEMLTLAVSAVSTVEWSDDHTHVEGWANLDGTD
HFVRAVYRVGKRGSGIAGSVAVFAD
120406914YP_956743.1 hypothetical protein Mvan_5981 [Mycobacterium vanbaalenii PYR-1]MREFETQECEPLPRRQSVELAALRRHDDTAAAELRNSLPLMLAGILDEVP
GAELGLTMLADPDGMVETAVSASPGDDSTALITEIATALEPIAEIAVRSN
QSVRWLTRWPVVPEIRHGSLGFAAREAAQAKATRWCNGGDAMSTQLIDDL
ATLPGQGIEVVLRAVSTAPEPRWEAQMYVVTGGDEPSLRLRAALRRRFAG
LQVASSPSDAAVWLEVGSTDLPALFAIPVAGSEAPLGAYTAAPAPIVVTP
SRIGDPEAGLRIGEAVTNSGRSTPVLLSEQERLRHIHVLGRTGTGKSSAL
AGLVNELAAGTDGALVADPHGQLCDRILAELPDEARDRVWVIRCGDVDNP
VPMNPLAETDPVRRDIAIADICATFQYLFDRNATGIVGPRFQERVAMTLR
ALASAHGSRASLLDVPIAANNDAFMDEAVKSSGNQRLQNWWRIDKLERRS
NERGEVLAWVNSKFEPFASTAAMRGILGSGADAIDFAEAMDNGRIILLDL
SKAELGEAASRLLGFMYLSRVWHAALRRRRPDRPFTVVIDEAHTLIAGAL
TSMLAEGRKFGLSVVLAHQYLEQLDAGLRPAVDGNVATTIAFRCAVSDAG
EVYKRFGGRIDTSVLVTLPELTAVTLRTAQSEPSQPHTLIIDHNRRVTPR
TGQDLDAHVADLMSSTWADLVDPHRDLTAGAVAGASNVTTMADDSTLPKP
GVPSTPPPVPGRPKKPTFLDDWLRQRTGETEVAGDRSTDTNAAEGSQ
120406912YP_956741.1 CHAP domain-containing protein [Mycobacterium vanbaalenii PYR-1]MNTKLTARLGLLLICTAVGPLLGAPTASADRTVTVNTGAGNINVRSGPST
GSQLLSTIPNGTRVAISCHVRGEVYRGGPYGRPTDIWNQLAGGGYVTDGM
LETGSNDPVVPTCGGPPAPAPTSGRSMGQTRTTNPGFAGYCTRGAYAKWF
EASGHRFYPALSGNARNWANSARAAGWTVVDDAQPRSIVVFQPGVHGAHR
ADGHVAWVDSVSQRPDGRYITLTEMNGSAGFNRWSSRTIKDIPGMAYILL
P
120406910YP_956739.1 hypothetical protein Mvan_5977 [Mycobacterium vanbaalenii PYR-1]MQPAWNEQAAATALRRHLVALGFALPAQLRVVGTPAEAMSLAARGDAIEP
YREACYRNIRSELGEYDSAHAAFVEAIDQAMALPIVNATVTVWGGWEAFP
IGANLHCVVLEAVRGVAARAAALSPEVVWVWDQLLIAFEHGLGWFTVVDD
TLIMVPMPTVVMPDGRLHCTDGPAVQWSDGSRMYFYEGVEFRRELLTRIV
TRTISAAQALALDDPHQQLLAMSAAPADDLLSELGAVCVDVGVKGTKLHR
VEGHFLPGRTDYCITMIDPSTGRCYLEWVDPAVGATHDAELCHAQLFGVG
LSEWLTLRLEA
120406908YP_956737.1 transposase- mutator type [Mycobacterium vanbaalenii PYR-1]MSRSESSADEAAAKLAQVLPAAAVDALLADAEATGTPIDGPDGLLAQITK
SVLERALDVEIADHLGYEHGDPAGNGSGNSRNGHGRKAVLTTAGPVDLEV
PRDRNGTFDPQIVPKRKRRLGQVEDMILSLYARGMSTRDITEHLGEVYGA
TVSAATISRVTDVVADEIAAWQSRPVDPVYPILYIDAIRLKIRDGGVVAN
KAAHVVIGVDVDGIKQVLGVWIQQTEGAKFWHGVLTELRNRGCRDALFVC
CDGLTGLPESITAVWPQAIIQTCVVHLLRASMRYASYTDRKKMAAALRPI
YTAATEEAAKLALEEFRAEWKTKSPGAVAVWDRAWAEFVPFLAFPVEIRK
IIYTTNAIESLNYQLRKVTKARGSFPSDAAALKLLYLAIRNINQKRGSNP
GSGTYRWTEALNAFAIQFPDRLPL
120406906YP_956735.1 transposase IS3/IS911 family protein [Mycobacterium vanbaalenii PYR-1]MPKEQSVGKPTTRRYSAEEKAAAVRMVRALRAELGIAQGTVQRVATQLGY
GVESVRTWVRQADIDEGVAPGVTTAESTRLKALEQENRELERANEILKRA
ASFFGAELDRQHKR
120406904YP_956733.1 hypothetical protein Mvan_5970 [Mycobacterium vanbaalenii PYR-1]MSRWREQVAHAATTLDDLHVVVVDETQVSGATLAVATGLISRVAPRAHVS
GTYFWRDTTNKQVGGVLQPGTVPVWYPGETSDGEELTVFGRGIGNSSPDY
WHHQPDSDAVSRKRLAAAYVSAPHHDPETYAHLADPLAQMLAQDIAYLTY
DYASGRVLRRPSFHRPDDDFDRIIADQDLAFDDFVALNDRRSTEISRKVK
ALC
120406902YP_956731.1 response regulator receiver protein [Mycobacterium vanbaalenii PYR-1]MHGIPRAYRALEELPLTPHPVVALAGCCRQPIDRSSASIRPVIGIREREV
LFAWFRCGTKAAAARELFVTINTVKTHIERVRDKYEAVGRPAPTQALLLI
RAIQDGWIDITYW
120406900YP_956729.1 integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1]MMVTRPEGVSDGQIAEGEGQRRREDPFGSGGVGRRDVGCRGRPAMRSVAG
ASTQVEVPVPRGGRRADAGGAQRRRTRGWQPRATSAAPGERRAQARPGRG
DGAVADLAARSSLGRPSPFTDLETLREAAGLPVSKFAPLAGIPERTYRRR
LARLRAGSADKGPWPAPVVDRIEALAAKYAEQWPAWGYRKIAALMRADGY
EVTNSSVQRALRRRGLLLPQGFRADRKSWAALRRRVFHDPPTERNRVWQT
DFSEFETAHGGIWRISAVIDYVTKYCLAITVTPTSRGRDAVSCVRLAVEE
ATRVLNLADLRLDRADMDVLDADDNVIGRTPASIAIVSDNGPCYRGRDFQ
TLFCGHDPLLRHIRTRIKSPQTNGVIERFFETLKYEHLFRGYIGDGDALD
MEAHRFRIIYNTIRPHQALQDRTPKQAYLAAKTPENLPTS
120406898YP_956727.1 hypothetical protein Mvan_5963 [Mycobacterium vanbaalenii PYR-1]MREVGGRDVFDEHRVAMLVEEFCRYRGVDAGTRIRVVENLDAAYAVVARK
GPDHRWKTIATRHSGADFPPAHAIVPAVAERQAYDHALRMYHRAQPASIG
RSWWLRHVVVSAAHWQRFSKAINTARQHGLGWMIRAHKDVVLVPRPALRY
LEGSPGLLDDDSGRMAVEWPDGTGFHFLRGTPIDAELYKQIVDGQLSLRA
VTAIADADVRSIALSYMSFQQLTSRTGAQLLDVGVRGTALYRLPLPGRIA
RDRSPGYGDYDYFIHMHDASHPDREFVEWVDPRIGARRDAELCQAHAFGI
TLQEWLSIEQEG
120406896YP_956725.1 hypothetical protein Mvan_5961 [Mycobacterium vanbaalenii PYR-1]MILLDDTFLSEVGLAALPAGQRQALLQRIYEELELRVGTSLTDSLSDAQV
EEFEALIDHDQTAVAAWLHSVVPNFTEDPLYMAMVEKLSAATPDAVVCEG
SAA
120406894YP_956723.1 integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1]MKELAADGIPVAVTCRVLKLSRQPYYRWLADPVTDAELVEAYRTNALVNA
HADDPEFGYRYLVEEAREAGEPMAERTAWRICSQNRLWSVFGKKRGKSGK
VGPPVHDDLVQRDFTADAPNQLWLSDITEHRTDEGKLYLCAIKDVFSNRI
VGYSIDSRMKSRLATRALHSAVARRGDVAGCIVHTDRGSQFRSRRFVHAL
GHYEMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRRWATREELRIAIVT
WIERTYHRRRRQSGLGRLTPIEFEAIMTTPASQAA
120406892YP_956721.1 hypothetical protein Mvan_5957 [Mycobacterium vanbaalenii PYR-1]MALDDDSESVRMAAWRAIRDAVVAGDDDLAEQLATRTQSAESVERVVVSA
MDRAAYENGTYRRFTGGLIRWLRRAARGDQTWAIARIGVEWWPELSLIDR
SRHRGDVTAEPEITEEEADRCLEIAAGRGHRRAAFRHDTLESLLIAYGDG
TPDDLISTADLRSIEARVAAKYAATDDSRADSWFRRATASPRWYDRDGGA
TWLEAMSGYGRWAHSHGDVALCDQVSGRVVDDAVVEGATDRCAMAADAHK
PYRDSFCLAASNESARLHIFRHLLIDHDPTPESGMELLRLFSRNHYFGPE
EHDIAAAVWERRHGPFRAAAAVESHAWQLTGFLLTEVVPSVLRLVGCDEH
AGRIVDVLATVDFSVNGFWEPVLEYDDRMRELGERSYGWGEPLDEVEMAE
YRARTDYHPHPLDRFIDELIDPARIAGWRTVEDTASALDDARRLRLLDWQ
HPLERAGLDSVASTLERGLRPRVSEREDRLLGGSDAWLAMWLATSSSVPD
GWKRRLQWSEVWNRISPMVAEILVTGAIAVAAVQRSDDANDANSAMAYDA
VQATITDGVQRHIEAVLAAATT
120406890YP_956719.1 hypothetical protein Mvan_5954 [Mycobacterium vanbaalenii PYR-1]MWAAIAVPGHALTNIIDLENLVGGRVNSSAVSDVWSEFGEVIDTRHSDQT
TVAASRRHAASAFLALPANLHRVIGAKGTDVADTALIDSVDVGWVAANFG
QVVIASGDHIFAPLAHGLQSNGLHVIQVIGRGASSATLYRACNEQKYLTH
IRDSALSSCPTTESGDSRRERRPPRVPGVPLLAAPQPGRRRMRLGRLRPS
HPYSGEAKRAPALRANGVPTRQ
120406888YP_956717.1 hypothetical protein Mvan_5952 [Mycobacterium vanbaalenii PYR-1]MPDNDTNANSGDRGIRWDVETQLAAILPGLSDEDLTDLASRVGEELHLRI
GTALSAGLTNQQLEDFEKLMDGGDDHLRNEWMETHRPDCRATVATVLADL
VAEVVRTVTATNPDAAQGNRVVAQLRRASIEVAEAHFNARGIKHTRHDDR
LRVVFAGEDDETETVVWIVMAGRRKDTFILTGFGVGIDFPQEERERVCAF
AADWNQRTWNPKAVVMVDEDTERCKVIGEIAVSIGPWITRAQVDVALGRG
VATLFGLFADVRQLLIASEPDAQMASIDVGESVIEA
120406886YP_956715.1 cell division protein FtsK [Mycobacterium vanbaalenii PYR-1]MGIPVSIVSLVLVYGFVGVFVNAVAPGDKERWLIRHKRGVDYFDPDDPYF
GHPFDVVAAIRSGLDALQRELGVMWASYVQMSEPGGHKKRILREIYESEF
NESTVRNLKIRLTFLHGSTTYLLARQEVNLSREWDQIPHIVRRASLGPYG
RDDSYTTTEYRYEPGGLLAARYRKLDRQHKGLLARKEFFNESVKLALDGL
VVPTIEWAKETLGRVGSKNTLGEVVKLHADEDSVRLAIPECAKALLPIAE
SLRRSAQPPVVDETAQKMDDDLARELEDLDAEFALKSVQASARIGLAVKA
LAPGAASEPLTEDTDAGITAAPSSYVRFGTIDSSTPAIAPFLNRAGWFIS
GDSTTRAELISQVLLRTILQVPTEALKIRSFDPMFSGVLGLLAPLGGVSA
TTYAEPQHDSDALRQLLGEVTSEVSAVSTVLGGRGMSSVIELWEADGSPS
WPLTLLVVLSYPSGIDVGLQDTLVRLAQSGPSRGMMLVVDHDTEITPPRG
VDPADLMRHMVTFKATEHGWQCSRLPDQILAAYDEALPWPARQALVQLVV
RRAGPQGPKLVRLQELVAGLTANPWSDQSVDAVEAIIGTHADGRATAATL
ALRSENPPQSNLLLGGAVGQGKSNLLLAMIYALALRYSPDELEMLLIDFK
HGLEFQRLGPDENGRNWLPHASVVCLESDKVLGLEILKHVRDELTARADL
FLRARVNSFTSYRKSTGQTLPRLLLVIDEFQVLFDGNDDVTAEAVSLVEK
LARQGRAYGIHLILSSQTLSGISALAVKAESIFAQFATRLSFKNTAEESQ
TILGRGNAAASDLTRPGEVVINRDYGRPSANETVLTGLVEPDFADEVQRQ
LWALDVRRREPVVFLGQNFAPWPIQHDGFVADTAYLGRPLSVGGGLAGFD
FRSDTSQAVGVIGTGQAEATAVLVAMIATLTAKWSPGDAVVVLDGRSPQS
RGDAVLAECLQQARARDLTVNVRTDADITDYLVSIVGSPPPQCATLVVAL
HLQRIDSLSDTKPFDPENPYGEMVSGAGALRELVGRGSISGTHVIGWWPN
VAAMQEALGYDSAGMRRFVLARAAQEDVRQVAGLSAPKSVASPRVMVVDP
DRDDGTGSGVTTVIPFDPWDPHRA
120406884YP_956713.1 hypothetical protein Mvan_5948 [Mycobacterium vanbaalenii PYR-1]MSEPVRQGEIMLLPVQAVVQTGSREAVRSYIVGHSESGHHHVLDCDREFD
VIVGTDGLLIELSGTAQLVHQADVDRHNTLIVEPGIYRVLRKRQYDPVLD
IHGPASD
120406882YP_956711.1 hypothetical protein Mvan_5946 [Mycobacterium vanbaalenii PYR-1]MEQPDPILVAAVRYPWGEVVTGRRHRNVYEAMALKGIISRDGCAEGFVGR
SGTFYTRDEATQVAVAARQVSADHSGPLNSEHLWPLTPAEKSKWRDG
120406880YP_956709.1 hypothetical protein Mvan_5942 [Mycobacterium vanbaalenii PYR-1]MRIRWRLRMAAAQREVWTGTELRRLLSERAGLELSAASVSALFTKEPSQI
KVSTLIALCTALDCTPDDLFEIDTTPVEQPAARPRPVASQPKTATARGRS
MPPM
120406878YP_956707.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MSGTRRKPGRMGPFIAGLQARWSELGYSDLAIRNMLKDVGAVGRWMQQHG
VQPDDLSPASLGAFRQHRIAAGARKIPSVKSFEPMLGFLREQGVVVEASM
NDSPLQRLLADYRGWLIDERGLAQMTVIRYENLARRFLTLYPLDAGVAVT
GAEVVAFLLQESQRVSVGSAKGRVAELRSLLRFLFVRGLTPRLLTTAVPP
VAGWRDTGIPKALPAGHVQQLLDHCDRSDPVQVRDYAILMMVARLGLRSI
EVARMQLDDIDWRTGRIILHGKASRKDGMPLPEEVGAALADYLTDIRPRT
QLRAVFVSCKAPRRAIRPDLVSDVTRRACDRAGLPRVGAHRLRHTLATEM
LQRGVKLADIGQVLRHRDLATTALYAKVDLATLRTIALPWPGDIQ
120406876YP_956705.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MSPIAPTLQAFFTDRLTKQRQVSPRTIASYRDSLRLLIGFAQERTGKTPS
RLEWTDLDADLIASFLDHLEHVRHNSARTRNLRLTAIRSLFGFAALRHPE
HAEVIQQVLAIPAKRFDKQLITFLTATEIEALIDAPDTDRWEGRRDRALL
LLASQTGLRVAEMTGLNCSDITFGDGSSIRCMGKGRKRRAVPLTTTTQAV
LRVWLTERGDVPDQPLFPTRTGRRLSTDTVERLVRLHAATAARTCPTIRP
AELHPHVLRHTCAMSLLHAGIDTAVIALWLGHADIRSTGIYLHTDLTIKQ
RALDAMTSPSTKPGCYRPRDKLLAFLEGL
120406874YP_956703.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MIDEHGHLHLRSAEHLDPIWRLWDELPAQWRGPVLGPGIQNWAAITENDW
PHLDLSGLPDPFAAELAWMAHWQASDGTRVSVLAMAQLANMIRRAVVEGR
DIPSSIRAMDYDAAAVLQSWFYLSRGKRLPSARGRGRVHALFGFARHALI
AASHDRPWWQLDFWHPRCDPRIPLTDREPVANYGCSPGDIQLPWVRAAVK
WHLGTMLESGALRWTTVSQERMRSFRRFDNWLTANFDDPTDILGDPTTAV
EQAAAFARWTAVAANRVTRQSDTRHLGRTVPIRGINDDLRAVAGLLEFVA
ANPGEARSVLGAEPWQRVNAAHSSSWFGRVTRIPHQRGFNDANYIDDHAL
AQITAALPLIGLPRTEQMTITRGDGTTLTANGLDDPQAMRMILLQILTGR
RASEIRTCDFDCLSAAPTSSGAAAGDDQSLTRFRYAQSKIDVAPDTILVD
REVTEVIAEQHRWLQAQHPDGSRRYLFARRLGNRRGDKPYPAGTYNWVLR
TLSDLVQITDAKGQVVRLSHTHRFRHTRLTRLAELGLPIHVLQRYAGHAT
PTMTMHYIAARDEHAEQAFLATAKLRSDGTRIQLSSDDHDSLHLFRRADR
FLPNGWCMLPPLQSCDKGNACLTCSVFVTDHTHRDVLERQLRETSDLIDW
TTTEFENRHSRPMPEDNVWLIRRHAEHHALTKLLDALNHAPDSATHGATT
KCHRPSAGPVPVPLDLTRHRRRTR
120406872YP_956701.1 hypothetical protein Mvan_5932 [Mycobacterium vanbaalenii PYR-1]MTTTPDAVPAPNTAAQASLYQRLRGHLAVLKLHDAAEALPSVLDRAQADG
TSMTAALEELLSIEVEATEARRLAGRLRFACLPTPASLEDFDYDAAPGLD
RKLITELGTCRYLETATNVLLIGPPVIVGSVARWPHSACSGRCCD
120406870YP_956699.1 hypothetical protein Mvan_5930 [Mycobacterium vanbaalenii PYR-1]MSTFGEQNWAFSTSAVTGGTSEPIPTPIYASVRTVAQELLLTLRQSGRTV
PNLPPASPLMGMIDSFTAADYTGKPLMLDKSRDDVSHVSFKFETLPGVTF
EIARVQLPQSEPGFDGLFPTGWLDLVGVRDASGDIVHQSGMAGPTEGSTP
PNALATGPIPTVAGPPVTFTFDNFPQAEFAAIRWQKKRETMRPWGREVRE
AGWIDLYVTLYGATWKMGGFLGPTA
120406868YP_956697.1 regulatory protein LuxR [Mycobacterium vanbaalenii PYR-1]MSELVPTGTVTLLLADVQGSTQLWETQPETMTAAVAQLDRTLTDLVSDHD
GVRPVEQGEGDSFVVAFTRASDAVACALALQRAPLAPIRLRIGVHTGEVR
LRDEGNYVGPTINRTARLRELAHGGQTVLSGTTSDLVADLLPDGGWLSDL
GTHRLRDLPRPERVVQLCHADLSNEFPPLRAREEIGVQRLPAQLTSFVGR
VDDMAQVRGLMDANRLVTLTGAGGVGKTRLATQVAVAVVEGYPGGVWYVD
LAPITDPALVAITVARALGLPDQPGRSTVDTIVRFIADRRMLVVLDNCEH
LLDACATLIDALLGACPALAMLATSREPIAVAGEQTWRVPPLALDDDAIE
LFTDRARRARPDFIISADDAAAVSEICHRLDGMPLAIELAAARVRALSLT
EIVDGLHDRFRLLTGGSRTAVRRQQTLRASVDWSHGLLTDPERVLFRRLA
VFAGGFDLDGAQAITVDGEVHRYEVVDLLTLLVDKSLLIAENTAGRTRYR
LLETVRQYAQEKLGESGEADTLRARHRDHYTARAAELDAPSVAGHERRLN
QTDIEMDNLRAAFAWSRENANTDHSLLLASSLHPLWRARGRLQEGQAWFD
AALTDYEARPGEADPAVYARALADRAFMDGHVGITDRLDQAQKALAMARD
IDDPALLVRALTACGGLAAYNADVARPLLAEAVDLARSMGDKWMLAETLA
WQAYAALMGGGDPVAARTAGEEARELADEMGDGFVSRICGWLLGIAHHFQ
GDLDAALALADGVVSESDVAHDTLNGCCGELVLAHSLAQRGDTDAARAAA
QVSLNVAVEVSPVHAGLAHAALAVANLAAGDVTAAEAASDSATRSFGPSE
VAGIQDPNVAAQIACTRGDLDTARSLVDGAVSITRGVHRASALTTRARIA
IAQGDPEQAERNAHDALSLAAGVGARLEVPDTLECLARVVGDGGSHHEAA
RLCGAAEAIRGRTGAVRFRIYDADHETTVTTLRDALGDKAFEAAWTEGSA
TSITEAIAYAQRGRGERKRPSSGWASLTPTELDVVGLVSEGLSNKDIAAR
LFVSPRTVQTHLTHVYTKLCLASRVQLAQEAARHT
120406866YP_956695.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMPQAEPTQPHAPSCRKPSDARSWSDEERRRVQRRTLVVVIASQVLGGAGL
AAGVSVGALLAKEMLGTESLAGIPAALFTLGSAAAAFSIGRLTQSWGRRV
GLGIGFTAGGVGAAGVVVAAASDNAPLLFAALFIYGAGTATNLQARYAGT
DLADPSRRGTAISVALTATTLGAVAGPNLIAPMGQVAVALGIPALAGPFL
LAAVAYVAAGSVLIALLRPDPYLVARQIDAASAREGDDTSVTAALRPTAG
AYVGAVVMIVAQVAMAAIMTMTPVHMSGHHHGLSAVGLVIGLHIAAMYLP
SLVTGVLVDRIGPHAMAVAAGITLLAAGLTAAFAPGDSLPLLVTALVLLG
LGWNFGIISGTAFVVDATVPANRPRVQGSIDVLIAIAGAAGGGLSGVVMS
AGGYAALSIACGVFALVLLPALLWDRKRTPAS
120406864YP_956693.1 hypothetical protein Mvan_5924 [Mycobacterium vanbaalenii PYR-1]MTAVRQLLRRAAYGSAAAVLVLAVSMGDVNADPAADALSKLNDLSAQAVQ
TREAVTAAQRDADARLAEQTAAEDRHRADLAAVDAANAQLAPLQDVANRV
AAMTYMSGRDGPMAAVLTAASPQQLIDRLSLQRVVAATTADQMKEYRSTR
ERAAAAAAASERSAADARAAAERAAAVRADLQAKWSELLRQIAAAEAQYA
ALTPQQQAVVDNAVPPPPLAAPAPQDPAIVAMPGLPPGDIAPPPLAAAIA
DIPEALPMGVASEVGLQPNAILAARAVSRQFPQIANIGGVRPDSKPWHPS
GLAIDIMIPNSDSPEGIALGDQIMAYAMANAARFGLQDVIWRGTYYTPAG
PQGSGYGHYDHVHITVTPRR
120406862YP_956691.1 peptidase S9 prolyl oligopeptidase [Mycobacterium vanbaalenii PYR-1]MALPGLISVEDFFNPPTRAAATISPDGTRMAFLAPWKDRLNVWVQGLEPD
ADEPRCVTADDHRSVMHFEWTDDPRWLIYLQDTNGDENWHIHRVDLDDPD
AAAVDLTPFPGAMAAPLREVRNGTTTVMLNNRDATLLDVHRLDIATGHLT
LIATNPGHVNGWLCSDNGDVFATSLTPDGDVELSRWDSATDTLQPIARFD
GSDYPVGIHPLVITPDGTGVWLGSHRDTDRSRLVRVDLVTGEETEADSHP
ELDIDPRAIVSPIIPAPLIQDRRTGELLGVRYFGERQVIRALDPGFGDIL
TNLENLSDGDVGRLSSDESGLRWVVGFNHDRDPGATYLYDHSTGESRLLF
RPMPHLDPEQLAPMRPVTITSRDGLALHSYLTLPVGVQPEGLPLVLVVHG
GPWYRDSWGFDAGVQMLANRGYAVLQVNFRGSLGYGKAFLKAAVGEFAGK
MHDDLIDGVHWAVEQGYADPDRIAILGGSYGGYAALVGVTFTPDVFTAAV
DYVGISDLANFMRTLPPIARPHLANNWHAYVGDPDDPEQLADMMARSPIT
KVDRIRTPLLVIQGANDVRVVQAESDNLVAALRARGVEVDYLIQADEGHG
AVNPENVIEMWDAVARFLARHLGGRA
120406860YP_956689.1 hypothetical protein Mvan_5920 [Mycobacterium vanbaalenii PYR-1]MSAPTGMVECPVCQIDVPAGEYCGLCGVPLAEHSGDGPHWLRARAFSAAP
GQRLLTPALTSSLFPHLTPRSRKVFLMGLGLLAAALAVATFLRMPAALIA
VASLGLPLLFVLYLRESDVFRDLPRSALALTATLGLILGAGWALLTGAAV
ARAYGVPLGAGIAGERILRDGIGVPVASMLLMVVPALVTRLSWRGTRASL
DGYVIGALGALTFTAAATLTRLAPQFTTGLVNRVRPMDGLLVEAGVRGIA
MPLTAAAVGGLIGTALWFTRPPAKAHDHRGFVRATLILIAVVVVVIYASL
GLVDVARLPQLWQLALHLTLTGIALFALRVGLHLALLHEAQDGAHIDEPI
LCVECNHVVPDAPFCAMCGAAMQACSHRSRQARRADRPIRLAENPVAGEI
VVGLLPGYSIHSGTFEATQPPTTSFRTVALALGITVVVLAGGLVGLSGLI
SRPAPKYVCPPDCGSPPMNRAVEINPRFTSADGAFSVSYPVEGAAYEISK
HADGVTAVLQAGDGGTMRLFSRPAGGHSAEEIAVDLLNETFPDTRTAYEI
PNTMVGYQPGYGLAADLWPQGAMSNSTRMRVIVMVAVKDDLALIAGAVGP
YRAFGPDFGSGKPSAASLQLALDMGKYVNSFSWRGDPPR
120406858YP_956687.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MNSAIVAPEVPTAPIHDLTGKNAVITGGSKGIGAATVARFVAGGARVVTS
GRSQPDSLPTGVEYVVADVATLDGVDLLARRAREILGDIDIIVNNAGATV
PHLGGVLDIEDAEWVNDLNINFLAAVRLNAALLPALYARGKGSIINVSSA
VTLSPPSPMLHYATAKAALATYTTGLAAEAGPRGVRVNTLTPGTVGSPGA
DAIRRAIIDGVGADRPEAGGIPIPLGRKGEASDIAEAIAFLASDRAAWIT
GSNLIVDGGQIQTR
120406856YP_956685.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MRRRRRLNRAKVATAIVSVALLVNGCEARVFGTPPAAENTPQAPVVAPQA
SLPALPEAPPNQPTEPLAGLDARVRQATADAAASGADIETVVLDRNTGQI
ISNGANKPFPIASVVKLFIADDLLLQESEGKTQLSAADRKSLDVMLRSSD
DSAAQIFWDRSGQNAVIARVVARYGLTGTTAPHNGHWDVTTSTASDLVRY
YDMLLDGSGGLPREQADIIIGNLARFTPTGVDGYPQRFGIPDGLNAEPVA
VKQGWFCCWNGGNQLHVSTGIIGPDRRYVMAISSLDPTGDAAARENITRA
VRTMFPGGKI
120406854YP_956683.1 putative outer membrane adhesin-like protein [Mycobacterium vanbaaleniMVTNRRSGMLEDSTAAGLPRRGRHRRGRPRRLQPYAWLGAGAVGFGLGAA
ALTGAGSAHADESAADPSSSSASSVSSSEDANESRAVSSGADPDDATEDR
DPPESEAPESQADTDDSATAEAAVPEETATETDIVDGGGRRAHPGSDAES
RAAAVEDLQDDDAATVDLPTDVGGSAAANTEPTAVLSWQSSPGWLTGRVT
GRIRAADPDGDRLTYAGTATTGTVAVTSWGSFTYTPSAAARHAAAATDVT
PVRATDTFDITVSDGWGGIVAVPVTVRIRPANSAPAWLRSTVAAPDPATG
QVTGRVTATDRDGDVFTYTAAAPSEGAVTVHADGSFTYHPSDAARRRAAS
TWYTDTDSFRVLLDDGHGATRAITVRVRIAPHNSAPVSGTPTYGPPDPST
GAIGGSVTATDPDGDRITYRLSAPPHRGALVVTGDGRFTYTPTPVARHAA
ATGRVDSTTDAATVEAGDSLGALTSIPLTFTILPANSVPTSLRATVGQPD
STTGVVTGAVTADDADGDPLTYSGSTVTVKGAVSVAAAGTFVYTPTANAR
QNAQAPDATAADRADSFVVTVDDGHGGMATLPVTVAIGSVPVPDPPDPPP
PPGALPAFPGAEGFGSLATGGRGGSVVYVTNTNAAGPGSLQWAIDQPGAK
YILFKVSGVIDTQIHLTNGDVTIAGQTSPGGITIRGLVTDESPYQDQAVR
APADFAENWILQHIRIRPGLNGPSDDGLRIRYTRNAVLDHVSIGNATDEA
VEISYSNNVTIQNSIIAETLGGHSFYGGVLMNYSNPAHGFGLDNIALHHN
VINRIEGRLPEGSRESLAAAYSTMNLELSNNLYWDPRFFIALGPNTNIVT
DSSGNPYPIYWNLNAVNNYFRTGPQFPYGMFDDQILRVVGNTLYVSGNRM
SSYPSRSDYELFYCCNDFASVSNPDDSSHRAQKLSARHPFPAITYTPTEM
LRAVLRDRAGAWPRDPMDIRLLESVAGDTISPADPATNPAGDALLPPYTG
AAPAAPPDTDGDGMPDAWEVGKGLNPLSANHNATTLSLLGYTDLEVYLHE
LSASLVDPARALG
120406852YP_956681.1 carbohydrate kinase [Mycobacterium vanbaalenii PYR-1]MAIPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIAKMSAGHP
LDDEDRYPWLESIGEWLARHPQGGVMSCSALKRSYRDQLRRHCPDIEFLH
LEGSVETIGRRQASRPGHFMPAALLESQFETLEPLEPGERGVTVDVDQSI
DGIVENYISTTDSLTAEED
120406850YP_956679.1 hypothetical protein Mvan_5909 [Mycobacterium vanbaalenii PYR-1]MFTAVRPCLSAGIALVGASVIAVTPISPPPTASVVASPAVQLAAIPSPLQ
LYTQVLETTLANVDAQFEYYFSEPFPIIGATLENYAQAFEDAVTALQSGR
SDELFVSVTRIVLQPLRSIVLSTGGLLGAYYLPSQLLKNLFGAAIGPLLN
GIAGTGLAIADVFEAITTFDVIGLVNSVINIPARIIDGVLNGVPGTSFGS
FDNLPGLLTPRFTRPYSSSLITLLIRLDQEMGRAITPIPPFPPSAINTWS
GPEVQTMMHTTEPATEPVAVQEQLPTADEAVPEENGPVAEELDLPMFDVP
GEDVLGEDVPEEDIAEAVVPEEVGPEEVALGEDVSEEADDLVEEEPALAQ
EQALTDTELTDDEPSSPAPTDEANDPDSETND
120406848YP_956677.1 integral membrane sensor signal transduction histidine kinase [MycobacMMVQAPAPSLGAAVASGPRYLLSSWPWRALVWTMFGGVLSAVLLIGAPLI
LLLGVSRSLRNAVWSPLLEIECARLSLIDDAAAERVRRDLSTARVEQRLP
ALRQVGYVLFTALIAGPWGVVLVAFLAILTVVMVAAPWLVRPGEPINVAL
WLIDTPGEAWFAALLGLVVLVLTAYLVGAYAAAVGQLAVVSLADPQALQR
EVTRLEHSRTALLTAVEQERRRIESDLHDRVQHRLMALALTLGLAENVHG
DNDAGRLAADAHRQVDDIAAELRAVLLGIQPRALTEHGLIAAVTDLIGPY
PLPVRVDFGATEVPRRLPSAIEQTAYLVLTEALTNVVKHASASTVTIAAD
RQDGMWWFMIRDDGCGGAVLQQHRGLATLAARVQAVNGTLTISSPAGGPT
EVSMRCPI
120406846YP_956675.1 thioredoxin [Mycobacterium vanbaalenii PYR-1]MTITNVKCRHCGTVNRLPAAANGTPRCAKCKNPLPWIAVAGDDDFAEVVE
RSKVPVLVDLWATWCGPCRMVSPALEQLAAERAGKLKLVKVDVDSARQTA
ARFSVQAVPTLLVIAGGTVLARQAGAAPVAALRTWLDQTLTRPR
120406844YP_956673.1 hypothetical protein Mvan_5903 [Mycobacterium vanbaalenii PYR-1]MSRFRAVTALAVALTAPWLWVPTAHAETFAQLPPVPVVASPTCGGSVSAE
AQAAPVQTYDRVDGGVRVAIHYDAGVYDGSCALTVAATWTNLDTGASGGG
DITAVSTIDGHYGFIGYANTTFQTGSGTVVVTVSSHPGAQMRVTT
120406842YP_956671.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMTKTLDTPTPGPLQQLGRKRLILWAAVLTLANVLADVVVGSPLMVLPLLL
DHFDTDQAGWLNASAMLAGAIWSPLLAKSSDIFGKRRILTGTLLLAGVGA
VVCLVAPTLWIFLVGRFLQGAAFAAVFLTVALARQICSPRLAMAIVGVVT
SGSSLVGIIEPFLMKPVIDMFGYRGVFVAAALLAVGAASCVRIFIPESPI
RSTGRVDIGGALLLGGGLGAVLAYISLGRDLGWLSGTMILLLAAGGVALA
GWVLLALRVDQPVIDIRALTRPILLTLLALVLAAGAFRSVLQLTGIIAQV
PPDLGLGYGLGNGEAVAVLLAAPNLGIVIGGVCAGWLAGRVGPALPLLVA
IAVGAVGTFAMSAGVSVLPVAVACGALLGMAAGAIGASGYNLAISLEVPE
RQGAIAGLVSVVLALGSVIVNVVGAEVLKGTQIPGVFAGGAPVSTVTGVY
LYVAMAGSLFVVAAVPALILARATTTRDVRGS
120406840YP_956669.1 DNA gyrase/topoisomerase IV subunit A [Mycobacterium vanbaalenii PYR-1MTATLDVPEQNPDLVLDQSADDYWNQYQLTFALYSVSDRAIPSAFDGLKP
GQRRLLYQMHDSKLLPGNKPQKSSKICSAVTGNLHPHGGASMYGAAALMA
AEFQRVKVIDGQGAFPRIQGDIPAADRYTEMRLSAPGAALTAELDNHAVP
MVPTFDGEWTEPTWLPARWPVLLCNGAVGIAEGWATKVPAHNPREVMAAC
RALLKTPNMTDDRLVKLIPGPDWGCGATVVGETGLREYITTGRGQFTVRG
TVSVDGKNCIVTELPPGVASNTVQDRIRALVESGELSGVADMSDLTDRRN
GLRIVVTAKRGHSAEQIREQLLALTPLESTFAASLVALDENRVPRWWSVR
ELISAFLHLRDSVVVRRSEYRLEKVTARRHLVAGLMTIHLDIDAAVAVIR
GSETVDEARQGLQERFGIDAEQADYVLALQLRRLTKLDVIELQAEAEKLD
AEFAELTELVANPDARRKVIDEELVETAKLFKGPEFDRRTVLDFDATPVS
AGADEDGPRERKVNAAWRLDDRGVFSDSHGDLLTSGLGWAVWTDGRVKFT
TGNGLPFKIRDIPVAPDITGLLCSGVLAPGHHLALVTRRGKILRIDPAAV
NPQGAAGNGVAGVKLAAGDPEDAVIAALPVSCANGEALLSISEKSWKVTE
VADIPVKGRGGAGVGFHPFVKGEDAVLAATISATGYVRGKKAVRADNRAK
ASIKGSGVDVTPAG
120406838YP_956667.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMSEHEVRMIILSTDDLDESIKFYSETLGMPLKFRDGTHFAALDGGSITLA
LATAVDHPIPGQVVVGIKTDDVDAAAKAIEASGGGIVKAPCDDAHERRAV
VYDNKGNGLVFYKPLAR
120406836YP_956665.1 glucose-methanol-choline oxidoreductase [Mycobacterium vanbaalenii PYRMTDFDYIIVGAGSAGCVLAHRLSEDPRVNVLLIEAGGRDRSPMIRIPKGV
GKILGDPKLTWHFPVRPIGPSQIVEQWVRGKTLGGSSSVNGMVYNRGSAP
DYDALAALGNPAWGWDHILPAFRAIENHELGPDPTRGTGGPLEISVDAHL
PRICHDVIAAGEKLGWSATDDVNGSDAARIGPAPRTIRNGQRVSSARAFL
HPVAHRPNLTIATDTTVNRILFKADKAIGVQATTSKGGAAVCTAGREVLL
SLGSISTPRLLQLSGIGDRSLLRGLGIDTLADSPNVGRRMREHRCFALQF
RLDRPVGYNRQLSTPLRQAFTAARYLATRRGPLAGAAFDVIGFFKTSPEL
ERPDAQILMAPFSLAPYEQGKEATVERDPGIQAIGYLLRPDSEGSVAITS
SDPEAPLDIDPGFLITTHDREKGAALFRTMRRLFSQSPVADHLVAETRPG
ADVSSDQAIIDAALTQGYCGYHAIGTCAMGPEDDDVVDSALRVRGVRNLR
IMDCSVMPTMVSGNLNGPVMAMAWRASDLILSGG
120406834YP_956663.1 molybdopterin binding oxidoreductase [Mycobacterium vanbaalenii PYR-1]MDLRGRTHLDPAGPYKRDPPAPHALTERCTSTADLIVLCHFGVPRVDRGS
WSLRIEGLVHHPTTLTFDELLRYPRTEITAVHQCSGSPFDPAVPTRRVGT
ATWAGARLADVLADCRPMPQARYIWSYGADGGTFAGAAVDSYCKDLPLSR
VDADVLLCYEVNGEDLPAEHGFPVRLLIPGFYGTNSVKWLTTITLADRRA
PGPFTAQWYQDPPAAGSEDPHPVWSLAPESLIVAPAAGQSLHRDAEVAIW
GWAWADGGVSQVDVGIGGSWHAAEVEGCRGWQWQRFSTAWTPSQPGTVEV
AARATSSLGQVQPTSGHRNAVHSVMVDVRDEEPWT
120406832YP_956661.1 activator of Hsp90 ATPase 1 family protein [Mycobacterium vanbaalenii MEITHSTFTLERRFPASVERVFQAWANPEARRRWMAQGAEHSQNFVVGGF
ETVKGFDGEGRALTYEARYAEIVLNERILTTSTLRAEDRLSTVSVTSVEF
RAEDADTRVVLTEHGIYLPGQEQPEWREHGTAQQLDTLAAELAAGADAEG
DRGAR
120406830YP_956659.1 hypothetical protein Mvan_5888 [Mycobacterium vanbaalenii PYR-1]MATNSRTTVSEDLTDPRAQKLVGTDSPPVVWLARLGALFLVLELYIFGRW
VTSDSFQRVMPGPDDGTNMVWIWFWDVLSIGGSIVFVAWIVRKRLREGEL
PPVAIVAMAWMLTAWQDPLVNALRPVFSYNSHFLNFGSWGEFIPGWIDNG
GVNPQPIFWWIGIYLFFVPLNMMGVDAYLNWVRRHLPRINRAGLIGFLMI
LMFAQDVIGEWITLIQGVDRYLWVGGSISLWPGTDYQFPLYEGIFWGCGM
VGLSAMIYYFRDARGHMFTDRGLARLKIRRGRTLIRVLALGAVFNAAMIV
FNLGYVAVNQHADTTQPTVPSYFQNGMCGLGDHPPCERGWW
120406828YP_956657.1 hypothetical protein Mvan_5886 [Mycobacterium vanbaalenii PYR-1]MTTASPRRAIDLVLSPAPAPARAGGISLTVLRIVAGLWLAHVWWKVPPDF
GEARRTGLWFWTHLAVDHPVFPPYSWLVEHVVLPNFTPFGWLVLVVETLL
PVLLLTGTAVRLAALIGIGQSLAIGMSVAQAPNEWPWAYAMMLGIHLVLL
LAPSAQYAAVDAIRAARRDGEPAPIARRLLGGWGLLLALVAIVAAVKSLG
DPFVAPRGSGVGYPPLQLFLGDYNMLAALVLLIVAGLMLAAAAVRIRALA
VTSAAIAALAALSIYVQLGRGEVWLGGNPSTAAVFVCAAVIAVGARPLRV
SS
120406826YP_956655.1 hypothetical protein Mvan_5884 [Mycobacterium vanbaalenii PYR-1]MSDPLIVGAVAYTPNVVPIWEGIREYFDSAGEPDAAMDFVLYSNYGRLVT
SLIAGHIDVAWNTNLAYVRTVMQTDGHCVALAQRDTDVGFTTVFVAPSGS
GLSGPTSIAGKRLALGSADSAHAAILPLHYLTRAGVPPSDLQVIRFDTDI
GKHGDTGRSELDAIEAMLAGEVDVAAIGSSTWEAMGRDELMAGTLEEVWR
TDGYCHCMFTALDTLPAQRYTPWVDKLLAMDWDNPEHRRILELEGLRRWV
RPHLDGYEPLFAAVEEQGVDPRW
120406824YP_956653.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MPLVPTRAGTLAYHVRGSGPTVVLLPAALHDHHDFDAVSADLARHHRVVA
VDWPGCGDSPPAPDPHAVTAPVLADGLEDLVAGLGEEPVVLIGNSVGGFA
AARLAIRRPHRVAGLVLVNTGGFLPINPIMRLFCRTLGTPQVARRILPAF
IRLYMQADNDLARAARDRAVTRAKTTSGVAMTAALWRSFATDAHDLRRDA
DKLTAPALIVWGSRDTAIPLPIGRATHTALPRARFETLPTGHVPFASAPQ
DFLAILRPFLTRTLGTTAGSPHQ
120406822YP_956651.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MLSTHSRLRIAGQMIVAVAALTAAVLAAPATAHAFSRPGLPVEYLDIPSP
SMARDVRIQFQYGGPHAVFLLDGLRAQDDFNGWDINTAAFEWYDQSGISV
IMPVGGQSSFYTDWYRPSRSNGQTYTYKWETFLTQELPQWLASHRNISPT
GHAAVGLSMAASSALTLAIWHPGQFVYAAVLSGALNPSEGWWPTLVGIAM
NDAGRFDAESMWGPSSDPVWKRNDPTENLGKLVANNTRIWIYSGTGKASD
FDSDATVGNLAAAQFLEKFLARTSRTFQEKYLAAGGRNGVFNFPSDGTHS
WNYWGQQLRQMKPDLQRVLV
120406820YP_956649.1 metallophosphoesterase [Mycobacterium vanbaalenii PYR-1]MATLPRAGAVGAHPRDHRPALLTDPFLQRPEPDSTEVAWFTEFCGDAHHV
LIGDGVGAMTDTELAAAAAGGAAHGVRVVAAQTVRLSRVAEDRDSHLPAD
RRPARGIAARAVYRHHAAVVVPAGDREPYRVISVLGDRFVVSETFSVGGP
LAPGMPAVIMLTSDHQLLVNTAANIEFAARTITEQLGKIDAVFMPGDLVN
VPDRASEWFDDERGSAFFAVMQGRGGRVASDGKAYRGAQILQHAPLYPAI
GNHEVQGRRAGHTSLDDSLHNAVPRAVAEAEYAKVADSVNPTGDPAVKSQ
WVEDNSFSVTTYEEIFSPPRSGPGGKRYYAATVGDVRLITLFATRVWRSD
RADADPAARTTGTRFQESHQHLTDPLAQGHGEFIFDDLAVGSRQYEWLRW
ELESPEFRDARFTVVMLHEGPHSLGENVVPAFTPPCRTEERDDHDRLVGI
RYDYPAAENLLLRDVLPLIEHAGVDLVCNGHNHLWNRFTSPAGVHYLEGS
NTGNSFGAFPDGSGRRRPVPPPPWNSEDTAAQGNPGGLSPTVPTIAPRRD
GGGRPLPYIADNNTVVFQAIYTGTGTVTSWYVDMADTTAGAVKFDEFRL
120406818YP_956647.1 phosphonate ABC transporter ATPase [Mycobacterium vanbaalenii PYR-1]MVVPDQVAGPTPARTSRATAIEVDDLRLRYRGASTNVLAGVNLRVEHGET
VALIGTNGAGKSTLLRCLVRLAEPTSGTVTLAGTDVTAAPRRALRGIRRD
IGFVFQRFHLIPRLTVVHNVVHGAMGRHGTRCAWPLTSPAEVRREAMASL
DRVGLASLAERRVDTLSGGQQQRVAIARMLMQRPTIILADEPVASLDPAS
ATAVMELLSGIAAERHVTVVMALHQMDLAMSYADRVVGLRGGTVDFDKPA
AECDAAQLEPIFADGVS
120406816YP_956645.1 UbiC transcription regulator-associated domain-containing protein [MycMMNHHLEMINRYAGQPLYRQLSDVLETRLAQRAKPGDKLPSEAELSQEFE
VNRLTVRRALDELNQRGLIETVRGKGSFVATPRMRYDISAGRDASFTRTM
LELGHRVGITVLGSEITESSELAAELRTDGELFVCTTLRLVDDEPWSVTM
TSIPTARFPRLAQQWAGDTSLFDYLHDNHGVRMQRASRTFAASLAEPAEA
EHLRIRVGAAILEMRGLNIDEDGIPVAAVRHRFRGDHVQFTVDLT
120406814YP_956643.1 hypothetical protein Mvan_5872 [Mycobacterium vanbaalenii PYR-1]MRWDAVHDSRTTFLACMRALCSPGTPIELSGTPQICEHPELDRGAAVLLA
LLDRGLGLGTHGGDAVHRVADMVCALTGADSAEVGAADWVLVHGPAATPI
SQARRGTRRTPETGATVVIATAGDARPLLLSGPGLPEPATAFVPLDALAL
HALSAANANPPAGVDLLIVTPECLIGLPRSVAIQAVP
120406812YP_956641.1 phosphonate metabolism PhnJ [Mycobacterium vanbaalenii PYR-1]MTPEPPTTVAALAAAHGRREAYAYLDEDTKRNVRRAILKALAIPGWQVPF
ASREMPVARGWGSGGLQVTLSLVGPADTVKVIDQGDDMSVNAAGMRKLIS
TSARCESTTSTAAATIIQSRHRIPEIDLRPDQLLVLQVPHPEPLRRVVPD
DIAALAAHAERDYTAAWLDLYDAQARLGGPRTGADHPVLVAGARLMSPSP
IPRYDVLRLDRRPHPILLGAGRRARLTALPPYTTVQPLAFDDIALDPEDA
EAPCWLCGSTTSYRVPTDGPSASQVWCCSDADACHSRREETAP
120406810YP_956639.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MTPTIATTRLSKRFANGVDVLDGAQVTATGGQLTLIHGRAGSGRTTLARC
LTGVYRPDAGAVTLRLGGRGDVDLTTADPRTVAWLRAHHVAAFDGPLAAA
PILTAQAAVARAAGCTQAGALAGLTRLGVADAARTPLGRLRAAQRHAVAL
AATLLAERPFIVLDGPDEYAPLQALTTWLAEAVAAGAAVIVTVAAHSPLE
SIATAVGELRKGEIAWHTV
120406808YP_956637.1 hypothetical protein Mvan_5866 [Mycobacterium vanbaalenii PYR-1]MTARQRDCDSVVTSGRLARATQFFDAAEHLEYDVPSAGGDLDVNSGIAPD
QNARSTDSTR
120406806YP_956635.1 cation diffusion facilitator family transporter [Mycobacterium vanbaalMTTPLSRQQEHRLLSRFMLLSLAAAIVTMALKAGAAVITGSVGFLSDALE
SGVNLVAAVVALWALRVAARPRDADHHFGHGKAEYLSALVEGAMIFVAAT
AIIWSAVERLMSPAPLVQPGVGLALSTAAAGVNLVVGVTLLRMGRRHRSV
TLVADGKHLMTDVWTSAGVIVGISLVALTDWYPLDPIVALAVGVNILWTG
YRLLRGSMSSLLSAALPEQDHAAVNAVLDRYRSEYPIEFAPLRTVESGRQ
RLVFVVVTVPGEWTVQAAHDLADRLEEDIDAALPHTETFIHVEPAGTSAR
120406804YP_956633.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMDVGRSTEGRPIQLGLGYNAAQFTLLVVVNALVGGMLGQERTVLPLLGEQ
EFGLRAYTAGLSFILVFGLAKAATNYFAGTLSDRFGRKPVLVAGWVVAVP
VPLLLIWAPSWSWVLAANVLLGVSQGLTWSTTVVMKIDLVGPARRGFAMG
LNEAAGYGAVAVTALATGYLAEAYGLRPAPFLLGLAFAALGLGLSAVFVR
ETHGHARLEAATHVARADGRHDHLHDQLTNREVFLQTSFRERALSSASQG
GLVNNLNDGLAWGLFPILFASAGLSVGRIGVLAALYPAVWGVGQLVTGAL
SDRWGRKWMIAGGMWLQAIALAMIANGDDFAVWAVAAVALGAGTALVYPT
LLAAIGDVAHPAWRARAVGTYRLWRDGGFAVGALVAGVVADVLGVRAAVW
TVAALTAASGLVVALRMYETHPGPR
120406802YP_956631.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MADPSTRSRILDATAELYRRQGMPATGLKQISAAAQAPFGSIYHHFPGGK
EAISVEVIRREGIRYAELVGAQLADTDPLTGIPQLFEKAGRDLEAQDYSE
ACSIETIALEVASTNERLRVEAAEVFQSWLTGLAAWFGRLALTEPECRRL
AMITLTALEGAFVLCRTLRSIDPIIAAGHGVQAAVRAAATTRRS
120406800YP_956629.1 hypothetical protein Mvan_5858 [Mycobacterium vanbaalenii PYR-1]MRQKRTVAVGAAAVAVAAVIASCSNTAGNEASSTASPAPVQTSAATPAAS
HNQADMMFTRHMIPHHQQAIEMSDMIIAKQGIDPRVVDLAEQIKAAQGPE
IAQMQGWLDEWGMPGNMPPGHGDMPGGPMMPGMPGMEGMPGMEGMMSPAD
MQALQNAQGVEASKLFLSQMIRHHEGAITMAENEIENGQSPDVVELAKTI
ASSQRTEIDTMNQILKSL
120406798YP_956627.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium vaMNHVLSIHHAQLSEQRQLGRYERPATMVGQTPVLRITVPFTDADRGFWAK
LEGFNPGGMKDRPALHMVQRARAAGALKPGARIVESTSGTLGLGLALAGT
GYGHPVTLVTDPGLEPIVARMLTAFGAHIELVVEPHQHGGWQQARRERVQ
QILSSDPHAWHPDQYNNPDNVEAYRGLAHELIDQLGSVDVLVCSVGTGGH
SAGVARVLRETDPQLRLIGVDTVGSTIFGQPAGARLMRGLGSSIYPGNVD
YAAFDEVHWVAPAEAVWACRTLAATHYASGGWSVGAVALVAGWAARNSPP
ATTVAAIFPDGPQRYFDTVYNDDYCRAHHLLGGAPPSHPATIADPLAQVA
TAWSRCTRIVDPTRVMPR
120406796YP_956625.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium vanbaalenii PYR-1]MPQAPCPPSLRVTADRLRTAAVAVAVLLIAAACSSTPAAAPAPDVITDKG
TPYADLLVPKLQASVTDGAIGVPVDSPVTVTAGDGVLGQVSLTNEAGVVV
DGQLSPDGTSWSSAEPLGYNKQYTLQAEALGLGGVTSTSATFETHSPDNL
TMPYVAPNDGETVGVGQPITIRFDENITNRLAAQQAVTVTTDPPVEGAFY
WLNNREVRWRPAQYWKPGTTVEVEVKAYGVEFGDGLFGQDDASTRFTIGD
EVIATADDATKMLTVRRNGEVVKTMPISMGKAKTPTDNGTYIIGDRYSFL
VMDSSTYGVPVNSPDGYRTEVEWATQMSYSGIYVHSAPWSVGSQGVANVS
HGCLNVSPANARWFYDNTRRGDIVEVVNTTGPTLSGTDGLGDWNIPWDRW
KAGNAND
120406794YP_956623.1 hypothetical protein Mvan_5852 [Mycobacterium vanbaalenii PYR-1]MMVWYGGHMGWWGYAAMGIGMVVFWALIIGGIVVLVRLSTGGTTAPAQPP
ATAEQILAARFARGEIDEAEYRDRLAALRG
120406792YP_956621.1 hypothetical protein Mvan_5850 [Mycobacterium vanbaalenii PYR-1]MVERTRDDAGRPRNARPRDALGRLLAPGSEGVPRIPDDLALPPSDSLAYA
QDLLDRGLAFNAHEVLEAAWKSRPAEERSLWQGLAQLAVGITHIQRGNLV
GASNLLQRGSGRLSEVGRPAPHSVDIDGLIGWAAGLVGDLGPAADISPSR
LRPTLTRSSAGRG
120406790YP_956619.1 putative transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MSAASPGEPPGRRRDVLRTLKAASGPMSIGAIADALDIHPNTVRFHLDRL
VSQGQVERIEPDRRRPGRPPQMFRAMPQMDRAGPRHYRLLAEMLAMSLAA
DGDPPTRAQAGGRAWGRELNVRAPRRKQSGAEEAVDRLVEVLDDVGFVPE
RLGAGEKQQIGLRHCPFLELAETQSRVVCGIHLGLMQGVLERQGAPVTVD
RLEPFAQPDLCLAHLTLRGRPPQA
120406788YP_956617.1 hypothetical protein Mvan_5846 [Mycobacterium vanbaalenii PYR-1]MSAGEEEPDYRFTLANERTFLAWIRTALALIAGGIAVVQFVPSFGIPGVR
HGLSVALTAGGGVLAALAVRRWQRVQAAMRRDEDLPPTHVPLLLGGAIFV
VTMVVLVVLLVWPPSGQ
120406786YP_956615.1 dehydratase [Mycobacterium vanbaalenii PYR-1]MTATAQTSPLEARVGHHYQMAGTYLVGREKVREYARAVQDYHPAHWDVAA
AAELGYSDVVAPLTFTSAPGMQCNRRMFEEIVVGYDTYLQTEEVFEQHRP
IVAGDELVIDVELTSVRRTAGRDFITVTNTFTDTHGERVHTLHTTVVGVT
AEDIDAGVKVAVQNAMMHDMNILDIGGSDADYEKTVRPGHDIRISEGTLT
RTPGTASFDDVKVGDALPAHHTRLSRGDLVNYAGVAGDANPIHWDEDIAK
LAGLPDVIAHGMLTMGLGAGFVSAWSGDPGAVTRYTVRLSQPAVVSAKEG
ADIEYSGKIKSLDPETRSGVVIVGAKSAGKKIFGLATVNLRFR
120406784YP_956613.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAVGRPREFDPESVEQEAMQLFWERGFDGVSISDITAATGVNRRSIYAEF
GSKEKLFERATLRYLAGPGGYLTEALTQPTARAVAEAMVHGAADTVSGDP
HGCLTVGNAPGLSELRESTVQRIAERFDAAVADGELPAVDTMVLARWIAA
VCQGLAVQARSGAGRAELHAVADLALAGWPKPPHPAVV
120406782YP_956611.1 hypothetical protein Mvan_5840 [Mycobacterium vanbaalenii PYR-1]MSEQAELSPTDWVREQTQRILEQGTTDGVEILDRPVVLFTTTGAQSGKKR
YVPLMRVEENGRYAMVASKGGDPRHPSWYFNVKANPAVTVQDGDEVTEGV
ARELDGDERQHWWELAVAAYPPYAEYQTKTSRQIPVFLVEKAE
120406780YP_956609.1 hypothetical protein Mvan_5838 [Mycobacterium vanbaalenii PYR-1]MGSDRSDGMARRRRALHFALKGRRDPASGAGQRRRTSGRLSERHTRKVLD
LTIRLAEVMLSSGSGTADVVATAQDVAQAYQLTDCVVDVFVTTIFVSALP
TADSPPVTIVRAVQARSTDYTRLADLDRLVRRITSGGVSVDEAHEAMDEL
SEQPHPYPRWIATAGWAGFALGIAMLLGGTWLTCILAAGTSVLIDRSGRL
LNRVGTPMFFQQAAGASIATLVAVAAFLFAGQGPTTLVATGIVMLLAGMT
LVGSVQDALTGYMLTAVARLGDVLFLTLGIVVGILAGLQIAALAGIQIQL
RVDATEYFVVPTTPRQIVVAVSGAALAGACLVIASYAKWRSVLTAGVAAG
LAEAVLIGLGRAGVGQVVATGTAAVGVGLLATLISIRRQAPALVTATAGI
TPMLPGMAVFRAVFYFAVERDFAAGMAQALAAAATALAIGAGVVMGELAG
SPLRYRAGRISDFLRVEGPPGLRRAVGNVVALRPAADQQSSRSPHQRSWS
VALEPELSEVATEANGEDPAPERDATGER
120406778YP_956607.1 putative methyltransferase [Mycobacterium vanbaalenii PYR-1]MEEPATPVSNVSDTARWVAVYRAIESARADAVFDDPFADRLAGERGREIV
ATVPRMMRSGWWMVARTKTIDDILMDAIGAGCDRVLNLAAGLDTRPYRLP
LSAEFSWVEADLPELIAEKEQLLAGESPRCRLTRHPVDLSDPVARDRFLD
EALSGATKALVLTEGLLMYLDPSDVDDLSRALVRSEVAWWMLDLAGPGLK
KWMNDNTGGLLRNAPFKFAPANGVGYFEQLGWRTREVESVFVVARRLRRL
PWLLRLVAWLPQPDPHRPPADRPWSAVVRLTR
120406776YP_956605.1 hypothetical protein Mvan_5834 [Mycobacterium vanbaalenii PYR-1]MAVPLGLALGALIGVLLGLLGGGGSILAVPALVYGTGLSIGQAIPISLIV
VAAASAVGALPRIRAGQVRWRMAGIFAAAGIPATVAGSAVSRHLPEPVLM
IGFAVVMVVAGIRMLADQGHTGTACEIRGGQVDWRRCAPRSIGAGLLVGV
LTGLFGVGGGFLIIPALVVVLGIEMSTAIGTSLLIIVANSLAGLVSHLDA
VGGNWSITAAFVGAAMATSLVAGHFGTKVDTDRLQRWFAYLVFAVAAYVL
VDTIIFR
120406774YP_956603.1 hypothetical protein Mvan_5832 [Mycobacterium vanbaalenii PYR-1]MQTETTPSANLKIWNRLQHLPLGKWMFSRAVCLKAPYFRTIHPAIEELRP
GYCRVTAPNRRGVHNHLGTFHAIASCNMAELAGGMMTDATIPSTHRWIPV
GMTVEYKAQARTAVTAIAHLHSIPEFGSEPIDLTVPVDVSDESGNIFVTA
RITMRITPRR
120406772YP_956601.1 hypothetical protein Mvan_5830 [Mycobacterium vanbaalenii PYR-1]MADPAVDRRSIPTLLLPLAVSLATAATLMVNYLANGLPINGQTTGDVTRR
FEVYFVPAGYVFAIWSVIYAGLIAYSVYLSLALARGRRDSGAARAIAPLY
LLTALANCSWLFAWHYNLFPLSMLLMVVLLGTLIVIYRVQAARPALSTVE
RWTVHIPFRVYLGWISVATIANATITLDDAGWSGFGLSEPTWGVIMVVVA
TALGLTMGIGHRDIAYAVVLIWALVGIAVRLHDTAPILIAALAGAAALGL
SLIFVARRPRLRDAV
120406770YP_956599.1 AraC family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSIPTDGRSRHIAMVVFDGVRTLDLTGPLEVFDVAQALGCRYSIGLYSSS
GATSVRCSSGLSIDAAPASVAASEVDTLLVPGGECLVAGGVPAHLRRAIR
ALAPGARRIASICAGSFALAAAGVLDGRRATTHWRHLDTFARRYPSTRVE
RESVYTRDGETWTSSGGTAGIDLALALVGDDFGAAVAQEISKEMVVLGRR
MEGHPQISAAARTPRPKHPELERLMATVVVNPAGHYELETVAAQLGLSPR
HLARLFKAQVGVTLREYVNEVRLENAVALVLAGESFHAAAQRSGLRSGAR
VRDHLIARRTPA
120406768YP_956597.1 nitrile hydratase [Mycobacterium vanbaalenii PYR-1]MKLQHNLGGLEGLPQPLTLEKRVFVEEWEKRIFGIHVAMMGLSNHLGSAL
PEYPIAEVPTAFRDEWTWADLRTGAEAMNPFDYFKFRYYEKWLGGITQFF
IDKGYVSEDELAAAVGAAAPSPDGAGDAIDDQVIDYLRRGDSPRRDVAHP
RFAVGQKVRITDVPAGAHTRLPGYLRARTGTVQRIFEGDYGYFVETGDGI
GDPMPIYIVEFTPHELWGVRAEPGANTLYAELFEAYLQPVEENQ
120406766YP_956595.1 hypothetical protein Mvan_5824 [Mycobacterium vanbaalenii PYR-1]MTLHSTCTTDQAAPSFDHEWQRRAFGLALALSEFGHYPWSEFQQSLIDTI
GAWETSTDPGRGEWQYYDHWVSALEHVVKQRELLTKPLATDDGDHAVADD
HH
120406764YP_956593.1 amidase [Mycobacterium vanbaalenii PYR-1]MVDFQEYRAQDATGLARLVAEKQVTADELLALAQARAAQVNPRINAIVRD
VPAAPAGIADGPFAGVPFLIKDLAQDYAGLPSSRGSRALMSLPAAEHSTI
VQRWIDAGVVIFGKTNTPEFGAKGITEPVAWGPTRNPWDVTRTPGGSSGG
SAAAVAAGIVPCAGANDGGGSIRIPAACCGLVGLKPGRGLTPMGPELGES
MHGSAVQGVVSRTVRDTAAMLDVISGGEPWGPFTPGMPNAPFASCVGQDP
GRLRIGVRVPTAITPVPHREAFAAVEATVQTLTDLGHHVDELPQAPFDDA
ALAREFLLTWFVYTAWELADAKRLTGAGDDAFERDTLILAAIGRATSSVD
YLDAVQRRHDHTRRLTRFFDSYDLLLTPSLATPPPAIGEFDLPVALQKAS
DVLLKTRTAHLLRFTKIVDDIVDKNLGWVPYTQLANITGRPAISLPLHWT
EEGLPLGVQFVAPLGGESLLVRLAAQLEQAMPWRDRVAPV
120406762YP_956591.1 hypothetical protein Mvan_5820 [Mycobacterium vanbaalenii PYR-1]MNTVLYFSANGAVYETRAYTKADIDHLIQDQGLHCLTSADNQFDFWFSPS
AHGCQRRTNQFATELLLATTDFTARTVPLLRGGVVVATHDGDGDLDGLSW
QQLDMLARHTRSVSRRDERVLRRRVVREDHRLRHEAATFAPTFVSCARPR
TPVRLG
120406760YP_956589.1 DEAD/DEAH box helicase [Mycobacterium vanbaalenii PYR-1]MSALIDDLSALRAAGADSDELFAGFALWAESNGTPLYPAQEEALIELVSG
SNVILATPTGSGKSLVATGAQYFALAGADARSRNNQSRRSYYTAPIKALV
SEKFFALCEVFGAANVGMLTGDAAVNADAPIIACTAEILANIALREGRDA
DIGLAVMDEFHFYGDPDRGWAWQVPLLELPDAQFLLMSATLGDVTFLRED
LTRRTGRPTALVANAERPVPLYFSYATTPMHETIQDLVDTAQSPIYVVHF
TQASALERAQALMSVNVSTKEEKAAIADHIGAFRFSTAFGSTLSRLVRHG
IGVHHAGMLPKYRRLVEQLAQAGLLKVICGTDTLGVGINVPIRTVVFSAL
SKYDGTRTRLLNAREFHQIAGRAGRAGFDTAGTVVVQAPDHEVENLKQFA
KVADDPKKRRKLVRRKVPEGMVPWSEATMKRLVDAVPEPLTSNMKVSTAM
ILDVVDRPGDPFAAMRRLLTDNHEPRKRQLRLIREAVGIARSLIQAGVVE
RLAEPEPDGRRYRLTVDLPPDFALNQPLSTFALAAIDLLDSTSESYALDV
LSVIEATLEDPRQILAAQLNKARGEAVAQMKADGIEYDERIELLDDVTYP
KPLAEVLEHAFAVYLQSNPWAADGKLSPKSVAREMWERAFTFREYVSVYG
LTRSEGAVLRYLSDAFKALRSGVPAAARTEELTDIVEWLGELVRQVDSSL
LDEWEQLTSPDQHARPAPEMPAVPARPRPLTGNERAFTAMIRNALFRRVE
LFAREQWEELAALDGRAGMSAQEWQDIGDEYFDEHDDVGTGADARGPALL
IFDRRRDVWRVRQILDDPAGDHDWGFEVEVDLAASDEEGTVVMRMVDAGR
L
120406758YP_956587.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MRLQRSVIVDVDPHIVWKHVSDPGCYPEFMASLERWEIVTAGPVGVGSRY
TVHWKVGSVPIGGVVEVTEFDEARDLAFIGITGVGLRGRFRLRENGQGRT
KVTFRLSYEAPGGLLGLIADRVAARQVGRIMDKTVKNLKELAES
120406756YP_956585.1 acyl-CoA thioesterase [Mycobacterium vanbaalenii PYR-1]MRSPTMKSSRTTIKRRGTSRDEEPDHGVRQDTCVSSSLGDVLASMQLDQA
GPAAFVGRQLPAPANHILGGHISAQALLAASLTAPGRTPHSVHTYFLRPG
DSRLTVTFEVVNLQEGRTFSARRVTARQGDEILLEAMSSFKSSTPSARPV
TYQPRCPEVAPPESLPRVAPHFAESDEVTKGQWASLRWFERRIVDAAADP
PARSRIWWRPDGEVPDDPVLTASLVAYLSAVTLTEPAYAARGGVTVSAQR
DHSVWFHAAADLSDWLLYEQSSPSSADTLALASGTMFNRTGELVCTVRQE
MYFPASRH
120406754YP_956583.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTAVSLITGGAGGMGLATAKVVGQDRAVVLCDVRQDRLDGAAAALKDLGV
AVTAVNCDVTDRRAVDALFETVSRLGTLVSVIHTAGVSPSMGDAEYVMRT
NALGTLNVDEAFYGAATDGAAIVNVASMAAYLLPAELIPTSAFPLALQDT
EAFMTEMLAACAIAPEEARSGISYAISKSFVRWYSSSQAERFNGRGLRIV
SVSPGSVDTEMGRLEEQAGAGAMVADAAVPRWGKPEEMAELLAFCAGDKA
GYLTGTDILNDGGVVASMTERARLAAASSS
120406752YP_956581.1 thioesterase superfamily protein [Mycobacterium vanbaalenii PYR-1]MPAQHRPEDYGYFVPITTRWMDNDVYGHVNNVTYYSYFDTVANHFLIREG
GLDIHTAPVIGLVVESKCSYLAPVAYPDELRAGLRVDKLTNRSVTYGVGI
FSGTSDEAVAHGYFVHVFVDRERRTAVPIPEAIRAALTSLVVG
120406750YP_956579.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MSLRVAVTGPTGEIGISTISALEAHPAVAEIIGMARRPFDTSEHGWTKTT
YRQGDILDRDAVEALVADTDVVVHLAFIIMGSREESARVNLEGTRNVFEA
AVAGPRVRRLVYTSSVAAYGYHSDNPVPITEDVPPRGSPEHYYSEQKAAC
EALLADVTAGSALEVYVLRPCIVAGPKATALADAMPWNQLPGPVRRLAHA
LPLLKPPFPDPGTPVQLVHHDDVASAIVAAVTTTSAQPGAYNIAGDGVLS
MSAVGEALGARPVRVPHGAATATSEVIARLPFVPSILEWLHAGRTSVVMD
TTKARDQLGWRPNFSAAETLSALASSIGND
120406748YP_956577.1 cobalamin B12-binding domain-containing protein [Mycobacterium vanbaalMSVDASRARERLWAAVLEADEFAAATTVFGAVDGGMPPEDVLLDVIASVQ
RRVGSEWAANRITVAQEHAATAINDRVIAALAHHPACSRADGAGRVTVAC
VDGEWHALPARLLAEVLRLRGWHVDFLGAQVPTPHLIAHLHQHGPEAVAL
SCMIPTRLPTAHAAITACQAAGTAVLAGGAAFGADGRFARQLGADAWAPD
ARAAAELLGRGLRPARTSPTHQPIDDLPHLADQEYTMVKSAGAQLIQTTL
WELEQRFPAMRGYTEMQRQHTIEDLAHIVDFLTTALYVDDDDLFTGFITW
TADILAARDVPAASLIPALESLAGQLPEFPRTQRLLKAAHAAFPPTPTTP
SLPV
120406746YP_956575.1 cutinase [Mycobacterium vanbaalenii PYR-1]MNIFSRWLAVAASVVAVTGGLPLAAAPAYAAPCPDVEVVFARGTFEPPGI
GATGQAFVDSLRSRAGGRTVDVYAVNYPASFDFATAADGVIDASNRVVTM
AANCPDTQLVLGGFSQGAAVAAYITEDTIPEGYTPPPGMTGPMPPSVADN
VAAVALFGKPSSGFLQMIYTGAPPINVGSRYAAKTLDLCIPEDPVCSPTG
RDNAAHGGYALTGMTDRAAEFAVRNMPRHGSEQPVDLAAGPR
120406744YP_956573.1 phospholipase D/transphosphatidylase [Mycobacterium vanbaalenii PYR-1]MTLLVPGDTCWRIEQADHFAGIVDGADYFRHVKAAMMRARHRVMLIGWDF
DTRMTFERGDKTLAGPNQLRAFLWWLLRLRPDLEIYLLKSNLGLIPAFQT
IWDGVTPVKLLNWLSSDRLWFAVDGAHPTGAVHHQKIVVVDDVLAFCGGI
DLTVDRWDTSEHLQHNTIRRTMGRAYGPRHEVAVAVDGAAARALGDQARN
RWRAATKQLLGPIEDADRIWPPGLEPSLRRVGVGIARTLPAQTPGGEVRE
VEALNRAAIAAGRRTIYLENQYLASRPLVSALASRLQEPDGPEIVIVLPR
RSESRLERESMDTARHDLLEILWAADDHHRLGVYWPVADGGAPVYVHSKV
LVSDDRLLRIGSSNLNNRSMGFDSECDVAIEADPDDRDHDAVRRVITATR
DGLVGEHLGVPAAEVASAVREHGSFLNALRALRGPGRTLVEFTADTVRDE
AGRLAENDLMDPDRVPRSITRTVQRLFGRLTE
120406742YP_956571.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMTAEATAARLPARNALGLMFDPVFGALFWGKIFAVVAVWTHGIVAAIVMY
DATRSALMVGMVGVVQFAPQLILSPTSGKWADTGNPARQILLGRVLCVAG
SGSIAAWMFVQPGLTGLAAAVPVLLGTTLVGFGFVVGGPAMQSIVPNLIR
AGELPTAMALNSIPMTIGRIIGPAAGAYLAAHIGPATAFAVSTVLHLVFA
FFLLAVRFPAPPERRAGTDYRVRVAVRYVLRDRPLLLALVAVTTVGIVSD
PSITLTPSMADELGGGASLVGTLSAVFGVGAAVGMTALALLRGRIGSAVV
SSIGMAALAAGSAILAVAMEPWVALTGFAVSGFGFGCAMTGLSTVVQERA
PEELRGRIMALWLVGFLGSRPIAAAVLGGTADVLSVYAAFAVAAALSLAV
TLLCRPAKLVGPIPD
120406740YP_956569.1 putative transmembrane protein [Mycobacterium vanbaalenii PYR-1]MMSTQQPVSGIGGVPMNPISTAFRGLTKVADATTAAAGAVGGAAVSGVVG
GVQGAAGGIRSGLSSGSRSTAAAALTLGAIGAAGLVEWPVLVTVGGAALV
MHQLGQRARQPAAPRQSTAPPAKKTAARPAKTARKTTASRRATAK
120406738YP_956567.1 PfpI family intracellular peptidase [Mycobacterium vanbaalenii PYR-1]MPNELQGRKIAFLAADGVEKVELEQPRAAVLDAGGDVDLLSVQTGEIDAR
NHDLEPAGTFTVDRAVEDARVEEYDALVLPGGTVNGDKLRLSEAAVAFVG
DFVRSGKPVAAICHGPWALVEADVVKDRTLTSYPSLRTDLRNAGATVVDQ
QVCIDGNLITSRSPKDLDAFCQAITDQFAGIPART
120406736YP_956565.1 hypothetical protein Mvan_5794 [Mycobacterium vanbaalenii PYR-1]MAKYHLNAAAVEFARGLIDARQYVLDSDWGEVQPDAAAQNSYLESHDWDE
YSRWHLGLTDGAVDGTKARYAFGYGDFRRVHRTGLIACVFRASQWRHKAV
ELAAHDLLQHLDATAGITP
120406734YP_956563.1 hypothetical protein Mvan_5792 [Mycobacterium vanbaalenii PYR-1]MSICDTCGNDYDKAFTVTRHDGRTATFDSVECAAAQLAPQCLHCGCRILG
HGIETDDGIFCCAHCARKDTNADVNDRYPVPAGA
120406732YP_956561.1 zinc finger CDGSH-type domain-containing protein [Mycobacterium vanbaaMTDKQVRVVRVVPGGPVMVEGPVCIEMPDGSRVESDRFMVAICACRRSKT
YPLCDTSHRRRSRAGDESA
120406730YP_956559.1 hypothetical protein Mvan_5788 [Mycobacterium vanbaalenii PYR-1]MAAPTRTIESTESIKGTLIAQLRTVLDLTHTEIQVAETRVGQARTDAVRR
ELSQNAENAKIRAEAIEKTIRELGGFPDVIGPFLGRAAAAVKALTEQAEP
FDEALLGDLALEGQLLDRSRYVKALAVAAKDQDVEALATRLITAHSATVD
WLTTVLAEDALGGPAALRRTPMQAAAGLAVKFANLPFTWSTRGAERVAEA
IRSVRPAVADLIERGSRTGDVAAKALSGARDSALQTAERITREQGAEDAA
DLIHAARGATGILDPDELPISGYDELTVNDAANAVKDLTDPADIRTIVAY
EEAHKNRQRVVSAAQTRLAAIAQEVVGIN
120406728YP_956557.1 hypothetical protein Mvan_5786 [Mycobacterium vanbaalenii PYR-1]MAVAGVAGWLWTSAVAQPHPASAPQQPSPAAQAHHEIQRVGQVIAASRDS
LTTSTPDGQTTTFRITADTTQIGPPGTVGPYTSFPLKRNVVVLGIVHEGV
PVATAIADQAAVGPDGPPMDYGLPT
120406726YP_956555.1 mechanosensitive ion channel protein MscS [Mycobacterium vanbaalenii PMDDAIEFTSATHLAVTAAWVAGAIGVAYVAGLAVSWLLQRLGRRSAVMHD
VAHLTRLPLRATLVVIAAGAAVRRTTDEQAVWRGWLDHALILALIATLTW
VLVSLVRVVERQVIARFAGGDEGLTDADRHRRKIKTQVTVLRRLVVALVV
VLGAAAALMTFPSFSDIGKTLFASAGVLTVVAGLAAQTSLGSVFAGIQIA
FSDAIRVGDIVVLEDEWGRIEEITLTYVVVHLWDERRLVLPCTYFTDTPF
QNWTRNATELLGTAELDVDFTVPFDAMRAELDRMLHANDKWDGRVGVLQV
TDAVEGLVRVRMLVSAPNAGALFDLRCDIREGMVAWLQRTNPCALPRKRI
EHHNDSRRHGEATEAPVGRPQAESGLFSGSAAAERRGRAMSGAR
120406724YP_956553.1 hypothetical protein Mvan_5782 [Mycobacterium vanbaalenii PYR-1]MALTSVPSARTASSVLMACSAALLASACQFSIGGGLDYDKLEKAITDELN
TSYSSIDQTVSSVECPEQSPRPGKGDTFECTADVGGQTVRVEATVTDDDY
NVNFKTKDTLYDLPSAATTLSDEISKTLEFPVTVDCGEGLKAVEVGATFD
CTAADEYGTERTVRVTAEPIGENDSWEIIE
120406722YP_956551.1 hypothetical protein Mvan_5780 [Mycobacterium vanbaalenii PYR-1]MGSSRYVALLRGINVGGRNKISMPDLRAVLEDAGFGNVSTYIQSGNVAFE
SDGARASLESDIEALLVRLLESPPVVVVRSHRQLRGVVEDAPGEFAERHT
EHHRDVIFVKAPLTVERAMEVVQLRDGVDDAWPGPGVVYFTRVIAEKARS
RMSRIVGTPEYRLMTIRNWATTTRMLTLLDEMR
120406720YP_956549.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTSRVPVNLLDGRAVIVTGAGRGVGRGIASALTERGAAVLAVDRDEQLLS
ETADGLGDTVRPLVADLREPGCAKRIVAAAVDAFGAVHGLVNNAIATNEP
KPFQDITREDYDLVFDVGPRATFELMQAVYPVFVGNGGGSIVNLGSGSGT
MGKPKFGAYAGAKEAIRGISKAAAMEWARDDIRVNVVCPFAESDGIRLWR
ETAPEAYERSLRTVPMGRLGDVDTDIGPVVCFLLSDEASFVTAQTVMVDG
GTTGFR
120406718YP_956547.1 hypothetical protein Mvan_5776 [Mycobacterium vanbaalenii PYR-1]MTNPGQKFSLLGSALYRFPVSYETLEETGLLPNGLTVEAARAEAARAYEL
DRAHVFHSWSAQAEISPMTLVAADGCHVWDGQGNKLLDFSSMLVNTNIGH
QHPKVVAAIAQQAAKLCTVAPQHANAARSEAARLIAERTPGELNRIFFTN
GGADAVEHAVRMARLHTGRSKVLSRYRSYHGGTDTAINLTGDPRRWPNDH
GTAGIVHFFGPFLYRSQFHAGTEAEESERALAHLHDTIRMEGPNTIAAII
LESIPGTAGIMVPPPGYMAGVRALCDEYGIVFIADEVMAGFGRSGKWFSI
NHFDVVPDLLTFAKGVNSGYVPLGGVAISPAIAETFAHRAYPGGLTYSGH
PLATAAAVATINTMAEDGIVENAARVGAEVIGPGLRELAARHRSVGEVRG
AGVFWAVELVADQTTREPLAPYGSSSAAMNSVIAECKKLGLLPFANYNRI
HVVPPCTITDEQAREGLAILDKALDVADAATENA
120406716YP_956545.1 HNH endonuclease [Mycobacterium vanbaalenii PYR-1]MGRPRSRRARRTGRRPEHHRRADLKPNPPRRRAAGSAAQRVRPVPRRPDQ
RPAGPHHRLAHRPDHRPRPDGRRRRRTRRPDHHLGPAVGRQNRTGHRRPR
RPPRPRRRPLHQELAGVPHPGIRHPRRQPRTHHHLGPHLRGDAAAAQRRI
DDMAHSVCPDDPRTLDDRRIEAYTALLAGITTLTCHCGNDDCEATAAPRP
GRDTTIYVLTDTTTGNTPAADQADQNTRDRNEAEPATDTTGKAKNENEAA
REGEREDAAASEDRDGTEQTPAAKQNVRPHTAQCRSAYVFGAGLAPTALL
EAMCEGATIREITHPGPDSAPEPRYTPSPALAAYIRCRDLTCRFPHCDTP
ATLADIDHTVPYPVGPTHPSNLKTLCRFHHLLKTFWLGATGWRDRQYPDG
TIEWTAPTGHTYTTYPGSRLLFPALCAPTATLWTGEPPQTTLSARRGAMM
PKRRNTRAHNRSRYIEAQRRRNRSEKICTTRSTDIARGRDILYRNTLHQF
HPPGHEPDYGNDPPPF
120406714YP_956543.1 hypothetical protein Mvan_5772 [Mycobacterium vanbaalenii PYR-1]MLQGRFVGELPELAVPWKAEAAPQPQLLVVNEPLAAELGVDADWLRGPDG
LGLLTGTVVPSDATPAAQAYAGHQFGGYQPRLGDGRALLMGEFVDSTGRL
RDLHLKGSGRTPFARGGDGLAAVGPMLREYVISEAMHALGIPTTRALAVV
ATGRPVYRDTVLPGAVLARVASSHLRVGTFQYAAAVSAREGNVDLLRRLA
DHAIARHHPAAAVAENRYLALLDAVSAAQAKLVAQWMLVGFVHGVMNTDN
MTISGETIDYGPCAFMEAFDPATVFSSIDSSGRYAYGNQPAITLWNLARF
AETLLPLIHENSGAAIALAEASLDSFAGLYETAWTDGMRAKLGVPGAPAE
SVTPLIEQLLPQMQQSHVDYTLFYRLLAGAARGDAEPVRGEFIDLAAFDE
WLGRWRALEPDPAVMDRVNPVYIPRNHLVEDALTAATGGDLGPLQQLLTA
VTAPFEERPGSERFAEPGEKEFSASFQTFCGT
120406712YP_956541.1 hypothetical protein Mvan_5770 [Mycobacterium vanbaalenii PYR-1]MSLNTIALELVPPNVERGREQAMEDAEKVLRCSAEAGLAGRIRHVMIPGM
IEEDGDRPIEMKPKLDVLDFWNMIRPELPGIKGLCTQVTAFMDEATLRGR
LTELRDSGFEGIAFVGVPRTLSDGEGSGVAPTDALSIFDQVVENRGVILI
PTREGEHGRFNFKCDRGATYGMTQLLYSDAIVGFLKEFAASTDHRPEILL
SFGFVPKVENRVGLINWLIQDPGNEAVAREQEFVRTLSDTDPAGRRRLMT
DLYKRVIDGVADLGFPLSVHFESTYGVNTAAFETLAEMLAYWSPDKP
120406710YP_956539.1 hypothetical protein Mvan_5768 [Mycobacterium vanbaalenii PYR-1]MRWRIRAGTAAATAALALVAGVPVVQADPVPMRPQVYDKVSRDGWHLNIR
IENEVVNSIPNLANAQNSREGFVTASATATAVGGANPITDSIFILGYQLG
CQSDVSAGLQYGGTAGLGPVGSLGLGGGILPSAAVGVNGGAAGFVQTVLQ
PGVIVDLPLSNMTLGPSGQAMLDIDNIHIKADACGGDVTIRSYAYLRVST
EAAHTQFAIYGDPIKI
120406708YP_956537.1 ATP-dependent helicase HrpA [Mycobacterium vanbaalenii PYR-1]MPEPSRTDVRALRARLDDLTISDAARLGRRLRQLRDPSEEQLGKLAKQFD
TAEALVASRLAAVPQISYPDLPVTERRDEIAAAIAANQVVIVAGETGSGK
TTQLPKICLELGRGIRGTIGHTQPRRLAARTVAARIAEELGTPLGEAVGY
TVRFTDQASDRTLVKLMTDGILLAEVQRDRRLLRYDTLIIDEAHERSLNI
DFLLGYLRQLLPRRPDLKVIVTSATIEPERFAAHFAGAPIVEVSGRTYPV
EIRYRPLEVTVPGQDGEDPDDPDHEVVRTELRDPTEAIIDAVAELEAEPP
GDVLVFLSGEREIRDTAEALRAVVDPGHTEVLPLYARLPTAEQQKVFHPG
RTARRIVLATNVAETSLTVPGIRYVVDPGTARISRYSRRTKVQRLPIEPI
SQASAAQRAGRSGRTAPGVCIRLYSEQDFEARPRYTDPEILRTNLAAVIL
QMAALGFGDIEGFGFLDPPDARSIRDGVALLQELGAFDQQADLTDIGRRL
AQIPVDPRLGRMILQADAEGCVREMLVLAAALSIPDPRERPADKEEAARQ
KHARFADQHSDFTSYLNLWHYLTEQRKERSGSSFRRMCRDEFLHYLRIRE
WQDLVGQLRGICRDIGIREQDEPADPAAVHAALAAGLLSHVGMRDTDGRS
YQGARNAKFVLAPGSVLSKRPPRWVVVADLVETSRLFGRTAARIEPETVE
RVAGHLVQRTYSEPHWDAERGAVMAYERVTLYGLPLVARRRVGYAQVDPE
AARDLFIRHALVEGDWQTKHHFFRDNARLREELAELEDRARRRDLLVGDD
EVFAFYDARVPADVVSARHFDGWWRKQRHRTPGLLTMTRDDLLRNEAGAE
QPDAWQAGDLSLPLSYRYDPGSADDGVTVHVPVDVLARLGGDEFAWQVPA
LREELLTALIKSLPKDLRRNFVPAPDTARALLASITPDSGPLLDAIQREL
RRRTGILVPIDAFDLDKLPPHLRVTFAVEAADGTVVSRGKDLGELQQQLA
APSRQAVAATVAGDLERTGLRDWPPELDELPRVVERKGATGHLVRGYPAL
VDAGKAADIKVFATKAEQDAAMGPGCRRLLLTAGPSVTKGVERSLDTRTR
LVLGTNPDGSLAALIDDCAAAAVQVLVPAPAWTREEFAAARKRLAANIVA
TTADVVRRVEKVLVALHEVEVALPSKPTPAQADAIADIRGQLARLVPPGF
VAATGAARLGDLARYLTAIGRRLERLPHAPAADRERMERVAAVQAEYDDL
RRALSPGRAAATDVQDIARMIEELRVSLWAQQLGTARPVSEQRIYRAIDA
VGVAGPGGGR
120406706YP_956535.1 hypothetical protein Mvan_5764 [Mycobacterium vanbaalenii PYR-1]MSTDNAALTAVVFVHGLLERRPMDIFDDFAKTVLPPRQGRWEYYPRPVEI
TDSYEARRYVAPSAGVELYEYDWSFLMTSTRYAGLMPALARLFLRRPGHV
PDQMFGIWRAVWLVLLVPLAVLLVLLVVGGYFLQTGMAGWIIGLVTSVVV
LSVALAVFRMAPRALTRSFLTTGFVNVARYFDLMAPESHAARRAIRGGLV
DLLYTLHHGRYARIVVLGHGIGGYIAYDALTTLWEEMHELRAAPDATPSG
LGSLGGLEAAADRLSVDPGSRGLLDDFQAKQFGLWQDLRAQGNPWRVTDF
VTVGTPMALADLFVGRPPIFAGLSRSDSRRGELFDRLTRRGVVVRCPPRS
EASAVDDVEPGPASYSSGASGVLGAQSPFAVTRWANIWFPVRRGGIRGDW
FGGVLRPLFGPGIREIAVSGNRPERLKPGVAQTWYFRQPDRDAEGDVAFH
LREVLALEDHSGLDASMNAPEPDPATVGRVVYRSWQRSM
120406704YP_956533.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKAVSCVHGTLEVVDLPSPRPGEGQLVLDVLRCGICGSDLHAKDHADELT
EVMAEGGYHDFVRSDTPVVMGHEFCGVVADRGRKVGKEFKPGSTVVAFPL
MRAHGGVHLTGLSPLAPGGYAEQVVAEAALTFVVPNGLDPATAALTEPMA
VAYHAVRRSDVTTKDVAIVLGCGPVGLAVICHLKALGVRTIVASDFSPGR
RALAARCGADVVVDPAVDSPYEAVPAKQRGLTELPALYELGVGSMEKLRK
IPGWSHVYRVADRLGGTAPKRPVIFECVGVPGMIDGIIGAAPLASRVVVV
GVCMGDDKLRPAMAIGKEIDLRFVFGYTPLEFRDTLHMLADGKLDASALV
TGTVGLGGVAAAFDALGDPETHAKILIDPAGTAVTP
120406702YP_956531.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMSGRRVVIAGMGDVGVLTAIKLADHADVIGISAKPGLVSGQELGWRLARP
DDWARHNWIPFGRFRGLDKVRTVHGTLTGVDLTARTVAVTLPDGSSTEVV
YDALVVATGVANGFWRQPTLQTAAQIGADLHGPHEKLAAARSVIVVGGGA
AAVSSAAQIATTWPDKRVELYFPGERALAGHHPRTWTTVRRRLHEAGVVL
RPGHRADLEPGFIGDELTTGPVRWSTGQPPSTADAVLWAIGRVRPNTGWL
PTELLDADGFVRVTPTLQVPGHPEVFAVGDVAATDPLRSSARNRADGLLA
RNIRAAFAGKPLREYRAPKRRWGSVLGIQPDGLEVFAPNGRAFRFPVWAF
DRVLMPGIVRWGIYRGVRQDVS
120406700YP_956529.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MRAAVLTAYNSPLLVDELPDPEPGPGEVLVRVMASGVNPLDIKIRRGEAP
HAQLPPPAVLGIDMAGVVEAVGPRVDRFTVGDEVFGMTGGVGGLQGSLAE
LAAVDARLIAHKPRTLSMAQAAALPLGFITSWEGLVDRAGVGTGQQVLIH
GGAGGVGFLAVQLALARGAQVYATGSTSSQAVIRAAGAVPIDYTATTVDE
YVAAHTGGEGFDVVADNVGGATLDASFTAVKRYTGHVVSALGWGTHSLAP
LSFRGAAYSGVFTLMPLLTGRGRDHHGEIVAEAAALADSGRLAPRLHPTT
FPLDAVNDAHTAVESGSATGKVVVEPNV
120406698YP_956527.1 hypothetical protein Mvan_5756 [Mycobacterium vanbaalenii PYR-1]MRLRKPAVLVTAALAGWCVLAPVAGAQPAPEPPPAPPADAPPAEGPKTTI
DANGSYAVGTEIAPGVYQSAGPIDGGACYWKRTAGEETVDNRLTKKPSFV
QIMPTDTTFTTSDCQTWQLTNAPMPPEPGPGSLLGELTQAIGSGMFSGGP
R
120406696YP_956525.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMIVKLDLLTPGIEVGLVTTDLDPMVAFYEGFLELEPQGEIEFDGGSQRRY
SLGGSVLKLVTYTTPPPAPAAPGGGRAQAGLRYFTIGVNGLRAVAEAFEA
SGYDVVEPLTEFAPVPGMGWMFVADPDGNHIELFGTL
120406694YP_956523.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRIGVVFPQTELGGDPGAVRAYGRRVEELGFTHLLAYDHVVGADPAVHTG
WSGPYDVDTTFHEPLVMFGYLAAVTTTLELVTGVIILPQRQTALVAKQAA
EVDLLSGGRLRFGVGVGWNAVEYEALGEQFTNRGTRSEEQVELLRQLWTQ
RTVTFDGRHHRVTGAGIAPLPVQRPIPLWIGAAAPRGYARAGRIADGWFP
LVGPGPALDEAKGAVDAAAREAGRDPSEIGMEGRVRWRHDLDQTAADIGE
WAEHGASHLSVDTMRAGLRTVNEHLAVLEAIADRVGLR
120406692YP_956521.1 Kojibiose phosphorylase [Mycobacterium vanbaalenii PYR-1]MIADEAFPVEPWHIRETELRLDLLPQTESLFALSNGHIGLRGNLDEGEPH
GLPGTYLNGFYEIRPLPYAEAGFGYPEEGQSIVDVTNGKLIRLLVDDEPF
DVRYGELSSHERVLDLRAGTLTRAAEWTSPAGKRVEVHSTRLVSLTQRGL
AAIEYVVEAVDDVLLTVQSELVANEDQPPASADPRVAAVLSHPLTPVQHE
VSERGAMLIHRTRASELTLAAAMDHVVEAPGRVDLSGDAGQDWARTTVVC
GLKAGERLRLVKYLAYGWSSLRSRPALRDQVAAAIAGARYTGWDGLLTAQ
REYLDEFWDCADVEVDGDADCQQAVRFGLFHVLQASARAERRAIAGKGLT
GTGYDGHAFWDTEGFVLPVLTYTAPRAAADALRWRASTLEMARDRAAELD
LRGAAFPWRTIHGEECSAYWPAGTAGFHVNADIAMAFDRYRVVTGDESLE
KDCGLAVLVDTARLWLSLGHHDRYGRWRIDGVTGPDEYTAVVRDNVFTNL
MAAANLRVAADACTRQPDAARALGVDTEETAAWRDAADAVHIPYDEELGV
HPQCDGFTTLREWDFDQNTKYPLLLHEPYVRLYPAQVVKQADLVLAMQWQ
SHAFTPDQKARNVDYYECRTTRDSSLSACTQAVMCAEVGHLELAHDYAYE
AALIDLRDLHHNTGDGLHLASLAGSWTALVAGFGGLRDDEGVLALDPQLP
GGISRLRFRLRWRGFRVTVDADHDAVTYTLRDGPEGVLTIRHSGDPLEIN
TRKPTRVAVRPKKPLLAPPKQPPGREPLRRWRSTVDASRNSRES
120406690YP_956519.1 general substrate transporter [Mycobacterium vanbaalenii PYR-1]METDIRRVVTGASIGNAVEWFDFAIYGFLATFIAAHFFPAGNDTAALLNT
FAIFAAAFFMRPLGGFFFGPLGDRIGRQKVLAVVILLMSAATLGIGLLPT
YEAIGVAAPMLLLVLRCLQGFSAGGEYGGGAVYLAEFASDARRGLTITFM
AWSGVLGFLIGSVTVTLLQALLPAAAMESYGWRIPFLIAGPLGLVGLYIR
LRLGDTPQFAELDKAEKTADSPLREAVTTSWRQIIQVIGLFIVFNIGYYV
VFTFLPTYFIKTLRFSKSEAFVSITLACLVALILILPLAALSDRIGRRPL
LIGGAVSFAVLGYPLFLLLTSGSLVAAITAHCLLAAIASVYISSAVSAGV
ELFATRIRFSGFSVGYNVCVAVFGGTTPYVVTWLTAASGNAIAPAFYLIA
AAVVSLAAVLTLRESAGRALAQVQERPANVGSGIHEGEMRR
120406688YP_956517.1 hypothetical protein Mvan_5746 [Mycobacterium vanbaalenii PYR-1]MNMRRLIMIAGVAVLLAGVIALLVPVSVPGPDGSIGCGNGIAADLSQARD
ADSGNLANLPVLNEIVPHTDYAAACESALSSRRSWAIPVAVVGLVVLAGS
FFVGGRTARARA
120406686YP_956515.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMHTDRHDDQLTDRFERDAMPLIADLYRHAIRLTRDHADAEDLLQETAAKA
YAAFASFQEGTNLVGWLYRIMVNTHISAYRRQQHRPTLQFTDEFTDGQLL
AHSQRGSSATRSTEELAIAHTGDPAIAAAMRSLPEKYRTAIYYADIEGRK
FREIALLTNVPIGTVMSRLHRGRKQLRDALSDVARDRGYPLPEAA
120406684YP_956513.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MNTSPNPPRLTSRVFAVAASALLFGSAVACAPPEKDNSNAQTESGVNAAE
ATSAGDFGGMEGLVEAAKAEGELNVIALPPDWANYGAIIKAFSDKYGIKV
NSAQPDASSQDEINAANQQKGRSSAPDVFDLGQSVALANTAMFAPYKVET
FDDIPAAFKDADGTWVNDYGGYMSIGFDSSKVPPVTSVDDLLKPEYQGKV
ALNGDPTQAGAAFSGVLMVALSQGGSADDIAPGVEFFRKLKEAGNFLPVD
PTPATIESGQTPVVIDWNYTNSAETKKLPSWTVLVPPENPVAGYYYQAIN
RDAPHPAAARLWQEFLYSDEGQNLFAQGGVRPVRADNMLADGTLDPAVAA
ALPVVDGPVTVPTPQQTEAASKYLAENWAAAVG
120406682YP_956511.1 binding-protein-dependent transport systems inner membrane component [MRGALWVMFGLFFLFPLYAMADFSTRNLIAGGRTWRAWANLFADQALYQA
IVVSLLLAVFTVAAMLVLLVPTMIWVRLRAPWAKGLVEFMCLLPLTIPAL
VIVVGLRNVYLWVTYFLGESALTLTFVYVVIVLPFAYRAIDAALSAIDLQ
TLSEAARSLGAGWLTTITRVVVPNIWSGILSAAFISIAVVLGEFTIASLS
GYETLQVQIVLIGKSDGPTSVAASLATLLFGFVLLLILSLVTRGRRNVGV
TV
120406680YP_956509.1 orotate phosphoribosyltransferase [Mycobacterium vanbaalenii PYR-1]MPGMPADTDRPQTWQAAFDLIRTRGHERREEPFKLASGQLSHDYIDGKYA
VDTGERLTIVSRAVADLAAAKGIEFDAVGGLTMGADPLAHGVAMVTGKAW
FSVRKEQKKRGREQWVEGTRLEPGMRVLLVDDVISTGGSTELALERIAPL
GVVVTGVIPMVDRGDVAAGRFAKRNVPFHALVTYRDLGIEPVKDV
120406678YP_956507.1 hypothetical protein Mvan_5736 [Mycobacterium vanbaalenii PYR-1]MVGPALRAVAVAGVLIVAGVSGGVAAVPALAQPTDTDGSGQTSDDPAGGG
SEDAGGGGDTTDDPVDSGDPSEEPDEPEPSRESAPDQGGSGDYGGTDDPA
TESPAPTLRESPFENSITLPFIRLPSAGEIPMGSWPTVSTFYTTVEIPVP
TLGEFLEALQIVPSPAPPPGPAIRTQEEAPVADATTGATGGGGGGSVAEP
VIFRAPLVTVPRAGTVAGKPPRTLPGKPGAAAPNGVTAPGVAGVATPVIR
GSVPSTPGVTALPPASPAGGQFVRLGGNPRGVTNPTLAEIAAVALPGLAG
LIFLTFSGGVIGYRQANSTRFVRTAGAERFLP
120406676YP_956505.1 ABC transporter periplasmic substrate-binding protein [Mycobacterium vMDMTRHQRLSRRLVPAVLTAIALPLAACGGSGAGADADAAAPADVNAAKE
QAKQFRTAGMPDDWINFGEFYQSVCDSYELGCNGFAAQGVNRTDTDMSSA
EEIAAFKNETTNAPMCSDIGIAFGQVAESEGVLLGYTPEAAAALPPAYKA
ADGGWVASAVGVISIMTNTDVIPNPPKSFADLLKPEYKGRVSISNPVTSG
TGQATVFSTAAALSKNKGEFDMDAAIDYWAEFFRLGQRNEAEYSAAAFER
GETPIRVAYDFVNIQAGQLVGEKGVDTAIVIPAEGGVWSPSATMCNKKTE
DPDLAKLVLDHTLSDEGQLVFARVGARPVRYVLGELEVPAELKTNWLPEG
QYANVIQYPDDAWPDPAVVAERWENDVLTAG
120406674YP_956503.1 binding-protein-dependent transport systems inner membrane component [MTSRGISRSTLLALWGVFLALPVAATMLYSVATVWRGRALPDGFTVHWWV
QTLSEPRVVAALLRSTWLATLTVLIVAAVVLPALYWGYIRNPRIRTTMQV
CALLPFALPFVVLAYGIKRLAGATEVTQPWEASPLLVVLGHVALAFPFFL
WPVDGAMAAAGVRNLSEAAETSGASPLSTLFRVVIPNIRTGILTGAILTF
ATSFGEYSIARVITGSSFETLPVWQVAALQDNRGNPNGVAVMAMFTFVLM
FVVSVLIARTGRGEPVRLLPGINTTQKR
120406672YP_956501.1 type I phosphodiesterase/nucleotide pyrophosphatase [Mycobacterium vanMSAGTNVAVVLVILDGVGARRVRADTMPTLHTLATSGAWRPDGSEAVLCS
ATYPNILTLVTGSTPAQHRVFANPLFGHEFTAGAHTQTVFERASTCMSEF
VVGDQYLIDVAKARTAGRHWPPEGVLPASAGVDEFGYATDAQVLPHAVAA
AERAPDLLVVHFNGPDTASHLHGPDSPEAIESYRTVDAALAGFIDSLRPR
WDELLVLIASDHDQEPIDDDRRIDLAGLAAARGVEAGVFHEGTAAVVVGR
DACDDRWLSGVPGVEGSWLCEPGVRVIASAPHHWFAAPGYPSRGGGHGGP
RTRDQVAVATGGHPMVAQIAQVWRHRRPAAQDWAGLVLAALKLATVAPR
120406670YP_956499.1 isochorismatase hydrolase [Mycobacterium vanbaalenii PYR-1]MTSNRTLIIVDVQNDFCEGGSLAVAGGAAVARGISDLLASAPDYRHVVAT
KDFHIDPGPHFSDHPDYVDSWPVHCVAHTAGAEFHPDLDTTAVEAVFKKG
HHSAAYSGFEGKDDNGSALADWLRAHDVDAVDVVGIATDYCVKATAADAA
AAGFTTRVLSPLTAGVAPATTADALDTLRAAGVEVL
120406668YP_956497.1 hypothetical protein Mvan_5726 [Mycobacterium vanbaalenii PYR-1]MAHGLGGSADLPIPYTYALIGAAWALTFTFAVVALAWRTPRFDAARPGRP
LPQWVTRAVDAPATRWTLAAATLLFTGWVAVSTFVGPQDSGNALPGVFYV
LLWVGLVALSVLLGPVWRVLSPVRALHRFSGGRSLGRTYPAALGYWPAAA
GLFAFVWLELASPDPGSLGAIRTWLLVYLAVTVAGALWCGTQWCARADPF
EVYSVVASRVSPLRRNSDGRIAIGNPFDHLPSLPVRPGIVAVLSVLLGST
AFDSFSATPQFRGFVDDLTDSGLGATAVRTAGLALFACVVAATFWAAARC
TGGVDARRRRELPGLFAHSLIPIVIGYVFAHYLTYLVERGQQTVYRLLGQ
PDAEVMYVLSMHPAVLATLKVGFVVAGHIAGVVAAHDRALKVLPARHQLT
GQLAMMLVMVGYTFTGLYLLFGG
120406666YP_956495.1 hypothetical protein Mvan_5724 [Mycobacterium vanbaalenii PYR-1]MTMEFSLQAVSVLAQSSGDEGGGTALSEIVALSAAGAVVTAVLLWIGWQH
RNHKITWLAGLADWSARRFKRPPWVALPIAMFIASIICALFGFIWDVSLH
IGNGRDDGALANPAHYFILIGLFGIFVAGCTAMVLPYDRPGPAAVRITDD
WYAPVGGIVMAGCGLYALLGFPLDDMWHRIFGQDVTLWGPTHLMMIGGAG
FSTLAALYLEYEGRRVRTDETPPDGIGLKFVQYLAFAGVLIGASVYQIEF
DFGVPQFRQVFQPMLIAAAAALALVAARIFMGRGAALIAALIAIGLRGLV
AVAVGPVLDAPLNWFPLYLGAALVVEILALTPLLRRPVLFGLVSGLGIGT
VGLWLESLWIGAVYPYPWPTSIWPEALAMSVPVAVLTGGCGAMVGMVLTG
RRLPGRAVGIGLVALTVLAIGGAAANGLRYDTPQNATASVTLTEAPAVDG
QRFVTADVRFNPPDVIGDNPNWVSVLGWQGGLPNERGQFVDHLEKVGVGH
YRSTEPMPVSGTWKTLLRVHDGRTLTAVPIYLAGDPGIGAEEVPAEAQFT
RPFVSEITILQRERSPDIPASLWLIGCLVVLLCTLAMIAGISWGAGRINN
SEPSGSEAEFAPSAQS
120406664YP_956493.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMAFDITPTAAQHDLARRTHEFAEEVIRPVAADYDQRQEFPWPVLEEAAAR
GFYSPLFYRDLIGDPTGLSLPMFMEELFWGCAGIGLAVVMPALALSAIGQ
AASPEQMLQWAPECFGTPGDLKLAALAISEPEGGSDVRNLRTTARRAGPG
ADADWIIDGHKMWIGNGGIADVHVVNAVVDQELGHKGQALFIVPGGTPGL
DMVRKLDKLGCRASHTAELKLTGVRVPADHLLGGQEKLDHKLARAREAIE
GARHSGSATLGTFEQTRPMVAAQALGIARAALEYVTEYANRREAFGAPII
DNQGISFPLADLATGLDAARLLTWRASWMAATGVPFERGEGSMSKLAASE
LAVRATERAVQTMGGWGYVKDHPVEKWYRDAKLYTIFEGTSEIQRMVISN
ALGAADGKPPLHVDLEPTGGPLNRMFGRGTPARTQVAASALAMKDRVPAP
VMQMAMKVLRPPRK
120406662YP_956491.1 hypothetical protein Mvan_5720 [Mycobacterium vanbaalenii PYR-1]MSSKKEWIAALDAVDHAHRAVAGLPFHTLQPADQRALLVRLDALEKLLAT
RQRQLLAHMVGGPPPVEFAGAPWAEVLARRLRISVGEAKRRIEDAGAVPT
120406660YP_956489.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MRIALLSYRSKTHCGGQGVYVRHLSRGLVELGHDVEVFSGQPYPEILDPR
VRLTEVPSLDLYREPDPFRIPRPSEIKTSIDLEELLTTWTAGFPEPKTFS
MRAARLLADRRDDFDVVHDNQCLGTGLLTIADSGMPVVATVHHPITRDRV
LEVAAAKWWRKPLVRRWYGFAEMQKQVARQIPELVTVSSTSAADIAEDFA
VDPNQLNVVPLGVDTQLFQPSEHRVRNRIIAIASADVPLKGVSHLLHAVA
RLRVERDLELQLVAKLEANGPTEKLIAELGISDIVHISSGLSDSELAALL
ASAEVACIPSLYEGFSLPAVEAMASGTPIVASRAGALPEVVGTDGECARL
VTPADVTELTAVLGELLDSPRELRRLGDNGRRRALEVFSWESVAAQTVAV
YERACERVATC
120406658YP_956487.1 hypothetical protein Mvan_5716 [Mycobacterium vanbaalenii PYR-1]MHDIPGVPGVFTPAQCRQTAESIAATQESSGAIPWSVGGHTDPWDHIENA
MALTAAGLLEPARAAFEWSRTQQRPDGTWPIQVRNGVIEDAHSDSNFCAY
IATGVWHHVLVTEDRSFAETMWPVVAKAIDFVLELQFGTGEIAWARGSSG
DADEALLTGCASIYHSIRCALALADYVDDPQPEWEVAVGRLGHAIAHHPD
GFVTKDRWSMEWYYPVLGGALRGPRARARIDERWDDFVVPGLGIRCVDDR
PWVTGAETCELVLALDAIGDKARAHEQFAAMHHLREDDGSYWTGLVYADG
KRWPVERTTWTGAAVILAADALSSTTPASGIFRGLDLPKGLEGQYDCECA
TSDR
120406656YP_956485.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSDPALESTRRRLTARQADTVDRLGRAAVELLRRDGFAALTVRRVAAEAG
VGAATAYTYFSSKEHLVAEVFWRRLAGSQRVDHGSGDPASRVVEVLGHIS
LLVAGEPEFAGAVTTALLGKDPDVEVLRLRIGRDIRDRLSDALGPDTDPD
VIDALEMLYSGALVRAGMGYTSYPEIAAKLEKAARLMLG
120406654YP_956483.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MSEATIAAHRSTADAESAPPRPVRLPPTPRIPKLLQGLGFSFSRQWTVAQ
IVRRYGDVFSMTLPVFGPTVMVADPALAKQLFMANTDDVGNIQPNLSRVL
GSGSVFALDGGDHRKRRKLLTPPFHGKSIKNYETIFEEETLREAANWPEG
QPFETLEPMMRITLNAILRAVFGADGAHLDELRRIIPPWVTLGSRLAVLP
TPHRTYGRFSPWGRLAAYRRQYDDVIGRLIDAVQADPDFDTRDDILALLL
RSTYEDGSTMSRQDIGDELLTLLAAGHETTAATLGWAFERISRHPEVLAK
LVAEAETDGNEYRQATILEIQRSRTVIDFAGRHVYAPTFELGEWVIPQGY
SIVVAIGQVHKRAQDFDDPDRFDPQRYIGQRPPTFAHIPFGGGTRRCVGA
AFANVEMDIVLRTVLRHFVIETTAAPGEKMHSRGVAYTPKDGGRVVMRRR
120406652YP_956481.1 hypothetical protein Mvan_5710 [Mycobacterium vanbaalenii PYR-1]MTITRRILLGWCVSVVATAVCYAVFFNGEFSDGGAVPPWLIAAAAGLAAL
TLGSVLCFARAGAYSPAGDPDGMYSLMTATAIVSEGLTIAAEIALGAPAL
WLSIPIATLVYSVGAVITLRRA
120406650YP_956479.1 methionine-R-sulfoxide reductase [Mycobacterium vanbaalenii PYR-1]MTQRYNKNPAAVDALSPEQYHVTQRNGTERPFTGEYWDNHEPGLYVDVVS
GEPLFASVDKFDSGSGWPSFTRPIEKENVLEKRDFSHLMIRTEVRSAHGD
SHLGHVFNDGPRDRGGLRYCVNSAALRFIHLDDLEAQGYGQYRGLFEATD
KEQA
120406648YP_956477.1 hypothetical protein Mvan_5706 [Mycobacterium vanbaalenii PYR-1]MTGNTFTRDELAEAFAGFEKTVDRAAQTRDWDPWVDQYTDDILYIEHAAG
TMRGRDEVRPWIWKTMESFPGSYMTSFPSLWSVIDEATARIICELDNPMR
DPGDGTIISATNISILTYAGDGKWKRQEDIYNPLRFVSATVKWCRKAEEL
GTLPDEAAQWMAKFSPGGRGAL
120406646YP_956475.1 O-methyltransferase domain-containing protein [Mycobacterium vanbaalenMSDRLRVDLHGSPQTMLATLYAKALDAGAPDSVLNDTWARDIVDRIDYDW
SSTTITTRNAPSVTLRSAHFDFWTEQFLAAHPRAVVVHLGCGLDSRFLRV
QPGDGVDWYDVDYPQVAALRERFYPVRPGNHVVAASVTDPAWLADIPDDR
PALVIGEGLTMYLREADGVALLRRVVDRFPSGELQFDAFNWLGIKAQWSN
AVVRRSGSTLYWAINGPADILDSVPGTRLLQWVPVFESDVFDRLPGVYRL
LGAVMNRIPAARTMSQFHRYAF
120406644YP_956473.1 hypothetical protein Mvan_5702 [Mycobacterium vanbaalenii PYR-1]MTDRPVLEPSPAHPITVVPTGRHVVVRVNGETIAETDSALTLQESSYPAV
QYIPMADVVTERLRPSDTATYCPYKGQAGYFDVVAGGQTVADAIWTYREP
HPAVAQIAGHVAFYADKADVTVHP
120406642YP_956471.1 Dps family ferritin [Mycobacterium vanbaalenii PYR-1]MTAFTVPGLTDKQGAEVAELLQKALSRYNDLHLTLKHVHWNVVGPNFIGV
HEMIDPQVELVRGYADEVAERIAALGTSPLGTPGAIINDRTWDDYSVARD
TVQAHLAALDLVYTGVIEDTRKSIERLEELDLVSQDMLIGHAGELEKFQW
FVRAHLENSGGELVNKGAATEKAAASKAKKNS
120406640YP_956469.1 glutamate synthase [Mycobacterium vanbaalenii PYR-1]MVADMHGRRSRDIVDKAITALLNLEHRGAQGAEPNTGDGAGILLQVPDEF
FRAVCEKEGFDLPEAGSYATGMAFLPQSSKDAAIACAAVEKIAEAEGLQV
LGWRDVPTDDSSLGALARDAMPTFRQIFLAGASGMELERRAYVVRKRAEH
ELGTKGPGQDGPGRETVYFPSLSGQTFVYKGMLTTPQLKAFYLDLQDERM
TSALGIVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRAREAL
IKTDIFGGQDLEKVTPICTPGASDTARFDEVLELLHLGGRSLPHAVLMMI
PEAWERHESMDPARRAFYQYHASLMEPWDGPAAVCFTDGTVVGAVLDRNG
LRPSRIWVTSDGLVVMASEAGVLDLDPGTVVQKMRLQPGRMFLVDTAQGR
IVSDEEIKAELAAGQPYQEWLDAGLFHLDELPQGDYVRMPHHRVVLRQQI
FGYTYEELNLLVAPMARSGAEALGSMGTDTPIAVLSARPRMLFDYFQQLF
AQVTNPPLDAIREEVVTSLQGTVGPEGDLLNPDAESCRQIVLPNPILRNA
ELSKLICVDPDHEIRGHKHGMRAAVIRCLYPVNRGGRGLKEALDNVRAKV
SAAIRDGARIIVLSDRESNEQMAPIPSLLSVSAVHHHLVRDRTRTKVGLV
VEAGDAREVHHMAALCGFGAAAINPYMAFESIEDMVDRGVISGISSDQAK
ANYVKAAGKGVLKVMSKMGISTLASYTGAQLFQAIGISQAVLDEYFAGLS
CPVGGIDLDDIADDVATRHALAYLDRPDEWAHRELEVGGEYQWRREGEYH
LFNPDTVFKLQHSTRTGQYSVFKEYTSLVDDQSERMASLRGLLKFREGVR
PPVPLEEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSG
EGGESVTRFDPDENGDWRRSAIKQVASGRFGVTSHYLANCTDIQIKMAQG
AKPGEGGQLPGHKVYPWVAEVRHSTPGVGLISPPPHHDIYSIEDLAQLIH
DLKNANPQARIHVKLVSENGVGTVAAGVSKAHADVVLISGHDGGTGATPL
TSMKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQLKTGRDVVVAALL
GAEEFGFATAPLVVTGCIMMRVCHLDTCPVGVATQNPLLRQRFNGKPEFV
ENFFMFIAEEVRELMAQLGFRTVNEMVGQVGALDTTQAAEHWKAHKLDLA
PVLHEPESAFMNQDLYCSSRQDHGLDKALDQQLIAQCREALDRGTPVRFS
TTIANVNRTVGTMLGHEVTKAYGGQGLPDGTIDITFEGSAGNSFGAFVPK
GITLRVYGDANDYVGKGLSGGRVVVRPSDGAPEGYAAEGNIIAGNVVLFG
ATSGQMFLRGQVGERFAVRNSGAHAVVEGVGDHGCEYMTGGRVVILGPTG
RNFAAGMSGGIAYVYDPDNTLADNLNAEMVELEGMGGIDSDDAVFVHGIV
QEHVDATDSAVGQRILADWNTELGHFKKVMPRDFKRVLQAIAEAQQSGAD
ENGVAEAIMAAANG
120406638YP_956467.1 hypothetical protein Mvan_5696 [Mycobacterium vanbaalenii PYR-1]MYLNPITRTRVGRIAWTLVRHPVKSREFPAKAERLITAAELTRYGI
120406636YP_956465.1 hypothetical protein Mvan_5694 [Mycobacterium vanbaalenii PYR-1]MIDMTEACTTTAELLAQVSDDQLTAATPCRDMDLGALIAHVGGLALAFEA
AARKDFGPLTDTPPTMEGGVDDGWRQAYPSRLAALAQAWRDPAAWQGMSR
AGGVDFPAELGGMIALTEVVVHGWDVAVSAGLRYDVPVDVLNVVLPHVAA
FAEQGPVEGLFAAPVPVPGDAPVLHRVLGLTGRDPSWPAG
120406634YP_956463.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MSDRFPADQERPLYEIKANLFKALAHPARIRVLEILATNRQPTSVSDILA
STGLEATLLSQHLAVLKRHHVVTARRTGNAVLYEPAHPLISEMLVIARTF
LADTLAGQRDQLKSLEALPPLEKRQ
120406632YP_956461.1 hypothetical protein Mvan_5690 [Mycobacterium vanbaalenii PYR-1]MWTMSRSWDDADDVGIERERSELEALDACHAPDEDPPIGPADKTVPTLLF
TATNPPGTVSATALIDGRILRVDLSPGVAAFTAQELSDEIALITSLARAQ
ASAAQHVLITEFMARLGHDRVSTRGILEFEIGLPSPESVRKRRAESFAAR
DHLYTC
120406630YP_956459.1 hypothetical protein Mvan_5688 [Mycobacterium vanbaalenii PYR-1]MSLFDDVSGVVGNVVDVVEGSVGTVESGVDFVGSVLDGDVTGATRDAYEF
VDNARDVLGGVRDLGVSIGRVPSRFVDNPILELANSPPIELAQRVIAGMR
LTTGSGDPVDGEEFKNAAKLMQEALELLIDAAPHGDHWSGAASEQYAGAN
TQNRRATSGVQVADWNIADFLEAEAEQVMRTRKTLDDINEYLFQFALSTA
WMNGIPGGRAAKLVVDATAAAGGALSAERALLTLVADSVERGGKIRDQFN
LYEGAANQERKLDDPTCDGPFVPAKVDRSDAGRPGRFDNPHYTVPTPVEP
PQHGPAATPYIGGGSSVPMPAPQSTSRTAHPQGSAPRPWAGTNPTAAPAS
PTPQPTGAPGTRTGSLPGQGAGNRGAAPLRVTARPTSDDKSQEIPT
120406628YP_956457.1 hypothetical protein Mvan_5686 [Mycobacterium vanbaalenii PYR-1]MSRISLGRYGFSVEVRDDDSHLAAALTVEGLGFGTLWLNGGQLDRLDRLT
DLLAATTTAVVGSAIIPPDRYSAAEVSELFARAEADAPGRLMVGLGSSHR
PRALTLLGDYLDELDAVPEDRRLLAAFGPRALAVARDRFAGAMPMLFTAQ
RTAEVRRVLGADRTLSVGLYVVLDEDPATARATARRPLQFLTAMPQYRKS
LERQGFSPDDISGISDRLVDTLVAWGGPRHVLDHAARLHAAGADHVQLNV
LGADGQPTGVAAARLLAAEFG
120406626YP_956455.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MRSSTRCKVSPVTATSPTRPARGRRAARPSGDDRELAILETAERLLADRS
LAEISVDDLAKGAGISRPTFYFYFASKDAVLLTLLERVIAEADAALAQLI
AERSSDRRTIWRRGINVFFETFGAHRAVCATTVGVKSTNSEARELWSRSM
QRWIDHIAAVIEAERADGAAPVTVPARELSTALNLMNESVMTATFTGHQP
AIPDDRVLDNLVHIWTTSIYGKTD
120406624YP_956453.1 ribonuclease activity regulator protein RraA [Mycobacterium vanbaaleniMTVTPRPTADLVDEIGPDVRSCDLQLRQYGGRTDFAGPITTVRCFQDNAL
LKSVLSEPGDGGVLVIDGDGSVHTALVGDVIAELGRSNGWSGLIINGAVR
DASTLRTLDIGIKALGTNPRKSTKTGEGIRDEAVEFGGVVFTPGDIAYSD
DDGIVVIAAG
120406622YP_956451.1 copper resistance D domain-containing protein [Mycobacterium vanbaalenMTHRRAVAGGALVTVASCVAAWALAYPAGSLTSAVPRAVADGAAVVTLGL
AVVPALDGPRYRDELVRRATAPLVSASAVWVVAELVRLALAGAEAAGTTV
TGLGLREAWEFAAYTAPGRAGLLTVLAAAAVCAVTSVAPRSGPACIAGAG
LACIGVIGHPLTGHLSGSVLGGVSIAVHALAAALWCGTLAGLVLTVDHRG
QWARVLPRFSQLSLGCVAALLAGGIAAGVTVLESPAALYATGYGRVLSLK
IALTLVLIALAWRNRELWLPAARTHRSTAAVSRTRAYTELTLMAATVAAA
AVLSVTG
120406620YP_956449.1 hypothetical protein Mvan_5678 [Mycobacterium vanbaalenii PYR-1]MSQATSEATAALRGAAAGLLTAALTLAAHGVGGGAVLAGAATVQLLVVAA
VVGGLAASVSGADDLRVMVCLLGAGQLVGHVVLAAGGHAHAAPPAAAMVS
AHAVAVVVGGLLINTGARLCRVLSKVLRLVGRPNPPLASVSRLSATAADQ
PMRSTLLIACSMSYRGPPAGARC
120406618YP_956447.1 hypothetical protein Mvan_5676 [Mycobacterium vanbaalenii PYR-1]MASGLLVGGWTTATASADTDTGTAANADATGGGADDRARPDTAAAAGGGT
DRDPDVEPADGGAVAESDDAGDITGRDTDPEPLPDPADGEPQPSEDAPVA
DKEPEEPRPPCCKDGDKDCEPGWPWPWPWPDDPDDRPKPDDGYGEGRPEG
VPSVRPLPGGVIRPGIEPPVAEPEDPGVLDTVPGIGVAAGNGPEAPISVP
ILVTVPTGGGASAGPSVAGSGGASASPRQIVESTPPRQLSPAPAGRDFAV
PPSVNRAGYGDYLRSAGISQVAALAVPGLAGILILTGVGGYVGYRQAKAG
QGVRASGIARFMN
120406616YP_956445.1 hypothetical protein Mvan_5674 [Mycobacterium vanbaalenii PYR-1]MIVWVIAGLLGLATGLRIGWALVNKQSLVSTAMILALGSLGLVAALNWQP
LTLLIDTLLRWPNISIGLSQVALVACAAGSCVMITTVSSSRAPATARRIA
VAQYGVAAVIAAVSLAVFLSAGQQPEMSPEEYLRRNLGSGGNALPWLLPL
LYVLMALSLVVWAGLRHSNRTRRGRALFVFTVGIVLIVLASAFFLLRAAG
TTGPVGVGAAATLLGCAMLIVAAGSLLPSLEDWFGAHRELRTIQPILDEL
GHRHPDVGIGVRPRGPLAFRVAERMSLISDALFLEATAADGALRPVDSSG
ADVTDLEDLIAREDLEAPDVPPAEQARAVAEWIFAGRGGAAGDGRAKFPG
LAWLRQPSTFSDREWILEIARQYRTLTADAVHAVPERAGQGAVAD
120406614YP_956443.1 hypothetical protein Mvan_5672 [Mycobacterium vanbaalenii PYR-1]MDFGSGRAIEIAPFHSRGSLKGFVVSGRWPDSTKEWAQLLMVAVRVASMP
GLLSTTTIFGAREELPDEPEPGTVGLVLAEGTVVGDAAVPPGHFADRQPP
ALMMLHPPSETTPSLPECAGAASGCVLLPGLPHLGLEHRAAWVEAESDGT
VTSMVSRVGVDPISHPDTAILAMLLAA
120406612YP_956441.1 putative phage repressor [Mycobacterium vanbaalenii PYR-1]MRGNHGPRAPRFRWPLRRFVVVEDSMRPTLEPGDGLLALRGGTPKRGQLR
VFPDPTRASRYLVKRVGGVRGGEAVMFEALSDNADAPGVTDSRVFGWVPA
TRSYRVVWTVRKG
120406610YP_956439.1 hypothetical protein Mvan_5668 [Mycobacterium vanbaalenii PYR-1]MIQVCSQCGTRWNVRDRQRVWCPRCRGTLLAPSGHAAGHGWDPRQASPQD
APRQGARLPSGYRWVAVRPGAPPRPPRRRRDLGPTPRYLSIPRWGLVERF
DVPVEDAAQRKGPSVNAVQMTLVATMAVLGAAAFVHVVRYVLLIVNRSVL
LNPWIAGAATWGGVAVSVVAVFLTVASLVVLTNWLIARRSAAFAHQGHRD
PRSAWVLRLGCLTPFVNLFWAPVYVMELADAEGRQRWLHRPIVVWWLFWV
ASTTVTTFAFATSFTADAQGIADNTVTTIVAYLFAAAALLSALRVFLGFE
RQPVQRPSRRWVTVRVDAGESDDAEPARAVESNGENPAA
120406608YP_956437.1 Dps family ferritin [Mycobacterium vanbaalenii PYR-1]MNMQPDLVYLGEMTSPGALDAVDTKFHSLLNEQVRSELGASQQYLAIAVH
FDSSDLPQLAKFFYRQSVEERNHAMMLVQYLIDRGVPAEIPAVDPVRNTF
ETPREAIALALDLERAVTEQISRLAGTARDEGDYLGEQFMQWFLKEQVEE
VALMTTLVRIADRAGADLFQLEDYVAREITPGAADPSAPRAAGGAL
120406606YP_956435.1 abortive infection protein [Mycobacterium vanbaalenii PYR-1]MSATDDEPTDAQRRALRIEIAVVLAVTFALSAYTALLSLIESVLLGLSGQ
TIALNPTRSPFDLIDLGLNLARLFQLLAWGALAVYLLWRSGDGPARIGLG
RICWRRDLLGGVGLAMLIGVPGLALYQIARILGLNASVEPAELNDTWWRI
PLLLLLSFGNGWAEEVIVVGFLLTRLRQLRVNPWLALVISSLLRGLYHLY
QGFGAGLGNVAMGLVFGYTWQRTGRLWPLIIAHTLIDAVAFVGYSLLHGR
LGWLI
120406604YP_956433.1 prephenate dehydratase [Mycobacterium vanbaalenii PYR-1]MPGIAYLGPEGTFTEAALRALQAHGLIPSTAPDAAGADEVTPIAADSTSA
ALAAVRSGDADFACVPIENSIDGSVIPTLDSLADGAALQIYAELTLDVSF
TIAVRPGTAAADVRTVAAYPVAAAQVRRWLAAHLPEAEVVPANSNAAAAQ
DVAAGRADAGVSTALATQRYGLEALAADVVDEPNARTRFVLVGRPGPPPK
CTGADRTSVVLQLDNVPGALVSAMTELAVRDIDLTRIESRPTRTGLGTYK
FFLDFVGHIEDPPVAEALRALHRRCADVRYLGSWPTGDVVGAAPPPMDES
ASWLEGLREGRP
120406602YP_956431.1 hypothetical protein Mvan_5660 [Mycobacterium vanbaalenii PYR-1]MERMSEIPGPAPGPWWRSLQAASTRRALLLTALGGLLIAGVITALPKADP
TGGLTANSISLGPRGNDTFDHAKSGDCLNWPDRTPDAAEVVDCAAEHRFE
VAESVDMRTFPGSEYGPDAAPPSAARIQQISQEQCSAAVKRYLGARFDPN
SRFTISMLWSGDKAWRQSGERRMLCGLQLPGPNNQQLAFQGKVAEIDQSK
VWPAGTCLGIDPATNQPTDIPIDCAAPHAMEVTGAVNLAAKFPDVLPAEA
EQDTFIKDECTKMTDAYLAPIKLRETTLTLIYSTVSLPSWAAGSRQVSCS
IGATLGNGGWSTLLNSAKGPLMINGQPPVPPPDIPEERLTLPAIPVPDSS
SDSSSDSSGSSSSSGSTYDESESPQQTVHGPQPTTAPTQTEEPAGQAPPG
QGNTFLNGPPPAPPAPPAGPLPPAPPGAPLPPAPPAEVVPPPAEVLPPPP
APLPPPPPGI
120406600YP_956429.1 hypothetical protein Mvan_5658 [Mycobacterium vanbaalenii PYR-1]MTATNGSTRFYDDGRIQLDREALTLRRYHFPSGTSKIIPLRDILGYRVQA
LGPFVHRFRLWGSSDFRRWLPLDMYRPLRSTMVTLDVAGVRLHPACTPAR
PDEFVQVLDELLDAR
120406598YP_956427.1 phospholipid/glycerol acyltransferase [Mycobacterium vanbaalenii PYR-1MEPVYGTVIQLARLVWRVQGLKFTVTGVENLPTTGGAVIAINHTSYFDFT
FAGLPAYQQHLGRKVRFMAKREVFDHKVTGPIMRSLRHIEVDRDSGAASF
EEAVRKLKDGEFVGVYPEATISRSFEIKTFKSGAARMAIAAGVPIVPHIV
WGAQRIWTKGHPKKMWRPKVPISIAVGKPIEPTLPAAELTTVLHSRMQHL
LEQVQEDYGPHPPGEFWVPRRLGGGAPSLAEANQMDAEEAAAKAARRGGT
PGLDAGSAEAPG
120406596YP_956425.1 cof family hydrolase [Mycobacterium vanbaalenii PYR-1]MLVATDVDGTLLDDDENVSPRTRSVVRAVVDAGAQFVLATGRPPRWVPPI
VDQLGFAPMAVCANGAVIYDPSTDRIISARTLSADALGQLAEIATRVVPG
AGLAVERVGSSAHDAATPQFVSSPGYEHAWLNPDNTEVSMEDLLSAPAVK
LLIRKAGARSADMAAVLARHIGIEGDITYSTNNGLIEIVPLGVSKATGIE
ELARPLGIEPADVVTFGDMPNDVPMLGWAGLGVAMGNAHPDAVAAADEVT
ATNAEDGVARVLERWWL
120406594YP_956423.1 LGFP repeat-containing protein [Mycobacterium vanbaalenii PYR-1]MLYRRPAPSILFTALAATVVMLPWAISGGPDGDDSPAMPAPQLAQQPLAD
LGGGESIRELHQDTPFSMVALTSEDFAGTSARVRAKKDDGSWGPWYEAEP
LEGVGADLPGPRGTEPVFVGRTTTVQVAVTRPSDAPPIGPAAAAHKPDGP
ALGYIPANVESPLPQNITAVLISPPQAPPDLVPLPNAATPAGQPPRIINR
VEWGADEGMRCGEPRYDTRIRAGVVHHTAGSNEYTPEDSAGIVRSIYEYH
TRTLGWCDIAYNAMVDKYGQVFEGRAGGMNRPVEGAHTGGFNHNTWGVAM
LGNFDVVPPTPIQLRNTATLLGWVLGQAGVDPLATVVMPSEGGSFTKFPF
GASPTLPTIFTHRDVGNTECPGNAAYALMGQIRDIAARFNDPPGPEQLAE
TLRGGAIHAKWEALGGMNSYLGRPTSPEASGEGATRYVTFEHGAVYWSPE
SGAEPVTGELYNAWGSLGFERGALGLPTSAEIPEPLWIVQNFQHGTLNFD
RETGAVTRVIDGVPVELPPPGADSTPVQLERFTPPSNPA
120406592YP_956421.1 UDP-galactopyranose mutase [Mycobacterium vanbaalenii PYR-1]MISPDPRAAARPQADGFDLFVVGSGFFGLTIAERAATQLGKRVLVVERRP
HLGGNAYSEAEPQTGIEVHKYGAHLFHTSNQRVWDYVRQFTEFTGYQHRV
FALHNGQAYQFPMGLGLVSQFFGRYYTPDEARALIAEQAAEIDTADAQNL
EEKAISLIGRPLYEAFVKHYTAKQWQTDPRQLPASNITRLPVRYTFDNRY
FNDTYEGLPVDGYTAWLEKMAADDRIEVRLNTDWFDVRDQLRAENPDAPV
VYTGPLDRYFDYAEGRLGWRTLDFELEVLQTGDFQGTPVMNYNDADVPYT
RIHEFRHFHPERAYPTDKTVIMREYSRFAEHDDEPYYPINTDADRAVLAA
YRARAKAETASSKVLFGGRLGTYQYLDMHMAIASALNMYDNTLAPHLRDG
APLADPETESSGS
120406590YP_956419.1 PA-phosphatase-like phosphoesterase [Mycobacterium vanbaalenii PYR-1]MADAPRGEDAVLVAVQRALADRPGVLAVARGLSHFGEHSLGWLAVAALGA
VLSPRRRRDYVTAGAGALLAHAAAVVIKRVVRRQRPHHPAIAVNVGTPSR
LSFPSAHATSTTAAAVLLARPTGLPLPALLVPPMALSRLVLGVHYPSDVL
AGVVVGAVVGKAVGRLGDTLADRAEGVSSS
120406588YP_956417.1 hypothetical protein Mvan_5646 [Mycobacterium vanbaalenii PYR-1]MPQSSSADTLSAAPGRVTAAKAGRLARWPAIPHDISVRVSLWLGVAVVAG
LFGWGAWQRRWIADDGLIVLRTTRNMLAGNGPVFNAGERVEANTSTVWSY
LMYLGGLVAGPARLEYVALTLALVLSVLGVVLVMLGTARLYEPTLKGRRA
LLLPAGALVYIAVPPARDFATSGLENGLVLAYLGLLWWMMVRWSQGLRGR
PTSRSFDVTLAVVAGLSVLVRPELALIGGLALVMMLIAVDQWRTRALIVV
AGGLLPVGYQIFRMGYYGLLFPGTALAKDATGAKWEQGLVYLANFNQPYL
LWAPAVLLIGLAIMVRLLCGRPAGVDRRASAGSGWLARTVRSPSAVVLFM
LVSGALQAIYWIRQGGDFMHGRVLLTPLFCLLAPVSVVPLMLPDSRRMAR
GAGYLYAGATSVLWLAVAGWALWAANSPGMGADATRVTYTGIVDERRFYS
QATGHAHPLTAADYLDYPRMRAVLTAIENTPDGALLLPSGNYDMWDVVPA
YPPPPDAPRGFGSEYNGPHTVFFTNLGMLGMNVGLDVRVIDQIGLANPLA
AHTARIEDGRIGHDKNLFPDWAVAEGPFFKEPPYIPTYLDEDWIRQAEAA
LKCPETEAVLNAIRAPMGPRRFLSNLLNAAEFTRYRIDRVPMYELERCGL
PLPEPVNPPYTGLPPTGP
120406586YP_956415.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MHAMLRAIAALTVAVAAVLAPVTAPTAGAQGVEMLMVPSAAMGRSIPVAF
QGGGPHAVVLLDAFNAAPDVSNWVTAGNAMGTLSGRGISVAAPAGGAWSM
YTNWEQDGSKQWETFLADELPNWLAANKGLAPNGHAIVGAAQGGTGALTM
ATFHPDRYRFAGSLSGFLTPSATALNGAITAGLARFGGVDTRNMWGLPQL
GRWKWHDPDVHAQLLVNNNTRLWIYSPATTTCTDVPAMIGYCDQAQGSNR
TFYQHYRGIGGGNGHFDFPTSGNHDWGSWSGQLAAMSGELVATIG
120406584YP_956413.1 cutinase [Mycobacterium vanbaalenii PYR-1]MAKTNRRKRHRLLALFAAGAVGLVVVLIVAIVVVVLRRPDAPPTAVPPTA
APPTGTSGVPPTSKPRPEFQDASCPDVQLISIPGTWESSVHLDPFNPVQF
PIALLLNVTNPIRAEFGTDRLEVFTVPYTAQFHNPLSADRQMSYNDSRAE
GTRATIKAMTDMNNRCPLTSYVLVGFSQGAVIAGDIASDIGNGRGPVDQD
LVLGVTLIADGRRETGVGQEVGPNAPGQGAEITLHEVPTLSALGLSMTGP
RPGGFGALNDRTYEICARGDLICAAPESAFNITALPKTLEVLAGGAGQPV
HAMYATPDFWNLDGLPATGWTLNWAQGLIEGAPQPKHG
120406582YP_956411.1 beta-ketoacyl synthase [Mycobacterium vanbaalenii PYR-1]MAEAQDGSSKAGPDMTVAEMREWLRNWVGNATGQAPDSINESAPLVELGL
SSRDAVAMASDIEDLTGVTLTATVAFRHPTIESLATVIIEGEPEADISAL
DDEDWSREVDEGVANIAIVGVGTRFPGDMNTPDEMWQALLEARDAITDLP
EGRWSEFLSEPRIAERVAKARTRGGYLSDIKGFDAEFFALSKMEADNIDP
QQRMALELTWEALEDARIPASSLRGENVGVYVGSSTNDYSFLGVADPSTA
HPYAITGTASSIIANRVSYFYDFRGPSMAIDTACSSSLVAVHEGVKALRS
GDADVVLAGGVNALVTPLVTVGFDEVGGVLAPDGRIKSFSKDADGYARSE
GGGMLVLKRLADARRDGDQIYAVIAGAAINHDGRSNGMLAPNPDAQEAVL
RKAYKDAGINPRTVDYVEAHGTGTILGDPIEADALGRVIGRGRAADRPAL
LGAVKSNVGHLESAAGAASLAKVALSLQRNKIPPSINYSGPNPYIDFDKE
HLKVADTVTDWPRYSGHAIAGVSGFGFGGANAHLVLREVLPTDLVEPAPE
PDVAVVTPANDDAKAVYVGGVRMDEYGEFVSDEPLARRESGFDEDDDRGD
DEFYGRLPEEEPELPGLTDEALRLLEVAREELAAAEAENPTTPIVPIAVS
GFLTSRKRATAAELADWIDSPEGRASSLEAIGRSLSRRNHGRSRAVVLAH
DHDEAVKGLRSIAEGKPNPIVISADGPVTNGPVWVLAGFGAQHRKMAKSL
YLRDQTFAEWINKVDSLIQDERGHSIVELILDDAIDYTDETTELPIEKVQ
LVIFAIQVALGELLKAHGAKPGALIGQSLGEAAAAYFSGGLSLEDATRTI
CSRSHLMGEGEAMLFGEYIRLMALVEYSAEEIVSVFGEDEAFNNLEVCVY
AAPTQSVIGGPPDQVDAIIARAESEGKFARKFQTKGASHTSQMDPLLGEL
AAELQGIEAHPVQVPYYSTVHEGSLIRAGSDPIHDVDYWKKGLRHSVYFT
HGIRNAVDNGHTTFLELAPNPVALMQVGLTTAAAGLHDAQLIPTLARKQD
EVDSMTTAMAHLYVYGHDLDMRTLFPLPADRPVDPATDYADIPPTRFKRK
PHWLEAHFTGDSSAVMPGNHVATPDGRHVWEYLPKGETDLAALVKAAAAV
VLPDAKLTASEQRAVPGEGSRLVTTLTRHPGGAGVQVHARIEESFTLVYD
AIVTRGGQQTALPTAVGATTVAEVATAPVAVEEPSGAPEFEADNLTAGAN
LGASFAKWSPESGETIGERLGTIVGAAMGYEPEDLPWEVPLIELGLDSLM
AVRIKNRVEYDFDLPPIQLTAVRDANLYAVEKLIAYAVENRDQVEELAET
QKGQTAEEIAAAQAELMGGATTVAELEAKLAEAGHPIAADKSTDEVVTAA
GTEAPPSDVAVPAPPSDVAVPAPPTDPSGPSIPAPPTDPLGPSAPTAERS
SAADGSSRERSSAAGLAAKVLTQEAVTEALGADVPPRDAAERVTFATWAI
VTGKSPGGIFNELPSIADDVAEKIAQRLSERAEGTITAEQVKVARTIQDL
SSHVRDEMDAGELDGFVRILRARPEGSTRVPVFVFHPAGGTTVVYEPLMK
RLPADTPVYGIERVEGSIEERAREYVPKLMEIQGNGPYILAGWSLGGALA
YACAVGLKSQGADVKFVGLIDTVRAGEEVPQTKEEIRARWDRYALFAQRT
FNVEIPAIPYEQLEELDDEGQVKFVLDAVKDSGVDIPGGIIEHQRTSYLD
NRALDTAVIENYDGHVTLYMADRYHDDAIMFEPRYATRQPDGGWGRFVAD
LEVVPIGGEHIQAIDEPYIAKVGAHMSEAINAIEAESEGK
120406580YP_956409.1 hypothetical protein Mvan_5638 [Mycobacterium vanbaalenii PYR-1]MEHVSTDFTGLRRDAPLGDPRLDLCDLYVFPSPKDPGRTALILTANPNAD
ALHPDAVYRIAIDNDGDLRNDIAFNFVFSDPSAGLSGPRQWVDVYLALQA
EARVDAAAGSRIFGDREVSFDGGPHIWQSGSFTFFAGARSDASFADSRVI
AMAVELPTAYLGAAPDVRIWARCSLLRDGTWVHADRVGHPWVSGFFASDD
DLAEYSAGEPNRDRARWMGHLIDLLADTGDYTREEAIEAIEAEGTLPDVL
TYNPSAPVRYPNGRTLTDDVADYRSKFLTNGQQGLSGLNTPDDLLPEFPY
LGTPR
120406578YP_956407.1 RDD domain-containing protein [Mycobacterium vanbaalenii PYR-1]MSVPDAADTHRTAGVVSRGTAAVLDLIVVGVLLGLLYAGLVLSRLALNPG
SFRFPALDAVFSGMVGFVAAVVYLSLCWSVSGCTAGAVAMGLKVVGRRTT
RLKPVTALLRAIACVVFPLGLAWVAVDAQRRSLQDIVFGSRVVYVRP
120406576YP_956405.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MGVHRYVLALTVLIGALLLAPPAAAQPDADPGPESVAVAIHPLEPFVMET
TNGELTGFTVELWNEIAKRLGWDTEFVRTDNVAGQLAAVAENRADVAVGA
ISFTADREQHFDFSQPTLEGGLQIIVPVHDTRPAVPGLGGYLDLLFSRTM
LIWLSAAIVVSVIPAHVFWLIERRDEDPVVSRSYFPGIFQSFSWGIGSLV
GKNSTAATKTITQSLAILWGFAGIVFISFYSANLSATLTVAKLDAKITGP
ADLYEKSVATVADTTAAEFLRGMGIAATETDTIEESYHLLREENYDAVVF
DSPVLRYYVAHRGEGVAVMAGPVFQEENQGFVFNIGSPLRKPINQALFRM
REDGTYNLIKEKWFGDDIAATAGDID
120406574YP_956403.1 cell wall arabinan synthesis protein [Mycobacterium vanbaalenii PYR-1]MSGTSGEAVSGTSAGAVNIDARDVKIARWVATIAGLLGFVLAVSIPLLPV
TQTTATLNWPQQNRLDNVTAPLISQAPVSLTATVPCEVVRSMPADGGLLL
GTAPAEGRDAALNAMLVTVSDDRVDVIVRNVVVASVDRDRVAGPGCERID
ITSNLDGTFAEFVGLTQVSGDNAGQPQRTGYPDPNLRPAIVGVFTDLTGP
APPGLSFSATIDTRYTTHPTALKLAAILLAIVSTVIALLALWRLDRLDGR
RMHRVIPTRWRTLTAVDGVVVGGFALWYVIGANSSDDGYILQMARVADHA
GYMSNYFRWFGSPEDPFGWYYNLLALMTQVSTASIWMRLPDLVCALVCWL
LLSREVLPRLGPAVSGSRAALWAAGLVLLAAWMPFNNGLRPEGQIATGAL
ITYVLIERAVTSGRLTPAALAITTAAFTLGIQPTGLIAVAALVAGGRPIL
RILMRRRQLVGLWPLLAPLLAAGTVVLAVVFADQTLATVLEATKIRTAIG
PSQEWWTENLRYYYLVLPTTDGAIARRVAFLFTALCLFSSLFIMLRRKRV
PGVARGPAWRLMGVIFATIFFLMFTPTKWIHHFGLFAAVGGAMAALATVL
VSPVVLRSARNRMAFLAGVLFILALCFASTNGWWYVSNFGAPYNNSVPQL
GGVTASAVFFTLFGVAALWAFWLHLRNKQDSRVVDALTAAPIPVAAGFMV
LFMVASMAIGVVRQYPTYSNGWANIRAFAGGCGLADDVLVEPDSNAGFLQ
PIPGRYGPLGPLGGTDPAGFSPNGVPDRIIAEAIRLNNPQPGTDYDWNRP
IKLSRPGVNGSTVPLPYGLDPARVPVAGTYSTGPQQESRLASAWYELPPA
DAAHPLVVITAAGTISGTSVAEADTSGQTVELEYATPGPDGAPVAAGRVS
PFDIGPTPSWRNLRYPRAQIPADAVAVRVVAEDLSLGRGDWVAVTPPRVP
EVRSVQEYIGSEQPVLMDWAVGLAFPCQQPMLHANGVTDIPKFRISPDYF
AKLQSTDTWQDGINGGLLGITDLLLRASVMSTYLSNDWGQDWGSLRRFDT
IVDAQPAEIDLGDTTHSGLWSPGPMRFQP
120406572YP_956401.1 cell wall arabinan synthesis protein [Mycobacterium vanbaalenii PYR-1]MVPQPVRSAEPTPPPNGSNHRNSRLIAIVAGLLGTMLAVATPLLPVNQTT
AQLNWPQNGVLRSVDAPLIGYVATDLEITVPCSAAAGLDRPGRTVLLSTV
PKQAPNAVDRGLLIERVNNDLLVIVRNTPVVSAPLDQVLSPACEQLRFTA
HADKVTGEFVGLQAQPDDGGPADESEPTEPLRGERGGYDFRPQIVGVFTD
LSGPAPPGLEFSATIDTRYSTSPTLLKLLAMIVGIAMTLVSLCALHVLDR
ADGRRHKRFLPNRWWSVSALDGLVAAVLVWWHFVGANTADDGYILTMARV
SENAGYMANYYRWFGTPEAPFGWYYDLLAVWAQVSTASVWMRLPTLLMGL
ACWWVISREVIPRLGSAVKHSRAAAWTAAGLFLAFWLPLNNGLRPEPIIA
LGILLTWCSVERGVATSRLMPVAVAIIIGALTLFSGPTGIAAVGALLVAV
GPLKTIVAAHVSRFGYWALLAPIAAAGTVTIFLIFRDQTLAAELQASSFK
SAVGPSLAWFDEHIRYSRLFTTSPDGSVARRFAVLTLLLALVVAIAMTLR
KGRIPGTAAGPSRRIIGITVISFLAMMFTPTKWTHHFGVFAGLAGSLGAL
AAVAVSAAAMRSPRNRAIFTAAVLFLTALSFATVNGWWYVSNFGVPWSNS
FPEWKFGFTTMLLGLSVVALLIAAWLHFSGRDVPPPDGTPPRWKRILQAP
LAIATWALVVFEVVSLTTAMLGQYPAWTVGRSNLQALTGKTCGLAEDVMV
EQDTNAGMLAPIGVPVGDALGEVTSEGFNPNGIPSDLSADPVMEQPGSDN
FADTDNNGDTGSEAGTEGGTTVAAGVNGSRARLPFGLDPAGTPVLGSWRG
GTQQPAFLRSAWYQLPAGWNDRKRSDSLLVVAAAGRFDQGEVLVQWAGPD
GEPAGSTGFDDVGAAPAWRNLRTPLSAIPAEATQIRLVASDDDLSPEHWI
AVTPPRIPELRTLQDVVGSSDPVLLDWLVGLAFPCQRPFGHRNGVIEVPK
WRILPDRFGAEANSPVMDYLGGGPLGITELLLRPVTVPTYLKDAWYRDWG
ALQRLLPFYPNAEPARLDLGTAERSGLWSPAPLRLS
120406570YP_956399.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MVFDATGNPQTILLLGGTSEIALAIAERYLRNARARIVLADLPDHPRKDA
AVEQMRAAGAKAVDWIDFDALDTDNHPKVIDTAWRDGDVDVAVVAFGLLG
DAEELWQNQRKAVQIAGINYTAAVSVGVLLGEKMRAQGSGRIIAMSSAAG
ERVRRSNFVYGSTKAGLDGFYLGLGEALREFGVRVLVIRPGQVRTTTTME
HWKATGAKEAPFTVDKEDVAELAVTASNKGKDLIWAPGAFRFVMMVLRHI
PRPIFRKLPI
120406568YP_956397.1 GtrA family protein [Mycobacterium vanbaalenii PYR-1]MSPQLSLTTQIWRFVVTGGLSAVVDFGLYVALLAAGLHVNIAKTLSFVAG
TTTAYLINRRWTFQAAPSKARFIAVVALYAVTYAVQVGINYVFYMEFEDQ
PWRVPVAFVIAQGTATVINFIVQRAVIFRLR
120406566YP_956395.1 alkylhydroperoxidase [Mycobacterium vanbaalenii PYR-1]MNHLRGPVGASVEDMTQTLTTQDRLKIYKASPELYDAMMTLSTAAAKDVD
PELAELIKIRASQLNHCAFCLDMHTRDARKAGVGEQKLDVLAAWTEAGEL
FGERERAALALTEAVTELGRDGVPDDVYARAAAVFSDRELGQVIAMVVTI
NAWNRINVAVRMPIPRR
120406564YP_956393.1 hypothetical protein Mvan_5622 [Mycobacterium vanbaalenii PYR-1]MALPGPADRWAGMSIPPYQPPTPPSAAGNTLLCPKCSGVMKTYDRNGIHL
EQCDSCRGIFLDFGELEALTQMENRFMQAAAPPPPQSGYGYGPGWGHRGS
KHYRKQGFGRLFFSS
120406562YP_956391.1 ABC-2 type transporter [Mycobacterium vanbaalenii PYR-1]MTIMDAAAQSRTFARAWGDLVAGFGKRELWLHLGWQDIKQRYRRSVLGPF
WITIATGTTAVAMGGLYSMLFKLELSEHLPYVTLGLIVWNLINASILEGA
EVFIANEGLIKQLPTPLSVHVYRLVWRQMILFAHNIIIFVIIAIVYPKPW
NWADLAVIPALGLIAANCVWVALCFGILATRYRDIGPLLGSLVQLLFFMT
PIIWNESTLQAQGAGGWAKVVELNPLLHYLDIVRAPLLGADQELRHWVVV
LVLTVVGWTFAALAMRQYRARVPYWV
120406560YP_956389.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MSPDEPYIETRNAWVEFPIFDAKTRSLKKAFLGKAGGAIGRNESNVVVIE
ALRDITMSLKMGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGVATVRGRVA
PVFDLGVGMDPEISGFENIIIRGLFLGQTRKQMMSKVDEIAEFTELGDYL
SMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDAEFLKKAQTRLA
DLVERSGILVFASHSNEFLARLCNTAMWIDHGTIKMEGGIEEVVRGYEGE
DAARHVREVLEETAHTHEH
120406558YP_956387.1 cysteine desulfurase [Mycobacterium vanbaalenii PYR-1]MAYDVARVRGLHPSLGDGWVHMDAQNGMLLPDSVGRAVSTAFRGSMPTTS
SAHPAARRSAAVLAAARQAVADLVNADPAGVVLGADRAVLLTSLADAASG
RVGLGYELVVSRLDDEANIAPWLRAANRFGAKVKWAEVDIETGELPTWQW
EGLVTRPTRLVAITSASSTLGTVTELREVTKLVHEVGGLVIVDHSAAAPY
RLIDIDEIDADVVALNALAWGGPPIGALVFRDPAVIDAFGSVSLDPHASG
AARLELGSHQFGMLAGVVASVEYLAGLDDSAQGTRRERLSISMRSASAYM
NALFDYLLVSLRSLPTVTVIGSPEVRIPVLSFAIDNVPAERVVQRLADNG
ILAIANASSRVLDVIGVNDVGGAVTVGLAHYSTSAEVDQLVRALASLG
120406556YP_956385.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPMEGIIGGRTASDTPGLDIAEQRAWQNFLDAALRLYATMNRSLSDEHGL
TLNDVRLLDLLAKSPTGSARMGDVAESLMSLPSRVTRQIHRLEVQGLVSR
IASPDDGRGVLASITPEGRSALATAMQTYGVAVRSHFLDRLSRPQVTAMG
ENCRRISVALKNGGPSAKIGRV
120406554YP_956383.1 hypothetical protein Mvan_5612 [Mycobacterium vanbaalenii PYR-1]MARMKTHARFTAATMVALGVVLGLTTACQRTTEGAVAQTTQPGPPLTSAP
TTSSRAPGIPGIPDIQIPNLPLPTRNTDVPEVPAPANAMTMTCEEFTDLD
EPTRVAVVREILSQEGNPLGPDGEFVGQILADAACQFLPSAVVADVLLGG
G
120406552YP_956381.1 cytochrome-c oxidase [Mycobacterium vanbaalenii PYR-1]MTAESTVEKPTTLVPKRPFPARLGPKGNLIYKLITTTDHKLIGIMYVVTC
FVFFLIGGIMALFIRTELAVPGLQFLSNEQYNQLFTMHGTAMLLFYATPI
VFGFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGALIALSGFITPGGAAD
FGWTAYTPLSDAMYSPGAGGDLWIFGLGVGGLGTILGAVNMITTVVCMRA
PGMTMFRMPIFTWNILVTSILVLLIFPLLTAALFGLAADRHLGAHVYDPA
NGGVLLWQHLFWYFGHPEVYVIALPFFGIISEVIPVFSRKPIFGYTTLIY
ATFSIGALSMAVWAHHMFATGAVLYPFFSFMTFLIAVPTGIKFFNWLGTM
WKGQLTFETPMLFSVGFIATFLLGGLSGVLLASPPLDFHVHDSYFVVAHF
HYVLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLV
QHWLGDEGMPRRYADYLPTDGFTTLNVISTIGAFILGASMLPFVWNVFKS
WRYGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYP
HMVERMRAEAHAGRKHGGPAGGDVTRLDDENVRT
120406550YP_956379.1 hypothetical protein Mvan_5608 [Mycobacterium vanbaalenii PYR-1]MGDRPATVDDVHEIATAMPHVTRVEGPKAGNPIYQVGGKSFVFFRTPRPD
ALDPDTGERYPDVIVIWVESEDDKLALTQDPDSPFFTTDHFDGHPSVLVR
ASRLGEVGVTELRELIQDAWLSRASKRRAQQWLAERGG
120406548YP_956377.1 beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYMDSKPPTATIEAAHREHLATLPFDDTRDFADADRGFIAAQQPCVIKAADG
RVVWDNDVYAFLTGDAPTTVHPSLWRQSTLAAKQGLYRVVEGIYQVRGFD
LSNITFVEGDTGIIVIDPLVSTEVAAAALALYREHRGDREVRAVIYTHSH
VDHFGGVLGVTSQADVDAGRVAVLAPEGFTAHAVQENVYAGTAMTRRAAY
MYGTVLERGPKGQVGCGLGQTPSTGEVAIIVPTVDIRETGETHTIDGVEI
EFQMAPGTEAPAEMHFYFPRFRALCMAENATHNLHNLLTLRGALVRDPHG
WAGYLTEAIDTFADRADVVFASHHWPTWGKDRIVEFLSLQRDLYAYLHDQ
TLRQLNQGFTGIEIAEAFAMPPALERAWHARGYYGSVSHNVKAVYQRYMG
WFDGNPARLWPHPPEAIGPRYVAAMGGIDRVVELAKGAFDEGDFRWAATL
LDHAMFTDENHAGARALYADTLEQLAYGAETATWRNFFLGGATELRVGNF
GTPTQTTSTSMVAQLTPEQMFDVLAISVNGPRAWDLDLAVDVTFLTAASR
ESGTAASRGSGTAATNYRLTLRNGVLVYRAAAADEASAHVTIRLANKLRL
LTLAAGDTTSPGLEIAGDAEVLTALVSVLDKPDPSFNIITP
120406546YP_956375.1 phosphoglycerate mutase [Mycobacterium vanbaalenii PYR-1]MQLLLVRHALPLRSEPGQGSDPSLSAEGLEQAKRLPDALARFPITRLVSS
PQVRAIETGQPVADALGLPIEVDDRLAEYDRDLAHYIPIEQIAAERPEEL
QRLIDGHLPSAVDEAAFLARVTAGIEDLVTGAGHDDTVAVFSHGGVINVL
LHHVLRTERLLSFHVDYASVTRLLSSRTGRLAVAGVNGTEHVWDLLPRNQ
RW
120406544YP_956373.1 hypothetical protein Mvan_5602 [Mycobacterium vanbaalenii PYR-1]MGTPPPPPKSAVHLTRAAALWTALTLGFLILIVLLIFIAQNTESAEFAFL
GWHWSLPLGVAILFAAVAGGLLTVAVGAVRMFQLRRAAKKNLKGGV
120406542YP_956371.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MISFEHVTKRYPDGTVAVDDLTLEVPEGTLAVFVGPSGCGKTTSMRMINR
MIEPTSGTLTVDGRDVTKVDAVKLRLGIGYVIQSAGLMPHLRVVDNVATV
PVLRGESRRSARRSALGVLERVGLDPKLADRYPAQLSGGQQQRVGVARAL
AADPPILLMDEPFSAVDPVVREDLQTEILRLQSELRKTIVFVTHDIDEAI
KLGDKVAVFGRGGVLQQYDAPARLLSNPANDEVAEFVGADRGYRGLQFFH
ATGLPLHDIRRVAEPEINALTLNPGDWVLVTRTDGTPYAWINAAGVELHR
NGSSLYDSTIAGGSLFQPDGTLRLALDAALSSPAGLGVAVDGAGQVIGGV
RADDVLAALDKQRAARQAEG
120406540YP_956369.1 binding-protein-dependent transport system inner membrane protein [MycMNFLQEALSFIFTAANWGGPAGLSARILEHLQYTVIAVFFSAVIAVPLGM
LIGHTGRGTFVVVTGVNALRALPTLGVLLLGVLLWGLGLIPPTVALMLLG
IPPLLAGTYSGIANVDRDVVDAARAMGMTESRILLRVETPIAMPLILGGL
RTATLQIVATATVAAYASLGGLGRYLIDGIKVREFYLALVGALMVTALAL
ILDAALAFAVWASVPGSGRLHRSGSMPQPLLGDEVALESRSRAGRRPDSE
ARHERGNPSPTVEA
120406538YP_956367.1 prephenate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MCQPRHVTKTPVCVIGLGLIGGSLMRAAKAAGREVFGYNRSVEGVDAARL
AGFDASTNLDETLARAAAVDALIVLAVPMPALPLMLRHVRESAADCALTD
VTSVKGAVHEEVAKAGLLARFVGGHPMTGTAHSGWAAGDARLFVGAPWVL
SVDDHVDPGVWATVMHLALDCGSFVVPARSDEHDAAAATISHLPHLLAEA
LAATAGEVPLAFALAAGSFRDGTRVAATAPDLVRAMCEANATHLLPVLDH
ALRLLIDARNQLAQHQPVSELVEGGHAARIRYDSFSRPQIVTTVIGAEEW
RDELAAAGRAGGVIRSALPVRDSRG
120406536YP_956365.1 CMP/dCMP deaminase [Mycobacterium vanbaalenii PYR-1]MNRQFSSAGEPAIQSKQVTDEELIRAALDAARLAGPRDVPIGAVVFAPDG
RELARAANAREEFGDPTAHAEILALRAAARELGDGWRLEGATLAVTVEPC
TMCAGALVMARVARVVFGAWEPKTGAVGSLWDVVRDRRLTHRPQVRGGVL
EAECAAPLEEFFAGQR
120406534YP_956363.1 hypothetical protein Mvan_5592 [Mycobacterium vanbaalenii PYR-1]MTHTPGDLPSPDEFRRKMAHLDREFADARRYLSMLCAGDNESLSALMMEI
HRGGRAMKVLAAMAVQALDFAQLSADRLGGDVQKWLDESVMTQDTAENER
DQTELGGES
120406532YP_956361.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKALRFYAPEDVRLEDVPEPTCAPDEVKLRVRNCSTCGTDVKIFYNGHQN
LTPPRTIGHEIAGEIVEVGADVNSTYGSSWQVGDRVQVIAAVPCGECHEC
RKGWMAVCQNQTSMGYQYDGGFAEFMIVPRQVLKVDGLNRIPDNVGFDEA
SAAEPFACAINAQELLGIEEGDTVVVFGAGPIGCMHIRIARGVHNCGPVY
LVDVNAARLQMSADAVSPDEIINGAEVDVVEKVMELTGGRGADVVITATA
ANVAQEQAIAMAARNGRISFFGGLPKTNPTITCDSNVVHYRQLHIHGANG
SAPEHNKRALQYISTGQVPVKDLITRHIPLDDVLDAFQIVKNGEAIKVTV
EPAP
120406530YP_956359.1 DeoR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MDSDTRQSRIVEFARTRGRVDVASLATELDVASETIRRDLKVLAGRRLLK
RVHGGAVPLETAAFESGVEYRSQVDLAQKHRIAAAATGLLHGAETVYLDE
GFTPRLIAERIAEQELTVVTSSLLAAEALAHSRTVTVLLLGGRMRGRTLA
TVDHWAVDMLSSLVIDVAFLGTNGISLEHGLTTPDPAVAAVKGTAVRVAR
RPVLVAAHSKFGESSFCRFARIEDFEAIVTGQELGAEEARRYEELGPVLI
RV
120406528YP_956357.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MTNRVQELLGVEFPVVQAPMTYIARAELAAAVSEGGGLGMVETLTPEGRE
DLLRVRDLTDRPVAANLMIQGWKRDPSIVDTLAAAGVRHVFTSAGDPALF
TARLHDAGMTVVHVVGSLKGALKAADAGVDALVVEGVEGGGFKSALGAST
MVLLPLIADRVDLPIICAGGVCDARSGAAAVVLGAEGVQMGTRMLASVEA
AVHTNFKDAIVAADDSGTVLLDVPGNPTMRVLRTGLAARIDEHPADAQLL
GRITDLYFGGDMEASVANTGQVSSRITELRPVAEIVRQTWRGIESVLDSA
RTRLD
120406526YP_956355.1 hypothetical protein Mvan_5584 [Mycobacterium vanbaalenii PYR-1]MKLMAAMAIAGAVLGAPLALSGTASATPSTCDGAGCVPSVNRDAQPGAYC
NQSTRYNFGLDGSGNTLACNSKSMWVASPPLVGVRTLRSPCGDATGVAQS
PDGVPLKCDGGAWSADYWTMFYG
120406524YP_956353.1 hypothetical protein Mvan_5582 [Mycobacterium vanbaalenii PYR-1]MKREILVAVGGAAIVMAGLSGCGSDKSETSGETSQAAAAEGKSTVTIDGA
DQEVQGTVVCSDMGGNTNIAIGDATTGIGVVVSTGDDPAVVSVGLGNVNG
VTLGYQSGAGQGEAKAEKDGKTYKISGTATGVDMANPMAPVNKPFEIEVT
CP
120406522YP_956351.1 queuine tRNA-ribosyltransferase [Mycobacterium vanbaalenii PYR-1]MDVELPGRLGRTGTIRTPHGDIQTPAFIAVGTQATVKAVLPETMKEIGAQ
AVLANAYHLYLQPGADVVDEAGGLGAFMNWPGPTFTDSGGFQVMSLGVGF
KKVLAMDTSRVQADDIIAEGKSRLAHVDDDGVTFRSHLNGSSHRFTPEVS
IGIQHQLGADIIFAFDELTTLVNTRGYQERSVQRTHDWAVRCLAEHRRLS
RVRSHTPPQALFGVVQGAQYEDLRRQAARGLTQIVDEEGRGFDGYGIGGA
LEKQNLATIVGWVSSELPDDKPRHLLGISEPDDLFAAIEAGADTFDCVSP
SRVARNAAVYSADGRFNITGSRYRRDFTPIDAECDCYTCTHYTRAYLHHL
FKAKEMLSATLCTIHNERFVIRLVDDIRVAIREGRFDELREHVLGRYYAK
A
120406520YP_956349.1 amine oxidase [Mycobacterium vanbaalenii PYR-1]MSGMTGHEADVVVVGAGLSGLIAARTLLGAGLTPLILEADTRVGGRILTE
DLGGLPMELGAQWIGDTHHRMFALAAELGVETYPQFDDGETTYELAGTGV
LRGNEFHDRFAGELAELEKVLRRLDGLATEVDPATPWTAPHAAEWDAITA
GAWYDAQGLSPVARTLLEICTVGILAVPTVEVSFLHLLFTIQTCGVTSEL
FAESEGGAQTTRFVGGTAEIPKRLAAMLTEHLVLDAPVQLIEHGSDSVTV
HCRGGRTARGRRIIVAVSPMLAGRIMYDPPLSGYRDQLTQRMPNSAAMKA
FFVYDEPFWRADGLNGQLISDVGPARMSNDTCIRGDDRGVILLFLEGEQA
RTHGHWSEEERRAALTAELVRHFGERAAHPQLYVDGEWGSRQWTRGCYNA
NCGPLVWTTYGAALAEPIGPIHWASTDTATEWSAYMEGAVQAGERAAAEV
IEALTK
120406518YP_956347.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMSRTLQLTPPGCYGPAMRYPRTVLLAVLAAIAVLLTACGSSGSGNPVESS
GVLRVGTEGVYAPFSYHDPATGQLTGYDVDVARAVGEKLGVNVEFVETPW
DSIFAALEANRFDVVANQVTITPERQQKYDLSEPYSIGEGVIVTRADDDS
ITSLADLRGKRAAQSTTSNWAGVARDAGAQIESVEGLTQAMALLSQGRVD
VVVNDSLSIYAYLAETNDTAVKIAGATGEKSEQGFAARKNSGLLPDLNTA
LEELKADGTLAEISQKYLKTNASGGQDAPQTQPRSALRLVLDNLWPLARA
ALTMTIPLTIISFVIGLVIALGVALARLSSNVVLTNLARFYISVIRGTPL
LVQLFIVFFALPEFGVRIDPFPAAVIAFSLNVGGYAAEIIRSAIQSIPKG
QWEAAETIGLNYAGTLRRIILPQATRVAVPPLSNTLISLVKDTSLASTIL
VTELLRQAQIIAAPTFEFFALYGTAAVYYWVICLVLSFGQARFERRLERY
VAK
120406516YP_956345.1 UbiC transcription regulator-associated domain-containing protein [MycMPTQTEDLRRRIVSDINAGVPGTKLGSERELAERYRTSRSSLRQVLAALE
EAGLVDRVIGRAGGIFISHAQVQRSLTDVVGVPAFLASQGYVAGTRVLST
KICAPDSATQQALKIGADDFVIEIQRLRLADGSPISLELAQFPADAFPGL
LEQQLGGSLYEILESQYGLVTARADERIEAVNATPEEANLLGIKAKSALL
LITRITYDQHDTPCEFSRDLFRGDRTRLAVTAQGRGVGVQPSVAAASVAL
QSPPI
120406514YP_956343.1 aminoglycoside phosphotransferase [Mycobacterium vanbaalenii PYR-1]MSGDDVNDDRAVAEKALEAFDLPQGSTLRLLNLSENATYAVEEPGCGHRS
ILRVHRQNYHRVDQIESELLWLDALRRDSDVTVPTVLPAHDGRRVVTVAH
DGADRHVVHFEMVPGAEPDENALTSTDFHTLGRITAALHDHARSWERPAA
FSRFAWDWENSLGGSPRWGRWRDAIGVGAQEAEVLERAERLLHRRLAEYG
TGPDTFGLVHADLRLANLLVDGDTITVIDFDDCGFGWYFYDFGTAVSFFE
DHPSVPEWQEAWVSGYRTRRTLAASDEDMLASFILLRRLLLLAWMGTHSH
SKESQAISVTYAAGSCKLAEQYLSSDGHRLF
120406512YP_956341.1 microcompartments protein [Mycobacterium vanbaalenii PYR-1]MASNAIGMIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGE
VGAVKAATEAGAESASQVGELVSVHVIPRPHSELGAHFSVAAQ
120406510YP_956339.1 hypothetical protein Mvan_5568 [Mycobacterium vanbaalenii PYR-1]MSVDRDVLRQLVREVVREAVGDLVTATPAPPPAAPPTAVQPARTPDGPVA
TGPLAADERSRTDTVRIANDRDLDVFVRNLLRLFENPKTRADLRHGRLSF
RLAGTERGGPGSTKRIERGAVTERQISDIAASGASLVLGPRAVLTPLARE
RARALGVPIHKERT
120406508YP_956337.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTGESAVPHAGQLLERARFAAAAYADYDQAAVARIVEAVAEAGYRNAERF
AAAAVAETQMGVVEDKVVKNRACSRGIVEFYRDQDYVTPRVDTARKIVEI
PRPAGVVLALTPTTNPVATVYFKVILALMTRNAVVVAPHPRARQCSAEAA
RLLAEAATAAGAPDGIVQVIDEPSLPLVEALMSDERTDVIVATGGTGVVR
AAYSSGNPALGVGPGNVPVFVDATADVDAAARRIVDSKAFDNSVLCTNES
VLIAEDAIAARLSTALTRHGAHILDADAAIRLREYMFPDGALNTEVVGRD
AAWIADRIGLRVTPKTRVLIAPFTDVIGEEVLTHEKLCPVLGMTTVADAQ
RGIRAARAVVRIAGAGHSAAIHSEDATVITDFAAQVPVLRVSVNVGNSTG
SSGLDTNLAPSMTIGTGFVGRSSIGENLQPENLMNWARIAYNSDAAVTMP
NFAGLSPWRSPAGPVPAYPRASNDPSAAAAAPAAPVSRPSARRTGEPGIE
ALRAELRALVAEELAQLIKR
120406506YP_956335.1 amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-MTEDVVPRQTAPTDSVQRLKRNAVGTFGVIFMAVATAAPITAMVGNVPIA
VGFGNGSHAPAGYLVATVVLGLFAIGYATMAKHITATGAFYGYISHGLGR
VMGMASGGIITMAYVVFEASLIGIFAFFFQNFLSSQFGFDIHWLIPALLM
LALNCILTYFDVNLTAKVLGVFLVTEIVMLSLGAIAVAVKGGGPDGFAVG
EILNPVGAFQPAAIAGASAGLGLFFAFWSWVGFESTAMYGEESKDPKRII
PRATMIAVLGVGLFYVFVSWMAIAGTGPKQAVELAQSADTSSEIFFAPVR
TTYGEWAITLFNILLVSGSFACGMAFHNCASRYLYALGREGLSTRLQDTL
GATHKTHGSPHIASFVQTGITLVLILAFFAAGMDPYIHMYTLLAILGTMA
ILIVQSLCAFSVIAYFHFHKNHPSSAHWFKTFLAPLLGGIGMLYVVYLLW
EHKESAAGAASGTLLFKLTPWIVVGLFALGAAMALYFKFNDKRRYELIGR
IVYDDSEIRD
120406504YP_956333.1 propanediol utilization dehydratase- small subunit [Mycobacterium vanbMAMSEISAASRENITVGNAVDGKLGLGDLRMDPATLAHQAAVAEAGGNPQ
LAENFRRAAELATIEDEQVMALYEALRPHRSTAAELEELRASLLARGAPR
CAALVEQAAAVYARRGLLR
120406502YP_956331.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MPVTRRRLVFIASRLCVLFAVAVSALMSPAAAAHAFSRPGLPVEYLMVPS
TAMGRDIKVQFQSGGPGAPAVYLLDGLRARDDFNGWDIETNAFEMYHGSG
LSVVMPVGGQSSFYTDWYRQACGNAGCSTYKWETFLTQELPAYLAVERQV
RPTGSAVVGLSMAGSAALTLAIHHPEQFRYAASLSGFLNLSEGWWPMLVG
ISMKDAGGYRSDDMWGPSSDPAWQRNDPMVNIGQLIANNTRVWVFAGNGK
PADLGTGEPEGDNVPAKFLEGFTLRTNRTFQEQYLAGGGRNGVFNFPDSG
THSWGYWAEQLQSMKPDIQRVLGAAPGQSALSSPDN
120406500YP_956329.1 DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]MSGSRRESVVKDLVFIGGLLILAVALIVYLVMGSEEVSDAASQPMSPQVS
APESNAPGGQVDAVTALSVERRTTGDPLAQGDPAAPVVMVMFADYRCPFC
AKFSRDTEPDLVERFVDQGVLRLEWRDMPIFGEQSMRAARAGRAAAEQGK
FWEFNHEVFAMSPDRGHADLNEDALVGFAEKAGVPDIDKFAASMRGNEFD
AAIDADLAQGSSIGVPSTPAFVINGEPVLGAQPTEEFVRVIDEAKDRT
120406498YP_956327.1 CopY family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MGLRQFGELEAVVMDLLWSREGASTVRSVYDELRGSRQIAYTTVMSTMDN
LFRKGWLERDKVGLAYHYRPAMTREEHSANLMRTVFESGGDGELILNFFL
EQIGEDDSAKLRQAIRRSTRKGSR
120406496YP_956325.1 hypothetical protein Mvan_5554 [Mycobacterium vanbaalenii PYR-1]MVLRSATQRISPAYESARRATLIRWLRAGAVGLTAMLLMAVPTDVINTPW
FSREVPVRWWEYPTLIAMGILTTVWMGIATSRRGAGTAVSGVTLATFAIG
CPVCNKLVLAAVGTTGALGLWAPVQPILATVSVTLMTAAVAWRWRQRPCA
AGQCGSVHAE
120406494YP_956323.1 hypothetical protein Mvan_5552 [Mycobacterium vanbaalenii PYR-1]MKSQSHPAEPHLGSVASKLNWLRAGVLGANDGIVSTAGIVVGVAAATAER
GPILTAGIAGLAAGAVSMALGEYVSVSTQRDTEKALLGKERQELRDDPAA
ELEELVALYEAKGISAATARTVAEELTEHDAFAAHAEIELGITPGELTNP
WQAALSSALSFTVGALLPLIAILLPPTTWRVPVTVISVLIALVITGAVSA
GLGGAPKQRAVLRNLIGGGLALMITYGIGHLVGAAVT
120406492YP_956321.1 ATP-dependent DNA ligase [Mycobacterium vanbaalenii PYR-1]MQLPVMPPVSPMLSKSVDTIPDGASYEPKWDGFRSILFRDGNEVELGSRN
ERPMTRYFPELVEAARAELPPRCVVDGEIVVATGGGLDFEALQLRLHPAA
SRVRMLAEKTPASFIAFDLLALDDTDYTARPFAERRAALVGALAGCGPTF
HVTPATLDVATARRWFDEFEGAGLDGVIAKPLDGHYLPDKRVMFKIKHQR
TADCVVAGYRLHKSGPDAVGSLLLGLYDDDGSLASVGVVGAFPMARRREL
VTELQPLVTTFDGHPWNWAAQVDPDTVRRYGGGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGQRFRHTAQFNRWRPDRDPLSCTFDQLDRPLTFSLDDIV
PGLGGTRPRG
120406490YP_956319.1 nitroreductase [Mycobacterium vanbaalenii PYR-1]MAKMLDICLRVLYTIDMPHPTDDVWEVLSTARSIRRFTDEPVTDAVIDRC
LEAATWAPNGANAQLWRFIVLDGPEQRAAVGKAAQIALTSIEAIYGMTRP
DDDDASRAARNNRATYELHDRAEEYTSVLFTAFKNEFSSEFLQGGSIYPA
IQNFYLAARAQGLGACLTSWASYAGGGQVLREAVGIPDEWFLAGHIVVGW
PRGHHGPVRRRPLTDVVFRNRWDPERADITYGRGARPRGKS
120406488YP_956317.1 hypothetical protein Mvan_5545 [Mycobacterium vanbaalenii PYR-1]MAFPGYTGLREYGNHGPARWAAELISAAGEFMAYGPSHWSVIAVFAVGAM
LLIWLGRRQTETGARRFGRIGGALTALIYLGASVNALIPPGIDWSVPLHL
TDLATLVAAYALWSQRQWAFALTYYWGLVLSLQALISPVLTGPDFPHYQF
LGFWAIHLLVVWAAIYLTWGRRMRPTWRSYRLALTVTAVWATITIAFNSI
AGTNYGFLNRKPANASLLDLMGPWPVYLLVGFTLVAAVWALMTWPWSLVR
RPM
120406486YP_956315.1 ATP-dependent DNA ligase [Mycobacterium vanbaalenii PYR-1]MEPMPLSADLPVMPPLEPMLAKAQTKVPDEPGMWSYEPKWDGFRALVFRD
GGPGRDNVVLLSRSGKDLARYFPEVLDSVRDELAPRCVLDGEIVVPREIA
GRTRLDWESLSQRIHPAESRVRMLAEQTPAHFIGFDALAVGDSSLMKEPF
RTRREALVDAVNEKQWCHVTRTTEDPALGAQWLQEFEGAGLDGVIAKRLD
GPYLPGKREMVKVKHHRDADCVAIGYRIHKSGEGIGSILLGLHRDDGELQ
MVGGAASFTAKARLKLLADLEPLRIGDDVRDGEPSRWNSAADKRWIPVRP
ERVCEVAYDQMEGNSANGRRFRHAVKFLRWRPDRDPASCTFDQLDVPLNY
DLNDVLERS
120406484YP_956313.1 hypothetical protein Mvan_5541 [Mycobacterium vanbaalenii PYR-1]MPIATLRKLLAALAIVGILLSGIGVATMMIFGSRGQQQEAVTPVRKPPTP
PPPSVPTDKEFLIGVVVTAQNCDPAGPCFYTYTIDPKYVGLHPFPESPFT
VEYEVLGGHQPQPGKFTVAGDQAEILKDVVLEGPPGAQLSARVLRVFEEP
PAPAAEPPPGPAAEPPPGPAAEPVPAP
120406482YP_956311.1 hypothetical protein Mvan_5539 [Mycobacterium vanbaalenii PYR-1]MSLRGWLLFTAMGVIWGIPYLLIKVAVEGLSVPVLVFARTAVGALVLIPL
TLRRGAWAPVLAHWRPVVAFAFFEIIAAWLLLSDAERHITSSLTGLLIAA
APIVAALLDRLTGGDQPLTVKRLAGLGTGLAGVAVLAGPELAGGSAWPVT
EVLLVAVCYAIAPLIAARYLAEVPAMPLTAACLGLAALIYVGPAAATWPA
EIPSMRVLTAVALLAVVCTSLAFILFFALIREVGAPRALVITYVNPAVAL
AAGVIVLNEPLTARHLLGLAMILAGSVLATRRPVEPMQAAPR
120406480YP_956309.1 PDZ/DHR/GLGF domain-containing protein [Mycobacterium vanbaalenii PYR-MIRRHRILPIALAAVLALVAPLTPAVAAPGDPVAASVQVEPAVVRIDTEV
DYQGVVGLGTGIVLDPAGQVLTNFHVVQGADRITGTVAGRAYPAQLVGYD
RKRDVAVLQLIGANGLAAAPIGDAYALVPGQPVVALGNAMGTEAPLTREV
GTLTGFGRTVQAEDTLTGTSDELTGLFEFAAPVRAGDSGGPVVNDLGQVV
GITTAASVNFRMGPGGKGFAIPINDAMGVAGQIRGGIRSDSVHIGPPTLL
GVGVRTAPRDEPGVLIQEVMVGGPADLAGLRAGDILIELDGTPLDSTNTL
TSVLDRHYTGDVLDLTWVDSTGVTRDGKAVLTPTV
120406478YP_956307.1 GntR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSFHSLGRDELRAQHDEQQRNYAELQAKNLRLDLTRGKPSPDQLDLSNGL
LELPGADAFRDAEGTDTRNYGGLHGLPELRTIFSELLGIPVPNLIAGNNA
SLEFMHDVVVYSLLHGGVDSPRPWIDDLRNGAGVKFLCPAPGYDRHFAIT
ESLGIEMVPVPLREDGPDVDLIEELVAVDPAIKGMWCVPVYSNPTGTTYA
WETVRRLVQMETAATDFRLMWDNAYAVHTLTHDFVKQVDILGLAAAANHA
NRPLVFASTSKITFAGAGVSFFGGSLGNIAWYLQHAGKKSIGPDKVNQLR
HARFFGDADGVRLHMQRHQQLLAPKFALALEILEDRLGDSKIASWTEPKG
GYFISLDVLPGTAKRTVALAKDAGIAVTEAGASFPYRKDPEDKNIRIAPT
FPALSDLREAIDGLATCALLSATEQLLALPAEK
120406476YP_956305.1 hypothetical protein Mvan_5533 [Mycobacterium vanbaalenii PYR-1]MIRFLLRVAVFLGSSAIGLLVAGWLVPGVSLSVLGFVTAVVIFTVAQGIL
SPFFLKMASRYASAFLGGIGLVSTFVALLLASLLSNGLSIRGVGSWIAAT
VVVWLVTALATVVLPVLVLREKKKAA
120406474YP_956303.1 FAD linked oxidase domain-containing protein [Mycobacterium vanbaaleniMSVPSTDARSAHADGVQRLLASYRAIPQDATVRLAKPTSNLFRARAKTRT
KGLDTSGLTNVIAVDAEARTADVAGMCTYEDLVAATLPHGLSPLVVPQLK
TITLGGAVTGLGIESASFRNGLPHESVLEMDVLTGTGDVVRASPDENPDL
FRAFPNSYGTLGYSVRLKIELEPVKPFVALRHLRFHSLSALIEAMDRIVE
TGGLNGEPVDYLDGVVFSAEESYLCVGQRSATPGPVSDYTGKQIYYRSIQ
HDGPTDGAEKHDRLTIHDYLWRWDTDWFWCSRAFGAQNPRIRRWWPRRYR
RSSVYWKLIGYDRRFGIADRIEKRNGRPPRERVVQDIEVPIERTVEFLQW
FLDTVPIEPIWLCPLRLRDDRDWPLYPIRPHHTYVNVGFWSSVPVGPEEG
YTNRMIERKVSDLDGHKSLYSDAYYSPEEFDSLYGGETYKTVKKTYDPDS
RFLDLYGKAVGRQ
120406472YP_956301.1 cell wall hydrolase/autolysin [Mycobacterium vanbaalenii PYR-1]MPAILRVGAAVVAAMLVATTPAGPAQAAPANIAGMIVFLDPGHNGSNDAS
ISRQVPTGRGGTKDCQASGTSTEDGFAEHTFTWDTTLRVRQALTALGVRT
AMSRGDDTGLGPCVDERAAMANALSPNAVVSIHADGGPATGRGFHVLYSS
PPLNAAQAGPSVQFAKVMRDQLAGSGIPPATYIGQQGLNPRSDIAGLNLA
QFPSILVELGNMKSPVDSALMKTPEGRQRYADAVVRGIVAFLSSQR
120406470YP_956299.1 recombination protein RecR [Mycobacterium vanbaalenii PYR-1]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNKVR
DGVTFCAVCGNVSDEERCRICGDARRDASLICVVEEPKDVQAVERTREFR
GRYHVLGGALDPLSGIGPDQLRIRELLNRIGERVDGVEVAEVIIATDPNT
EGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRR
AMA
120406468YP_956297.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MRSRPAVWLRWATVHGVPRAFLTVRARRGEPLARLILGRGDRLALIEEIR
AAGPLMRTPVVWATADYDVCRTVLRDNDFGVADPSETGLPDALLGLIRRV
DPGLPNPVEPPAMLMTDPPQHTEYRKLVSRSFTPRSIAALDTRIGELTAE
LLDDLGRRREVDLIADYAAQLPAAVISRMLGVPDEDRARILGWGETGAAL
LDIGIGWRPFRAAIDGLVDVDTHLGAHFRRLHQNGADGTPFSSLALDGSL
SGRELISNAALLVGAGVETTVNLIGNGIAALLDHPDQLALLRDDPGLWPS
AVEEILRYDSPVQMTARTAHRDTEIAGVGIRKGAVIVMLLGGANRDPKVF
DRPQTFDITRANARDHLAFASGIHVCLGAALARIEGATALRELFTRYPDL
HLTAPAEPRDLVTLHGYRHLPVRLGRAATATRRAS
120406466YP_956295.1 integral membrane sensor signal transduction histidine kinase [MycobacMMPGGFSWPIVVSIDVTLFIVSAVAILQRPESQWWIAILGLAVAYSPYLV
FFAVDISVSPAVEALALGLAWMLAISIWLFGMSAPIEGDFAPVLLGLVTG
VIGSMTSMRGGMLAAVTAAGILGAAVAMDRVDTPWLYLSFIGIGWLVGYL
MRIQQELLLEQREAQQKLAEHAAVDERRRIAREVHDVIAHSLTVTLLHVT
GARRGLQEDRDVDEAVEALEQAERLGRQAMADIRRTVGLLDDAVGKVTPE
PGVGDIAMLVDDFVRAGLAVRFESSGRHDRISGAAGLALYRIAQESLANI
AKHAPDAVSELSLTVSPSEAVLTVTNRLPVPVAAANCADGRGMRGMRQRV
QQLGGTVNAGPDGDGWVVHATIPLDDESCVLRGCGG
120406464YP_956293.1 glutamine amidotransferase [Mycobacterium vanbaalenii PYR-1]MSESTVRIGLVLPDVMGTYGDGGNSVVLRQRLRMRGIDAEIVEITLDDPV
PAELDLYTLGGAEDYAQRLATKHLIRYPGLQQAISRGAPVLAICAAIQVL
GHWYETSAGERVDGVGVLDVTTSPQSERAIGEVAGTPLVDGLTDPLTGFE
NHRGGTVLGPDARPLARVTKGVGNRAGDGFDGAVQGSIVATYLHGCCLAR
NPQLADHLLAKVVGPLAPLHLPEVSQLRRERLAAPRRV
120406462YP_956291.1 DNA polymerase III subunit epsilon [Mycobacterium vanbaalenii PYR-1]MSSTAGSRWGRPADQPGAGWAVVDVETSGFRPGQARIVSVAALALSDDGN
VEKSLYSLLDPGVDPGPTHVHGLTAEMLAGQPAFGDVVGDLIEVLRGRTL
VAHNVGFDYSFLTAEAEMVHAELPVDTVMCTVELARRLDLGLDNLRLETL
AAHWGVTQMKPHDALDDAMVLAQILKPVLVRAQERRKWLPVHPVSRRTWP
NGRITHDEFRPLKALAARMPCAYANPGVFVAGRPLVQGMRVALSAEVGHT
HEELVERILHAGLAFTEVVDGHTSLVVCDDPAPEQGKGYQAGGFGVPTLG
SAEFLRHLDTVIGGSAIEEFADQASAGDQFTLF
120406460YP_956289.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MVSMDHMTENPPHPVARTWGNRHDYLPAAGRDFFLPAYDLLVRLLGTYPL
YDELVTQAELAGELDVLEIGCGTGNLTARALRAAPSARITATDPDPRAVT
RARRKAAGEGPVRFETAYAQELPFADASFDRVLSSLMLHHLDDGTKVSAL
AEAWRVLRPGGRLHIVDVGGADQPEGLMSRLTGHRHAAAGARLPQLVEAA
GFDTTVVATRRLRVFGPVSFIRATRPGE
120406458YP_956287.1 2-isopropylmalate synthase [Mycobacterium vanbaalenii PYR-1]MTENYSPSADAYSSVRTITTPAGPPNPGQPSWNTQRGSSMPVSRYRNFAA
EVPGGAPAAPFDRTWPDKVIDTAPLWCAVDLRDGNQALIDPMSPARKRRM
FDLLVKMGYKEIEVGFPSASQTDYDFVREIIEQGAIPDDVTIQVLTQCRD
ELIERTFEACDGAPNVIVHFYNSTSILQRRVVFRADRDEIKKIATDGARK
CLEEAGKHPGTRWRYEYSPESYTGTELEYALDVCNAVSEVIEPTPDWPLI
VNLPATVEMATPNVYADSIEWMSRNLARRGSIILSLHPHNDRGTAVAAAE
LGYQAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEI
RRTVEYCNQLGVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKISADEQD
SDVDDIVWQVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKADHGLA
LPRRLQIEFSQAIQQITDGEGGEVSPKEMWDAFYDEYLAPITPLERIRQK
VDASEVDGGTDTITAVVKVNGEEHEIVGAGNGPLAAFVDAIGAVGFHVNV
LDYSEHAMSAGEEAAAAAYVEAEIDGKTVWGVGIATSITTASLRAVVSAV
NRAMRTRPSLLR
120406456YP_956285.1 FAD dependent oxidoreductase [Mycobacterium vanbaalenii PYR-1]MTETADVVIVGGGLEGAAAAWALSRRGVTDVVVAERNTVGSGMTGKSSGI
VRCHYGVSSLAAMAADGLEVFENGEDIFGTDIGFRQTGYVVGVGEQNVES
LRKSLAAQRAVGVDTEEIDKDEVAKLWPFADLTPFAAFGWEARGGYGDAY
QTAQAFSTAARAAGARVRQGTAVTDLLVDGDRVTGVRTADGSEIFAGTVV
VATGVWTRPFLARYGIDVPIRVIREQIVLIDPGVEVGKVPVFSDLVSLQY
VRPEVGGEILFGNSDLPGYDAIDPADPDDYLNRATDGFVDLTVDKVGTRF
PGFPDAAISGSYAGCYDVTPDWNPIISVAPLDGLVIAAGFSGHGFKIAPA
VGRLVADIVVDGHSSDSRIPASDFRFSRFAEDDPLKTPYPYVGAGQMR
120406454YP_956283.1 glutamate synthase subunit alpha [Mycobacterium vanbaalenii PYR-1]MEQMRTFDLRTTPLREVNTALHAADLTGDFLIEHPAGAHNVAVGLSAPVK
VTIDGHVGYYAAGMNQHADVIINGNAGTGVAENMMSGSVWVKGDASQSAG
ATAHGGLLVIEGNAAARCGISMKGVDIVVGGDVGHMSAFMAQAGRLVVRG
DAGEALGDSIYEARIYVRGDVASLGADCVAKPMRDEHHSELEKLLKAAGF
EGDDTRSYTRYGSARSLYHFHVDNASAY
120406452YP_956281.1 glutamate--ammonia ligase [Mycobacterium vanbaalenii PYR-1]MAEDLATLAEQHGTKFILALFVDLRGKPCAKLVPVEAVDLLSTEGVGFAG
YAVGAMGQEPKDPDLMAIPDPASFTPIPFIKEGLAIVHCDPHVNGEPWPF
APRVILKSLIERCSDAGFEPWVGAEVEYFLLSRNDDGSIAVADTADTAAQ
PCYDARGVTRMYDHLAAVSTAMNQLGWSNYANDHEDGNGQFEQNFKFADA
LTTADRVITLRYLLSMIAAERGMIATFMPKPFGDKTGNGLHFHLSLTSGG
APVFPAEEDERGLGLSDTAYGFIGGILEHACALQAVVAPTVNSYKRTGAV
ATSSGASWAPRLPTYGGNDRTHYIRVPDSDRIEMRGGDGSANPYLAIAAA
LGAGLDGIKRSTDPGAVGQGVSTRALPLTLLHAVEDFEGDAVVTGALNAA
GEGVAAYFANIKREEFFAYHSTVGAWELDNYLTAF
120406450YP_956279.1 hypothetical protein Mvan_5507 [Mycobacterium vanbaalenii PYR-1]MIEPIRRHIVVNAPVERAFTVFTAQFGDFKPREHNLLAVPIVETVFEPRV
GGHIYDVGEDGSRCRWARVLDFEPPSRVVFSWDIGPTWQVESDASRTSEV
EVRFIPETPDRTRVELEHRHLDRHGEGWRSVADGVGGDAGWPLYLRRFGE
LIDR
120406448YP_956277.1 nitroreductase [Mycobacterium vanbaalenii PYR-1]MPAAPTDRLADTSVPIHPPIAERWSPRAFDPGADLDRDDLVALLEAARWA
PTWGRRQPVRFVVGLRGDAPFTTIAGLLRRGNSYAKAASALILLCTDDGE
DDRTQRYAAVDGGAAMANITIEAVSRGLIAHPMAGFDVAGASEAFALPDG
LRPVVVIAVGRLGDYADVAPEIAERDRLPRHRLPLSEVVLNWTP
120406446YP_956275.1 aspartate-semialdehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MVRIGVVGATGQVGQVMRTLLAERDFPATGVRFFASARSAGKKLGFRGQE
IEVEDASTADPSGLDIALFSAGATMSRVQAPRFAGAGAVVIDNSSAWRKD
PDVPLVVSEVNFERDAGNRPKGIIANPNCTTMAAMPVLKPLHDEAGLTRL
IVSSYQAVSGSGLAGVEELAGQARAVIDGVEQLVHDGSALQFPPPNKYVA
PIAFNVVPLAGSLVDDGSGETDEDQKLRNESRKILGIPELAVSGTCVRVP
VFTGHSLSINAEFSQPLSVARAKEILAGAAGVTLVDVPTPLAAAGADDSL
VGRIRRDPGVPDDRGLALFVSGDNLRKGAALNTIQIAELLAAQL
120406444YP_956273.1 hypothetical protein Mvan_5500 [Mycobacterium vanbaalenii PYR-1]MTGSAGLTDDELTAWRSFVDMRHLLERHLVGHLQREFGLSESDFEFLINL
SEATAGRMRSHELGEMTQWEKSRLSHHLSRMERSSPGTWCTTSSCDSSTS
LV
120406442YP_956271.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MRVLKSDSGYVLEGDWDGQDAANAFLNHLGGRGFSAATVRAYAFDVANLS
RFLVQQAVGLVAVDAPLVFDWIDWQGVRRTDQPTSGHRSSTPPAASTVNR
RVAAVRALFEYLVMTGVCTDNPVPSPRRGQGLRQSQRGLLGHLGPGRARS
GGRLVRQPQRLPESLSTNDVDAFLATLATHRDRAMVLVMLLGGLRSAEAR
GLLLTDVDMGRRRLRVIGKGGKERHVPVDAAFFTELAAYLRWERPPGLAT
PQCFVVLRGPTTGAPVSEAGLRSLFRRHRETSGATRVRPHRLRHTYGTEL
SAAGIDLLTLRALMGHVSPETTARYVHLSIEQLAAEYGAARATLAGARQ
120406440YP_956269.1 hypothetical protein Mvan_5494 [Mycobacterium vanbaalenii PYR-1]MISAMSEATPPREESEPVTAPVGTPPPPVPPQTVYVQQPSGRLNKAALWV
GIVAGSVFIVAAIFGAGVFVGKNIGDGPRNHHIGVMHHGPMMSPMGPQGG
FQRGPGSAGPFGPGGPVMESPRQPAGPAAPTAPPRP
120406438YP_956267.1 30S ribosomal protein S18 [Mycobacterium vanbaalenii PYR-1]MTARRREAAPAKKRRNLLKSLGIERVDYKDTSTLRQFISERGKIRSRSVT
GLTVQQQRQVTTAVKTAREMALLPYPGQNPTGR
120406436YP_956265.1 50S ribosomal protein L33 [Mycobacterium vanbaalenii PYR-1]MARNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRITLRKYDPVVRRHVDF
REER
120406434YP_956263.1 cobalamin synthesis protein CobW [Mycobacterium vanbaalenii PYR-1]MRTPVVVVAGQSDTDGITGVLLDGAGTVLVEHRFDGHVVHRSTTVVQGGL
LDTADEVLELTNCCLSCTVREDLLSHLRRLHRRPDVKRIAVRLGPWMEPE
QVCFAITRLPAARDVAIAAVVTAVDTSTWLRQALGDDELDDGRTVAQVVV
GQVEFADVVVLTGPDPDVVAVTRRLAPRARVAVGAQRLGVALADLDPDAR
RGRSDDPHASLLSGQPPLEAAGPVRLVEFQSRRPFHPLRLHAAVDLLLDG
VIRSRGRLWLANRPGHALWLETAGGGLRVTRTGKWLAAMTSREIAYVGPE
RRAMADLIWGYPHGDRHTSMTVLVCGAEPADIIDALQGALLTDAEMQRPQ
DWGRYEDPFHDTLEGDADEARLA
120406432YP_956261.1 glutamate--cysteine ligase [Mycobacterium vanbaalenii PYR-1]MACTMTSDGVVEQRFDPLSSAEAAAQHIVDGCLIDGPVGQVGLEVEAHCF
DLTDPSRRPGWDELTATITALPPLPGGSVVTVEPGGAVELSGPPLAEPAS
AISAMAADHTVLRAAFARAGLGLVLVGADPLRPAARVNPGPRYQAMEAFF
RASDSGDAGAAMMTSTASVQVNLEAGPRAGWADRVRLAHALGPTMIAIAA
NSPVLGGDFTGWQSTRQLVWSRLDSARCGPILGASGDDPASDWARYALRA
PVMLVHSPDPTPVTQWVPFADWADGRVLLDDRPPTLADLDYHLTTLFPPV
RPRGFLEVRYLDSVPDATWPAVVYTLATLLDDPAAADVAAEATEEVATAW
DRAAQLGLRDRRLHAAATRCVQAAADRAPRALEESMGHLVRSVEQGRSPA
DDFADRVVAHGIADAVTELAQGEL
120406430YP_956259.1 hypothetical protein Mvan_5484 [Mycobacterium vanbaalenii PYR-1]MDMCRHLGWLGDPVSVASLILEPPSGLLVQSYSPRRQKHGLMNADGWGVG
FFDGAVARRWRSAAPLWGDASFASVAPALRSGCVVAAVRSASVGMPIEAS
ASAPFTDGTWLLSHNGLVDRAVLPSSPRAESTNDSALLAALIFDRGIDEL
GATIAGVAAEDPNARLNILAGNGTRLLATTWGDTLSVLRRDDGVVVASEP
YDDDPAWQEVPDRHLVEVDGAHVHLRPLKGS
120406428YP_956257.1 class V aminotransferase [Mycobacterium vanbaalenii PYR-1]MTLAEQWRAARPPVAGVHVDSAACSRQSFAVIEAAAQHARHEAEVGGYVA
AEAAAPALDAGRTAVRALTGMSDAVVHFTTGSNHALDILLGDWTGARTLA
CLPGEFGPNLAIMARHGFSIKVLPVDEFGRLDVNAVGAALSSHQPALVHF
TVLGSHSGIVQPVRDMASACRGHGIPLIVDAAQGFAHLDVAGIGADALYS
SSRKWTAGPRGVGVLASRPGLLADDTRIRLNHAETNVGLQVGFSVAVGEY
VAAGPDAVQSRLREVGAATRTALADVPGWRVVEHVTEPSAITTLQSTDGI
DPLDVRTRLIAEHQIVTTYLGLERAPREMSHPALRVSPHVDVTDADLAAL
ADALATVTR
120406426YP_956255.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MARTRRAGAALPYGALDRDHLVKHLLELARRVGVENVTMRALATEAGTSA
SSVYYHVKDKAALLDLLAESVIESIEVPTEGDWEQRTRALYTNAWKVMIA
IPGIAAMLQQRPLTGAADAVDRTVKAIMAESGWTADEVAAAHVVLYIHLL
GSVQLEHHLRHSGIEIKSDDGAESVFQHGLRVILAGLRSCHTETSTPTT
120406424YP_956253.1 ATPase [Mycobacterium vanbaalenii PYR-1]MLDSVEEVREALAGEGYIADERLATTVFLQTRLDKPLLIEGPAGVGKTEL
AKVLAAATGRRLLRLQCYEGQDETKALYEWDYGKQLLYTQILREKIGQLV
SDAADLTEAVERIGAQESVFFSDRFLAPRPLLEAVRSPEPVVLLVDEIDR
ADEALEAVLLELLGEYQVSVPEIGTFRAVHAPYVVLTSNNTRDLAAALKR
RCLHLFLDYPAAERELEIVRSKNTGLSDALAAQLVDIVRGLRELELRKAP
SISETIDWARTLAVLGVDELSAQVLSDTVSVVVKYDKDVRKSLDALPRLV
DPNATVPEQHSHGHGHGHGHDHDHHGPEHHDHDHGDDGRAARAAKDQPGR
FTDGYYGTPRRAEQAATAGSLGRRRAL
120406422YP_956251.1 iron-containing alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1MGARYPTLTPELDRGRAATTPRLLKFHAPEIVFGIDSMVEAAHAAVRLGA
QRPMLVTDPGLIEAGWSDEMVTHLAGMGVRAAIWSDLTPNPKDHEVAAGY
QKYAEHGCDVIVAVGGGSVIDAAKGVAILAANGGDILDYEGVDKAQVPIP
PMVVVPSTSGTGADVSQFCIVTDTTRNTKITILGRALVPDITVIDPRLLT
TMPEWLNAATGLDALTHGIEAFVSLGHNQLTDHHALRAVQMVTDNLVHTI
DRPNEMPARVLMAQAALEAGLAFTNAILGAAHAMSHQVGGLLDLPHGVIN
GVLLPHVIRFNAEADPEPYQVIATSLGVTDPGAPAAEAALALADRIDRLA
RDVGVPRGLAELGVAEDDLPRLARTALQDACMSTNPRPADEAQMHALFRA
AL
120406420YP_956249.1 two component LuxR family transcriptional regulator [Mycobacterium vanMKPIRLVLVDDHAILRQGLRSVLERADDLIVVGEAASESEAVAVVGATSP
DVVLLDLKLSAGSEFEGLTLCAKLSAAHPKLGLLVLTTFLDEDLVVRAVH
AGARGYVVKDVDTTELVRAIRAISAGDSAFDSRSAAAVVRSMSGRSESRA
QLTDREVEVLRLLAAGLSNNKIGERLYISATTAKFHVSNIMRKLEVSRRA
EAVYAASKRGLI
120406418YP_956247.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MAHMTDVMDWDSAYRGEGDFEGEPPWNIGEPQPELAALWRDGKFRSEVLD
AGCGHAELSLALAADGYTVTGVDLSPTAVAAATAASAERGLSERTSFVAA
DITTLTGFDGRFATVVDSTLFHSLPVESRDGYLQSVHRAAAPGAGYFVLV
FAKGAFPAEMEGGPNEVTELELREAVSRYWIIDDIRPALIDTNVPKLPGM
PPPPLDMLDDRGRLRMQAFLLQAHKES
120406416YP_956245.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MPRGGPDASCLDRLLQTDRQEYLDRDSAGDAGLEQTKRSVIRALDWTGEV
FGNHEKFAKIALDEVADVADPRILELGAGHGGLSRKLLEWHPSARLTVTD
VEPASVAAIAAGDLGSHPRATVRQMDATALDAADGEFDLAVFALSFHHLP
PQLAARAIAEGARVADKLLIIDLPRPPAPLHVLRLAAMLPWAPLVPFLHD
GVISSLRAYSPSALRALATHADPAVDIELRGGLLSPQVAVATRR
120406414YP_956243.1 glycerol kinase [Mycobacterium vanbaalenii PYR-1]MADFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWVEHNPVE
IWERTGSVLATALNKTKLSTSDLVALGITNQRETSLVWNRHTGRPYYNAI
VWQDTRTDRIASALDRDGRGDVIRQKAGLPPATYFSGGKLQWLLENVDGL
RADAEKGDALFGTTDTWVLWNLTGGHRGGVHVTDVTNASRTMLMNLETLD
WDDELLGFFDIPRQMLPEIRPSSSPEPHGVTVDWGPADGEIPVTGILGDQ
QAAMVGQVCLDAGEAKNTYGTGNFLLLNTGENIVRSKNGLLTTVCYQFGD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQVEDNGGVYFV
PAFSGLFAPYWRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAM
AADSGVHLEVLKVDGGITANDLCMQIQADVLGVDVVRPVVAETTALGAAY
AAGLAVGFWDGADDLRANWQEDKRWSPTWSDDQRAAGYAGWRKAVQRTMD
WVDVD
120406412YP_956241.1 XRE family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MMANVADANRELADFLKRARSAVDPARAGLPADGRIRRVPGLRREEVALL
AGVSTDYYARLEQGRRITPSAAVLDAIARALDLGDTGRAHLGRLVGASPT
RRRSSRPVQRVRPGLYQLLDSLDETPAMILGRRTDVLATNRAARVLFADF
DAMPPRERNYARWMFTSEQARNLFADWSVQARTAVENLRLDFGGDPHDPA
VIELVDELSAASAEFRMWWAEHRVFQRTYGTKRLRHPVVGDLSVDYETFT
MPGDAEQTLFVYLAEAGSPSRDALNLLLSWSANSV
120406410YP_956239.1 aldo/keto reductase [Mycobacterium vanbaalenii PYR-1]MDSYQLGSYSVGRVGFGAMQLPGPGVFGPPRDHDQAIAVLRRAVELGINH
IDTAQIYGPNVANELIREALHPYPADLALVSKVGGKRDAQGNWLPAQEPD
DLYDQLEENLRTLDTDRLAAVNLRVFGSAGGAGPADLNRALFDRQLSTMI
RARDEGLIAGIGLSNIGVDHLRIALERTEIVCVQNAYNLVDRTSQPVLEL
CLEHGVAFVPFFPLGSGFVPDNPVLNHPAVVREARNLGRTPAQIALAWTL
SVAPNVLLIPGTSSVTHLEENTAVRDVELDDETRRELDEAAH
120406408YP_956237.1 PadR-like family transcriptional regulator [Mycobacterium vanbaalenii MSLRIAALGLLAEGSASGYDLLKQFEKSMANVWPATQSQLYSELNKLAAG
GLIEVCAVGPRGRKEYRITDAGRAELQRWVAERQDDPPVRSAGLLRVFLL
GLVPPEQARAHLHAMAEEADGEVRRLTELRESLTGGRAADPTDESFFGFA
ALDYGLRLNAMQAEWARSVIDRLDT
120406406YP_956235.1 RDD domain-containing protein [Mycobacterium vanbaalenii PYR-1]MVAQHQPVVTGDAVVLDVQIAQLPVRVLSALIDVTVVFVVYVLGVILWAV
TLTQFDPAFSGAVLIIFTVLALVGYPTIFETATRGKTLGKLALGLRVVSE
DGSPERFRQALFRALAGVIELWMLTGGPAVLCSLLSPKGKRIGDIFAGTV
VISERAPRQSPPPVMPPQLAWWATTLALSGLSPSQAEIARQFLSRARQLD
PQVRDQMAYRIASDVVAQISPPPPPGTPPALVLAAVLAERHRRELGRLQQ
QPFQPGPVWPAPPQPPAATPPSWPPAPPSAPPPQHPGGFAPPS
120406404YP_956233.1 hypothetical protein Mvan_5457 [Mycobacterium vanbaalenii PYR-1]MEHAVEDLFRNSGGYATTAALLRVMSRQQLDVRVRKGELIRVWHGVYAAT
EPDYLGRLQALDSYIGQPAVACMGTAAVLYGFDNEATSAVHILDPGVRVR
PTVGLMVHQRVGAPLGRVRGRLATSPAWTAVEVARTLHRPRALATLDAAL
RTGLCTPVELHAAVTEQRGRRGIVAVRELLPLADARAESPMESEARLAMH
DYGVPRPELQYVVHGAWDSWRVDFAWPEVLVAAEYESVDWHTGRDAMLKD
KARFAGLQHAAWTVIPITVTDVRISPERLAERIKEHLWRAAHTASSHKLA
L
120406402YP_956231.1 ATPase [Mycobacterium vanbaalenii PYR-1]MTQPTNHEGARNALMALRAEIAKVVVGQDAVVSGLVIALLCRGHVLLEGV
PGVAKTLLVRTLAAALQLDFKRVQFTPDLMPGDVTGSLVYDARTAEFEFR
AGPVFTNLMLADEINRTPPKTQAALLEAMEERQVSVDGQPRPLPDPFIVA
ATQNPIEYEGTYQLPEAQLDRFLLKLNVPLPPRDQEIAILNRHANGFDPR
DLSFVKPVAGPAELAAGREAVRQVLVGDEVLGYIVDIVGATRNSPSLQLG
VSPRGATALLSTARSWAWLSGRGYVTPDDVKAMARPTLRHRVALRPEAEL
EGATADGVIEGILSAVPVPR
120406400YP_956229.1 hypothetical protein Mvan_5453 [Mycobacterium vanbaalenii PYR-1]MSTIDIDRDAAQEAAQNELAKAIYPKPSPMDMLYDWIEQLLYRLTASAAK
FPGGWYTVAVLLVLLVVAVVVAVRIARRAMRSDRSTGPALFGDHILSAAE
HRATAERHAASGDWAPAVRHRVRAIARQLEENGVLDPVPGRTATELARAA
GRALPALSGELSTAADTFNDVTYGEQPATEPQYRMIAALDDHLGSRTPSS
VAVHADAAHQPWAEVR
120406398YP_956227.1 hypothetical protein Mvan_5451 [Mycobacterium vanbaalenii PYR-1]MTLMRVPAAALVTLTLLMTQPTGTAMAQPHSETETRNLATVHAGFESWRA
GTGSPYDALADDATWEIVGNSAASRVYSGKEDFLTNVIRPFNARMSQRLI
PQIRDIYADGDTVVVFFDAEGTARDGIPYRNTYAWFLTLNDGQIVKAAAF
FDAVAFNDLWQRVPA
120406396YP_956225.1 regulatory protein LuxR [Mycobacterium vanbaalenii PYR-1]MTSSAQPIRPSQESQVELVGRRAERRALDGVLSAVSAGRSGVLVLSGVLV
LSGEAGIGKTALLDEVAGQIAEGLLVRVAGVESETEFAYAALHQLCIPLF
ERIEQIPGPQRAALLTAFGQRRSPTPDPFLVGLAVLSLVSEFVHQCPVFL
IIDDQQWLDRASSIAIAFVARRLSAEPVGVVFATRTVGEELRGLPELVVG
GLTDDDSRELLALNLDGPLDTSVRDRIIVEARGNPLALLEIPRALGRTGL
AGGFGAPGVPLTHSLEGAFRHQLHGLPLPTRRLLALAAAEPAGDASTLWR
AAEVLGIETNAAVPAVEAGLAEIGSRVRFRHPLIRSTAYRSVALSDRQLI
HSALAAVIDRELDPDRRAWHLGHAAIGPDDEVAAELERCATRVRARGGVA
AAAAFLERASALTLDPSNRCDRTIAAASAKAQAGALDVAKDLLKVADAAP
MTELQRAQADLVRAQLAFISNHGNDAAPLLLGAARRLESIDPTLARETYL
DTLSAAIFAGRLAVDGGVLEVSEAASAATRSLNTPGAADLLLDGMTTQHS
AGFEKGLPNVREALRIYGPGMTTEQELRWMFLACVAAAHVWDLDRLMSLA
VRHVQLSRDTGAVSELPLALSCLITPLLFTGRFGEAARAIDELTAAIDAM
GNNLTPYGALSLAAMSGRRDHLQRLGSTAIHNAEHRGEGIGLTVNAWATA
LLENGHGRYHAAAEAAVYATSYPGDCTSAGWALIELVEAGSRTGDDAVAS
AALERLTEMTTPSGTDWGLGVEARSRALTTEGDAAEALYLEAIERLGRAG
MGPDQGRAHLLYGEWLRRRRRRVDARAQLRSAHHLFDSIGMDAFAERARV
ELLATGETAQKRTNSRVAALTAQEAQIARLARDGLSNPEIGARLFISART
VQYHLSKVFAKLGIRSRSQLEHSLPELAT
120406394YP_956223.1 PA-phosphatase-like phosphoesterase [Mycobacterium vanbaalenii PYR-1]MQTDPHRPDATTSALRSARRRWTLTLIGATLFLIAVYWLAVRTATGQAVE
NAALYGADQVDPRAFLAARNLLDTITVTSLVAATVLVGAIGLLRRQANLA
MAAMAVILGSQAVTQILKYVVLQRPDLLPTDEYLANTLPSGHTTAAMSVL
FATLIVMPYRFRGVAMFFALTWAVGIGAYTVIAQWHRLSDTLAADAVALA
VACAASQFLARTDRIRAVVSPGAARFTLRTAFVGLVTVVGAVSAALGAVA
LLASLRQDIDAATEWQLFLSAQWLAAAGSIFAALLFWWTWYRLETKRRSD
LTTAR
120406392YP_956221.1 methyltransferase small [Mycobacterium vanbaalenii PYR-1]MRMLPGDNADLRKARGAFFTPTPVARFLTDWAVRHPEHSVLEPSCGEAVF
LHEIGQRGGHTGPLVGVEIHPGSAEESQRSLRARGIDATIHARDFFSHAE
FGSYDAVVGNPPYVRYQDFAGEARARARQAALRAGVALSNLASSWAAFTV
HSALHLRPGGRLGLVLPAELLSVNYAAGVRQYLMDHFGQVGLVLFDERVF
PGVLEEVVLLLADGYQPDGGRGATHMRLSQVRDAAGLARLTGSRRWSPPG
NGAKWSAGLMSAAGLSAFDSVVRGDAFTFLETWGDTTLGMVTGSNRFFTL
SPDKVDALGLAPSDLIPLSPPGSRHLRGLALTPKALRALGEEGRSTYLFR
PADEPSPAGWHYIASGEDLDVHRAYKCRVRTPWWRVPYLRPADLFLTYMN
ADTPRLTSNRARTHHLNSVHGVYLRDEFRQDGMNLLPLASLNSVTLLGAE
TVGRAYGGGMLKIEPREADVLPVPSPDLVRRNADQLRRIRPAVATCLRDA
RLLDAVALVDEVLLLGTSTLSERALRAVRRDHAGLTARRITRGKVGKAHG
GE
120406390YP_956219.1 metallophosphoesterase [Mycobacterium vanbaalenii PYR-1]MPSAPSGSPGSILKATAAASVGTLVAGIGYASLIERNAFVVRETTMPVLS
PGSSPLKVLHISDLHMRPSQRRKQAWVRDLARWQPDFVVNTGDNLAHPKA
VPSVVQALGDLLSVPGVFVFGSNDYFAPRLKNPANYLTNPGHRIHGEPLP
WQDLRAAFTERGWLDMTHTRREFEVAGLHIAAAGVDDPHLKRDRYDTIAG
PASPTANLTLGLTHSPEPRVLDRFAADGYQLVMAGHTHGGQLCLPFYGAI
VTNCDLDRSRAKGPSRWGARTQLHVSAGLGTSPYAPLRFCCRPEATMLTL
VAAPTGGSDVGSRAGHSSPTVSAR
120406388YP_956217.1 transcription factor WhiB [Mycobacterium vanbaalenii PYR-1]MSSIKPAARKTTVDPSDQSILHGAEAEARIAWVSQARCRQTDPDELFVRG
AAQRKAAVICRHCPVIAECGADALDNRVEFGVWGGMTERQRRALLKQHPE
VVSWADFFAAQRKHRTAG
120406386YP_956215.1 anion-transporting ATPase [Mycobacterium vanbaalenii PYR-1]MATTSSASSVPDGTKQLGWPSRLTKARLHFVSGKGGTGKSTIAAALALAL
AAGGRKVLLVEVEGRQGIAQLFDVPPLPYEEVKIATAEGGGQVNALAIDT
EAAFLEYLDMFYNLGLAGRAMRRIGAVEFATTIAPGLRDVLLTGKIKEIV
TRNEKDQPRGKGHVYDAVVVDSPPTGRIARFLDVTKAVSDLAKGGPVHSQ
ADGVVKLLHSDLTAIHLVTLLEALPIQETLEAIDELREMDLPIGSVIVNR
NIPAYLAPDDLAKAAEGVIDADAMRAGLTTAGITLSDDDFAGLLTETIQH
ATRIAARNESAAQLVELDVSRLDLPTLPDGVDLGSLYELAEELAHQGVR
120406384YP_956213.1 endoribonuclease L-PSP [Mycobacterium vanbaalenii PYR-1]MSGWSERLDELGIALPEVVAPLAAYVPAVRTGNLVYTAGQLPISNGELAA
TGKVGAEVSAEDAKHLARRCALNALAAVDALVGIDSVVKVVKVVGFVASA
PGFDGQPGVINGASELFGEVFGEAGAHARSAVGVSELPRNAPVEVEVIVE
VS
120406382YP_956211.1 CRP/FNR family transcriptional regulator [Mycobacterium vanbaalenii PYMDEILARAGIFQGVEPSAVSALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDREALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
120406380YP_956209.1 endonuclease III [Mycobacterium vanbaalenii PYR-1]MTVKPARGASPRKSGRKWDEETHLGLVRRARRMNRTLAQAFPHVYCELDF
TDPLELTVATILSAQSTDKRVNLTTPALFKKYRTARDYATADRTELEELI
RPTGFYRNKANSLIGLGQALEERFDGQVPRTLDELVTLPGVGRKTANVIL
GNAFDIPGITVDTHFGRLVRRWRWTAEEDPVKVEHIVGELIERSEWTLLS
HRVIFHGRRVCHARKPACGVCVLAKDCPSYGAGPTDPLIAAPLVKGPETE
HLLALAGL
120406378YP_956207.1 NUDIX hydrolase [Mycobacterium vanbaalenii PYR-1]MSWDSREGELTPSAAPPWLAPLVDRPGAVKDAYRRRVPAEVLAALTAANA
TAAVTGARRDAAVLVLFSGPQEGSRGTLPDDADLLVTVRASTLRHHAGQA
AFPGGAADPGDQSPVHTALREAAEETGIEAGRLQPLATLEKMFIPPSGFH
VVPVLAYSPDPGPVAVVDESETALVARVPVRAFINPENRIMVYRRQNTRR
AAGPAFLLNQMMVWGFTGQVIAAMLDVAGWAVPWESDKVYELDEAMALLD
AEGSYGDAQR
120406376YP_956205.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MVRPDPSVVRIGGPWRHLDVHANGIRFHVVEAERQAGADDRSKPLTDRPL
VILLHGFGSFWWSWRHQLAGLTGARVVAVDLRGYGGSDKPPRGYDGWTLA
GDAAGLVRALGHNTATLVGHADGGLVCWATSVLHPRVVQAIAVVSSPHPA
ALRASALTRRDQGQALLPSLLRYQVPIRPERLLTRDDGAELERLVRSRSS
AKWQAGEDFSESIRHMRRAIQIPSAAHCALEYQRWAVRSQLRAEGRRFMS
SMKRPLGVPVLHLRGEQDPYVLADPVYRTQRYAPHGRYVSIEGAGHFSHE
EAPAAVNEQLRRFLNQVYG
120406374YP_956203.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium vanbaalenii PYR-1MRISGRSVPVRAAILALTALLTLTIVPAHAATPVPLGGGSGLVVNGETLC
TLTAIGTDNQGSLIGFTSAHCGGPGAVVAAEGAENTGPVGTMVAGNDVLD
YAVIKFDPARVTPVNTVNGFRIDGLGPDPRFGDVACKLGRSTGYSCGVTW
GPGQEPGTILNQVCGGPGDSGGPVTVNNRLVGMLHGAFSEDLPTCVVKFI
PLHTPAVTMSFNTQLADITAKGRPGSGFVPVGATY
120406372YP_956201.1 acetyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MQRLVTTLTTMTETQLDAIASYPPPPEFTESANATAELYDEAEADRLAFW
AKQANRLSWQTPFTEVLDWSDAPFAKWFVGGKLNVAYNCVDRHVEAGNGD
RVAIHWEGEPVGDARDITYAQLKDEVCQAANAFAELGLKAGDRVAIYMPM
VPEAIIAMLACARLGAMHSVVFAGFSASALKARIEDAQTKLVVTTDGQYR
RGSAVALKTAVDEAIESLGDDNPVEHVVVVRRTGIDIAWTQGRDVLWEEV
VPKASTEHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQASYTHY
NVFDIKPETDVYWCTADIGWVTGHTYIVYGPLSNGATQVVYEGTPASPDE
HRHFQVIEKYGVTIYYTAPTLVRTFMKWGRQLPAEHDLSSLRLLGSVGEP
INPEAWRWYRLAFGGDNTPVVDTWWQTETGGIMISPLPGVTHCKPGSAMR
ALPGISAKIVDDDGNELEPSPDYGEHVTGYLVLDKPWPAMLRGIWGDEER
FRETYWSRFAEKGWYFAGDGARYGTDGEIWVLGRIDDVMNISGHRISTAE
VESALVGHSGVAEAAVVGASDEHTGQAICAFVILKSSAHGGEANMVDELR
AEVAREISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTL
LDPSVFEAIRASK
120406370YP_956199.1 HAD family hydrolase [Mycobacterium vanbaalenii PYR-1]MQSQTGVVNCQFVQSEAVCHAAHAYADDVTSPDPAVGGSQTPPAPTPPDR
PIRTAAFFDLDKTVLAKSSTLAFSKPFYSQGLINRRAVLKSSYAQFLFLM
SGADHDQMDRMRTYITNMCTGWDVEQIKAIVGETLHDIVDPLVFAEAAEL
IADHKLCGRDVVVVSASGEEIVAPIARALGATHAMATRMVVEDGKYTGDI
AFYCYGEGKAEAILALADREGYALEHCYAYSDSITDLPMLATVGHPTVVN
PDRTLRKEAAARGWPVRTFSKPVSLRDRLPAPSGAAVATTAAVGVSALAA
GALTYSLLRRFAF
120406368YP_956197.1 type II secretion system protein E [Mycobacterium vanbaalenii PYR-1]MSAPLIDRVRERLAMQSSPLRPSVVAAAIRAESGGVLGDAEVLTNLRELQ
TELIGAGILDPLLSGPGVTDVLVTAPDAVWVDDGNGLRRTSVRFADDAAV
RRLAQRLALTAGRRLDEAQPWVDGNLSGFGAGQPGGPLSVRLHAVLPPVA
AGGTCLSLRVLRPANQDLDALIGAGAIEPDAAGILRDVISARLAFVVSGG
TGAGKTTLLAALLAAVPEDERIVCVEDAAELAPDHPHLVKLVARCANVEG
AGEVTVRDLVRQALRMRPDRIVIGEVRGAEVVDLLTALNTGHDGGAGTVH
ANNPAEVPARFEALAALGGLDRAALHSQLAAAILSVTGCGVCRTVTHVGF
RWGFLVGDTVICNGVTDVGSRWVLLCCGGGAVRRVRWRGLVRGFCSRL
120406366YP_956195.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MDPPPPRGAASSPVAVSSWQSQWARVPGQWRKPVYPIDTAPFQEVFLRNQ
FYLRGNRAGAAHDFTPAAPPRFAEEIAWWVWWCWDQQLRKIEPSLLAWLV
RTLPAAISEHTTRTGAAPTSIAELDPTELIRQAALSFQRRNNRLPSPGSR
RNISHLIEHLHLNVSVSCTDTPWWAHDIWDLRADPRIPQRPHEPCHDQTV
RLRGITPDWLREGLRFWLRSALTYDLLTWSSVVDRARNLGSQLGHFATTA
GHLQDPLISTDPDQLRTVFLDYLDYLRSPQAATHSERLTSDTVASLQAQT
QSFYTFMHDHAAEAATATATARWRDITLTHTALWSPINAPKHRRRARELT
WHSTADLQRMLAYLDVLAAEPKQKVVLTGPDGDLSVLAGLGDPQAARIWL
LQALTGRRASEILMLDYDPLEAIPGQDRPVGTEPDNGAFVARLRYQQTKV
DGIVPTILVEQAIVDIIGEQQRWLTTKYPQLQSKYLFLGLKNQHRGQRPR
SYTTYRAMLDKLDKCHTLTDSAGRALRFTQTHRLRHTRATELLNDGVPFH
VVQRYLGHKSPEMTARYAATLAATAEAEFLKHKKIGAHGADIDITPHDIY
EMTQLAARTDRVLPNGVCLLPPLKQCDKGNACLGCGHFATDTTHLDELRA
QLAATEALIATRRDQYRQRAGRELGDDNIWIIERHREIDSLHAIIDRLAA
TADNSVAGPGTGKRLPLLQIQTRGAHQSALDKASRPRTGEQ
120406364YP_956193.1 hypothetical protein Mvan_5417 [Mycobacterium vanbaalenii PYR-1]MTVEVFGARVRQARVLRQMTATAVMEHMGWRSPRQTRLEQAETATLDALE
FEALVALLRFPARFFTTAPVSRVAARDLLFRAPKATTVTEKEYLAVFANV
VGDLVDQLNGVEKGPVVALEPLPVGTDVVTAAAKARAWLGREACEPIRYL
TYDLEAAGVPVVLRTKHSRSTGRIDWDTQDEEPAGGLTEKHLGCSARTGE
FRQRPLVLMRSIDSWERSRWTVAHEIGHLVLHRHGEVSDDQENEASRFAS
EFLAPAAAIAAEITDAPTLNHLMPVKLKWGISLGALIMHLRESKLIDEHR
AAMLQRQLYTRINSETGRTWGKTEPGWDARLPEQPRLLIKWVEACYGATS
VEMLAALDLIFPADLLADILAGQRGASAPRPARVDVALAPVGGTDRGDTV
VVAASERFRSRRQA
120406362YP_956191.1 hypothetical protein Mvan_5415 [Mycobacterium vanbaalenii PYR-1]MFTRRATITTATILALAGSVAIGLSGGETTTLAQPPGGVSSTSGPALPVQ
GPWDQCWGPNGWDPNCWGPGPWGPGGYGPGMTGPGGYGGPGMMGPGGYGP
GTMDPGQWGPGMMGPGQWGPGQYGPGMMGPGPWDY
120406360YP_956189.1 hypothetical protein Mvan_5413 [Mycobacterium vanbaalenii PYR-1]MYDGWGWGGMGSGGWILMTVLMVLFWAAVITAVVLAIRYLTGPRHTGAHP
PGPGPARAEGLLAERFARGEIDEDEYQRRMTLLREHR
120406358YP_956187.1 heavy metal translocating P-type ATPase [Mycobacterium vanbaalenii PYRMSDTCCGHDDPGAERDERERGPEKLWQVSEIRAAALAGVLLLAGLIVGWA
GGPGPVTLVAEAAALVIAGVTFVPSTLKRLVAGKIGVGTLMTIAAVGAVS
LGEVGEAAMLAFLFAISEGLEEYSITRTRRGLRALLSLVPAVATVRRGGR
EYRVAPTELAVGEVMVVKPGERIATDGVITAGRSALDTSAITGESVPIEA
GPGDAVFAGSINGTGVLDVQITATATDNSLARIVAIVEAEQARKGSSQRL
ADRVASPLVPAVMVAAAIIAVAGSVVGDPRVWIERALVVLVAASPCALAI
AVPVTVVAAIGAASKMGVLIKGGAALEALGRIRGIALDKTGTLTRNQPTV
ITVVPADGVSGGEVMAVAAALEARSEHPLAAAILAATDQLTPARDVESVP
GAGLSGWLDGSLVRLGRPGWIQPGPLAEVIDRMQRAGATAVLVERDGAVL
GAVAVRDELRPEAPEVIGGLRAHGYQVAMLTGDNERTARALAADAGIDDV
HADLRPEDKARIIEELRSRRPTAMVGDGVNDAPALATADLGIAMGAMGTD
VAIETADVALMGQDLRHLPQVLSHARRSRRIMLQNIGLSLAIITILLPLA
LLGVLGLAAVVLVHELAEIVVIANGVRAGRTQPLAGIPQPHGRRVSTRRA
TAQIGNAAHR
120406356YP_956185.1 hypothetical protein Mvan_5409 [Mycobacterium vanbaalenii PYR-1]MRAAGAVGHRPRCWRTPAIKGRPALVRPANPIVVDGNPDPEACLCRLDIA
DAVELTELLQFVNDWLASDTGRLDASLTHYVGHPGCTADELRADLDRFIF
LLWQRRRTTLRTRIARSTPPMP
120406354YP_956183.1 type II secretion system protein [Mycobacterium vanbaalenii PYR-1]MTAAALALAAAVLVAPAGSRWRRVLSAPPSRRLRLPVPVCGALLCAVTAL
LLSPAAVLAAALLMATLSVRSRAARRRRNRVTEAAALQGALDVLIGELRV
GAHPVAAMNTAAQESDARIAGALGAVAARALLGADVAAGLRAQGRRSLLP
GHWDRLAVCWHLAQAQGLAIATLMLAAQRDIAERERFRGRVEAGLAGARA
TAAILAGLPVLGVLLGHAIGAEPLSFLFSGGFGGWLLVTGTVFVCCGLLW
SDRITTGVLT
120406352YP_956181.1 hypothetical protein Mvan_5404 [Mycobacterium vanbaalenii PYR-1]MREHLRDIRTRLLVLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDSI
VTALTNIISRALNTNV
120406350YP_956179.1 hypothetical protein Mvan_5402 [Mycobacterium vanbaalenii PYR-1]MLAVTSGGAILGAAVTARHRAQAAADLAALSAAAGVPAGHTAACGRAEHV
AHAMGARLTECAIDHLDVVVRIEVTVGTGGTGLGPASALARAGPATPAG
120406348YP_956177.1 hypothetical protein Mvan_5400 [Mycobacterium vanbaalenii PYR-1]MTHDWLLVETLGTEPVVVAHGAYTKNLVPVATYLRRSPHLMAIQTAIGET
VRGGGGLSSITPKNDRVIRTEVVQMSDGRIHGVQVWVGAPDESPPERPLV
GPLLWDLTAGTATDTTESLRVGGWDPANQSTHGRAFADDLPRRDLNPNEA
EVLSMVIKPEAGVTLCNTWDVTDYRGQPITVGFVARSLPEALEDGGERLI
CRAMNWRSVREGASLQHDLLGQRIVDGLRQPGVYRALVDPRNWTLLKWLD
EPVPFLDRHANRESEQAIHPQDMHVMSAMADQFATGVASGVLRLVGHNGG
WTPVHVTVNRVKLGKGVYAGLASLRKPTPAELTAAGLDCAPESTGRRPKA
LSRKDKASRA
120406346YP_956175.1 cold-shock DNA-binding domain-containing protein [Mycobacterium vanbaaMPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAI
120406344YP_956173.1 DNA topoisomerase I [Mycobacterium vanbaalenii PYR-1]MADEERGSGKNGAEPRRGNGSSVRRLVIVESPTKARKIAGYLGSNYIVES
SRGHIRDLPRNAADVPAKYKSEPWARLGVNVEHNFEPLYIISPDKKSTVA
DLKDKLKNVDELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEITEP
AIRAAAEDPRDLDNDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGR
VQSVATRIIVQRERERMAFRSAGYWDVTAELDASVSDAQASPPTFVAKLN
TVDGRRVATGRDFDSLGAVRKPDEVLVLDEAAANALATGLRGAQLAVSSV
EQKPYTRRPYAPFMTSTLQQEAGRKLRFTSERTMSIAQRLYENGYITYMR
TDSTTLSQSAIDAARNQARQLYGEEYVHPTPRQYTRKVKNAQEAHEAIRP
AGDVFQTPGQLHSQLDTDEFRLYELIWQRTVASQMADARGTTLSLRIAGA
APATTLGGGTASDVQVVFNASGRTITFPGFLKAYVESIDDLAGGEADDAE
SRLPNLTQGQRVDAKGLTADGHTTSPPARYTEASLIKALEDLGIGRPSTY
SSIIKTIQDRGYVHKKGSALVPSWVAFAVIGLLEQHFGRLVDYDFTAAME
DELDEIAAGHERRTNWLNNFYFGGEHGADGSIARSGGLKKLVGGNLEEID
AREVNSIKLFDDAEGRAVNVRVGRNGAYLERMVADPDNPGELKPQRANLK
DELTPDELTLELAEKLFATPQEGRSLGVDPATGHEIVAKDGRYGPYVTEV
LPEPPDEGEAGATAKKGKKPTGPKPRTGSLLRSMDLETVTLEDALRLLSL
PRVVGVDPASGEEITAQNGRYGPYLKRGTDSRSLATEEQMFDITLEEALK
IYAEPKRRGRQGAATPPLRELGVDPVSEKPMVIKDGRFGPYVTDGETNAS
LRKGDDVLSITDARASELLADRRARGPVKKKAVKKAPAKKTPAKKTAAKK
AAKKA
120406342YP_956171.1 DNA polymerase III subunit delta' [Mycobacterium vanbaalenii PYR-1]MTGVFSRLVGQDAVETELTAAARAARGDSPHTSGLDVSGVTGTMTHAWLI
TGPPGSGRSIAALCFAAALQCTSDGTPGCGECRACATTMAGTHADVRRII
PEGLSIGVDAMRAIVQIASRRPGTGRWQIVVIEDADRLTEGAANALLKVV
EEPPPSTVFLLCAPSVDPEDIAITLRSRCRHVALVTPPVDAIARVLIDSD
GLPEKDAEWAAAVSGGHVGRARRLATDERARERRQRALGLARDAATPSRA
YAAAEELVATAEAEAKALTEDRNEVEAEELRTALGAGGTGKGTAGTMRGA
AGALKELEKRQKSRHTRASRDALDRALIDLATYFRDALLVSSGATDVVAN
HPDMAEKVAAMAAHASPEKLLRCIEAVLECREALAVNVKPKFAVDAMVGT
VGQALRS
120406340YP_956169.1 hypothetical protein Mvan_5392 [Mycobacterium vanbaalenii PYR-1]MDSNEPPEFFLDRSLGKRVAAGLTERGWRIHRVVDHFANDAQDIPDEEWM
RYGLVRGWFPLHKDGRIRGTEAERRPLIEFNAPMFYLDNQQLRIDEMVAR
FHAAQRQIYTRTRVAGAACFAVSAHGIRRTWP
120406338YP_956167.1 hypothetical protein Mvan_5390 [Mycobacterium vanbaalenii PYR-1]MNRVARAAAALIALQLVIRAVLAFGGYFYWDDLILVGRAGTQGLLSPGYL
FDDHDGHVMPGAFLVAGVITRLAPLEWIGPAISLVILASAASLALLRALY
VILGWRPVLLVPLTFALFTPLAVPGFAWWAAGLNSLPMLAAMAWVCADAI
LLVRTGNQRYAWTGTLVFFGGLLFFEKSAIIPFVAFTVAALYGHVTGTAT
VRQVWRRGARLWTAALAVTAAWIGVYLLVVDQQRWSFDLAMTWDLLSRSF
THGIAPGLVGGPWDWQRWAPASPWATPPPAVMVLGWSTLAAVVAVSLLRK
RRIGPVWLAALGYAVACQVPVYLMRSSRFTALELAQTLRYLPDLVVVLAL
LAAVGLCAPNRDRARWLDHSTRRTVVTVCAATAFVVSSLYSTSTFLTSWR
DNPAQPYLQNARAGLARAHASSDAPMLDQEVDPLVLQRVAWPENLASHMF
ALLRDRPEFASATTDLRMLDTAGNLVDAKVTWVRTIRPGPDARCGYLVQP
DFPVRMPLDGPLLPADWTVEINYLGNSDGSMTVSLSEGDEVKVPVRPGLN
RVYVRLPGAGDAITVSANTAALSVCVASGPVGFVAPV
120406336YP_956165.1 putative integral membrane protein [Mycobacterium vanbaalenii PYR-1]MTDATAGPSGAVTRGSVVRVGAATAMSAMCGYAVLYLAARDLEPAGFSVF
GVFWGAFGLASGAAFGLLQETTREVRAPSWNPDGTYTRPMRVAAGVGVGA
AAVIAVTSPLWSGHVFVDARGLSVALLSAGLAGFCLHTTLLGALAGMNRW
SEYGALMVTDAVLRVVVAAATFALAWGLGGYLWATVAGSTAWLLMMLVSP
ATRAAARLLTPGGTATFLRGAGHSIAAAGASAVLVMGFPVLLKATSGDLG
AAGGVVILAVTLTRAPLLVPLTAMQGNLIAHFVDQREHRLKALVAPAALV
GALGAAGVALAAAFGPWLLREAFGAQYHADGTLLGWLTAAAVAIALLTLT
GAATVAAALHRAYAAGWVIATVAATLLLLLPLDLEVRTVVALLCGPLLGI
AVHLSALARARSIRWHTPAPSDTKETP
120406334YP_956163.1 non-ribosomal peptide synthetase [Mycobacterium vanbaalenii PYR-1]MTAADRTPEIPSQYLLSAFAPESRTLIDILYDTARRYPDAPAIDDGTVQL
TYAELISDVEDSVAWLGARGIGRGDRIGIRMPSGSYALYVAILATLATGA
AYVPVDADDPQERADLVFTEAAVVAVITEQGLVRGPGSSRGWRAAAPLSR
DDAWIIFTSGSTGTPKGVAVTHRNAAAFVDAEAQIFLQDNPLGPGDRVLA
GLSVAFDASCEEMWLAWRNGACLVPAPRSLVRSGMDLGPWLVSRDITVVS
TVPTLASLWPAEALEAVRLLIFGGEACPPELAERLAAGPDSAGREVWNTY
GPTEATVVACAARLDGRSAVSIGLPLPGWDLAVVDKEGRPVAPGEVGELV
IGGVGLARYLDPEKDAEKYAPLPYPSDIAHWTRAYRSGDLVRLELDGLYF
VGRADDQVKVGGRRIELGEVDTALVHLPGVSGGAAAVRRTAGGTPLLVGY
IAVAPGLEGSFDVHEARARLSESLPAALVPRLVVVDELPTRTSGKVDRDA
LPWPVGGDDSDEGADLGGGTLGWLAGLWREVLAAPVDGPEADFYALGGGS
LSAAQLVSALRQRYPEVTVADLYDHPRLGSLAGYLDELAPPPAVETRVVK
PVSRLTQAVQVALTVPLAMLTGMQWVVWLAVANNVAAELSLVDWVKPIDW
WWILGGFLLFVTPPGRMSIAVFGARVLVGSLQPGTYRRGGSVHLRVWLAE
RLAEASGAENMAGAPWLVYYARALGNNVGKGVDLHSAPPVTGMLTLGHRC
SIEPEVDLSGHWIDGDLFHIGAITVGNDATVGARTTLLPGAVVGKNADVA
PGSAVIGKVKNGQYWKGSPAVKSGKAKHPWPDHRPPRAPVWVFVYGVTSV
LLGALPLAALAAGLAVIGWGVRGTPSVTGAVVPALLWLAPATAAALVVYA
LFTVVGVRLLAIGLDEGYHPVRSRSGWQLWATERLMDAARNYLFPIYAGL
LTPWWLRLLGAKVGKGTEISTALLIPKFTVIEDGAFLADDTMVASYELGG
GWIHVARATIGKRAFLGNSGITQPGRRVPDDGLVAVLSATPYKAKAGSSW
LGSPPVRLRRKPTAADALRTFHPSRRLKVLRGTVETFRFVPVVVTFAIGV
AVLWSVQYLAVTFGWIWAGLAAGPILLTAGAVAGGVAAIAKWLVVGRITA
IEHPLWSAFVWRNEVSDTFVETVAAPWFARAATGTPVMNLWLRALGAKIG
RGVWCETYWLPEADLVTLADGATVNRGCVVQTHLFHDRIMRMDTVVLEEG
ATLGPHCVALPAARIGAGATVGPASLVMRGDEVPPSTRWQGNPIAPWHPS
RKKRSDSADPKPKKSTAA
120406332YP_956161.1 hypothetical protein Mvan_5384 [Mycobacterium vanbaalenii PYR-1]MADDGGVSELTDGDQQIVRVTAPDLQQARRVRARIRAGSGDVAVILDITV
AVAADFRSAQQVSGPADSRTVHYAGTVAGLAGLISDIASAEVADGVTLIP
ASPRQDVGTVGRDVLGRLAARDQPRAS
120406330YP_956159.1 putative OHCU decarboxylase [Mycobacterium vanbaalenii PYR-1]MLHQGIGLDAFNALPMRRAVHAVFECCYSVPLAADLARARPFDTHDRLFR
FADTLLFGLSEESIDSILQAYPDVGKRPGSEKSQAEQCAIVDDRPEMMAE
LAAASKKYLDHFGFGFVMFINGYCADDVLASMHDRMHNDYETERKVVRNE
LARINRTRLERMLGPEGGYDNW
120406328YP_956157.1 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase [MRPTRWRRSTYLVVGVSVLLLVVVVVVAAAALVATRQPAEQPAVEAAPAP
ATAAPGVVPVSDSADKPTPQGLTRALQAVLANPDLGRFTGRITDARSGDQ
LWAQGAGVPMQPASTNKMLTAAAALLTLDRDARLTTRVLSASPGVVVLVG
GGDPTLSAAPRNVDTWYRDAARIVDLADQIRRSGVDVKSVQVDVSAYSGP
SMAPGWDPLDIDGGDIAPMEAIMLDGGRTQPVTVESRRSRTPALDAGRAL
AVALRVDPAKVTVLPSAARGTEIASVQSPPLMQRLRDMMNFSDNVMAEAI
GREVAAEVGRPQSFDGAARAVLSTLEDAGIDTAGARLLDSSGLSVDNRLT
AETLDEVVQAAAGDSEPALRPLVDLLPIAGGSGTLSNRYLDTDDGRAAAG
YLRAKTGSLTGTNSLAGIVTDESGRVLTFALLSNDAGPTGRTALDAFAAT
LRSCGCR
120406326YP_956155.1 tRNA(Ile)-lysidine synthetase [Mycobacterium vanbaalenii PYR-1]MDRPGAVAELRTAVAGFVRDHAAASGPWCVALSGGADSLALTAVAAALRP
TTALIVDHGLQPGSARVAATARDQAMALGCVGAQVLCVEVGVGGGPEAAA
RAARYRALEEARRGAPVLLAHTLDDQAETVLLGLGRGSGARSIAGMRPSD
PPWCRPLLGVRRAVTRLACAELGLTPWQDPHNTDRRFTRVRLRTEVLPLL
EDVLGGGVAEALARTATALREDTDALDGIAARIVTVPGADLDTAVLTPLP
AAVRRRVIRGWLLGGGANGLTDKQIRAVDDLVVDWHGQGGVAVPGGLARE
RLFAGRRKDVLTLYREPVAERQR
120406324YP_956153.1 molydopterin dinucleotide-binding region [Mycobacterium vanbaalenii PYMTETALRICPFCEATCGLTLTVDDGRVTGARGDRDDVFSAGFICPKGASF
GELDNDPDRLAAPLIRRDGVLTEATWDEAFAAVAEGLGAVVRDHGGASVG
VYLGNPNAHTVAGALYPPLIIRGLGTRQVYSASTLDQMPKHVSLGLMFGS
PVAFTVPDLDRTDHLVIIGANPLVSNGSLATAADFPGKLRALRKRGGRLV
VIDPARTRTAALADRHLAPRPGTDAALLFAVAHVLFDENLVDLGALADHV
AGVDEVRALASGFAPETVADFCGVDADDIRTLARELVAAPTAAVYGRMGT
STVEFGTLGSWLVDVVNVLTGNLDRPGGVMFPLSPVAPAPRGHRPGRGFD
TGRWHSRVSGYPEVLSELPTAALAEEIETPGEGQIRAMITIAGNPVLSAP
DGDRLDRALDGVGFMVSVDPYLNETTRHADVILPPPPPSRSPHFDFALNA
LAVRNNARYSPPVLPLDGRPDEAEILSRIALVLYGIGYDADPALVDEQVI
ATTLAKETADAGSPVAGRPVEELTAMLPVGPGYERRLDMMLRIGAYGDAF
GARPDGLTLQRLKDAPHGIDLGPLQPRLRDVLRTPSGKIELAPPQLVADA
ERLRAAVGRRTDGYLLIGRRHLRSNNSWMHNLPALAGGSNRCTLRMHPDD
AAELGVGDTAIVKGAGGELVVPVEVTEDIRRGVLSLPHGWGHDRGGTGQL
LAAGQPGVNVNQLNDGSTLDPLSGTAVLNGIPVLVGPAS
120406322YP_956151.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MMRAVLRYGVCRQVDDRAGLIAAARTAFGELGAAAGLADIAGYAGVSPTV
LCRHFGDRDGLVAAVLDDLVASLGDDEDPPIVAAGAVSGAVSGARFHPKY
AVAPLAALATVMPMMPAQATAATSAEPTTATTAVEPAATVLTLTPLWPVW
PLEYALQGSLCESGGCDLIPYLPFSTAAGVSLLTDRLSSTADVSRVASDT
DTVVFGYSHGAVVAAEWLAEHAEDPLAPAAGQLSFVLIGNPTRAYGGTYP
ALPQTQYQVIDVVRQYDPVADFPADPFNLLAMLNIGAGILSSVHLDYTDV
ALDDPGNTVWTEGNITYVFVPTRNLPLLTPLRLIGLGWLADELNEPLKEI
VERAYDRPYLPEAEPVDPPAEPAPDPVVEPVAETLDAATDTAVATPASSP
DDAAAPDTTADGPEVSPADVDPAATEPDTEETTAAATEETTADPAVTVED
VSQESAATAEPDAADTAGG
120406320YP_956149.1 ATP-dependent metalloprotease FtsH [Mycobacterium vanbaalenii PYR-1]MNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTSVAMAQISGDNV
KSAQIDDREQQLRLELKNGNGDTENSDKIITKYPTGYGVPLFEALQAKNT
KINTVVNQSSILGTLLIYMLPLLLLVGLFVMFSRMQTGGRMGFGFGKSKA
KMLGKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSQGKP
IADDADLDGLAKRTVGMSGADLANVINEAALLTARENGTIITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIDPIYKVTILAR
GRTGGHAMSVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSHEV
AQIIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRVELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPLPEPA
FKTAIAQASRAAAEQAQKNGGNGSQASNGVPGGPTQPDYGAPAGWHAPGW
PPQAGGPHPPQPQGYWYPPPPPSGWQGAPQAPAYPGYPPYQPHSQPGQPA
PHGGAAAASPKEDPGHEGGGENGRSAPPSNG
120406318YP_956147.1 dihydropteroate synthase [Mycobacterium vanbaalenii PYR-1]MGVVNVTDDSFSDGGLFLDRDRAVIHGVELVRQGAAIVDVGGESTRPGAT
RIDPAVESSRILPVVKELAQLGITVSIDTMHAAVARVALEHGAQIVNDVS
GGRADPDMARVVADAGVPWVLMHWRSVGSDRPHEVPPYGDVVTAVRDELM
AGVDAAVDAGVDPAKLIIDPGLGFAKTAQHNWALLHALPEFVTTGIPVLV
GASRKRFLGELLASPDGELRPPAGRETATAVVSALAGWHHVWGVRVHDVR
ASVDALAVVAAWQAGRDD
120406316YP_956145.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [MMTSVVLSIGSNLGDRMAHLQSVLDGLAGSALAVSPVYETDAWGGVEQGPF
LNAVVLAEDRELDGYGWLRRAHELEDAAGRVRDQRWGPRTLDVDLVQCHG
PDGEVVVHDDVLTLPHPYAHARAFVLVPWLQVEPTATLTVDGRTDPLTAH
LAAVDAAERAGVRTTDFVLRIADGA
120406314YP_956143.1 hypothetical protein Mvan_5366 [Mycobacterium vanbaalenii PYR-1]MTDPTRGARLRRGGRRPGWILMTVLLVLAIAASSALVFTNRVELLKLAVI
LALWAAVVAAFVSVIYRRQSDADQAKVRDLKLVYDLQLDREISARREYEL
AVETHLRRELASELRAQSADEVAALRAELAALRANLEFLFDTDLSHRPAI
ETERTAGRVSSSRIDTQEDFRAAEEPYAPKTDESPIIDVPAEPHPPEGEW
APRGEAGGAHRRSAEQPQWAPPPAPAPPPPPPPPPPPPPPPPAQQPPPPP
QPTPPPAQQPSPEPQFPWLPPAPPPRPQPRTPEPAPTASGWKPVPAEGQW
IPAGEPGSHWAAAHANGDQGEYVGRRRAPDQVEPEPPRGKHSAAGEEPTE
APAAPEAPAEPDADGGAHTGGQSVAELLARLQAAPSGGGRRRRRED
120406312YP_956141.1 pantoate--beta-alanine ligase [Mycobacterium vanbaalenii PYR-1]MTRRDTPKFTAGQLNVYTRPGDVAAVTRALRATGRRIVLVPTMGALHEGH
LTLIRAAKRVTGAVVVVSIFVNPLQFAANEDLGAYPRTLDADLDALRAEG
VDIAFTPTADDMYPNGMRTTVHPGPLGAELEGALRPTHFAGVLTVVLKLF
NTVRPDRAYFGEKDFQQLALIRQMVTDLDLEVEIQGVPIVREPDGLAMSS
RNRYLDAVQREQAGALSAALLAGMYAAGEGTAAAVDAARAVLDEVPAIEV
DYLEVRDAMLGPAPEVGMGRMLVAGRLGATRLLDNIAIDIGVPSGPGRQA
EFDEHELPWRN
120406310YP_956139.1 pantothenate kinase [Mycobacterium vanbaalenii PYR-1]MLLAIDVRNTHTVVGLISGSGDHAKVEQHWRIRTEPEVTADELALTIDGL
IGDDAERLTGAAGLSTVPSVLHEVRVMLDQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYHKFGTASIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAERSAALRRVELTRPRSVVGKNTVECMQAGAVFGFAG
LVDGLVSRVRDDVDGFGGGDVNVVATGHGAPLVLADLRTVEHYDRHLTLD
GLRLVFERNRDSQRGKLKQAR
120406308YP_956137.1 lysyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MVHLSWHVVTSPDSPDDIPEQFRIRQGKRDRLLAEGRDPYPVKVDRTHTL
AELRAAYPDLPADTKTGQEVGVAGRVIFARNSGKLCFATLQEGDGTHLQA
MISLDQVGQDSLDAWKADVDLGDIVFVHGEVISSRRGELSVLADSWQIAS
KALRPLPVAHKEMSEESRVRQRYVDLIVRPEARAIARQRVAVVRAVRNAL
ERRGFLEVETPMLQTLAGGAAARPFVTHSNALDADLYLRIAPELFLKRCV
VGGFDRVFELNRNFRNEGADSTHSPEFAMLETYQAYGTYDDSALVTRQLI
QEVADEAIGTRQVPLADGSVYDLDGEWDDIQMYPSLSEALGEEITPQTAV
PRLWRIADGLGVEIPRDRGYGHGKLVEELWEFTVGDKLWAPTFVRDFPVE
TTPLTRPHRSIEGVTEKWDLYIRNFELATGYSELVDPIIQRERFEEQARA
AAAGDDEAMALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGLSIRETVL
FPIVRRHGN
120406306YP_956135.1 ATPase [Mycobacterium vanbaalenii PYR-1]MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKET
AEAGTGGRGGEAGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVEHTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAASL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFTQGGGENNYERMKQKVHDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIKMVDLMIGRVSKQLAAKDMTME
LTDKAKSLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQLV
TVDVEGWDGEGAGEDAKFTFIGTKKPVKIEEPDLAQAGAAGGPSAAE
120406304YP_956133.1 hypothetical protein Mvan_5356 [Mycobacterium vanbaalenii PYR-1]MTSPDLSKTSARAIDFSGTKAALWLSITAFLALVVLYFIGMDQGATSVFG
SNTYIHEFVHDARHLLGFPCH
120406302YP_956131.1 phosphoglycerate mutase [Mycobacterium vanbaalenii PYR-1]MSEVVRLTLVSHAMTDAMAAGRFPTDESVNQLGRDQIHRVDLGPAGPAFC
GPEARTQQTAALLGLRATVESGLADLDFGRWRGDVLGRVPPDEMTIWLTD
PTRAPHGGESVVELIARVGRWMDSLTTGRTERTRVVAVTHPAVIRAAILV
ALDAPPKSFWRIDIAPVSRTVMHFRGHAWTLRSAP
120406300YP_956129.1 antibiotic biosynthesis monooxygenase [Mycobacterium vanbaalenii PYR-1MPIGRGSLMIMSTKTPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGF
LGFQLLRPVKGDNRYFVVTQWDSEEAFQAWATGPAVEAHAGERANPVATG
ASLLEFEVVLDVAGTDT
120406298YP_956127.1 hypothetical protein Mvan_5350 [Mycobacterium vanbaalenii PYR-1]MSTALAFLILLAPFALAGLLCWAANRAGALRVHLDQFRWAAPLTGRLSDD
RDWSRVQHDTDAIRTRFEQQPSWPASGVSGERR
120406296YP_956125.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTDHKAPTKVVVIGGGYSGTLAANHLRLRSDVDITLVNPRPKFVERIRLH
QLAAAGRDATVDYGTLLGEGVRLVVDSASRIDTAARKVWLASGRQLDYVY
VVYAVGSTGAPPAGVPGAVEFAYPVAELEQADRLRAALDDLHPAAPVTVV
GAGLTGTETAAELAEAGRNVTLVCGGGLLPTFSAAGRRSAARWLRRHGVA
VLESDTVAEVRAGAVVFADGAVRPSALTVWTTGFGVPDLAAVSGLATDDI
GRLLTDETLTSVDDPRIVAAGDCAAPSGAPLRMCCASASQLGPQAANTVL
SRIAGEQPSDFDYAFAGSCVSLGRRTGILQFARKDDSPVSVYIGGRVGGS
LKEAICKGTLWGLRRGARKPGSAIWFKGGPRPGQPAVRPRAVTQS
120406294YP_956123.1 HhH-GPD family protein [Mycobacterium vanbaalenii PYR-1]MIDPDALLDWYEHAQRDLPWRRPGVSAWQILVSEFMLQQTPVARVEPIWL
DWIARWPTPSATAAAGPADILRAWGKLGYPRRAKRLHECATVIATDHDDT
VPDDVETLLTLPGIGTYTARAVACFAYRQRVPVVDTNVRRVVARAVHGLA
DAGSPSSRDLGDVETLLPADDTAPRFSVALMEFGATVCTARAPRCGVCPL
QRCGWRARGFPAGTGPARRAQKYAGTDRQARGRLLDVLRGSDSPVTRAEL
DVAWTTDTAQRDRALDSLLVDGLVEQTADGRFALCGEAGS
120406292YP_956121.1 hypothetical protein Mvan_5344 [Mycobacterium vanbaalenii PYR-1]MLDLEPHGPLPRQIYWRRRALALGIAALVIGIVVAVVAVVVMNSTSNEQP
TANESAAPAAEAVPPPLPGENPEVKSPIQPPAQQAPPPTPTPTAAVVPPP
ILKEGDDCPDSTLAVKGITNQPQYVVGDQPKFTMVVTNIGLVACQRDVGA
AVLAAYVYSLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEVTWTGMGSA
PNCPLPRQPIGPGTYNLVVQLGNLRSATVPFILAQPAQAPPPAPADGAPH
LPVPGPVG
120406290YP_956119.1 DNA repair protein RadA [Mycobacterium vanbaalenii PYR-1]MARTNSKTRSQFRCSECHHVTPKWVGRCPDCGTWGTVNEVALTAVGGSAT
RRAVAPASPAVPISSIDPGSTRHFHTGISELDRVLGGGLVPGSVTLLAGD
PGVGKSTLLLEVAHRWASTGRRALYLSGEESAGQIRLRAERTGCSHDEVY
LAAESDLQTALGHIDAVQPTLVVVDSVQTMSTTEADGVTGGVTQVRAVTT
ALTMTAKTTGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALR
MVRGIKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKPVSGTAVTV
TLDGKRPMIGEVQALIGSPASGSPRRAVSGIDSSRAAMITAVLEKRAKLP
VGMNDIYLSTVGGMRLTDSSSDLAVALSIASAFTDLALPTTAIAIGEVGL
AGDLRRVTGMDRRLAEAARLGFTYAVVPSGVTSAPAGLQVLPADNITSAL
QVLRRISQNGAN
120406288YP_956117.1 CarD family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVSQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKA
STILDEVLAAAS
120406286YP_956115.1 cysteinyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDVLR
RWLTAKGFDVAFIRNVTDIDDKILHKAADAGRPWWEWAATYERAFTAAYD
ALGVLPPSAEPRATGHITQMVELIERLIERGHAYTGDGDVYFSVATLPDY
GKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEPSWPTPWGRGRPG
WHTECVAMCESYLGAAFDIHAGGMDLVFPHHENEIAQAEAAGDGFARFWL
HNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYLGSAHYRSMLEFS
ETALQDAAKAYAGIEDFLHRVRTRVGAVVPGEWTPKFGAALDDDLAVPAA
LAEVHAARAEGNRALDAGDHDTALTHAMSIRAMMGILGADPLDERWESRD
ETSAALAAVDVLVQAEVQRREDARARRDWAEADAIRDRLKEAGIEVTDTA
DGPQWSLLDGTDK
120406284YP_956113.1 arsenical pump membrane protein [Mycobacterium vanbaalenii PYR-1]MELILSVAALASVLAFALLRPHRWPEAVIAVPAAALVIASGAISWDDALA
EVGRLAPVVGFLAAVLVLARLCDDVGLFHTAGVMMARATSGGQIRLLASV
FAIAAGVTAILSLDATVVLLTPVVLATARTLAVPPRPHAYATAHLANSAS
LLLPVSNLTNLLAFGAAGLSFLHFAAAMSLPWLAAIAVEFVLLRWFFAKD
LAVEPRRAAVTEPVEVPVFALVVLGLTLLGFAVTSLLGLSPAWAALAGAL
VLGVRALATRHTTVTRIAAAADVPFLIFVLCLGVVVAAVMRNGLESAMRD
AIPEGQGLAALLGIAAVAAVLSNVVNNLPAVLVLLPLVTPIGPAAVLAVL
IGVNIGPNLTYVGSLANLLWRSVVRRDMRVGFAEFSRAGLVTAPLTLVAA
VLGLWAWIQLFGL
120406282YP_956111.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMHAPLHPDLLSRRSIDVAVGILMALRRCSEDQAFAEIAAAAHRMGLPLGE
VTRALIAVADAHSGHTSHRDEALRIWGELFSEHPRR
120406280YP_956109.1 cobalamin synthesis protein CobW [Mycobacterium vanbaalenii PYR-1]MNRTPVLLVSGQELTDQISEALLHKSGTLVVRHRFDGQVVLRSVCIRRGD
EPHTSQWPIELMNCCVDCTIRSDLLVLLRRLHRRDDVSRIVVHLPPWLEP
EPLCWDINNVDVVVGPGYIDGPAARDVRIEAVITTVATGQWLTDALGADV
LDDGRTVAQVVVGQAEFADVLLLSAPDRTTQAVLHRLAPRAQIITGTEQL
GSALDALSDSARRGADHDPHEPLLSGEPPLVAEHGVKLVEFQAIRPFHPL
RLHRAIDDLLDGVVRLRGRAWLASQPDVVLWIESAGGGLRVGHAGEWLAA
SAIDEPADPDPERAVLASLRWDEQFGDRHISLTALICGADPEAVTASLSA
ALLTDDELSRPDLWAHWEDPFGEWHEDPCEGLDKADGAATRDRPDEGDPT
GFSRS
120406278YP_956107.1 permease [Mycobacterium vanbaalenii PYR-1]MAAVAVGTPSTRYRPNSMHVLVIAVVGLALVGGILRGFVAGTPGVATAAT
VFCGIFVQALPFLALGVVISGAVAALVTPDRLARWLPKRPSAAILAAGVG
GFALPGCECGSVPIARRLFGESTVGAAALTFMLAAPAINPAVLVATAVAF
PGEPGMVVARCAASLITALIMGGLWARFGLPRWITRRVPHEHSTGGSRWT
AFSEAARHDFLQASSFLVVGAAAAAALHVLVPAWMFEHLAGQLLLGIAVM
ALLAVVLALCSEADAFVAASLSMLPLLPRLVFLVVGPAVDIKLFAMQVGM
FGRAFAIRFAPVTFVVATATATIVGLLVLGNR
120406276YP_956105.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MAAEALVGDPSAHPVAPLQQVLAAIHDPVRLEIVRRLHNAGGPMQCGALY
DGINKSTATHHFKVLREAGVTERLVIDGLTYQRLRREQVGAAIPGLLESV
VAGANREAGLS
120406274YP_956103.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MTIIFNKGTSATARIDVSAVDFGYPGMPVFRGLTLSVTPGAVTAVVGANG
SGKSTLLSLLAGVLRPATGRVDVDARNIALAVQRSAVTDSFPVTAGEAVM
MGRWRRLGLLRRPKADDRAVVEHWLTELGLSDLRHRALGELSGGQRQRVL
LAQAFVQQAPLLLLDEPTTGLDTDSAGVVIGHLRRLAGEGTTVVTATHDP
AVVQTADHRIDLDRPGPH
120406272YP_956101.1 periplasmic solute binding protein [Mycobacterium vanbaalenii PYR-1]MRRWTLVCICAILTAVAACTGGTAASATGEVIVTTNILGDVVRNVVGDAA
DVRVLMQPNADPHSFGVSAQDAAAMGRAGLIVYNGLGLEETVIRNVESAA
AEGVPTLAVTDHVDPIEFAEGDSAGTSDPHFWTDPQRMIMAVDAIEEAVR
EIDGIDRDAVARNAESYRAKLRELDTSMRTGFDTIPAERRKLVTNHHVLG
YLAQRFGFTVIGAVVPSGTTLAAPSASDLQSLVDAIDFARVPAIFVDSSQ
PDKLARVLARDAGVDVEIVPLYSESLSPPGTPGATYLDMMRANTDAIITG
LR
120406270YP_956099.1 3-mercaptopyruvate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]MTRADIFITAAELARLIAEGAPVNVLDVRWELTRPDGREAYTRGHVPGAV
YVSLEDELSDHAVTGRGRHPLPSGDSVESAARRWGLRRGVPTVVYDDWNR
AGSARAWWVLTAAGIGGVRILDGGLAAWTAAGGRLETGVPAIDPGDVAVE
FRDLYRGALPALTAEDVTGFDGVLLDARAPERFRGDTEPVDRVAGHIPGA
RNAPSVETLSVDGTFLPDDELVRYFRGRGATEGGVGVYCGSGVTAAVTIA
ALRATGVEAKLFPGSWSQWSADASRPVATGE
120406268YP_956097.1 periplasmic solute binding protein [Mycobacterium vanbaalenii PYR-1]MISSFRGVRVLAATLAVSLPFVLSACGGDDTSAMDTSAAPDCPTTPVNVV
VSVDQWGNIVSQLGGACAEVTTVLAGSAVDPHDYEPAPSDAADFEGAQLV
VLNGGHYDEWAAKLAATSAADAPVVNAVELSGGHAEQGQEHAGEDGHGHA
EEGQEHAGEQGQELGDEGNPHVWYNPTAVTEFAEAVTAQLGKLSPDAAGY
FAERHAEFAESMKPYDEVIAAIKAGATGRTYAATESVFGDMATALGLVDR
TPQGYQVAAANESDPSPADLDAFLQLLADRGVDVLIYNTQTEGSVPEQIR
SAAEQAGIAVVDVTETLPSDAKSFQDWQVAQLDSLAKALDVRT
120406266YP_956095.1 ABC-3 protein [Mycobacterium vanbaalenii PYR-1]MTQVLAVEYVALGYQDNWLHILGSSFMRNAWAGGTIVALAAGLMGYFIVV
RHSSFAAHALAHIGLPGATGAVLIGLPAAVGLGVFCVGGALVIGALGKRA
ADREVATGTVLAFATGLGLFFNSLATRNSSTLTNVLFGNLLAITSEQLLS
FFALLVLTAAGIAFIFRPLLFTSVNSKVAEAKGVPVRGLSIVFMVLLGLT
VTMAVQAVGTLLLFALVVTPAATALMVTARPVMAMAVSAVIGLVSVWAGL
AFSAMFNLPPSFVIVSIVCAVWLLVWAGCRVPVRA
120406264YP_956093.1 permease [Mycobacterium vanbaalenii PYR-1]MSTASRDAPAAGPGGPSERTRTLGILLLAAFGWVGAYVLNEHLWDAAVGW
LGLDLHTRAVGAVHFFLYDTVKIFLLLTGLMFVVGMLRASLDLDRARDYL
RGRGLFVGLVLAVFLGVVTPFCSCSSIPLFIGFVAAGIPLSITLTFLIAS
PLVSEIAAIMIGDQFGWHIAAVYVVAGSVLSLVIGWIFSRFDLSRWVEPM
VFTTKVAALRADGRVPSLAERVDAAVDETKDIFRSVWLWVLLGVGIGAVI
HGWVPADFFVRFAGPGNPFAVVVATLAGVPLYVNGAGVVPIAEALWAKGM
SLGTVMAFTMSTIALSVPQAVMLRRVMKPPLLALFFGTVAFGIMIIGFLF
NLVG
120406262YP_956091.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MFARCRTAAHAGAMTHSPDAAALAEEWDERYTSLADRIPDGTPSAVLIET
AEKLTPGAALDIGCGVGSDAIWLAAQGWKSTALDVSRVALDRATERGRRA
GVDVNWVCSRLEDLPLPPGGFDLVTAHYPALLHSPGADAERTLLAAVAPG
GTLLVVHHADIDVDLAKAHGFDPADYLSHDDVIELLGEEWEVSVEKRRPR
DVPAGIDGQHTHDDIVLARRR
120406260YP_956089.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSGTSEFAADKSQTSARATSGAGSESRPRQVMNVAVLAESELGSEAQRER
RKRILDATLAIASKGGYEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSA
LGREFERIDAKTDRSAFPAGATAYQRLNIMVGKLNRAMQRNPLLTEAMTR
AFVFADASAAGEVDHVGKLMDSMFARAMSDGEPTEDQYHIARVISDVWLS
NLLAWLTRRASATDVAKRLDLAVRLLIGDGDQPKI
120406258YP_956087.1 hypothetical protein Mvan_5310 [Mycobacterium vanbaalenii PYR-1]MTSSGGITFITMNRLAATSAAALATMLMAALTASPPATAASNTATSSIAV
DPATQIQMHVTANCDPAQNRCFFNTSANLLTPNGPTGFPGDTWARQTVTL
RSNSQDVWQEAWYSAPAGTPRELKGANHNNVLSRMLKSLRDVEVSVTYFG
GGPIERFTTDGDSVPTEWTTGLPAKGSDFIVCSQIQVVYGGVNLTTPSAC
AQTTF
120406256YP_956085.1 acyl-CoA dehydrogenase type 2 [Mycobacterium vanbaalenii PYR-1]MTSIQQRDAQSVLAGIDDLLPRIAKRSQAAEELRRLPDETVTELDEVGFF
KLLQPEQWGGLQCDPTIFYEAVRRIASACGSTGWVASIIGVHNWHLALFD
QQAQEEVWGSDPTVRVSSSYAPMGAGTVVDGGYLVSGAWQWSSGCDHATW
AFLGGPVIKDGKPVDFGSFLIPRTEYRIDDVWNVVGLKATGSNNVVVKDV
FVPRHRFLSYKAMNDGTAGGYQNNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYDAHVEHQGKRVRAAFAGEKSKDDPFAKIRIAEAASDIDAGWRQLIGN
VGAEYRLLEAGEEIPFSLRAAARRDQVRATARAIASIDLLFEASGATALQ
LDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
120406254YP_956083.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMTIKSLGYLRIESTDVAAWREYGLKVLGMVEGSGSTEGALYLRMDEFPAR
LVIVPGERDRLLVSGWETANASQLQDIRKRLEVEGTPYKEATATQLAERR
VDEMIIFDDPSGNTLEVFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAETLHFYRDVLGFYLRDSMKLPPQLVGRPADGAPAWLRFLGVNPRHH
SLAFMPGETPSGIVHLMVEVENSDDVGLCLDRALRRKVKMSATLGRHVND
KMLSFYMKTPGGFDIEFGCEGLEVDDENWVARESTAVSLWGHDFSVGFKS
120406252YP_956081.1 hypothetical protein Mvan_5304 [Mycobacterium vanbaalenii PYR-1]MNISRPGTVDRIEADDALLACSTLPRVDHVDAHLLRIGRPPVRTPEAWAR
EILEHTSVTMRMRLRTGWSALGITLHHGRHDTIAGWPITANTAEYVRLQG
DSRAGLTGQLVTRVSDEGVTFATFVRLGNPVARMVWAKVLPTHLAIVRSL
VEEAADRVG
120406250YP_956079.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MPFLGHERGRAYYRHWAAAEPAAAVVFLHGFGEHTGLYHRYGFALNAAGI
DLWAVDQFGHGLSPGDRGDFGTIEDSSALAEQLTDLVAQQHPGLPLIAQG
HSFGAIVTLFRLLDGAARYRAAVVSGAPLIPIPDLLDADTSFDLDPAWLS
ADPFYVDSLENDPLAFVASDSTALTRELDRGWDRFGTDLPSLSVPTLAVH
GVNDPIAPIGAVRAYAEQIEALQLVEFAGARHDVLNEVQHRDVAAAIIDF
IHRSY
120406248YP_956077.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMSTQHDARPDGPPSITTGLKRVVVASMAGTVVEWYEFFLYATAATLVFNK
VFFAEGTSEAAGLIAALLTYAVGFVARPLGGVVFGHFGDKYGRKKLLQFA
ILLVGAVTFLMGCLPTYAQIGVWAPILLVVLRFMQGFAVGGEWGGAVLLV
AEHSPNKERGFWASWPQAAVPVGNMLATVVLLVLTGTLSNDAFLSWGWRV
AFWLSAVVVLVGYYIRTKVTDAPIFVAAQEEVERVKSVSYGVVEVLKRYP
RGVFTAMGLRFAENIMYYLVVTFSIVYLKTHVGADTSDILWWLLAAHAVH
FLVVPQVGRLADRFGRRPVYIAGAMLAATWGFFAFPMMNSGDYLLILGAV
ILGLMIHALMYAPQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSLAPAIA
TWLLDRFGTWVPIAVYLAGAAVITLVAAWFTRETNGIDLHSLDVADREQL
AKAGIV
120406246YP_956075.1 acetoacetyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MTVTTIEAQWVPSDRDIAEAQVTRFARFAEERTGKTFADYHALWQWSVDD
VEAFWGALWDYFDLGERADVLDGAEMPGARWFPGATLNYVDQVVRQARTD
RPAIIHVSEDGSDREVSWAELLGRAAAFAERLRAAGIGPGDRVVGYLPNI
PEAVIAFLATAAVGAVWSACGQDYSAKAALDRLGQLEPKALVAADGYLFG
GKYRDKRDDVRALAAGLPTLQATFSTDDLAERSDNALDPVRVPFEHPLWI
LFSSGTTGLPKGIMHGHGGVLLEHLKAVALQSDIGRDDTFFWYTSPSWMM
WNFQVAGLLVGATIVCYEGSPNAPQPDSLWGIAARIRATVLGTSPGYVLG
CIKAEAEPGRTHDLSALRTVGITGSSLPPSSSLWLRDHVGVQIASISGGT
DVVSAFIGGVRTVPVWPGELSAPYLGVALDAWDESGKPVRGEVGELVITK
PMPSMPVGFWNDPDGKRYRSAYFETFPGVWRHGDWITITDHGSVIVHGRS
DSTLNRHGIRMGSADIYQAVESLPEVTEALVIGAEQPDGGYWMPLFVVLA
DGVELTDEVRERINDIIRSEVSPRHVPDEIIRAPGVPHTRTGKKLEVPIK
KLFQGGDPAKVVERSAVDDPALLDWYVTQRRS
120406244YP_956073.1 xylulokinase [Mycobacterium vanbaalenii PYR-1]MTLVAGVDSSTQSCKVVVCDSATGQVVRSASSPHPDGTEIHPDRWWEALQ
RTIEAVGGFDDVAAVSVGAQQHGMICLDSAGQVVRDALLWNDTRSAEAAE
QLVDELGGPAAWAERIGVVPVAAVTAAKLRWLADHEPVHADATAAVCLPH
DWLTWRLSGSTDIADLCTDRSDASGTGYYSAETDGYQYDLLALALRGRIP
LAPRVLGPRESAGATPHGAALGPGAGDNAAAALGLGAASGDCVVSLGTSG
VVSAVGRAAPHDPEGIVAGFADATGHQLPLVCTLNGAPVLATVAEMLQVD
FDEFDRLALSAPAGADGLVLVPYFAGERSPNLPQAAGALHGMTMRNLHPA
NIARAAVEGLLSSMAFCIDKIGDQGVAAERIILVGGASRSEAVRRIAPAV
LGATVYVPTPAEYVALGAARQAAWVLSGQDTPPPWSVGEPARYDADATPQ
VLERYRAAAPLTLR
120406242YP_956071.1 xylose isomerase [Mycobacterium vanbaalenii PYR-1]MTVLESSRPVPDALSPRREDKFSFGLWTVGWPGVDPFGVATRPALDAIEA
VDRLAALGAYGLTFHDDDLFAFGSSDGERRRAIDRLTSALSANGLVVPMV
TTNLFTQPVFKDGGFTSNDRAVRRFALRKVLRNLDLAAELGAQTFVMWGG
REGGEYDSAKDVQAALERYREALDVLCQYVIDQGSGIRFAIEPKPNEPRG
DILLPTVGHALAFIETLAHPEMVGVNPETGHEQMSGLNFTHGIAQALYSG
KLFHIDLNGQRGIKFDQDLVFGHGDLVNAFSLVDLLEHGGPDGGPAYDGP
RHFDYKPSRTEDAEGVWASAAANMRMYLLLRQRAAAFRADPDVREAMVAA
KVAELRKPTLAAGETYADLLNDRSAYEEFDTGAYFGGKGCGFVALHQLAV
EHLMGAR
120406240YP_956069.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MDTQPPILELRGVNKSFGVVHVLHDVDFCVYPGQVTALVGDNGAGKSTLV
KAIAGIHPIDTGTYLFEGKPVTVHSPNDVSALGVEVVYQDLALCDNLDIV
ENMFLGRELKRRGMLDEARMETMAREALTSLSVRTVKSVRQPVSSLSGGQ
RQTVAIAKSVLWNSKVVLLDEPTAALGVAQTRQVIELVRGLAERGVGVVL
ISHNMNDVFEVADRICALYLGRVAAEVKASEVSHGQVVELITAGRSGSLG
LAPAQAAESM
120406238YP_956067.1 aspartate aminotransferase [Mycobacterium vanbaalenii PYR-1]MTVSQRSGIPPFYVMDVWLAAAERRRTHGDLVNLSAGQPSAGAPSAVRDA
AVAALNRNDLGYTVALGIPELRAAIAGSYTARHGLTVDPDDVVVTTGSSG
GFLLTFLACFDPGDRVAIASPGYPCYRNILTALGCEVVELPCGPKTRFQP
TLQMLTELDPPVSGVIVASPANPSGTVIPPAELAAIATWCESSGVRLISD
EVYHGLVYPGAPATSCAWETSREAVVVNSFSKYFAMTGWRLGWLLVPDEL
KRAVDRLTGNFTICPPALPQIAAVSAFTPESIAEAEALLHDYAANRTLLL
DGLSALGIDRLAPTDGAFYVYADVSHLTTDSLAFCSKLLDDTGVAIAPGV
DFDTVRGGAFVRLSFAGPASDLEEALRRIGAWLA
120406236YP_956065.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMNFEIDEQQRDFAASIDAALGAADVPAAVRAWGEGDTAPGRKVWSQLADL
GVTALMVPEKFDGIEAHPVDLVVALERLGRWNVPGPVAESVAVAPVLLAD
DDRSAALAAGELIATVAAPPLVPRAVNADTAGLILLAEDGSVSNASAGAE
HESVDPSRKLFEVSAYGDRKAADVARAFEFGALATSALLVGAAQAMLDAS
VEYAKQRSQFGTVIGTYQAIKHKLADVLIAVELARPLVYGAALSLADGST
DTGRDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHDLSLLLLRVQALR
PAWGDPTWHRRRVLEALTK
120406234YP_956063.1 long-chain-fatty-acid--CoA ligase [Mycobacterium vanbaalenii PYR-1]MRTTPAVLDRIARELPDHPAVVTTAGGAGNPAVAGESGNPAAARTLTYAE
LRAEVRQAAAALIDLGIEPGDRVAIWSPNTWHWVVACLAIHHAGGVLVPL
NTRYTASEAEDILVRTAAPLLFASGEFLGADKAASVDRDAVPALRHVVRI
PIEKSDGTWDEFMSRGANLDAVDERVAAVTGDDVSDILFTSGTTGRSKGV
RCAHRQSLDASAAWAACGQVTSDDRYLCINPFFHNFGYKAGILACLQTGA
TLFPELTFDPENAMRAVQEHGITVLPGPPTIYQTLLDHPKRGDYDLSSLR
FAVTGAATIPVVLIERMQSELDIDIVLTAYGLTEAAGFGTMCRADDDAVT
VATTSGRPIADFELRIGDQSEVLLRGPNVMLGYLDDPEATAAAIDADGWL
HTGDVGELDDAGNLKITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAA
VIGVPDERLGEVGKAFVVRLPSAELDEKTVIDYAREHLANFKTPRTVEFL
DALPRNPGGKVVKPLLRQHSERA
120406232YP_956061.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTDLSVAPTEIEGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVVS
DYHERRLTETRDELAAFGLGKVDSVVCDVTSTEAVDALITSTVEKAGRLD
VLVNNAGLGGQTPVIDMTDDEWDRVLNVTLTSVMRATRAALRYFRDAPHG
GVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEYGVRVNAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVASTIAFLASDYSSY
LTGEVISVSSQHP
120406230YP_956059.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MAEAYVIDAVRTAIGKRNGSLAGMHPVDLGAAGWRGLFARNDVDPGAVDD
VIAGCVDAIGPQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGA
QAILSGTADLIVAGGMQNMSQIPISSAMIVGEQFGFTSPTNESKSWLHRY
GDQEISQFRGAEMIAEKWDISREDMEQFALTSNQRAQAAIRAGHFENEII
DVDGFRVDECPRETTLEKMAGLKTLVDGGRLTAAMASQISDGASAVLLAS
ENAVKVHNLKPRARIHHISARGADPVFMLTGPIPATQYALDRAGLTIEDI
DTVEINEAFAPVVQAWLKETKADPEKVNPNGGAIALGHPLGATGAKLFAT
MLNTLERTGGRYGLQTMCEGGGTANVTIIERL
120406228YP_956057.1 FAD-binding molybdopterin dehydrogenase [Mycobacterium vanbaalenii PYRMDLNTVEAVHIPTRRDEVWPVGPSDAILAGGTWLFSEPQPQVSRLIDITR
LGWPPITFSDDGMEIAATCSLAEIGSLTNTLPSDRPDWPAAPLFGQCCAA
LLASFKILGSATVGGNICLSFPAGAMISLASALDGTVTVWSADGSDYVVP
IGEFVTGAGSNVLRSGDVLRSLWLPAHALRSPTAFRKLAPSPLGRSGVVV
VGRRDEDDGQFVLSVTAATVRPHVFRFPLPPTAGEIRTALAAIAETEFTR
DAHGDPDWRRAVTLTLAEQIRRELT
120406226YP_956055.1 FAD-binding monooxygenase [Mycobacterium vanbaalenii PYR-1]MKVVIVGAGMGGMSAAIALRQIGIDTVVYERVTENKPVGAAISVWSNGVK
CLNYLGLQEETAELGGKVETMSYVDGHTGDTMCRFSMHPLIEQVGQRPYP
IARAELQLMLMKAYGIDDINFGMKMVGVENDTAGSAAKATFADGTTVSAD
VIIGADGAGSITREYVLGGPVSRRYAGYVNYNGLVSTDDAIGPATEWTTY
VGDGKRVSVMPVSDDRFYFFFDVVEPQGSPYEEGRVREVLRAHFAGWTPG
VQTLIDTLDPLATNRVEILDLDPFHTWVKGRVAVLGDAAHNTTPDIGQGG
CSAMEDAIALQWAFKDHPDDVHAALAAYQSARTERAADLVLRARKRCDVT
HAKDPQVTSRWYDELRNEDGTNIIRGIVGNIVGGPLTPVTAATEG
120406224YP_956053.1 putative OHCU decarboxylase [Mycobacterium vanbaalenii PYR-1]MKAIGLAGFNALSERQRMHLLFEVCSSTIWARRVVAGSPFRDAEALYDRA
DRVLAELPDAEIDAALDGHPRIGAKADNPSSAREQARVADSGPEVKAALA
AKNREYEDRFGYVYLVCASGRSADELLDILTERLGNDADTERRVMRNELG
KINRLRLERLLHEPT
120406222YP_956051.1 L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium vanbaaleniiMSRGAGIASRTWTAAAKSTVVRSNSWARFLRRPSDRDAIAMHRLVADTRV
LDVNSTYTYLLMATDFADTTIVADRDGELCGLITAYHPPVRPEVLFVWQV
AVAESARGTGLAGVMLDTLVDRVRRDRHGHPVTVEATVSPDNTASRAFFG
AFAKRHGVLLVEQPHFTSAQLDSDGNHEDEPLLRIGPIATPMVD
120406220YP_956049.1 L-ectoine synthase [Mycobacterium vanbaalenii PYR-1]MIVRTTDEITGTNRDVAAEHWRSKRIILADDGVGFSFHETTIDANSVSEF
HYQHHVEAVWVVEGTGTLTNHETGEVHPLRPGTMYLLNGHERHRVTCDTT
MRMLCVFNPPVTGREIHDENGAYPAAVQAS
120406218YP_956047.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGPGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHVRGQDVGVMALVGTFSQYGTVPEASI
VKIDDDIPLSRACLLGCGVTTGWGSAVNTADVSPGDTVVIIGLGGIGSGA
IQGARLAGAEKIVVIEPVESKRELAFRFGATHFVTSMEEATALVADLTRG
VMADSAILTVGLLEGSMLEEAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMRAGRNIRGVILHDH
120406216YP_956045.1 putative CoA transferase subunit beta [Mycobacterium vanbaalenii PYR-1MISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDIVL
TDGEARLIADTPAIGAAATIEGWMPFGRVFETLAWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHPTSYWVGNHSKRVFGTEVD
IVSGIGWDKVDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRAVSLHPGV
EPDQVAENTSFEVHGLAEAETTRLPSGDEQKLLREVIDPKSLRDKEVKV
120406214YP_956043.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MPITTKTVEPGIVSVTVDYPPVNAIPSRGWFELADTITAAGRDHSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCYEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNSDVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRLFFTAATVTADTLHHFGSVHEVVPRADLDEAALRVARDIASKDTRV
IRAAKEALNFIDIQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTEKGK
A
120406212YP_956041.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQAVVDEIVGAGGEAVTSGANVADWAQAEGLIQTAVDSFGTLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRAKSKAGESVD
ARIINTSSGAGLQGSVGQANYSASKAGIAALTLVAAAEMGRYGVSVNAIA
PSARTRMTESVFADMMATQDKDFDSMAPENISPLVVWLGSVESRDVTGRV
FEVEGGKIRVAEGWAHGPEIDKGARWDPAELGSVVPDLLAKARTPVPVYG
A
120406210YP_956039.1 phosphoglycerate mutase [Mycobacterium vanbaalenii PYR-1]MRDVRRTARRLLTILAATLAAAVLFAASAFAAADIVLTFVRHGQSQANAD
GIINTEVPGPHITALGQQQAALVAGVLAAGGYQGIYASDMVRTQETAAPL
ADILGESVTVLPGLREIDAGIYEGSSETDGLGRLGYGLTPALWTLGLRSA
WIPDSTDTNGNVFSDRMSEAVQIIYEDGWARPVAFSHGATIMFWTMMNVD
NPDLGLLLSHQLPNTGVVVLEGNPEDGWTLVSWDGVAVDPDPSFLTKTFV
NVRELITTPQTAVYNVKKAFATGDLAAITDSFAQAVIDVVLAPVRFVGAV
ATDVLELVFPPAPSVQVEAPMSAESTTDESDVPADVPDDVVAVAPSEDVE
SRTPEPASDEAETREESAAPESEATEPEISASQSEESEVETETTEETTTA
GTTGDDDTDETDDGAAVKEAA
120406208YP_956037.1 hypothetical protein Mvan_5260 [Mycobacterium vanbaalenii PYR-1]MIADADRIAAAQAYISALATHRADDVPFAPGCTRVEVGLKTGFSGNHLRR
SLNRGLQYRVIREVTAPEFTVDGDTVRARFELFTKPSLAGRRVGARIDEM
FLIPADDPSGRAQIHHIKASIRPFLTR
120406206YP_956035.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MPGPNSCPISPEFDFLDASLNLERLPVEELAELRKSEPVHWVDVPGGTGG
FGDRGYWLVTKHADVKEVSKHNEIFGSSPDGAIPVWPQEMTREAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAVGRLEDELRARAQRIAATAATEGSG
DFVEQVSCELPLQAIAELLGVPQEDRDKLFRWSNEMTAGEDPEYADVDPA
MSSFELITYAMKMAEERAKNPTEDIVTKLIEADIEGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSRNPDQWELYKKERPETAADEIVRWATPVS
AFQRTALEDTELGGVQIKKGQRVVMSYRSANFDEEVFENPHSFDIMRNPN
PHVGFGGTGAHYCIGANLAKMTINLMFNAIADAMPDLKPIGDPERLKSGW
LNGIKHWQVDYTGQCPVQH
120406204YP_956033.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMYIDLTPEQRQLQAELRQYFSTLITPDEAAAMETDRHNEAYRAVIKRMGS
DGKLGVGWPKEYGGLGFGPVEQQIFVNEANRADVPLPLVTLQTVGPTLQV
YGTEEQKKKFLPGILSGDIHFAIGYSEPDAGTDLASLRTTAVKHGDEYIV
NGQKMWTTGAHDADYIWLACRTDPEAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVRVPADMLVGEENGGWKLITTQLNHERVGLGPAGR
VAGIYDQVHAWASKPGSDGVTPVEHDDVKRLLGQIKAIWRVNELLNWQVA
ASGETIAVADAAATKVFSTERIQEVGRLAEEIVGGYGNPADPETAELLDW
LDKMTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
120406202YP_956031.1 MaoC-like dehydratase [Mycobacterium vanbaalenii PYR-1]MSAPALEVGTKLPELKIYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRYLTDWAGPTARIKSIGLRLGVPWYAYDTITFTGEV
TAVDDGVATVKVLGSNSLGDHVIATATLSLGDR
120406200YP_956029.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MRRTCACRFRARHNTLPAHGATPRSPTRSRRYRLGAEQRPAPANSSCHHG
VVSVALISAVDPYPTDAGKKVVLAGFVDYLADRHGADNVHYIKVGTARRE
NFPVQLHEVPGPRRVDVLRNVAARVATGRASLQEAFLGSRQTMEAITQIL
EDIKPGLRIYDTVRMAQYASDDIAANSICYLDDLFSERYDRMLKAAARYP
DVELSPLGNFAEHVPKRLQPLATDRVSQSALLRLERRLVLRSEDRAARRF
GRCLLLNSGETAQLQRRTGVAPGRIQCVPPLLNIVASSGRTYRGTKEFIF
LGLLSLPHNEDGLESFLRTAWPLVLARMPDAHLTVIGRDASPRLLALTTE
LAGSVTVAGYVPDLDDALNGAAALINPLRFGSGIKLKVFEALRRSLPVIS
TTVGAEGIDSGPGTGILIADDAAATADLLCSLTSVERNAEVSDEAREHFA
STYSRDAVFAVYDRAFTL
120406198YP_956027.1 hypothetical protein Mvan_5250 [Mycobacterium vanbaalenii PYR-1]MTKRRMLIAVLAVLGAVLGAGIGVFAVAAPSRYSASADVAFLPAPNLTTV
EASDFWEVLTRGQVTRTAAIVYDDPRWLPSAADAAKVPRDDLTLEAVALP
DTTMLTVTVSAGSAGAAEAALNNVLTTATPEVSSLVAPYFVKVLWPPENS
AWPEASPGRLQLAAAGALGGFLIGAGIGWLVQRRRGDAGSPGKHSDGSTH
GAPPGS
120406196YP_956025.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MLVELSPSGGLFQFAFELGSALAARGERVELWTGPRPELASSQPGFTVRP
VLPTWHPGDTGVHSRAFRLARRGFRAGQLIFAWTVLSVRLLAARPHAVLW
SQWRFAFEPMFVVAVSTLLRSSILGLIAHEPVPRSDAKDTSTAKAGALLT
RAFRAAWRRLDVAFVLGPRTRDLAVTHWQPRCPVYVIPHGAEPGVRGGRS
VRPVADTEPVVLFFGVWAKYKGIEVLLDAFARVRAELPESQLVLAGDVGA
DIDLPSVLDRAGQIGNVDARPGYVAIDDVAALFDAARVVAVPYIRATQSG
VAHLAFTFGRPVVSSAVGDLPEVIEDRVTGLLVEPDDADGLAAALVELLR
NPSLAATLGAAGEQRVNDAWTTAAARVCDALAEAATVRSRKGD
120406194YP_956023.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MTRGISALVLIDAFRMGGAETLLAPMIVASRDTDVTMDVVSISPADWNSE
KTMAILADAGIATRSLGIRRLLDPVALPRLVKTIRQGRYDIVHAHLEMAM
TLAVPAAALVGRPAVCTFHHVARPLQGRAAWRERLAVEAATRSRRALFVS
EASRRSFAETYRPNRMPKNWEVMHNGIDISNFSPGQADPRVRSELAAGTQ
GPVVVLPAAFRDFKGIPVAIKAWPAVKQRFPTAVLALTGGGELEGELRRL
VADLGLGDSVNFVGVRTDMPEVYRAADVVVLPSTHGENLPTVLIEASATA
CAIAASRVGGIPDIVLDGATGLLFEPGSADGLAEAVCRLLDDVELRRRMG
AAASERARTEFSATAWLARLRTTYLEAMGVPR
120406192YP_956021.1 hypothetical protein Mvan_5244 [Mycobacterium vanbaalenii PYR-1]MTDAGSATTLWFYGNTSQTTLSFPVAPGLRPATLNATLNLPFAMRSGTLS
VTQDDRLVSKVALPLTDFAPVVIPLDSVEVVDDSATVTLKLTGLAEEGYC
LDEENPVGLVNGSITYTGTVSPPSTVADFLPPVLRTVTIGLPETPTQAES
DTAVQLAAALQARYRAQAPQINVVPLPADATTVGGPAQPLERRIVVKEGA
EEGLSLAGGDDPQLLISGPPDQLTNQARLLTDSSLDMAVSTSAVAGELRP
EPAPPGDSATLAQLGTTNLSNIGVAPQVSIALDQTRFGHATQEFRLHLLG
THTPVPPEVGAQMTASVDGQIIDTWQAGADGNIDRWVDVPGRLVARYTSV
VVGLDTSGYIGRCNDFRPITLTIAGSTVVESTPAAPPLSAGFAALPQALM
PRMAVGINPDSFVDTARAVQIVLGLQRLSVVPLQTEVTSLQQAIDGDGPA
VLVSADGWTDPSIQLPVRSDGQQLTLTGFDDDRETTLTLDPGIRFGSLQT
VSEGQRPLLIATSNGVAAQLDELLRWLNDDPRGWSRLRGNAVVAIEGAEP
QLVPGRNTLSVYGPPTATSTDDQEQGGEGVPTWWIAGGVVAAAAIGIAAY
WLGTRRRATGGGSPGDSDSDSDRQA
120406190YP_956019.1 hypothetical protein Mvan_5242 [Mycobacterium vanbaalenii PYR-1]MSSHEPEPDDADTGPLHVSRLRTPLGEGPGDREPRYDAPLSVNPRPVHRD
RRPVVLVAAAAAALVGLGALAWVFWPSSGGEGHAGAPTTTTETESREEAE
TRLLDMVPPGYAADACEAVVPVNGALAQVSCDKNDDTGGPLTATYTLAKD
GRALRELFDGVVNASAVVNCPGNIQSPGPWRRNATPEQTAGTLVCGFQQS
RPTVAWTTDTDLMVSEVQSGPQGPNMVQLYTWWASHS
120406188YP_956017.1 PE-PGRS family protein [Mycobacterium vanbaalenii PYR-1]MARHAKKSDRSMAIRTYLTAGLTAGVTGAALAGVGTLLLADGDVSGPAQI
EVQLVSNEEDILWLSLNGGSDRRSAAQSAVVQQSSANPALRPMIGDGGWL
IGNGLDAADDCQGDACNGGDGGILWGNGGNGAHGGTGGDGGFWFGHGGNG
GDGDAVLDANGNVVRAATAGGAGGKGGYMFGNGGAGGKGGDAVYQNGVKK
NGALAGGRGGDSGYLLGNGGNGGAGGSDSNNLNVADDPATTNVNESAQNN
AAGGAGGAGGVGGILNGNGGHGGDGGSADSANGNATGGSGGRGGLAHSNA
GGTGGNGGNGGDAEADDAGKTAKGGNGGAGGTSGTGQGGSGGNGGNAVGD
DAHAVGGSGGAGGGVRLGTGGDGGDGGDAVSEDGNATGGKGGDGGSVDLT
GGGGGAGGEGGDADGDEKATGGSGGSGGTGGLGGDGGAGGDGGDAVADDE
GGATAGSGGDGGFGGTDGDDGSASDGADAPATD
120406186YP_956015.1 dehydratase [Mycobacterium vanbaalenii PYR-1]MPINLDEAIGAELDPVEFAWTSSDIQLYHLGLGAGMDPMDRAELRYLVDD
TPQVLPTFGNVAQSFHMTAPPAVKFPGIDIELSKVLHASEAVTVPGPIPA
SGTGIAVTRFTEIWDKGKAAVIWSETTVKDPDGTLLWTQKRSIFARGEGG
FGGDRGPSGSSAAPDRAPDLEITVPTSPQQALLYRMCGDRNPLHSDPDFA
AAAGFPRPILHGLCTYGMTCKALVDNLLDGDVSGLKSYGARMAGVVFPGE
TLRVNVWKEDGGYSATVTTPERDNAVALAGVEFVPA
120406183YP_956012.1 acetaldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MADKKSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKL
GLETSHEGVDWLLAQSELPDMVFEATSAYVHKAAAPRYAEAGIRAIDLTP
AAVGPGVIPPANLRAHLDAPNVNMVTCGGQATIPMVYAVSRVVEVPYAEI
VASVSSASAGPGTRANIDEFTKTTSAGVQNIGGAQRGKAIIILNPAEPPM
IMRDTIFCAIPEHADHAAITQSIKDVVAEVQTYVPGYRLLNEPQFDEPSV
VNGGNHVVTVFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLAAT
AGGAQA
120406181YP_956010.1 ATP-dependent DNA helicase RecQ [Mycobacterium vanbaalenii PYR-1]MTTRADAQAILEQLAGPGAVLRDDQWTAIEALVVHRRRALVVQRTGWGKS
AVYFISAKLLRAAGHGPTVIVSPLLALMRNQVAAADRAGVHAATINSSNV
TDWAEIHDRVRSGDLDVLLVSPERLNNPDFRDQVLPSLAHDAGLVVVDEA
HCVSDWGHDFRPDYRRIRTLLADLGADVPVLATTATANDRVVADVAAQLG
VGDFGREDQDGGSDTLVLRGGLDRESLRLSVVNAGNPAQRAAWLVAQLDS
LPGSGIVYTLTVAQAHDVASLLAEQGHKVAAYTGATEASEREQLESDLLD
NRVKALIATSALGMGFDKPDLGFVVHLGAPSSPIAYYQQVGRAGRSTASA
EVILLPGREDQEVWRYFASVAFPSESMVRNVIGALETDRPQSTAALEPLV
DLNRSRLEMVLKVLDVDGAVRRVKGGWVATGRPWAYDEQRYRTLDEARRR
EQQAMLDYQSTDGCRMAFLRRQLDDPELGADERCGRCDNCAGSSYSADVD
AAVAEDSRQRLMRPGVEISPRKQWPSGLAKLGVDLSGRITDGPAPGRVIG
RLTDLGWGARLRTLLEQDDAEVPDDVVQAAVKVLAAWDWQVRPTAVMALD
SDTHPLLTSSLARRLAELGRLTDLGVLRYTPERRPVTAANSAYRVAALRG
AWESPDPDAISAAGGPVLLVDAMTDTGWTLTMAARVVRSAGAPAVLPFAL
AATS
120406179YP_956008.1 hypothetical protein Mvan_5231 [Mycobacterium vanbaalenii PYR-1]MLNAGPLNRESLTTACAFAAAGVLVCGCVAPSMESRSVRSEVRVVQLASR
SATVADPLGGLAESLPDAVGVDADVVAAALRLPTVDPADVSAAVPPVLAS
LSTDEITEVTEASVGGPMIATRLISLLLQPLVWLVQVLPDPLKPIAGGFL
FMATFVGGVVGAAIDAVVDPILRLFGFGALAAAPLAAVEAVAGDPAADDS
VVVAAEPENATSQTITVVDAESTEVTGGVEVAGLDETEDASTQSESPLQE
EVPSDAVHSADDLTESGLTDLDSTEIDISDDQADAQAAQQESEVTAGDDG
SSEAGRAAEDSTPSPEPSGDVADS
120406177YP_956006.1 hypothetical protein Mvan_5229 [Mycobacterium vanbaalenii PYR-1]MTPDRTRSSFGAVFTQPLAEAIAEAEKLVAAAPFIESEADLLEGLQYLAG
CVAACTHVAFDYDRDHPFLHSGTGPFTKMGLDNPDTMYFGTRVQPGHEYV
VTGRRGTTTDVSFQLLGGEYTDEVVPDSETAFDDRKLDIAADGTFEWRFT
PKVPSQLVIREVYNDWSAQRGTFAIARTDTAGTAPPPLTRELIEKRYAVA
GKQLVQRVKTWLQFPQWFYNDTQPNSMVAPRLTPGGLATQYSSAGQFDLA
EDQALIITLPVTDAPYLGFQLGSLWYISLDYINHQTSLNGTQAQADPDGM
IRIVVADRNPGVTNWVETLGHRKGFLQFRWQRVSRELTPADGPTVELVDI
DKVAAALPYYESNTISEQDWRARIALRQKQIGERMVG
120406175YP_956004.1 hypothetical protein Mvan_5227 [Mycobacterium vanbaalenii PYR-1]MTPRTDVGTVEDLHASAVKACGLDDFGSDDDNYREALGVLLESYRRDADL
TELGSKMQRFFVRNALVARLVSEAAFKQYPEHADVAIERPIFVTGLPRTG
TTAVHRLLAADPRHQGLELWLAEFPQPRPPRETWSQNPVFQALDAQFTKA
HEENPDYTGLHFMTADEVEECWQLLRQSLHSVSYETLAHVPTYSQWLARQ
DWTKSYQRHRRNLQLIGLNDREKRWVLKNPSHLFALDALMATYPDALVVQ
CHRPAETIMASMCSLAQHTTEGWSNTFVGDVIGADSMETWSRGLELFNAE
RAKHDPAQFYDLDYFALIKDPVGAVGDIYRSFGIDFPHAARAAMTATHEE
SKKGPRAPKHTYSLSDYGLTDEQVKERFKGL
120406173YP_956002.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMSTEASAGTAHIREIDTGALPDRYARGWHCLGPVKNFLDGKPHGIEIFGT
MLVVFADSQGELNVLDGYCRHMGGNLAQGEIKGDEVACPFHDWRWGGDGK
CKLVPYAKRTPRLARTRAWHTDVRGGLLFVWHDHEGNPPQPEVRIPEIPE
WSSGEWTDWKWNTLLIEGSNCREIIDNVTDMAHFFYIHFGLPTYFKNVFE
GHIASQYLHNVGRPDVNDMGTAYGEASLDSEASYFGPSFMINWLHNKYGD
FKAESILINCHYPVTQDSFVLQWGVIVEKPKGLDDGTTQKLADAFTDGVS
KGFMQDVEIWKHKTRIDNPLLVEEDGAVYQMRRWYQQFYVDVADVTPEMT
DRFEMEVDTTAAVQKWNVEVEENLKARETETQST
120406171YP_956000.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVEAGSAARRGRPRSEAARSAVLTAAAELALEGGPAAATVEAIAKRAHVS
RTTIYKWWPSAASIVLEGLLDAVRASITRPSGSTSVQALVHHVSSLNAIL
ADPAVGPLLRNVIAASTSDPAIERAVLDQWIAPRRAAVAVTLREAVDRGE
LPGDVDIEVAVDALVSPPYYRLVLGMPPLAAEAVDRLVETVWSGCRH
120406169YP_955998.1 lipid-transfer protein [Mycobacterium vanbaalenii PYR-1]MNDVAVVGFAHAPHVRRTDGTTNGVEMLMPCFASIYADLGITMSDIGFWC
SGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKILTG
EVETALVYGFGKSSAGTLRRVLALQTDPYTVAPLWPDSVSMAGLQARFGL
DTGKWTAEQMAQVALDAQAAAPRVDSLEPGNSIEELLERPYFADPLRRHD
IAPITDGASAIVLASGDRARELRERPAWITGFEHRIETPVLGARDLTTSP
STAASAQAAAGGDTASIEIAELYAPFSHQQLILKEAIGLPDSTRINPSGG
ALAANPMFSAGLERIGFAARHIFDGNASRVLAHATSGPALQQNLVAVLEG
QS
120406167YP_955996.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MKLGLQLGYWGAQAPTNHAELVATAEEVGFDTVFTAEAWGSDAYTPLAWW
GRETTRMRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGAKFPKPLARTREYIDILRQVWAREAPVHSDGPHYPLPLTGEGTT
GLGKNLKPITHPLRADIPVMLGAEGPKNVALAAEICDGWLPIFYSPRIAA
MYNEWLDEGFARPGARHTRETFEICATAQVVVTDDRAEMMELMKPHLALY
MGGMGAEDTNFHADVYRRMGYAEVVDDVTKLFRSGRKDEAAKVIPDELVD
DSAIVGDLGYVQEQIKAWEAAGVTMMVVGARSPEQIRDLAALV
120406165YP_955994.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTSTLPALDVDLADGNFYADGRAAREAYKWMRANQPVFRDRNGLAAATTY
QAVLDAERNPELFSSTGGIRPDQPGMPYMIDMDDPAHLLRRKLVNSGFTR
KRVMDKVPSIENLCDTLIDAVCERGECDFVRDIAAPLPMAVIGDMLGVLP
DERDMLLKWSDDLVCGLSSTVDEQTIQKLMDTFAAYTAFTTEVIADRRAN
PRDDLFSVLVNAEVEGQRMSDDEIVFETLLILIGGDETTRHTLSGGTEQL
LRHQDQWRQAVADPELLPGAIEEMLRWTSPVKNMCRTLTADTEFHGTSLK
AGEKIMLMFESANFDEAVFENPDEFDIHRNPNSHMAFGFGTHFCLGNQLA
RLELRLMLTKILQRLPDLRLADESMLPLRPANFVSGLESMPVVFTPTAPV
GA
120406163YP_955992.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MALNIADLAEHAIDAVPDRVALISGDEQLTYAELEEKSNRLAHYLIDQGV
KKDDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELKYLFENSD
MVALVHERRYADRVANVLPETPNVKTILVVEDGTDEDYQRYGGVEFYSAL
AQGSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIADEYGLAKQAVESGPMVRYPIPPMIHGATQSATWMALFSGQTTVL
TPEFDAEAVWRTIHEHKVNLLFFTGDAMARPLLDALLAAQDAGDQYDLSS
LFLLASTAALFSTSLKEKFLELLPNRIITDSIGSSETGFGGTSIVAKGES
HTGGPRVTIDKNTVVLDEDGNPVTPGSGVRGIIAKRGHIPVGYFKDEKKT
AETFKTINGVRYAIPGDYATVEADGSVTMLGRGSVSINSGGEKIYPEEVE
AALKGHPDVFDALVVGVPDPRFGQHVAAVVQPREGTRPALADLDAFVRTQ
IAGYKVPRSLWLVDEVKRSPAGKPDYRWAKDVTEERPADDVHANHVGAK
120406161YP_955990.1 hypothetical protein Mvan_5213 [Mycobacterium vanbaalenii PYR-1]MNGARSLLTTLVDQGVDVCFANPGTSEMHFVAALDTVPGMRGVLTLFEGV
ATGAADGYARMSGKPAAVLLHLGPGLGNGLANLHNARRAHVPMVVVVGDH
ATYHKKYDAPLESDIDALAHTVSGWVRRTLDVGDIAVDAVDAVAASRAGV
VSTMIVPADVSWNDGEPTEPLPAGHPAPGIDDDAVREAADALNSGVPTVL
LVGGDATLAPGLSAAVRIAERTGAKVLCETFPARLQRGAGVPAVERLAYF
AEGAEAQLVGAEHLILAGAASPVSFFAYPGRPSDLVPQGCEVHVLAGHSG
AAAALEQLADDVAPGTTASVAPLMRPDLPTGELTAFSAAAVIGALLPEGA
VVVDESNTAGVGVAAATAGAPGHDVLTLTGGAIGYGMPAAIGAAMAAPDR
PVLSLQADGSAMYTVSALWTQARENLDVTTVIFGNGAYDILRIELQRVGA
ENAATPGPSALRLLDLGSPTLDFVKIAEGMGVPARRVSTAEDLAAALTEA
FAAPGPHLIEAVVPSLVNT
120406159YP_955988.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMTDVREIDTGSVMTRFARGWHCLGLADAFRDGRPHGVDAFGTMLVVFADT
GGSLRVLDGYCRHMGGNLAQGEIKGDEVACPFHDWRWGGDGRCKLVPYAK
RTPRMARTRAWPTTEVNGQLLVWHDPERSSPPTELIPPTIAGYDEGRWSP
WQWSSILIEGAHCREIVDNNVDMAHFFYIHHAYPTYFKNVIEGHTASQFM
ESKPRPDFTANPEKLWDGTYLRSEATYFGPAYMINWLHNDLAPDFTVEVA
LINCHYPVSHNSFMLQWGVAVQEMPGLPADKAAKLAAAMNRSFGEGFLED
VEIWKNKSPIENPLLTEEDGPVYQHRRWYQQFYVDAADVTADMTGRYEQE
VDTTHANDLWQQEVERNMAARKPGSV
120406157YP_955986.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MTARRDDVAAMLLDRTGDRRPGLRTRERDWTWDEVVHESAVRASIASTLS
DLDPPHIGVLLDNVPDFVFWLGGAALAGATIVGLNPTRGAADLAADIRHA
DCRLIVTDAAGADRLRGLDHGVPPDHLLRVDSPDHAQLLDAHRVEPVAAP
GVGAKSLFLLLFTSGTTGTSKAVRCSQGRLARIAYAATDKFGHHRDDVDY
CCMPLFHGNAIMALWAPALANGATVCLTPTFSASRFLPDVRYFGATFFTY
VGKALGYLMATPEAPDDADNTLQRGFGTEASPEDQKEFRRRFAAELFEGY
GSSEGGAVATPDPAAPPAALGRPAHDDVVVVHPETLCLCPTAVLDASGRV
LNPDEAVGEIVDRRGAADFEGYYRNDAADAERVRNGWYWSGDLGYLDGAG
FLYFAGRRGDWLRVDGENISTLTIERVLRRHAGVIAAAVYGVPDPRSGDQ
MMAAVEVADPGSFDVDAFASFLVAQDDLGRKGFPRLLRISAKLPATGSNK
VLKRDLQAQRWHTDDAVHRWVGRGHPRYRLMTDADRGALDAEFTVHGREH
HVAE
120406155YP_955984.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFKTTEASEDLGGLVRTITESVCTPEHQRELDGLRPEAGGRFDRDLWGK
LIDADILSTTSPESLGGGGFGVLEEVAVLVALGRQLAAVPYLESVMLAAG
ALATFGSASLQQDWAAQAIKGEKVLAVAFDGEMGEGPVLAQGSGDGYTLT
GSRTQVAFGVNADAFLVPAETDSGTAVFLVGSADDGVAVTALDTTGHGSV
AGLQLQGVAIGSDRRVGGPEVLDWLVTRHALGRSAYQLGVLERALELTAS
YAREREQFDRPIGSFQAVSSRLADGYIDIKGLRLTLTQAAWRLSEDLPAD
LDVASAAFWAAEAGHRVAHTTVHVHGGVGIDIDHPVHRYFLAAKQTEFAV
GGATGQLLRIGRELADTPA
120406153YP_955982.1 3-ketoacyl-ACP reductase [Mycobacterium vanbaalenii PYR-1]MTHTDLSGHVAVVTGAAAGLGRAEAIGLAKAGATVVVNDIAPALDKSDVL
DEIAAAGSKGVAVAGDISQRSTADELVETADGLGGLAIVVNNAGITRDRI
LFNMTDEEWDAVIAVHLRGHFLLTRNAATYWRSKAKQGGPGVENGQIYGR
IINTSSEAGLSGPVGQPNYGAAKAGITALTLSAARALGRFGVRANAIAPR
ARTAMTAGVFGDAPELPEGAVDPLSPDHVVNLVRFLASPAAEGVNGQLFI
VYGPTVTLMAAPTAERQFSADGAEWDPADLSDTLRNYFADRDPERSFSAA
MGLGDPH
120406151YP_955980.1 hypothetical protein Mvan_5203 [Mycobacterium vanbaalenii PYR-1]MSYDATIRFRRLLRFFPRAVDTVGEQALFYGETFRYVPNALTRYRKETIR
LIAEMSMGTGALVMIGGTVGVAAFMTLASGGVIAVQGYSSLGNIGIEALT
GFLSAFLNVRIVAPVIAGIALAATIGAGATAQLGAMRVAEEIDAVESMAV
HAVSYLVSTRLIAGLIAIVPLYALSVLAAFFAARFTTVYINGQSAGLYDH
YFNTFLIPSDLLWSFLQAIVMSIAVMLVHTYYGYNASGGPVGVGIAVGQA
VRTSLIVVVTIVLFISLAVYGASGNFNLSG
120406149YP_955978.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MRDKTLINVGVFTVAMLLVAAMLVVVFGEFRFASEDKYHATFTDASRLKA
GQDVRIAGVPVGTVEGLTLNPDNTVDVAFTVNDRYQLYTSTKAVVRYENL
VGDRYLEITSGPGDLVKLPKGGTITHTEPALDLDALLGGLKPVVKGLDGA
KINEISNAVIELLQGEGGALSAMLSNTSAFTQNLAARDQLIGDVINNLNT
VLGTVDEKGAEFNASVDQLQKLITGLAEGRDPIAGAIGPLATAENDLTAM
LEASRRPVQGVIENVRPFAQRMDERKGDVNKVIEPLAENYLRLNALGAYG
SFFNIFYCSTRLKINGPAGSDILVPFGGPPDPSKGRCAEVE
120406147YP_955976.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MKRSRWLRTALVGVLVATLAIGAYLVWPNRAGHKVTAYFTSAVGLYPGDD
VRVVGVPVGTIDSIEPRAGDVKITMTIDGDVKVPAEAKALVIAPNLVSAR
FIQLAPAYTGGTVMADGAEIGLDRTAVPVEWDEVKEQLTQLSTQLGPHEG
SVQGPLTDVVNQAADTFDGNGDTFRRAVRELSQTAGRLGDSRTDLFGTIR
NLQILVDALSNSNEQIVQFSNHVASVSQVLADATTDLDVTLGTLNQALTD
VRGFLGESNEALIGQVNKLTDFTNILTAQSDDIEQILHITPNGLSNFYNI
YNPAQGTVGGLLTLPNFGNPVQFICGGTFDAAATTDNYKRAEICRQRMGP
VFKRIAMNYPPLLFHPINSITAYKGQIIYDTPATEAKAETPVPYLQWQNA
PGVTPPQIAPDADLTSLLVPAEGPEASTSHAGGPETGPAPAAPVAPGPAE
AGR
120406145YP_955974.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MLDRLTRLQLMIFAIVTVLSVGAVSLFYLHVPSAVGIGAYNVTANFVAGG
GIYQNANVTYRGVTIGHVKSVGLSDTGVVAHMQLNSGTPVPENVTATVKS
VSAIGEQYIDLVPPQEASDATLRDGSDIGVDRTAIGQDIAGLLAEAENLV
QSVSNSRLQDLLSETFKAFNGSGPELARLIQSSRLLVDEANANYPEVSQL
IDQAGPFLDAQIRSGDDIRSLAEGLGRLTTEVADADPQLRTTLQTVPGTA
EVVNETFDGIRPSFPMLAANLANFGRIGVIYHKSLEHALVVFPALLAALN
TVAGGVPTDEGGKLDFKIHLQDPPPCSTGFVPATQIRSPADTTLRELPTD
LYCKVPQSDPSVVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGNNPWR
GPPVPVGTPIQDGRNILPPNKFPMIPPQVDPDPGPPSVQLPPGVAPGPGP
APHAPFPLPVPPNEQGPPPPPWPYFAPPDQVVPPYGRPPLAPPPAPPAPA
PAPAEGSPALPAEAPLASGTSVATYDQNGKFVDPAGGVGVYAPGSDKLAP
AENWVDLMLAPKQV
120406143YP_955972.1 hypothetical protein Mvan_5195 [Mycobacterium vanbaalenii PYR-1]MRDWPAKLIAAIGVLLATGFVALSAVGGALYWNRVELNGEEQARAELPSL
AAQQIPLVFGFDYQTVERTFAEVYPLLTPEYRKEFQDRVTNEIIPQARDR
QLISQAHSVGAGILDAHRTSASVMVYMNRTVTDKAKESVYDGSRLRVDYK
KVDGKWLIAYITPI
120406141YP_955970.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MGTYAITGSASGMGAAAVARLRADGHTVITVDIKDADVVADLSTSDGRAA
AAAQVLTACDGRLDGAVLAAGLGPSQGAERLRMIATVNYLGVVELLERWR
PALAAAANAKVVVIGSNSTTTTPAVPARAVRALLAGDVDKALRATRLYGP
GRPAMVYAASKIAVTRWARRHAVRPEWAGAGIRLNVLAPGAVMTPLLQEQ
LDNKRQARFVERFPVPVGGYGQPEQLAEWMRFMLSDAADFLCGSVIFVDG
GTDSLFRRDDWPRPVPARRIIGYVQRFRGRG
120406139YP_955968.1 hypothetical protein Mvan_5191 [Mycobacterium vanbaalenii PYR-1]MPAKSDPAEIGDVEPIADSTERQARRVVAAYATDADECRVFLSMLGIGPA
KPGD
120406137YP_955966.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MLLSLSERTYLVTGGGSGIGKGVAAAVVASGGNAVLAGRNADKLAAAAEE
IKAQTGDGAGEVIYEPADVTDEDQAARLVEAATAWHGRLDGVVHSAGGSE
TIGPITQIDSAAWRNTVDLNVNGTMYVLKHSAREMVRGGGGSFIGISSIA
SSNTHRWFGAYGPSKAALDHLMMVAADELGPSSVRVNGIRPGLTRTDMVA
PIVDTPALSEDYAACTPLPRVGEVEDIANLAVFLLSDAASFITGQVINVD
GGHGLRRGPDLSAMLEPIFGADGLRGVVST
120406135YP_955964.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKIGFIGLGNMGSAMAANLLSAGHEVLAYNRSRDRVVALAERGATPVPTV
AAACEGDVVFTMLADDTAVESVTFGDTGIVAALAPGAIHVSASTISVALS
EKLTAAHAEAGQMFVSAPVFGRPEAAAAAKLFVVAAGPHDAVTSLQPAFE
AIGQRTYVMSEEPKTANLVKLSGNFLIASVIESLGEAMALVSKAGVDRQT
YLELLTSTLFAAPAYQTYGGLLARKQFEPAGFAAHLGLKDVRLVLAAGEQ
LEVPLPVASLIRDRFLTLLAGGGRDLDWSALGALADWEAGGPRPGSG
120406133YP_955962.1 carbon-monoxide dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKAAPFAYHRPDTVADAVSMLGEFGDDAKILAGGQSLVPMLAMRLTHFEN
LIDISRVDELRNIEPRGDAVRIGAGTPHALVGMDDEVAESVPLLTLSTPH
IGHFQIRTRGTLGGAIAHADPAAEYAAVALALDAEMEATSARGTRRIPAA
EFFTGLWETALAADEILTAVSFPVWTGHCGFAVQEFARRHGDFAIAGATL
AVELDGRDRVARCGIGLLGMGSTPERGTPAEQAVVGRPVTDITAEEVGRL
AVSELHDVPADLQGRPAYRSKVGATMVARAWSQATTAALETREALNA
120406131YP_955960.1 carbon-monoxide dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTDTATNAVTARYAGQRVPRVEDSRLLTGHGRFVDDISRPGMLHACFVRS
PFAHATINGVDASAALALPGVHAVFTAADLNPDVKEAWHAVAGKDVPDTP
RPPLAEGEVKFVGDPVALVVADSRYLAEDAVDLVEVDYDPLPAVADFRKA
VGGAEAGVPVVHAAYPDNVAGGMGGMPPDEEIFATAAHVVEEHIYQQMYV
PVPMETRGMVVEWTSTTNELTVWASTQTPHELRAFAARLLGIPAQGVRVI
MRDTGGAFGQKVVPMREDMCILLAARKMPTATSNAQSGVAVKWIEDRREN
LMSAGQSRHVDGKVRMAFDSDGKILAADIDFVQDVGSYPTPYPVLTTAAI
GMFFPGPYRVPKASFNYKTVFSNTPGLHAYRGPWQYETLTREMLLDSAAR
KIGMDPVELRRINILRGDEMPFFNPNGMPYDNCAPADTFEQAVKILDHEG
FRKEQADALAEGRYIGLGFSAYIEPTGAATGNLATEGATIRMESTGKINV
YVNGGSAGNSIETTVVQLTADALGANIEDVATIQGDTAVTPYGAGTQGSR
SAPMTAGAVNEAGAILRRQIIAIGAQILGVEESEIELANSRAGVRNDPER
SVSFADIAYRSYYDPAQLGGVSPTLEATARFNSQAMIHWANATHVCTCEV
DVETGQVTLTRYIVSEDVGPMINPNIVEGQVAGGTVQGIGGALLEKLAYD
DAGNPVASTFVDYLLPTATEVPPIEFGHVEIPGPGVGGYKGAGEGGAIGS
PPAVINAINDALAPLGVTLTQLPATPATIVELIERAGKDH
120406129YP_955958.1 peptidase M15D- vanX D-ala-D-ala dipeptidase [Mycobacterium vanbaaleniMSVVALRCLIIGALAAVASIGPSATGAASPVPPVSDAARAAGFVDVRSVV
PDAIVDLRYATPDNFVGIPLYPAGARCMVHESLAPGLAVAADLVRPHGER
LVFWDCYRPHAVQVRMFEMVPDPAWVARPGPYARSHVAGRSVDVTLAGPD
GLVDMGTGFDDFSPRSLAYAADGVSPAAQANRARLRDAMIAGGFTAYDGE
WWHFDGPGAAVERPILDVPVD
120406127YP_955956.1 hypothetical protein Mvan_5179 [Mycobacterium vanbaalenii PYR-1]MAEAGLWVAWGVPTRGRERSALDLLVETEGYLSDLQGRGRIEGFDRVVLK
PQSIELGGFILIRGSKEQIDGLRRDHDFELWLTRVQLVADQVGVADAWLG
DGIAEAVSLYEKALENLD
120406125YP_955954.1 HNH endonuclease [Mycobacterium vanbaalenii PYR-1]MSRTCLGCGVDLQTRQQKVFCSNACQQSYRRRLLLEAWLATGVCGRLSYQ
GHYIRDYVYEQQGGCCALCGIKNTWNGLTLALIIDHIDGDSGNNRRENLR
LICPNCDSQLPTYKARNRGKGRFYRRQRYRDGLSY
120406123YP_955952.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMPVPENVPEARVLVVDDEANIVELLSVSLKFQGFEVHTASNGPAALDKAR
EVRPDAIILDVMMPGMDGFGLLRRLRADGIDAPALFLTARDSLQDKIAGL
TLGGDDYVTKPFSLEEVVARLRVILRRSGRGHEEPRTSRLTFADIELDED
THEVWKAGEPVSLSPTEFTLLRYFIINAGTVLSKPKILDHVWRYDFGGDV
NVVESYVSYLRRKIDTGDKRLLHTLRGVGYVLREPR
120406121YP_955950.1 histidine triad (HIT) protein [Mycobacterium vanbaalenii PYR-1]MLDGMATVFTRIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPREEI
DNWQDIDPAEFARVMEVSQLIGKAVCKAFDTERSGVIIAGLEVPHLHVHV
FPARNLSDFGFANVDRNPSPESLDEAQARIKAALAELS
120406119YP_955948.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTSGRRVLITGAGQGVGRGLALAFGAAGAEVLVNDLHRERSENVVDEIRA
AGGSATPAPFDVCDYASVVTAVAATGPVDVLVNNAGNAGAEGFGGRARFA
DTEPVDWDSFLRVNLYGVLHCTRAVLPTMIANTWGRILTVVSDAGRTGDP
GGAVYGAAKAGAAGLMRSVALENGRFNVTANNISLGTMRTPLTEPLWAEH
GDSPQAKEILRNYAIRRPGVPDDVTELALLLASDHGSWITGQTICVNGGY
SFGL
120406117YP_955946.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAASPKGRGSDPNARQRLIEATARVMRDEGYAAATSRRVAAEAGVKQALV
YYYFPTMDDLFVEVLRAGGESALEHMRAALTNDDPLHALWLINNDASRTG
LNTEFMALANHRKAIRVELRAYAERVRDIETAAVTVALRANGVDLDEHPP
VVISMLIAQVARSLCNEVAVGVTLGHDEMRAYVERQLKLLAPVTGG
120406115YP_955944.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRLVFALPHMLRLPAMSQPWEASVTGADQTRMARCADQWGYDMIAVPEHF
VIPAEHVELSGPHYLQSTVAQAYLAGATERIRLNSCITVLPLQHPVVLAK
ALATADWMSGGRMMVTFGVGWLQGEFEALGVPFRERGRMADEYLAVIKEL
WTSDAPSFEGKYVSFREVAFEPKPVQKPHLPIWIGGDADAALRRAAKYAS
GWWSFLTPPEKLAERLDFIKSQPDYDGRPFDVVHGLGTNRVGEGHVAQHD
PDARPGMSAAEIVDRLSWLGAQGVTVSAVPIPKVRGVEEYLDYAQWVIEE
IKPQVP
120406113YP_955942.1 nuclear transport factor 2 [Mycobacterium vanbaalenii PYR-1]MTETTDLTPVVAASRNSWRCVQSGDREGWLALMADDVVLEDPIGEAVTNP
DGTGVRGKDAVAAFFDTNIGPNQLRVTCEETFPSSSPTEIAYILVLETTF
PNGFVATVRGVFTYRVNDAGLITNLRGYWNMDAMTFSQKESAD
120406111YP_955940.1 hypothetical protein Mvan_5163 [Mycobacterium vanbaalenii PYR-1]MASREQLEDWVQRWLKANQDAEAAGDWKPLAEFYTEDATYGWNIGPKEDV
MCVNKQEIRDVALGLEMEGLENWVYEYQKTLIDEKQNEIVGFWKQIANKG
DGTRDEIYGIGGSWFRLNDQLLIEWQRDFFDFGHVQKAFMKLIESGDLTP
TMQKRIERSLAGERLPGYYPIGEAPVPIW
120406109YP_955938.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTAVKEVPRVSGGEEEHGHLEEFRTDPIGLMKRVREECGDVGWFQLADKQ
VILLSGAEANEFFFRSSDSELNQAEAYPFMTPIFGEGVVFDADPERRAEM
LHNTALRGEHMKGHATTIEAEVRKMIEGWGESGEIDLLEFFAELTIYTST
ACLIGLKFRNQLDSRFANYYHLLERGTDPLCYVDPYLPIESFRIRDEARA
GLVELVQDVMHGRIANPPKDKSDRDMLDVLVSIKDEDGNPRFTANEITGM
FISLMFAGHHTSSGTSSWTLIELLRHPEFYAKVQQELDDLYADGQEVSFH
ALRQIPSLDNALKETLRLHPPLIILMRVAQDEFEVAGYPIHKGQMVAASP
AISNRIPEDFPNPDDFDPDRYEKPRQEDLINRWTWIPFGAGKHRCVGAAF
AQMQIKAIFSVLLREYEFEMAQPPESYQNDHSKMVVQLARPAKVRYRRRV
RD
120406107YP_955936.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTISEVRLDPYNYDFHEDPYPYYKRLRDEAPLYRNEELGFWALSRHADVL
KGFRNSTTLSNKFGVSLDPASRGPHASKTMSFLAMDDPAHLRLRTLVSKG
FTPRRIRELEPRVTEIAVTHLDAMLEQATTGDAVDYVDEFAGKLPMDVIS
ELMGVPDADRVQVRAWADAVMHRDDGVTDVPDSAIEASLNLIVYYQEMVA
ERRKKLTDDLTSALLEAEIDGDRLTDDEIIGFMFLMVIAGNETTTKLLAN
AAFWGHRNPDQLTSVYQDLARVPLWVEETLRFDTSSQILARTVSGELTLY
DTTIPDGDVVLLLPGSAHRDERVFENPDDYVIGREIGSKLMSFGSGAHFC
LGAHLARMEARVALAELFKRIRGYEVDEANAVRVHSSNVRGFAHLPIRVE
IR
120406105YP_955934.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MAILADRESRLLIDGKLVAGSSGTFTTVNPATEETLGVAADASAEDMSAA
IGAARRSFDETDWATNTDLRVRCIRQLQQAMRDHVEELRELTIAEVGAPR
MLTSAAQLEGPVEDLSFCADTAESYAWTTDLGIASPMGIKTHRTIAREAV
GVVGAITPWNFPHQINLAKIGPALAAGNTLVLKPAPDTPWAAAVLGELIA
EHTDFPAGVINIVTSSDHGVGALLSKDPRVDMVSFTGSTNTGRAVMADGA
ATLKKVFLELGGKSAFLVIDDADLAGACSMAAFTASMHAGQGCAITTRLV
VPRDRYDEAVEAAAATMGGLKAGDPTKPGTVCGPLISERQRERVQGYLDS
AIAEGGRFACGGGRPADRDTGFFIDPTVIAGLDNNAKVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVFSADPERAAGIAARMRVGTVNVNGGV
WYSADMPFGGYKQSGIGREMGLAGFEEYLEIKAIATAAN
120406103YP_955932.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSERADELRVGYIGLGNQGAPMAKRLVDWPGGLIVFDVRTEAMTPLVEMG
ASAADDVAGVSAADVISVTVLNDAQVRDVVGELAAHAEPGTVIAIHSTIE
PDTAPELAEQLRPKGIHIVDAPVSGGAGAADKGELAVMVGADEHAYDRVK
PVFKQWASMVVRAGEPGAGTRMKLARNMLTFVGFTAACEAMRLAEAAGID
LQKLGRVVRHSDAQSGGPGAIMVRDDMLPLAPEHFLYDMFVHTRGLGEKD
LRLALGLGESTGVELPLAEIALRDLAAGLGVPHTTSTTEE
120406101YP_955930.1 hypothetical protein Mvan_5153 [Mycobacterium vanbaalenii PYR-1]MMTTTSRYAALSRAELATLVPELLLIGQLIDRSGMAWCISKFGREEMLQI
AIEEWAGSSPLYTKRMQKALNYEGVDVITVFKGLQLDIGAPPQFMDFRYT
VHDRWHGEFHLDHCGALLDVEPMGEDYVRGMCHDIEDPTFDATALATNRK
CQVRPIHRPPRAPADRHPHCAWTVIIDESYPEVDFVPQLEIVAASRAYNT
ELAPIDPSDEGLADYSGPLLSDVDFGAFSHSALVRIADEVCLQMHLLVLS
YNLAVRARANGDAALEESIRYKSLIGIAGVAAERIKNALGISADATGALR
VLELHPLMNPAAYVSVDVDPDFLHVRRSPAYEDGAWISLVSPVADLPLQA
IAAAVNPYLRAEVSGTESDWTVRVVETDTAAKELPEVEVCKFSGGASWEF
ENRKSLPLTVV
120406099YP_955928.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTATQSCPFLPHGYDFTDPDVLLKGIPVTEFAELRRTAPVWWNEQADSIF
DDGGYWVISRHEDVKAISRNSTQWSTNTKGAVMRLPDGVTAEQLDLTKAL
LINHDAPEHTRLRKIVSRLFTPRAIAGMEDRLADAAREIVRSAAEKDSGD
FVDDVAMMLPLQAIADLIGVPEEDREKLFHWTNAIMNTDDPEFDADPTMA
NAELMGYAYSMAEERRRCPADDIVTRLVQADIDGESLGEVEFAFFVILLA
VAGNETTRNAMTHGMNAFFDNPAQWELFKRERPETAIDEIIRWATPVHCF
QRTALEDVEVGGVTIAEGQRVGLFYSSANFDEDVFDRPFDFDILRDPNPH
LAFGGNGAHFCIGANLARMEIKLMFNEIADQIPDISKLAEPQRLRSGWIN
GVKNLQVAYR
120406097YP_955926.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MMSRMPTLNRREMLALGLRAGLAATAASALGTAVASAAPAPTFVTGSFAS
AARGGAVTNWVIARPPDQTAPLRPVILLHGKDSSAEMVMSMGVERFLADA
VRAGLPPFAMAAVDGGNGYWHRRASGDDPGAMVLDEFLPLLATQGLDTSR
VAFLGWSMGGYGAMLLGSRLGAGRTAAITAVSPALWTSPGAAAPGAFDGA
ADYEANSVWGLAALNGIPLRIDCGFDDPFYSATEQFIAQLSTPPAGGFSP
GGHNAAFWSSQLTSEMTWAAPLLAT
120406095YP_955924.1 amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-MSESVAGPRSPEKQPELKRVMGPGLLLLFVVGDILGTGVYALVGDVAGEV
GGAAWLPFLVAFAIATVTAFSYLELVTKYPQAAGAALYAHKAFGIHFITF
LVAFVVMCSGITSAATASRAFAANFFEGAGIDASKLGVVVLALLFMAALA
AVNYRGVGESVRLNVVLTIVEITGLVVVVLVGLWAFTGGADVDFSRITAF
ETGEDKNTFLAVTAATSLAFFAMVGFEDSVNMAEETKDPVNTFPKILLSG
LSIAGVVYVLISIVAVALVPVGRLEESDTPLVEVVRAGAPGLPIDAILPF
MTMFAVSNTALINMLMASRLIYGMARQHVLPPVLGTVHPTRRSPWVAILF
TTLIAFGLIIYVSTFASSNAIAVLGGTTSLLLLAVFAVVNVAVLALRRDV
REAGGHFKTPTALPVIGFLASLFLVTPLSGRPAQQYIVAATLVAIGVVLF
FVTQLINRQLGIRDGHITDPTRLGSGTD
120406093YP_955922.1 adenylosuccinate lyase [Mycobacterium vanbaalenii PYR-1]MPHYLPVQGPISCVFVSNPVPVPDVLAHRYASEEMVAIWSPEAKIVAERR
LWLAVLKAQAELGVGVPDGVVADYERVLEEVDLASIAARERVLRHDVKAR
IEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLELVHARGIAVVARLA
ERAALYRDLVMAGRSHNVAAQATTLGKRFASAAEELLVALQRVRELIDRY
PLRGIKGPMGTAQDMLDLFDGDTDRLADLERRVAGFLGFTDIFTSVGQVY
PRSLDHDVVSALVQLGAGPSSMAHTIRLMAGHELVTEGFAPGQVGSSAMP
HKMNTRSCERVNGLQVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPD
AFFALDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILIAAVRAG
VGRETAHEVIKEHAVAVALAMREKGAEPDLLDRLAADPRLPLDRQALDAA
LADKQVFTGAAGDQVDRVVAAVDDLIARYPEAAEYTSGAIL
120406091YP_955920.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MRILVLGGDGFCGWPTALHLSDAGHDVLIVDNEIRRRMDVELGVQSLTPI
VSLPERIEAWREVSGRCLQLEMFDVARDYDALLNTLRTYRPDAVVHFAEQ
RAAPYSMKDAAHKCYTVDNNVNATHNVLAALVEARLDSQLVHLGTMGVYG
YETSAVDLPEGYLTISYPDRHGAVVTREALYPTKPGSVYHLTKSLDQLLF
QFYAHNDGIRVTDLHQGIVWGTQTAETRRDPRLINRFDYDGDFGTVLNRF
LMQAAIGYPLTVHGTGGQTRAFINIQDTVRCVRLAIESGDQVGRRVRIMN
QVAETLRVRDLAELLERLVGAAVAYLPNPRAEADENELAVRSDNLKRLGL
DPILMEAGLLGESMEIAKEYANRCDVSKIPSVSYWNAERRCAAQKVSR
120406089YP_955918.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MSDPGPRGVEEHYRSIDSAPPEYSVNRPPSAVNGALMNFFSLSVVALLAA
TEIVRRIDPYAPRDLVFIRAEGQSAAIPVRVFLLLIASAVALSLATNWWR
RLAVGGEMVGKGLLICLVVDLSAYIGHSLGLFEAEVVGQQLASSLASLVV
FPFVILRHARLPKPVDLPPVGRIRWHAWVRLIVPLVVAFVLAAWIEQRTP
LTTEFMREWALLGGVGPGIFLVQQLFVIITASIGLLMVRWSRRARFAPPL
AVMVPAHNEAHDIAAAIEAVDRAAARYAAPVHLYVIDNASTDATTAAAEA
ALAACAHCTGEVRPCAQPGKAVALNYAISIIREEFVVRIDADTVIGENCL
DVTLRHFANPKVGAVGGMPRPPRVRTFFDRARMVEVLLKHGFFQVSMMGF
DGILGEPGMFVVYRRRAVLEAGGIVEGMNGEDTDICLRMSSQGYLNMAEP
TAVYLSEVPQTWAHLREQRIRWFRSIYHVTAHNRRALLDRSSMAGVVVLP
FQLANAARRAMMLPLLLFGLLIFGLFQKTYPGLSEPRLWAVFLGLPMLVA
IAVCLSRQPRAVLYIPEYLVFRVVRSYFTLAAVLSLNFPPLHPRLRRRAS
GEKPVATPRQAPAKRSSHLTRQHSRVAPAGRRSSSVES
120406087YP_955916.1 putative transmembrane protein [Mycobacterium vanbaalenii PYR-1]MKSRWVPYATTPGRLMAQLFSDVVVVGWTAIWIFVGTAVHSAVATIADFG
YQVESGANGVAGNLDSAGQSAEDVPLIGGAIGGPLTAAGDAAREIAGAGQ
TLGVTAGWLAWLLALAVAAPPILALMMPWLFLRVRFFRRKWTAVTLSSTW
AGEQLLALRALANRPLPKLAAISTDPVGAWREQDPVAIRGLAALELRASG
IRAANLKRAK
120406085YP_955914.1 oligopeptidase B [Mycobacterium vanbaalenii PYR-1]MKPSEMAGPPAPIAKRIDTRREHHGDVFIDPYEWLRDKDNREVVDYLEAE
NAFTEHVTEKLAPLRQQIFDEIKARTKETDLSVPTRRGDWWYYGRSFQGK
QYGVQCRCPVTDPDDWTPPQFDENTEIPGEQVLLDENVEAEGHDFFSLGA
ATVSVDGNILAYSVDVKGDERYTLRFKDLRTGQRYDDEIVGIGAGATWAA
DNNTVYYVTVDEAWRPDTVWRHRLGSGLPAERVHHEPDERFWVAVGRTRS
NKYVIIAAGSAVTSELRYADAADPQAEFTTVWPRRDSVEYSLDHAVVGGE
DRFLILHNDGAENFTLVEVPVAEPTDVRTLIEHRSDVRLDSIDAFAGHLV
VSYRKDALPCIQLWPVSDTGYGDPQDITFDSELMSVGLSANPNWSAPKMR
IGATSFITPVRVYDLDLATGERTLLREQPVLGDYHPEDYVERRDWAIAED
GARVPISVVHRAGLEGPAPLLLYGYGAYEACEDPRFSIARLSLLDRGMIF
AVAHVRGGGELGRPWYEHGKLLEKRNTFTDFASVGRHLVDTGTTRPENMV
AYGGSAGGLLMGAVANMAPDLFAGILATVPFVDPLTTILDPSLPLTVTEW
DEWGNPLEDPEVYAYMKSYSPYENVESRNYPAILAMTSLNDTRVYYVEPA
KWVAALRHAQTDPAADAVKVLLKTEMNAGHGGISGRYERWKETAFQFAWL
LDAAKAGHDGGA
120406083YP_955912.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSSRGTYHHGDLRATILARAADLVAERGADGVSLRELARAAGVSHAAPAH
HFTDRRGLFTALATEGFRSLAEELSRARPEFLDAALAYVRFALANPGHYE
VMFDKSLYHADDPALVDAETAAGSELAAGVGTLDDPRAKDDPQAAALAAW
SLVHGFALLWLNGAVNTTGDPMATVRRVAGMLFGGEPVTCPT
120406081YP_955910.1 hypothetical protein Mvan_5133 [Mycobacterium vanbaalenii PYR-1]MGVAGHLIVSISGISDRTLADVAAFRAALDDRGVPASFLVAPRLKGGYRL
DHDPTTVDWLVERRAQGDAVVLHGFDEAATKQRRGEFATLPAHEANLRLM
AADRIMEHLGLRTRLFAAPGWNVSQGALTALPRNGFRTVAGLTGITDLVH
RTTVRARVLGIGEGFLTEPWWCRTLVLAAERTARREGIVRVAVAARHLRR
TGPRQAMLDAVDLALMHACAPTVYEWRPRAALTDAA
120406079YP_955908.1 beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYMLQLTHFGHSCLLASFDDGSGAQTTVLFDPGNFSHGFEGITGLDAILITH
QHPDHADTARLPALVEANPQAALFADPQTAAQLGGSWQAVNVGDQLSIGH
LTVRGAGGTHAVIHPEIPVIDNISYLVGDGEHPAKLMHPGDALFVPGEPV
DVLATPAAAPWMKISEAIDYLRAVAPVHAVPIHQAIIDPIGRPIFYGRLT
EMTDTDFRVLEQESAVTF
120406077YP_955906.1 phosphoribosylformylglycinamidine synthase subunit PurS [MycobacteriumMAKVVVHVMPKAEILDPQGQAIVGALGRLGFDGISDVRQGKRFELEIDGD
IDDDKLAEIAESLLANTVIEDWTVTREGQA
120406075YP_955904.1 hypothetical protein Mvan_5127 [Mycobacterium vanbaalenii PYR-1]MLVDPELLRAFAAQVDAAAATIRGTDVGTTAGAAGDGLPGSETQWSARQV
GVHLKLIAEDIAKDIAAMGHAVRGAGDSYEVTDEALAGDFKKLF
120406073YP_955902.1 hypothetical protein Mvan_5125 [Mycobacterium vanbaalenii PYR-1]MKPLSAVAVVAVLFGGLGSFCIMWVVRLLQQGRYASMVVAVGFAVFAFSV
LAMRVIVAAGKVAPRVEYGGGGTLLRPDPTVDRISLIGLLAALATLLLYG
VVASFGIAGLPGLAGDQRWLGLASIAAAILGLPSLRRVAGQRGMSYLRLT
AAGYEYSDAWSRTETEWDELSDISDRPTHKPWLLIAGSTYLTTSDGRSRT
LASDWYTPGGRAVRKLVRFYWRHPECRGELTDARAARRLADPW
120406071YP_955900.1 Linocin_M18 bacteriocin protein [Mycobacterium vanbaalenii PYR-1]MNNLYRQLAPVTDAAWAQIEEEATRTFKRYIAGRRVVDVSEPGGPVTAGV
STGHLRDVASPGDGVVAHLRDAQPLVRLRVPFSLKRIDIDDVERGSQDSD
WDPVKEAAKKLAFAEDRAIFEGYEAAHINGIRRSSSCPALALPEDPREIP
DVISQALSELRLAGVDGPYSVLLSADVYTKVSETTAHGYPIREHLNRLVD
GDIIWAPAIDGAIVLSTRGGDFDLQLGTDVCIGYLSHDAETVQLYLQETM
TFLCYTAEASVALSA
120406069YP_955898.1 putative aminopeptidase 2 [Mycobacterium vanbaalenii PYR-1]MPASPQGLCEFIDASPSPFHVCRTAAERLLAAGFTELSESDPWPGAGDHF
AVRAGSLIAWRSPDGSRALPFRIVGAHTDSPNLRVKQHPDRFVAGWQVVA
LQPYGGAWLNSWLDRDLGVSGRLSVRDGNSIRHTLVRVDDPILRVPQLAI
HLSEDRKGVELNPQRHVNAVWGTGTGARSFLDFVAGRAGVVGDDVLGFDL
MTHDLTPSRLAGVDDNLVSAPRLDNQATCYAGLEAFLSARAGADAVPVLV
LFDHEEVGSQSDHGAQSELLLTVLERITLAAGGSREDFLRRLPASMVASG
DMAHATHPNYPDRHEPGHLIEVNAGPVLKVQPNLRYATDGRTAAAFALAC
AQAGVNLQRYEHRADLPCGSTIGPMTAANTGIPTVDVGAAQLAMHSAREV
MGAADVADYSAALAAFLSPG
120406067YP_955896.1 phosphoribosylformylglycinamidine synthase II [Mycobacterium vanbaalenMTQEVDTVERAAATPDHPQPYRELGLKDDEYERIREILGRRPTDAELAMY
SVMWSEHCSYKSSKVHLRYFGETTTEKMRETMLAGIGENAGVVDIGDGWA
ATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAA
DAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDASYAGNPLVNALCVG
VLRKEDLKLAFASGAGNKIILFGARTGLDGIGGVSVLASETFGGDESGAG
RKKLPSVQVGDPFTEKVLIECCLELYAADLVVGIQDLGGAGLSCATSELA
SAGDGGMRVELERVPLRAANMTPAEILSSESQERMCAVVTPDNVDAFMAV
CRKWDVLATDIGEVTDSGRLEITWHGETVVDVPPRTVAHEGPVYERPVQR
PDSQDALVANTTASLERPSTGDELRATLLQLLGSPALCSRAFITEQYDRY
VRGNTVLAEHADGGVLRVDEQTGRGIAISTDASGRYTALDPYAGAQLALA
EAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGAAALGI
PVTGGNVSFYNQTGTTAILPTPVVGVLGVIDDVKRRIPTGFGTEPGETLI
LLGDTRDEFDGSIWAQVTADHLGGVPPTVDLDRERLLAEVLTAASRDGLV
SAAHDLSEGGLIQAVVEASLAGETGCRIVLPEGWNPFVTLFSESAGRVLV
AVPRTEESRFTAMCEARGLPANRIGVVDQGPDGGEPAVEVQGLFTVTLEE
LRRTSEGVLPGLFG
120406065YP_955894.1 abortive infection protein [Mycobacterium vanbaalenii PYR-1]MRDGVRATALAMLLLGWSLAAPRLPQRWNPLPQTMFGAGVAALAGAPLGL
RPPMLWRGLQWGSAAVAPVALSVAAATTSPPVRAGMVARDLPDPAASWLL
LRIPFGTVWSEEATFRAALGATAERAFGRTAGRLFAATVFGLSHVPDARA
AREPILGTVLVTGTAGWAFSWLYAKSGSLVAPMLAHLAVNEAGAVAALAV
QRRRSARGRPADGARSPGRRSRS
120406063YP_955892.1 hypothetical protein Mvan_5115 [Mycobacterium vanbaalenii PYR-1]MASSGAGTSRPCGALRTWVMAARRTVDPAQTRAAVAALADWLRDPDAPAP
ARAQLADAVRFTARTLAAVAPGAAVEVRVPPFVAVQCIEGPRHTRGNPPN
VVETDARTWLLLSTGLLTVADAAADGALQLSGSRAAEIADALPLVALPD
120406061YP_955890.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MSTEQVRCLVTGATGYIGRRLVPELLDRGHTVRAMARTPAKLDDAAWRDR
VEVVRGDLTEPDSLASAFDGVDVIYYLVHSMGTSRDFVAEEARSARNVVA
AAEKAGVRRLVYLGGLHPQGKTDLSRHLASRVEVGDILLGSTVETVVLQA
GIVVGSGSASFEMVRHLTDRLPVMTTPKWVHNTIQPIAIADVLYYLAEAA
TAEVPESRTWDIGGPDVMEYGEAMQIYADIAHLRRRVMVVLPFLTPTIAS
LWVGLVTPIPSGLARPLVESLECDAVAHEHDIDTVIPPPEGGVTGYRDAV
TQALRDDGTAAKGGRRHLLRFSKVVPQ
120406059YP_955888.1 phosphoribosylaminoimidazole synthetase [Mycobacterium vanbaalenii PYRMAGSPTTCAERTPGRIGCSRRPVALWPMSDRAEQHGISYASAGVDIEAGD
RAVELFKPLAKKATRPEVRGGLGGFAGLFALRGDYREPLLASSTDGVGTK
LAVAQAMDKHDTVGIDLVAMVVDDLVVCGAEPLFLQDYIAVGRTVPERVA
ELVSGIADGCVLAGCALLGGETAEHPGLMAPDHYDISATGIGVVEADDVL
GPDRVRPGDVIIGMASTGLHSNGYSLARHVLLEIDHMNLAGHVEEFGRTL
GEELLEPTRIYAKDCLALAAETQVRTFCHVTGGGLAGNLERVIPHGLVAE
LDRGTWTPAPVFGMIAQRGRIERAEMEKTFNMGVGMVAIVAPEDTDRALA
VLTARHLNCWTLGTIEKGGKDGPRAVLVGQHPRF
120406057YP_955886.1 glycine cleavage T protein (aminomethyl transferase) [Mycobacterium vaMSAVPAPDIGPDAGAVWHYGDPLGEQRAAAQGAVVVDRSHRAVLSLTGAE
RNSWLHTISSQHVSDLADGTVTENLSLDGQGRVEDHWVQTQLDGRTVLDT
EPWRGEPLLSFLRKMVFWADVVVEPADLGVLSLLGPGLTDPAVLDAVGLP
ALPAPNSAVELPGGGFIRRLPGPAVEVDVVVPRDELAAWRDRLVAAGVRP
AGVWAYEAHRVAARRPRLGVDTDERTIPHEVGWIGGPGVGAVHLDKGCYR
GQETVARVHNLGKPPRMLVLLHLDGASDRPSTGDPLLAGGRTVGRLGTVV
DHVDEGVIALALLKRGLPADTALTTGGEVHAAATIDPDSMPPADGVGAGR
LAVDRLRGGTA
120406055YP_955884.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MSCPSVAGWRTAAAVLVVLAGPACAAPVGVTAPTLDSSKCSRDVLATQYP
GILTFGADQPVYPPWYMGDDPTNGDGFESALAYALAAKLNYTGDDVRWVR
VPFNTALAPGAKTFDVNLSQFSITEQRRAAVDFSTPYFDVTQAVVAVRTS
PAAAVTTLDGLRPLRLGAQVGTTSHTAATELGGSVPVQAYNTNVDAKMAL
LDGEIDAMVVDLPTALTMAEELRHGVLVGQLPADGEHLEQFGIVLSHGSP
LTRCVSWAVDSLREDGTLAGLQNRWLTDTGPVAVLR
120406053YP_955882.1 hypothetical protein Mvan_5105 [Mycobacterium vanbaalenii PYR-1]MSSGDEAVAAAAQRARVTAARNIPVFGDLPLPADTANLREGANLDDALLA
LLPLVGVWRGEGEGRAAHGDYRFGQQIVVSHDGGDYLNWEARSWHLDDDG
EYARPGLRETGFWRFVSDPGDPEESQAIELLLAHSAGYIELFYGRPLNQS
SWELVTDALARSKSGMLVGGAKRLYGIIEGGDLAYVEERVDADGGLVPHL
SARLTRFVG
120406051YP_955880.1 hypothetical protein Mvan_5103 [Mycobacterium vanbaalenii PYR-1]MKITIACAASAAFAAVALIGAPAALADPEGDFLTVIGNGGITWPSDKTQQ
VIETGYAVCQDWDNGASFEQEVADLTSVTDWSDYQAGYFIGAATGAFCPQ
YEWKVS
120406049YP_955878.1 thiosulfate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]MARSDVLVTADWAESNLEAPKTVFVEVDEDTSAYDTGHIPGAVRLDWKTD
LQDPVKRDFVDAAQFSKLLSERGIANDDTVVLYGGNNNWFAAYAYWYFKL
YGHQDVKLLDGGRKKWELDARPLSKDAVERPQTSYTAKEPDNSIRAFRDE
VIAAIGTKNLVDVRSPDEFSGKILAPAHLPQEQSQRAGHIPTAINVPWSK
AANEDGTFKSDEDLAKLYAEAGLDGEKETIAYCRIGERSSHTWFVLQELL
GHKNVKNYDGSWTEYGSLVGAPIELGS
120406047YP_955876.1 thioredoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1MSSSWIAVIAVLIAAFGLAFVIGRLLTLRSGLIKGAAEWPALDDSDVDAL
GLSRTGPTVLHFSAVWCGPCAGVRRVVDQVCAELPEVTHVEIDLDADPES
ARKLSVLSLPTTFIFDADGRQRYRTSGVPTAADLRSALQPLLA
120406045YP_955874.1 response regulator receiver protein [Mycobacterium vanbaalenii PYR-1]MDLLLLTVDPHPESVLPSLALLAHNVRTAPTEVSSLLEAGTADVAIVDAR
TDLAAARGLCRLLGTTGTSVPVVAVVNEGGLVAVNVEWGLDEILLPSTGP
AEIDARLRLLVGRRGGMANQENLGKISLGELVIDEGTYTARLRGRPLDLT
YKEFELLKYLAQHAGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYEALIGTVRNVGYKAVRPARGRAPAAGADLPSDDLDGDDPYEDGVGS
LDRDGVPEALGDALRSQ
120406043YP_955872.1 arsenite-activated ATPase ArsA [Mycobacterium vanbaalenii PYR-1]MSKVEVFEPALCCATGVCGEDVDQQLVTFSADLDFVSGRGGDISRYNLAG
EPRAFAENDTVRAFLHVAGSVGLPLVLVDGVTVMTGRYPDRSQLAAWAGI
DTPDGKIPLDIEDTTAAGGGCCGSDSSGATQLLLESARPMTLRFLDAPPR
FLFFTGKGGVGKTSIACAAAIHLARNGKRVLLVSTDPASNVGQVFGLRVG
NAITTVPAVEGLSALEIDPEQAAEAYRERIVAPVRGLLPDREVQSITEQL
SGSCTTEIASFNEFTELLTDSDALTGQFDHVLFDTAPTGHTIRLLQLPGS
WTDFLNEGKGDASCLGPLSGLDKQRAIYAEAVEALADPLRTRLVLVARAQ
RSTLAEITRTHRELAAIGLTRQYVVINGVLASPAGNGDPLAAAIHTREQQ
AIAALPDELRGLPLDQVELKATNIVGVDALDSLFTSDARIPEGDDGTGLP
VVDAPLSALIDELAEGDHGLIMCMGKGGVGKTTIAAAIAVALADRGHPVH
LTTTDPAGHLSGTLHGTLPNLHVSSIDPVEATRAYRDHVLATKGAALDEQ
GRSMLEEDLRSPCTEEVAVFQAFSRVISESRNKFVVVDTAPTGHTLLLLD
ATGSYHREVARQLGNRHFTTPLMRLQDPELTKVIVVTLAETTPVLEAAGL
QSELERAQIQPWAWVVNNSLAAAHPTSPLLRQRAVAELPQIDKVRTDYAD
RVAVIPLLACEPVGIPALEALAGSRTAAV
120406041YP_955870.1 protein tyrosine phosphatase [Mycobacterium vanbaalenii PYR-1]MSIEITGTTEKRAAIFAALADPSRLAIVDHLLLADASPSELRAVLGIQSN
LLAHHLGVLKTAGLVRQTRSEADRRRTYLQLDHQALESLVPATGRKATRV
LFVCTQNSARSQLAAAIWNRRSELPAASAGTHPASGVHPGAVAAARRHKL
HLRPHTPRYLGDVLGPGDLVIAVCDNAHEELPVELPRLHWSVPDPVRTAQ
AEAFDAAVDDLTDRIEHLVPHLKSA
120406039YP_955868.1 phosphate ABC transporter permease [Mycobacterium vanbaalenii PYR-1]MPTTPGKGSALRQGGGRWGDTVFKSIAIAAGATIIGAIALMALFLIIKAL
PSIQANQANFLFSTEFLTSDPDNLRFGIRDLFMVTVLSSVFALVIAVPIA
IGIAAFLTNYAPARLARPFAMLVDLLAAVPSIVFGLWGIFVLAPWLTPVA
TFLNDNLGWFFLFSEGNVSLAGGGTIFTAGIVLAVMILPIITSVTREVFA
LTPRGHVEAAQALGATKWEVIRMTVFPYGRSGMIAASMLGLGRALGETIA
ILIILRTAAQAGHWSLFDGGYTFASKIASAAAEFSAPLPTGAYIAAGFVL
FALTFIVNALARAAAGGRVSGG
120406037YP_955866.1 phosphate ABC transporter ATPase [Mycobacterium vanbaalenii PYR-1]MAKRLDLKDLNIYYGSFHAVADVGLSVMPRSVTAFIGPSGCGKSTVLRTL
NRMHEVLPGARVEGSVLLDGEDIYASGVDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRRNLDDIAEKSLKGANLWNEVKDRLDKPGGGLSGG
QQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLISELKQDYTIVI
VTHNMQQAARVSDQTAFFNLEATGKPGRLIEVDDTEKIFSNPSQKATEDY
ISGRFG
120406035YP_955864.1 cell envelope-related transcriptional attenuator [Mycobacterium vanbaaMEDAAATHRRPHPGDEWLTRSARPKRGAAPWERTTDTPPSAQEPESVDES
APITVADLIAKIHGEAPPSEPTRHRAEPELDYEPEPERHGQPEPAPYGQP
EPGLYGQPELGRYGQPELGLGEEPEPYPDGDDLDTMVLPALDPSRADLPD
LTATRPPAHTLPKPRLRPSGRIAVVGRVAAALVAVLALVLTGGAWQWQSA
KNNLLNRVSALDPDSRDIVDPNAQFGDENFLIVGTDSRLGENAGIGAGTT
EDAAGARSDTVMLVNIPANRKRVVAVSFPRDLEIEPMKCEPWNPETREYG
PISDPESPMYGMDEAYTEYKLNSAFAVGGPKCLVKVIQKLSGLHVNRFMA
VDFVGFSKMVDALGGVEVCSTTPIEDYELGTVLATAGRQIVDGHTALNYV
RARQVTTETNGDYGRIKRQQLFLSSLLRSLISKETFFSLSKLNNVVNMFI
GDSYVDNVDTKDLVDLGQSVQGVNAGRITFVTVPTVGYADEWGNEIPRTE
DMQALFDAIINDDPLPEERNADNTPVPGTPESLTNPAPAQPDQGQSGGEI
VDAITTDPQSVTVQVSNSTGSTGLGSTTADALQAYGFNVTTPDDYPGPLP
RTTVFFSPGNEEAAATVASSFADATIERVAGMDDVVQVVLGSDFNAVTAP
SPSGSPVQVHVIRGTKTPATTLPEDLTVTNAADTSCD
120406033YP_955862.1 fatty acid desaturase- type 2 [Mycobacterium vanbaalenii PYR-1]MSKDLTDLQLLTELEPVVEPLINRHMRMTKDWNPHDYIPWSDGKNYYALG
GQDWDPEQAKLSEVARVAMMVNLLTEDNLPSYHREIAMNFTMDGPWGFWV
NRWTAEENRHGIALRDYLVVTRNVDPVELEMLRLEQMTRGFSPGQNEQIE
ADLFADSLFDSVIYVTFQELATRVSHRNTGKACEEPVADQLLQRVSADEN
LHMIFYRDVSEAGFEIAPDQAMKSLHKVLRNFKMPGYTIPDFRRRAVTIA
SGGVYDPRIHLEDIVMPVLKKWRIFEREDFNGESARLRDDLGLLVEELQE
AVDKFEVAKQRREERLRQMAEKKAAKNLLVGSSAS
120406031YP_955860.1 hypothetical protein Mvan_5083 [Mycobacterium vanbaalenii PYR-1]MTQDTSEADPLTSGSAADSVPVAAGCPVTSGGYDSVPQPLGPDSLTWKYF
GQWTGLFQGPWAGSMQNMHPQLGAAVKDHSIFFMERMPRLLRSIYPIGGV
VFDGDRAPKTGAQVRDYHIGLTGVDDQGRRYSALNPDVFYWAHATFFKST
LLAAERFHGGLTEDQRRQLFDEHVTWYRMYGMSMRPVPKTWEDFQEYWDH
MCTNVLENNWATREVLDLSTMPKHPSLEWVPDWLWKQNLKVMQRFLLFMT
VGLYDPPIRELMGFTWSPRQEWLHRRVGNMLHLATRLLPDRVTMHPRKRS
AMDRAFGRLPADAPLVETPARNLPPVEYRDNPHYYSPKV
120406029YP_955858.1 hypothetical protein Mvan_5081 [Mycobacterium vanbaalenii PYR-1]MLLGVGRHSIAKKRRNPSVYVVSALAPAAVFLAVKADTSAIRVAVEEEPV
AAPAPAPVEEQFVPCCVEVVAAPASGPGPARLTDDGVADVEPASLVSASR
WRVVSRTLPAGVAPENGLQVRTILTARSISAVFPEINNIGGVRQDALRWH
PNGLALDVMIPNPTSQAGIALGNQIVAYVMANAERFGIQDAIWRGAYYTP
GGAKAGGYGHYDHVHVTTTGGGYPDGDEVYFR
120406027YP_955856.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MNDFRQRLLDALEASIAEDGYARTTVADIVRRAKTSRRTFYEHFDSREAC
FVALLSDANADQIRQIYAAVDPSAPWQKQVRQAIEAWISSGEARSALMLS
WIRDVPALGAAARGLQREAMEHFVDMVGALGATDEFRAAGVGPFSRRRII
MLLGGLRELTASTVEEGGRMSDVTDEAVEASIALLSPPAR
120406025YP_955854.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVRPAQTARSERTREALRQAAVVRFLAQGVEDTSAEQIAADAGVSLRTFY
RHFASKHDLLFADYDAGLHWFRSALAARSPEESIFESVQSAIMASPYEDW
AVTKIAAMRAKELDTGRIVRHIRQVEADFAEAVEQHMAAAGAAAPGTDER
MRTTVTARCIAAAVFGAMEVWMLGEDRSLPELDRLCRQALTLLRSGIEDP
VG
120406023YP_955852.1 hypothetical protein Mvan_5075 [Mycobacterium vanbaalenii PYR-1]MTKEKPKTTETDAGSEHADDDVVSDPSKGTEDRVDWSDEGGATESGPAT
120406021YP_955850.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MATSVVYGRAMATKDSREVVIEATPEQILDVIADVEATPTWSPQYQKAEI
LDRYDNGRPKQVRMTVKAAGLTDEQVIEYTWGDNEVSWTLVSATQLKAQD
AGYTLTPAGDKTKVKFDIAIDLSVPLPGFIIKRTIKGGVETATEGLRKQV
LKVIKG
120406019YP_955848.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MAIRASREVLIEAPRDAVMEALADVGALPSYSSMHKRAEVMDRYPDGRPH
HVRVKIRLLGLVDTEILEYRWGPDWLVWDAQPTSQQYAQHVEYRLSSDDH
GECTRVRIDITVEPVVPIPEFLIRRACGGVLDAATTGLRELALRDAGT
120406017YP_955846.1 NADH:flavin oxidoreductase [Mycobacterium vanbaalenii PYR-1]MAFTLGAGSALLKPIQVGGVTAENRIFMAPLTRSRADADGTPSSLAAQYY
AQRAEAGLIISEATAVCEQANGAYLNTPGLYTDRQQEAWAEIASAVHGAG
GKMFVQLWHVGRMAHPEISGFENVGPSPIAADLVTHTPSGKKPLPVPRAL
TAAEIAEIIGLFRAAARRAVDAGMDGVEIHSANGYLLHEFLSDVVNQRTD
AYGGSPQNRARFTAEVVEAVAAEIGPERVGLRISPGNNAGDMTEVDQISA
YELLLCRIASLNIAYLHVVSEPSAPAFAAIRTQWEGTLVLNTPRAVDTDF
AELENLATWGVISAAAVGRAFLANPDLVQRLTSGAELNEPDVATFYAPGP
AGYIDYPTLDELAEPQSA
120406015YP_955844.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MSEEAFIYEAIRTPRGKQRNGALNEIKPVNLVVGLIDEMRVRFPDLDENL
ISDLILGCVSPVGDQGGDIARTAGLVAGLPDTTGGFQLNRFCASGLEAVN
LGAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAWAGDPETNYRIGFVPQG
IGADLIATIEGFSREDVDAYAARSQERAAAAWAGGYFAKSVVPVKDQNGL
VVLDHDEHMRPGSTVESLGKLKTAFDGIGAMGGFDDVALQKYHFVEKINH
VHTGGNSSGIVDGAALLLIGSEAAGKSQGLTPRARIVATATSGADPVIML
TGPTPATQKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRGAKRALMTLCVGGGMGVATII
ERV
120406013YP_955842.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MNTSQIWQELDRQVTAGRIPGYVAAVRRTGIGEVHASGRLSFDAGAPAML
SDTPFRITSLGKPLGAALTLALIEDGVLGLDDEIRRWLPEFAEPAVLREV
TGPLSDTGPADRPITVSHLLAMTAGWGMLLQDCPLQSGIDEREIGSGPVP
PQMTGDEFVRRLAELPLAFQPGTGWLYDTPVKVLSVLLARAAGMPLGDLL
AQRLTQPLGMTDTGFWTDADRLPAPYRPAGDGVEDIELPDGAFVRPPLFE
DLSCGLVSTAPDLLRFFSAMADGGAPVLHPESVRLMTTDQLTVDQRMQGL
PILGPGVSWGLGVAVDVEAVSPWMAPGRWGWTGGSGTSAHVHPDGSVAVF
LSQRELADAQDGFDDFWAAVSVG
120406011YP_955840.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMALTKDEREQFLAEPHIAALSVSAGDGRGPLTVPIWYQYTPGGDLWFTTG
AGSRKHQLIQSNGHVSLMVDRVEPTVRYVAVEGPVLRIEPGTDAQLVEMT
RRYLAPEKVDGYLEFARREHGESVAVFVKPARWLSADLGAV
120406509YP_956338.1 microcompartments protein [Mycobacterium vanbaalenii PYR-1]MAELRSFIFIDRLQPQTMSYLGTWIKGALPRAGVAAQIIEVAPGLDIEGV
TDVALKHAEVQAGVLVVERQFGYLEFHGDTANVEAAADAALDELGQDAAS
ATPPKILASRIISSIDQQHAFLINRNKIGSMVLAGESLYVLEVSPASYAI
LATNEAEKAADVKVVDFRMIGATGRVYLSGSESDVRQAASAAEEALARSV
P
120406508YP_956337.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTGESAVPHAGQLLERARFAAAAYADYDQAAVARIVEAVAEAGYRNAERF
AAAAVAETQMGVVEDKVVKNRACSRGIVEFYRDQDYVTPRVDTARKIVEI
PRPAGVVLALTPTTNPVATVYFKVILALMTRNAVVVAPHPRARQCSAEAA
RLLAEAATAAGAPDGIVQVIDEPSLPLVEALMSDERTDVIVATGGTGVVR
AAYSSGNPALGVGPGNVPVFVDATADVDAAARRIVDSKAFDNSVLCTNES
VLIAEDAIAARLSTALTRHGAHILDADAAIRLREYMFPDGALNTEVVGRD
AAWIADRIGLRVTPKTRVLIAPFTDVIGEEVLTHEKLCPVLGMTTVADAQ
RGIRAARAVVRIAGAGHSAAIHSEDATVITDFAAQVPVLRVSVNVGNSTG
SSGLDTNLAPSMTIGTGFVGRSSIGENLQPENLMNWARIAYNSDAAVTMP
NFAGLSPWRSPAGPVPAYPRASNDPSAAAAAPAAPVSRPSARRTGEPGIE
ALRAELRALVAEELAQLIKR
120406507YP_956336.1 class III aminotransferase [Mycobacterium vanbaalenii PYR-1]MYDYGTFSFDSKAQVLERAKEFWNPDKTQFWTDSGVDLVIDRRQDYFLWD
MSGRRLIDMHLNGGTYNLGHRNPEVMQAITDGMQYFDVGNHHFPSVARTA
LAQKLIESAPASLSKVAFGSGGGEAIDIALKSARHATQRRKIVSIVKAYH
GHTGLAVATGDDRFAKLFLADRPDEFVQVPFGDTDAMEQALRGRDVAAVI
METIPATYGFPLPPIGYLEAVKDLCVRYDALYIADEVQTGLMRTGEMWCI
SKHGIEPDIMVTGKGLSGGMYPITAALLSDRAAQWLDQDGFGHISTFGGA
ELGCVAALKTLEISSRPEVRSSVHYIADIFAKGLSRIQADYPGWFVGIRQ
NGVVIGLEFDHPEGAKFVMRELYQNGVWAIFSTLDPRVLQFKPGLLLNRD
LCEDVLDRVEVAVGRAKLAATGRRKP
120406506YP_956335.1 amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-MTEDVVPRQTAPTDSVQRLKRNAVGTFGVIFMAVATAAPITAMVGNVPIA
VGFGNGSHAPAGYLVATVVLGLFAIGYATMAKHITATGAFYGYISHGLGR
VMGMASGGIITMAYVVFEASLIGIFAFFFQNFLSSQFGFDIHWLIPALLM
LALNCILTYFDVNLTAKVLGVFLVTEIVMLSLGAIAVAVKGGGPDGFAVG
EILNPVGAFQPAAIAGASAGLGLFFAFWSWVGFESTAMYGEESKDPKRII
PRATMIAVLGVGLFYVFVSWMAIAGTGPKQAVELAQSADTSSEIFFAPVR
TTYGEWAITLFNILLVSGSFACGMAFHNCASRYLYALGREGLSTRLQDTL
GATHKTHGSPHIASFVQTGITLVLILAFFAAGMDPYIHMYTLLAILGTMA
ILIVQSLCAFSVIAYFHFHKNHPSSAHWFKTFLAPLLGGIGMLYVVYLLW
EHKESAAGAASGTLLFKLTPWIVVGLFALGAAMALYFKFNDKRRYELIGR
IVYDDSEIRD
120406505YP_956334.1 glycerol dehydratase [Mycobacterium vanbaalenii PYR-1]MADELGRFRVLNSKPVNLDGFSVPDAGLGLVAMSSPHDPAPSLKIRGGEV
VELDGKGAGEFDVIDEFIARYGIDLTVAEEAMALGDETLARMVVDINVPR
AEVVRLIGGTTPAKLARVVALLSPVEMQMAMAKMRARRTPSNQAHVTNQL
DDPLLIAADAASAVAYGFREVETTVPVLGDAPSNAVALLIGSQVGSPGAM
AQCSIEEALELRLGLRGLTSYAETISIYGTEQVFVDGDDTPFSKAILTSA
YASRGLKMRVTSGGGAEVLMGAAEKCSILYLESRCVSLARALGSQGVQNG
GIDGVGVVASVPEGMKELLAENLMVMMRDLESCAGNDNLISESDIRRSAH
TLPVLLAGADFVFSGFGSIPRYDNAFALSNFNSDDMDDFLVLQRDWGADG
GLRTVSPEHLEAVRRRAAKAVQAVYRDLGLADYEDARVEEVVAANGSRDL
PAGHPKMVAEAAASIEARQLTVFDVIASLHRTGFTDEAEAITTLTRERLR
GDQLQTSAIFDEKFRVLSKLTDPNDYTGPATGYALTDRRRAEIDAIRQAR
SSAELTADQESYRGHVLVTDVEPAQQGSDPREVCIGLSPAWGRSVWLTLC
GLTIGEVLRQISAGLEEEGCIARPVRVRSTIDVGLIGLTAARLSGSGIGI
GLQGKGTALIHRRDLAPLANLELFSVAPLLTAKMYRELGKNAARHAKGMA
PVPIFTGGTDESISARYHARAVALVALERESCEPGQPPVTVKVEWP
120406504YP_956333.1 propanediol utilization dehydratase- small subunit [Mycobacterium vanbMAMSEISAASRENITVGNAVDGKLGLGDLRMDPATLAHQAAVAEAGGNPQ
LAENFRRAAELATIEDEQVMALYEALRPHRSTAAELEELRASLLARGAPR
CAALVEQAAAVYARRGLLR
120406503YP_956332.1 hypothetical protein Mvan_5561 [Mycobacterium vanbaalenii PYR-1]MTTPAGRSSGTVVAGIDVGNHTTEIVLARVRDGAVTTLAHGQAPTRGRKG
SAESLQGAAALLHRIEVDAGCRAEELLLSALRPVDTATAPIPPAYSPTSP
VRSLRRPDASTPAGTGYGVGQHVRLCDLNAGVVDEPVVISVDETTDFEVA
AREISLAVARGWQVVGVVAAQDDAVLIRNRIPIDVPVVDEADLTGLEPGA
LVAVEVVEEGRAYRAMADPIALSAALHLPAGSLVEVAEFCRELADSAAIA
VTPRTEAPLPPAPDDDYVDVRVDGALVRYTPAEAHGVLRRSVPGCVNAIR
LRSVPTAASGLSVHDAFFTDLGSIDNGAWLRRGVADAQGTVVALLAAEEA
DDAAASLSELTGRPARTLSSEPEAAAWGARTTPGLPPGSMVCDIGGGTVD
LIGADGTVVAAGAGESITVAVARVLGIPHALAETVKRTPAVRVEGPHVAH
EEDGRRVFLDSPASSDAIGRLCTRGSAGLVPFSDRLAAEEWRSLRLAIKQ
ETVAANIARCLTAFGESPTALVLAGGGALDDELMRTVGEALRSVPIVVGR
ADVDGVHGPRFAVARGLIAMYAADQLSGDDSAD
120406502YP_956331.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MPVTRRRLVFIASRLCVLFAVAVSALMSPAAAAHAFSRPGLPVEYLMVPS
TAMGRDIKVQFQSGGPGAPAVYLLDGLRARDDFNGWDIETNAFEMYHGSG
LSVVMPVGGQSSFYTDWYRQACGNAGCSTYKWETFLTQELPAYLAVERQV
RPTGSAVVGLSMAGSAALTLAIHHPEQFRYAASLSGFLNLSEGWWPMLVG
ISMKDAGGYRSDDMWGPSSDPAWQRNDPMVNIGQLIANNTRVWVFAGNGK
PADLGTGEPEGDNVPAKFLEGFTLRTNRTFQEQYLAGGGRNGVFNFPDSG
THSWGYWAEQLQSMKPDIQRVLGAAPGQSALSSPDN
120406501YP_956330.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium vanbaalenii PYR-1]MELGRWRGTARLATALAHLALLGAAVVGVLSIDGGAESAPPGPGSSAATA
AARPAGLAISPTPGAVNVEPVGSVEVSALGGHLGEVSLVNEDMEAVPGEM
SADGTTWRPKVPLGYGRTYTLEAVGGGDAAPVRAATTFTTVVPRQQAAVS
LTTTSGAMLRDGAVYGVGVVVVASFDRDVPDRAPAERALTVDTDPRVEGS
WYWLDDHTAHWRPRQYHAPGTTVKVSADVYGIPLGDGVYGAEDQHVRFRI
GDSHVSIADDDTKQIQVYENGRLVRTMPTSMGKGGTQTIGGTTLAFWTQR
GVYTVMDKSDQVVMDSSTYGLPLDVGYRLTVNNAVRLSHNGIYLHQLDST
VWAQGNTNVSHGCLNLNADHARWFYEFSRPGDVVEVRNTGGDPLPLWQNG
DWSVSWDRWLQGSALS
120406500YP_956329.1 DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]MSGSRRESVVKDLVFIGGLLILAVALIVYLVMGSEEVSDAASQPMSPQVS
APESNAPGGQVDAVTALSVERRTTGDPLAQGDPAAPVVMVMFADYRCPFC
AKFSRDTEPDLVERFVDQGVLRLEWRDMPIFGEQSMRAARAGRAAAEQGK
FWEFNHEVFAMSPDRGHADLNEDALVGFAEKAGVPDIDKFAASMRGNEFD
AAIDADLAQGSSIGVPSTPAFVINGEPVLGAQPTEEFVRVIDEAKDRT
120406499YP_956328.1 cytochrome c biogenesis transmembrane protein [Mycobacterium vanbaalenMTGVGIFGAFLGGLASLLSPCSALLLPSFFAYAFDRVQRLVQRTTAFWVG
LCVVLVPLGAGVSALGGALTRYRGEVTMIGGVVIIGMGLMTVLGRGFALS
SAQRLFARIRISTTMSVIALGALYGLAGFCAGPLLGGVLTVSAMGGDPVL
GGTLMAVYALGMAAPLFVLALLWKRFDLSRRGWLRGKSVKWGPVHTHSTS
LVSGVILVVIGTVFLVTDGTANLGGVLGVDEQFDLQVWLRVMGTSAADPI
VLLGVVGASLAWRGHRLWRRRSESDESVTVSGGGGS
120406498YP_956327.1 CopY family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MGLRQFGELEAVVMDLLWSREGASTVRSVYDELRGSRQIAYTTVMSTMDN
LFRKGWLERDKVGLAYHYRPAMTREEHSANLMRTVFESGGDGELILNFFL
EQIGEDDSAKLRQAIRRSTRKGSR
120406497YP_956326.1 peptidase M56- BlaR1 [Mycobacterium vanbaalenii PYR-1]MNAVTVLLAYAVALSWFAPALLTASASAGAHPRLAVAGWIAAVGSALSAW
AGAVVILVVGAVHAVVTRSALTFCVETLGLTSAVHLPSSTATALVVVLLI
ATSAVALYTVRRVVMALIRGRRRNVEHAEAVSIVGRPTEHPGVVEISARQ
PTAYCVSGGGRSVIVMTTAVRDLLDEDGMAAVLAHERAHLRGRHHHVIAV
LNALAAALPRLPLMRRAAREVAALLEMCADDAASREHGRTHLLNSLALLS
TGDRLPEGALAAAGTAVLDRLLRLAQPPATSWWRPHVAVFAVMAACGVPI
AALSLCVY
120406496YP_956325.1 hypothetical protein Mvan_5554 [Mycobacterium vanbaalenii PYR-1]MVLRSATQRISPAYESARRATLIRWLRAGAVGLTAMLLMAVPTDVINTPW
FSREVPVRWWEYPTLIAMGILTTVWMGIATSRRGAGTAVSGVTLATFAIG
CPVCNKLVLAAVGTTGALGLWAPVQPILATVSVTLMTAAVAWRWRQRPCA
AGQCGSVHAE
120406495YP_956324.1 hypothetical protein Mvan_5553 [Mycobacterium vanbaalenii PYR-1]MKQVLRDLWETRTDSPFPGLTTHAYLWTPANILFYSPATDAQFNELTELG
GVNDQYLSHRDEAGPMLARIAERFGSTLHAPAADLADIGKHAHVDVPLKG
RYVDYNGVEIIPTPGHSPGSVSYLVSGADGRYLFTGDTLFRNPDGHWWAG
YIEGFHQPGDADTIAESLRTLAEVSPDFVISSAFQGNSAVHRVEPDLWRG
HIAHAIAGLPTSARR
120406494YP_956323.1 hypothetical protein Mvan_5552 [Mycobacterium vanbaalenii PYR-1]MKSQSHPAEPHLGSVASKLNWLRAGVLGANDGIVSTAGIVVGVAAATAER
GPILTAGIAGLAAGAVSMALGEYVSVSTQRDTEKALLGKERQELRDDPAA
ELEELVALYEAKGISAATARTVAEELTEHDAFAAHAEIELGITPGELTNP
WQAALSSALSFTVGALLPLIAILLPPTTWRVPVTVISVLIALVITGAVSA
GLGGAPKQRAVLRNLIGGGLALMITYGIGHLVGAAVT
120406493YP_956322.1 transposase- IS4 family protein [Mycobacterium vanbaalenii PYR-1]MFSTHLSTQLRKALPVQVSHKFAASSAVFDDDHLVSCAGLVPVMTLAAQT
GLAQLLAAKVRITEPRIKSGSANPAPKLTTVVAGMCAGADCIDDLDLVRS
GGMKTLFDGVYAPSTIGTLLREFTFGHARQLESVLREHLAGLCERVQLLP
GSDERAFVDIDSLLRPVYGRAKQGASYGHTKIAGKQILRKGLSPLVTTIS
TETAAPVITGARLRAGKTNSGKGAARMIAQAVATARASGVTGQILVRGDS
AYGNSAVVAACRRAGARFSLVLTKTAAVAAAIESISESAWVPVKYPGAVR
DPDTGAWISDAEVAETTYTAFSSTKTPVTARLIVRRVKDARFLDALFPVW
RYHPFFTDSDEPVDASDITHRRHAIIETVFADLIDGPLAHMPSGRFGANS
AWILCAAIAYNLLRAVGVLAGGVHAVARGATLRRKFVNIPARLARPQRRA
ILHLPTHWPWAQQWLTLWRNTIGHSPPTAATH
120406492YP_956321.1 ATP-dependent DNA ligase [Mycobacterium vanbaalenii PYR-1]MQLPVMPPVSPMLSKSVDTIPDGASYEPKWDGFRSILFRDGNEVELGSRN
ERPMTRYFPELVEAARAELPPRCVVDGEIVVATGGGLDFEALQLRLHPAA
SRVRMLAEKTPASFIAFDLLALDDTDYTARPFAERRAALVGALAGCGPTF
HVTPATLDVATARRWFDEFEGAGLDGVIAKPLDGHYLPDKRVMFKIKHQR
TADCVVAGYRLHKSGPDAVGSLLLGLYDDDGSLASVGVVGAFPMARRREL
VTELQPLVTTFDGHPWNWAAQVDPDTVRRYGGGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGQRFRHTAQFNRWRPDRDPLSCTFDQLDRPLTFSLDDIV
PGLGGTRPRG
120406491YP_956320.1 hypothetical protein Mvan_5548 [Mycobacterium vanbaalenii PYR-1]MAENPLLSPCAGGRRHPDELGHQRIRFTRPARHNDLAGRYPLDGHGDQTC
AHRAPPVRRGRIDRTSSARRADEGLSGCEILRRHRLAARQRMLSWHHQHP
RLLVEHGDPGVVHRNEQRVPSHQHVNRTFSEGPLLVAHPMGRLGEPEEIA
KAIG
120406490YP_956319.1 nitroreductase [Mycobacterium vanbaalenii PYR-1]MAKMLDICLRVLYTIDMPHPTDDVWEVLSTARSIRRFTDEPVTDAVIDRC
LEAATWAPNGANAQLWRFIVLDGPEQRAAVGKAAQIALTSIEAIYGMTRP
DDDDASRAARNNRATYELHDRAEEYTSVLFTAFKNEFSSEFLQGGSIYPA
IQNFYLAARAQGLGACLTSWASYAGGGQVLREAVGIPDEWFLAGHIVVGW
PRGHHGPVRRRPLTDVVFRNRWDPERADITYGRGARPRGKS
120406489YP_956318.1 hypothetical protein Mvan_5546 [Mycobacterium vanbaalenii PYR-1]MFGSVFAGLEESALIAVIEQCAREEAQAGAHKSAAIAQLVSSTVSWDDEH
DDWVYDCWAQTASELGAVLSLGQRRASGQMRIAIALRDRLPRLAERYLQG
RVSAQVVSKICWRTRLVVDSQVWALLDGELATQAQRWGSLSEEALVRAID
ALIERYDSDAVIRAREHVSGLDFRVGASDDPDALVMVWGKILGCDAAVLA
ARIAELLKGLCDNDPRSVCVRRSHAVGAIVRGQDHLRCRCGSPDCTASAA
PAPGSSNVVISVLADPAALDAVRQLIAAEDREQQDKLADKQAKAKEQGKA
ESQPQTEPIPQAEAEVEVEVEVEPEPEPEPAIESEPAPVKPVAPSNPAAC
VRDSGVALLPGVKVLPIVALAEAIRAGAAIKTLWLPGPDPEPHYRPSTKL
AAFVRARDLFCRYPGCDVPAEHCDLDHVVPYPYGPTHPSNLNCKCRTHHL
GKTFAEGWQEQQLPDGTVLWTTPAGQRCTTVPGSWLFFPGWDTTTAELPP
MAQPPPDPDRLAKMPKRRRTRAAEEAARIKAEREHNALQRALERKQALGQ
QPRSVAAQRIRQDYGAEPPPF
120406488YP_956317.1 hypothetical protein Mvan_5545 [Mycobacterium vanbaalenii PYR-1]MAFPGYTGLREYGNHGPARWAAELISAAGEFMAYGPSHWSVIAVFAVGAM
LLIWLGRRQTETGARRFGRIGGALTALIYLGASVNALIPPGIDWSVPLHL
TDLATLVAAYALWSQRQWAFALTYYWGLVLSLQALISPVLTGPDFPHYQF
LGFWAIHLLVVWAAIYLTWGRRMRPTWRSYRLALTVTAVWATITIAFNSI
AGTNYGFLNRKPANASLLDLMGPWPVYLLVGFTLVAAVWALMTWPWSLVR
RPM
120406487YP_956316.1 hypothetical protein Mvan_5544 [Mycobacterium vanbaalenii PYR-1]MSNHFTGLSLGPPLGDQRLDLCDLYAFQSPTDNSRTVLILNANPTAEALH
PDAVYRLAIDTDGDLVNDVAFSFIFSTPVDGRQTVDVFLARGEQSRSPEP
VGEQIFTDVDVSFGSQPNVVTAGDITFAAGSRSDAFFFDFDGIKNLFDIS
GKRNFTAPHLAELGGKTPWTGLDSNTTANVFSIAIELPTNTLDAKGPIRI
WGRCSLRENGTLVHVDRAGHPSVSSFFNTDDTKLEYNASEPSNDWNRWLD
QFVHLLGHTGHYTREDAIAAIEKEGTLPDMLTFDPAKPAQYPNGRVFTDD
VIDYRLAFLTQGECPPSGLSPHTDTLTEFPYLGPPHTP
120406486YP_956315.1 ATP-dependent DNA ligase [Mycobacterium vanbaalenii PYR-1]MEPMPLSADLPVMPPLEPMLAKAQTKVPDEPGMWSYEPKWDGFRALVFRD
GGPGRDNVVLLSRSGKDLARYFPEVLDSVRDELAPRCVLDGEIVVPREIA
GRTRLDWESLSQRIHPAESRVRMLAEQTPAHFIGFDALAVGDSSLMKEPF
RTRREALVDAVNEKQWCHVTRTTEDPALGAQWLQEFEGAGLDGVIAKRLD
GPYLPGKREMVKVKHHRDADCVAIGYRIHKSGEGIGSILLGLHRDDGELQ
MVGGAASFTAKARLKLLADLEPLRIGDDVRDGEPSRWNSAADKRWIPVRP
ERVCEVAYDQMEGNSANGRRFRHAVKFLRWRPDRDPASCTFDQLDVPLNY
DLNDVLERS
120406485YP_956314.1 hypothetical protein Mvan_5542 [Mycobacterium vanbaalenii PYR-1]MPSPATEIDVDGVKVRLTSPDKPYFPKLGKDGTKGKLFEYYLAVADRMVA
LLRDRPVHLQRFPDGIDGEEIYQKRVPQKHPDYLHTCTVTFPSGRTADAL
KITHPSAIAWAAQMGTVTLHPWQVRCPDIEHPDELRIDLDPQPGTGFIEA
RSVAVDVLKPLLDELGLVGFPKTSGGRGVHVFLRIATDWDFIAVRRAGIA
LAREIERRAPDAVTTSWWKEERGARLFVDYNQNARDRTFASAYSARKTPI
ATVSTPLTWEELRTAEPDDYTILTVPDFVAGRPDPWAGIDDTAQSIDTLL
EMVKADEERGLGDLPYPPSYPKMPGEPPRVQPSKKVAANWDEDGNRVGE
120406484YP_956313.1 hypothetical protein Mvan_5541 [Mycobacterium vanbaalenii PYR-1]MPIATLRKLLAALAIVGILLSGIGVATMMIFGSRGQQQEAVTPVRKPPTP
PPPSVPTDKEFLIGVVVTAQNCDPAGPCFYTYTIDPKYVGLHPFPESPFT
VEYEVLGGHQPQPGKFTVAGDQAEILKDVVLEGPPGAQLSARVLRVFEEP
PAPAAEPPPGPAAEPPPGPAAEPVPAP
120406483YP_956312.1 thioesterase [Mycobacterium vanbaalenii PYR-1]MTQPQRSRWMRNFHPSPTARIRLVCFPHAGGSASYYFPLSSALTPEFDVF
GVQYPGRQDRYSEPFVETIDELADQAHAALSALPDAPLAFFGHSMGAVLA
FEVARRCETLSGRQVVTVFASGSRAPSRYGDERNAKSDTDLVGVMRELGG
TDPRVLENPELLATFLPAFRNDYRALQAYHRGTDIGISAPIVVMTATDDP
KTSETDARAWHEHTSGGGEVHTFTGGHFYLEKQPQRVIEVVSATLRSVG
120406482YP_956311.1 hypothetical protein Mvan_5539 [Mycobacterium vanbaalenii PYR-1]MSLRGWLLFTAMGVIWGIPYLLIKVAVEGLSVPVLVFARTAVGALVLIPL
TLRRGAWAPVLAHWRPVVAFAFFEIIAAWLLLSDAERHITSSLTGLLIAA
APIVAALLDRLTGGDQPLTVKRLAGLGTGLAGVAVLAGPELAGGSAWPVT
EVLLVAVCYAIAPLIAARYLAEVPAMPLTAACLGLAALIYVGPAAATWPA
EIPSMRVLTAVALLAVVCTSLAFILFFALIREVGAPRALVITYVNPAVAL
AAGVIVLNEPLTARHLLGLAMILAGSVLATRRPVEPMQAAPR
120406481YP_956310.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MPNTASYRVVQWTTGNVGKSSVAAIAGNPTLELVGCYAWSDDKVGRDAGE
LAGIEPVGVTATNNVDALLALKPDVVVYNPMWIDVDELVRILEAGVNVVA
SASFITGRNLGDGRDKLADACQRGGSTLFGSGVSPGFAELLAIVAGTACD
RIDKITIAESADTTLYDSPDTERPVGFGTAIDDPNLQPMAANGTAVFAEA
VQLVADALAIELDEIKCVSEYAQTTEDLVMASWTIPAGHVAGVYASWQGI
ANGKTVIDINVRWKKGQTLDPDWQLDGDGWKITIDGRPTVNMQVGFLPPQ
DMIENAKTLEDFFVLGHIMTAMPPIHAIPAVVAAAPGIATYNDLPLPTPR
GVVPTA
120406480YP_956309.1 PDZ/DHR/GLGF domain-containing protein [Mycobacterium vanbaalenii PYR-MIRRHRILPIALAAVLALVAPLTPAVAAPGDPVAASVQVEPAVVRIDTEV
DYQGVVGLGTGIVLDPAGQVLTNFHVVQGADRITGTVAGRAYPAQLVGYD
RKRDVAVLQLIGANGLAAAPIGDAYALVPGQPVVALGNAMGTEAPLTREV
GTLTGFGRTVQAEDTLTGTSDELTGLFEFAAPVRAGDSGGPVVNDLGQVV
GITTAASVNFRMGPGGKGFAIPINDAMGVAGQIRGGIRSDSVHIGPPTLL
GVGVRTAPRDEPGVLIQEVMVGGPADLAGLRAGDILIELDGTPLDSTNTL
TSVLDRHYTGDVLDLTWVDSTGVTRDGKAVLTPTV
120406479YP_956308.1 hypothetical protein Mvan_5536 [Mycobacterium vanbaalenii PYR-1]MGRTVAVIWHASFSIAAGVLYFFFVLPRTPELVGDTSPTLGTVLRVVVGA
LIGLAALPVVFTLLRTRRPEFGTPQMALNLRTTSIALHVLSGVLIVGAAV
AEIWISLDSAGQWLFGIYGAAAAVALLGVLAFYLAFVAELPPPPPKPLKV
KKRKSRRGRSDAAEDTETADAETADAEVEETETADAETESVTPDADADAD
ADAEEPVPTAEDDPASDTPESGDGKLQNRRPTGKGAVLGRRKRTRGGVAV
ED
120406478YP_956307.1 GntR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSFHSLGRDELRAQHDEQQRNYAELQAKNLRLDLTRGKPSPDQLDLSNGL
LELPGADAFRDAEGTDTRNYGGLHGLPELRTIFSELLGIPVPNLIAGNNA
SLEFMHDVVVYSLLHGGVDSPRPWIDDLRNGAGVKFLCPAPGYDRHFAIT
ESLGIEMVPVPLREDGPDVDLIEELVAVDPAIKGMWCVPVYSNPTGTTYA
WETVRRLVQMETAATDFRLMWDNAYAVHTLTHDFVKQVDILGLAAAANHA
NRPLVFASTSKITFAGAGVSFFGGSLGNIAWYLQHAGKKSIGPDKVNQLR
HARFFGDADGVRLHMQRHQQLLAPKFALALEILEDRLGDSKIASWTEPKG
GYFISLDVLPGTAKRTVALAKDAGIAVTEAGASFPYRKDPEDKNIRIAPT
FPALSDLREAIDGLATCALLSATEQLLALPAEK
120406477YP_956306.1 DNA polymerase III subunits gamma and tau [Mycobacterium vanbaalenii PMALYRKYRPATFADVVGQEHVTEPLSTALNSGRINHAYLFSGPRGCGKTS
SARILARSLNCAEGPTATPCGVCDSCVALAPNGPGNVDVVELDAASHGGV
DDTRELRDRAFYAPAQSRYRIFIVDEAHMVTTAGFNALLKIVEEPPEHLI
FVFATTEPEKVLPTIRSRTHHYPFRLLAPKTMRTLIEKIVASESVRVDDA
VYPLVIRAGGGSPRDTLSVLDQLLAGAEDDHVAYQRALSLLGATDVALID
EAVDALAADDAAALFGAVEGVVDAGHDPRRFATDLLERFRDLIVLQAVPD
AAARGVVDGPEDVLERMREQAARLGTATLTRYAEVVHAGLGEMRGATAPR
LLLEVVCARLLLPSASDTEAALLQRVERIETRLDMSIPASDEISASAPAV
PRKQFVRKSEAAPQPAPSAQAPAPARAPEPSPEPTPVPAREPDPVPEPPR
EASKPVEPEPVPPPLPPPPPVRPPAAPVVEAPATTPAAAVATGEPSAAAV
RSMWTTVREKVRERSRTTEVMLAGAIVRAVEGDTLLLSHESAPLAKRLSE
QRNADVIREALKDALGVNWKIRCDPGTAPASAAAPAREPQRGPAEPPPPP
DIDDEESMLAEAGNSDPAAPRRDPEEAALELLQNELGARRIDG
120406476YP_956305.1 hypothetical protein Mvan_5533 [Mycobacterium vanbaalenii PYR-1]MIRFLLRVAVFLGSSAIGLLVAGWLVPGVSLSVLGFVTAVVIFTVAQGIL
SPFFLKMASRYASAFLGGIGLVSTFVALLLASLLSNGLSIRGVGSWIAAT
VVVWLVTALATVVLPVLVLREKKKAA
120406475YP_956304.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium vanbaalenMTTFRDGAADTGLHGDRKLTLAEVLEVFASGRLPLKFTAYDGSSAGPDDA
TLGLDLLTPRGTTYLATAPGDLGLARAYVSGDLQLQGVHPGDPYDLLNAL
VQKLDFKRPSARVLAQVVRSIGIEHLKPIAPPPQEALPRWRRIAEGLRHS
KTRDADAIHHHYDVSNTFYEWVLGPSMTYTCACYPHPDATLEEAQENKYR
LVFEKLRLKPGDRLLDVGCGWGGMVRYAARHGVKAIGVTLSREQAQWARA
AIERDGLGDLAEVRHSDYRDVRESQFDAVSSLGLTEHIGVANYPSYFRFL
KSKLRPGGLLLNHCITRHNNRTGPAAGGFIDRYVFPDGELTGSGRIITEI
QDVGLEVMHEENLRRHYALTLRDWCRNLVQHWDEAVAEVGLPTAKVWGLY
MAASRVGFEQNSIQLHQVLAVKLDERGGDGGLPLRPWWTA
120406474YP_956303.1 FAD linked oxidase domain-containing protein [Mycobacterium vanbaaleniMSVPSTDARSAHADGVQRLLASYRAIPQDATVRLAKPTSNLFRARAKTRT
KGLDTSGLTNVIAVDAEARTADVAGMCTYEDLVAATLPHGLSPLVVPQLK
TITLGGAVTGLGIESASFRNGLPHESVLEMDVLTGTGDVVRASPDENPDL
FRAFPNSYGTLGYSVRLKIELEPVKPFVALRHLRFHSLSALIEAMDRIVE
TGGLNGEPVDYLDGVVFSAEESYLCVGQRSATPGPVSDYTGKQIYYRSIQ
HDGPTDGAEKHDRLTIHDYLWRWDTDWFWCSRAFGAQNPRIRRWWPRRYR
RSSVYWKLIGYDRRFGIADRIEKRNGRPPRERVVQDIEVPIERTVEFLQW
FLDTVPIEPIWLCPLRLRDDRDWPLYPIRPHHTYVNVGFWSSVPVGPEEG
YTNRMIERKVSDLDGHKSLYSDAYYSPEEFDSLYGGETYKTVKKTYDPDS
RFLDLYGKAVGRQ
120406473YP_956302.1 hypothetical protein Mvan_5530 [Mycobacterium vanbaalenii PYR-1]MGQVSATSTVLIEADPATVLAAVADYQAMRPKILSAHYSGYRVLEGGQGA
GTVAEWKLQATKSRSRNVKADVDVAGRTVIEKDANSSMVTNWTVAPAGPG
SSVTVKTSWQGAGGIGGFFEKTFAPLGLRKIQAEVLGNLKREVEGTIGIE
GTQG
120406472YP_956301.1 cell wall hydrolase/autolysin [Mycobacterium vanbaalenii PYR-1]MPAILRVGAAVVAAMLVATTPAGPAQAAPANIAGMIVFLDPGHNGSNDAS
ISRQVPTGRGGTKDCQASGTSTEDGFAEHTFTWDTTLRVRQALTALGVRT
AMSRGDDTGLGPCVDERAAMANALSPNAVVSIHADGGPATGRGFHVLYSS
PPLNAAQAGPSVQFAKVMRDQLAGSGIPPATYIGQQGLNPRSDIAGLNLA
QFPSILVELGNMKSPVDSALMKTPEGRQRYADAVVRGIVAFLSSQR
120406471YP_956300.1 hypothetical protein Mvan_5528 [Mycobacterium vanbaalenii PYR-1]MQPGGQPDMSALLAQAQQVQQQLMEAQEALANAEVNGQAGGGLVQVTMRG
SGEVVAVRIDPKVVDPSDVETLQDLIVGAVADAAKQVTILAHDRLGPLAG
GMGGLGLPGM
120406470YP_956299.1 recombination protein RecR [Mycobacterium vanbaalenii PYR-1]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNKVR
DGVTFCAVCGNVSDEERCRICGDARRDASLICVVEEPKDVQAVERTREFR
GRYHVLGGALDPLSGIGPDQLRIRELLNRIGERVDGVEVAEVIIATDPNT
EGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRR
AMA
120406469YP_956298.1 hypothetical protein Mvan_5526 [Mycobacterium vanbaalenii PYR-1]MPGMGEVILGGEAVRAGVVTRHELARWYTPLYRGVFVRKGVEVTLRDRAV
GAWLATGRKGVIAGLAAAALHGAAWIDADIPIEVAGVKRRSHAGLITRSE
VIATDEIVRRAGLPVTSRTRTAFDLGRQLDRAEALARLDALMWNQPFSID
EVAELADRRPRVPGVGQLRDLLPLIDGGAASPRQSRLRLWLLDCGFPRPQ
TQIPVLEGSRPVAFLDMGWPEYQVAVEYDGDHHRKNRDQYVKDIARLRML
EALGWIVIRVIAEDRPAHWLERTEAALQSRGCRLAATELQLFVRTLAA
120406468YP_956297.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MRSRPAVWLRWATVHGVPRAFLTVRARRGEPLARLILGRGDRLALIEEIR
AAGPLMRTPVVWATADYDVCRTVLRDNDFGVADPSETGLPDALLGLIRRV
DPGLPNPVEPPAMLMTDPPQHTEYRKLVSRSFTPRSIAALDTRIGELTAE
LLDDLGRRREVDLIADYAAQLPAAVISRMLGVPDEDRARILGWGETGAAL
LDIGIGWRPFRAAIDGLVDVDTHLGAHFRRLHQNGADGTPFSSLALDGSL
SGRELISNAALLVGAGVETTVNLIGNGIAALLDHPDQLALLRDDPGLWPS
AVEEILRYDSPVQMTARTAHRDTEIAGVGIRKGAVIVMLLGGANRDPKVF
DRPQTFDITRANARDHLAFASGIHVCLGAALARIEGATALRELFTRYPDL
HLTAPAEPRDLVTLHGYRHLPVRLGRAATATRRAS
120406467YP_956296.1 hypothetical protein Mvan_5524 [Mycobacterium vanbaalenii PYR-1]MTWSQLHERMAFMADMVERATTDPDGALNSAAGSDDVQRLFGDEEGLLLS
LRHRWVNMLAAKLDQAAQDDRSADQVRADLAAANPGLRALLDAAARRSVR
VRALDRGEQHMVDIYAGPRPDNQTVA
120406466YP_956295.1 integral membrane sensor signal transduction histidine kinase [MycobacMMPGGFSWPIVVSIDVTLFIVSAVAILQRPESQWWIAILGLAVAYSPYLV
FFAVDISVSPAVEALALGLAWMLAISIWLFGMSAPIEGDFAPVLLGLVTG
VIGSMTSMRGGMLAAVTAAGILGAAVAMDRVDTPWLYLSFIGIGWLVGYL
MRIQQELLLEQREAQQKLAEHAAVDERRRIAREVHDVIAHSLTVTLLHVT
GARRGLQEDRDVDEAVEALEQAERLGRQAMADIRRTVGLLDDAVGKVTPE
PGVGDIAMLVDDFVRAGLAVRFESSGRHDRISGAAGLALYRIAQESLANI
AKHAPDAVSELSLTVSPSEAVLTVTNRLPVPVAAANCADGRGMRGMRQRV
QQLGGTVNAGPDGDGWVVHATIPLDDESCVLRGCGG
120406465YP_956294.1 two component LuxR family transcriptional regulator [Mycobacterium vanMTDGVIAALLVDDQELVRSGLRRILRRKDGIAVVGECADGDEVPAAVAAY
RPDVVVMDLRMKRVNGIEATRRLTAAGGPPVLALTTFSDEELLSGVLRAG
ASGFVLKDSPAEELIRAVRAVARGDGFLDPSVTARVLDTYRTAAEEPVPE
AVDDLTPRELDVLRLMAKGRSNSEIADELVISGVTVKSHIGRIFLKLRLR
DRAAAIVYAYQKGIVAPRA
120406464YP_956293.1 glutamine amidotransferase [Mycobacterium vanbaalenii PYR-1]MSESTVRIGLVLPDVMGTYGDGGNSVVLRQRLRMRGIDAEIVEITLDDPV
PAELDLYTLGGAEDYAQRLATKHLIRYPGLQQAISRGAPVLAICAAIQVL
GHWYETSAGERVDGVGVLDVTTSPQSERAIGEVAGTPLVDGLTDPLTGFE
NHRGGTVLGPDARPLARVTKGVGNRAGDGFDGAVQGSIVATYLHGCCLAR
NPQLADHLLAKVVGPLAPLHLPEVSQLRRERLAAPRRV
120406463YP_956292.1 hypothetical protein Mvan_5520 [Mycobacterium vanbaalenii PYR-1]MPCSITPRVGPSSKLPGMVTPRGRIALAAGAGARWASRVTGRGAGAMIGG
LVAMTLDRSILGQLGRGRRTVVITGTNGKSTTTRMTAAALATVGPVATNA
EGANMDAGLVAALAAAPGAPLAALEVDEMHVPHVSDAVSPAVIVLLNLSR
DQLDRVGEINHIERTLRAGLARHPSAVVVANCDDVLMTSAAYDSPDVVWV
AAGGGWASDSVSCPRSGEIIVRDGAHWYSTGCDFKRPTPDWWFDDTHIHG
PDGLTLPMTLTLPGTVNRGNATQAVAAAVVLGADPAAAVAAVSAVDEVAG
RYRTVQIGGHTARILLAKNPAGWQEALSMVDRDAAGVVIAVNGQVPDGED
LSWLWDVRFEHFESVPVVAAGERGTDLAVRLGYAGVEHTLVHDTVAAIAS
CPPGHVEVLANYTAFLQLNRVLDRV
120406462YP_956291.1 DNA polymerase III subunit epsilon [Mycobacterium vanbaalenii PYR-1]MSSTAGSRWGRPADQPGAGWAVVDVETSGFRPGQARIVSVAALALSDDGN
VEKSLYSLLDPGVDPGPTHVHGLTAEMLAGQPAFGDVVGDLIEVLRGRTL
VAHNVGFDYSFLTAEAEMVHAELPVDTVMCTVELARRLDLGLDNLRLETL
AAHWGVTQMKPHDALDDAMVLAQILKPVLVRAQERRKWLPVHPVSRRTWP
NGRITHDEFRPLKALAARMPCAYANPGVFVAGRPLVQGMRVALSAEVGHT
HEELVERILHAGLAFTEVVDGHTSLVVCDDPAPEQGKGYQAGGFGVPTLG
SAEFLRHLDTVIGGSAIEEFADQASAGDQFTLF
120406461YP_956290.1 response regulator receiver protein [Mycobacterium vanbaalenii PYR-1]MSETAVFAGRRDGTPVYAYPRRRPQAPVSVLELGPDAPPVRTTHIHEFPV
LVYQPATGSVDVVAAGLPVDPGRGGDRTGAVAVFFDPAALGEGARSPWPT
WRAHPLLSPFLHGHHDGILRLEVPAARRPFWDAGVAALQAELTDRRDGYA
QAALAHLTVLLIELARLSDDVVGDLRRSNEPLLAQVFDVIERRLGEPLTL
RDVARECGLTAGYLTTVVRRRTGRTVGSWIAERRMAEARALLLATELTVG
EVGRRVGMTDPGYFTRQFRSCHGESPRTWRARHG
120406460YP_956289.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MVSMDHMTENPPHPVARTWGNRHDYLPAAGRDFFLPAYDLLVRLLGTYPL
YDELVTQAELAGELDVLEIGCGTGNLTARALRAAPSARITATDPDPRAVT
RARRKAAGEGPVRFETAYAQELPFADASFDRVLSSLMLHHLDDGTKVSAL
AEAWRVLRPGGRLHIVDVGGADQPEGLMSRLTGHRHAAAGARLPQLVEAA
GFDTTVVATRRLRVFGPVSFIRATRPGE
120406459YP_956288.1 choloylglycine hydrolase [Mycobacterium vanbaalenii PYR-1]MSERCPTVLDVCTRVVYLGTNDRVVTGRSMDWKVEIGTNLWVLPRGIRRA
GQAGPDSLEWTAKYGSVVATAYDICSTDGVNEAGLAANLLWLAESQYPAD
DAGGPAVALSLWAQYVLDNFATVAEAVAALTANPLRVATAEVPGQQRMAT
LHLAMSDASGDSAIVEYIDGRQTIHHDRSHQVMTNSPTFDKQLAITEYWE
EIGGTVMLPGTNRAADRFVRAAFYINAVPKCDDPVLAVAAVFSVVRNVST
PYGIATSDEPNISSTRWRTVVDHKSLRYFFESALSPNTFWVDLKNLDFSV
DAPVRRLELGEGEKTIYAGDTSAQFQPAEPFAFLAVP
120406458YP_956287.1 2-isopropylmalate synthase [Mycobacterium vanbaalenii PYR-1]MTENYSPSADAYSSVRTITTPAGPPNPGQPSWNTQRGSSMPVSRYRNFAA
EVPGGAPAAPFDRTWPDKVIDTAPLWCAVDLRDGNQALIDPMSPARKRRM
FDLLVKMGYKEIEVGFPSASQTDYDFVREIIEQGAIPDDVTIQVLTQCRD
ELIERTFEACDGAPNVIVHFYNSTSILQRRVVFRADRDEIKKIATDGARK
CLEEAGKHPGTRWRYEYSPESYTGTELEYALDVCNAVSEVIEPTPDWPLI
VNLPATVEMATPNVYADSIEWMSRNLARRGSIILSLHPHNDRGTAVAAAE
LGYQAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEI
RRTVEYCNQLGVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKISADEQD
SDVDDIVWQVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKADHGLA
LPRRLQIEFSQAIQQITDGEGGEVSPKEMWDAFYDEYLAPITPLERIRQK
VDASEVDGGTDTITAVVKVNGEEHEIVGAGNGPLAAFVDAIGAVGFHVNV
LDYSEHAMSAGEEAAAAAYVEAEIDGKTVWGVGIATSITTASLRAVVSAV
NRAMRTRPSLLR
120406457YP_956286.1 XRE family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MALPEDPADPGPLLRNTSGTARDRDPAAPVEELEIEAAIGRNVRLLRLQQ
GLTVAETAARVGISKAMMSKIENAQTSCSLSTLALLAKGFDVPVTSLFRG
ADVERPAAFVKAGTGARIVREGTREGHEYQLLGSLRGEHKRLECLEVTLS
GKSQTYPLFQHPGTEFIYMLEGVMDYSHSRTVYRLHPGDSLQIDGEGAHG
PVDLVEVPIRFLSVIAFPDSQV
120406456YP_956285.1 FAD dependent oxidoreductase [Mycobacterium vanbaalenii PYR-1]MTETADVVIVGGGLEGAAAAWALSRRGVTDVVVAERNTVGSGMTGKSSGI
VRCHYGVSSLAAMAADGLEVFENGEDIFGTDIGFRQTGYVVGVGEQNVES
LRKSLAAQRAVGVDTEEIDKDEVAKLWPFADLTPFAAFGWEARGGYGDAY
QTAQAFSTAARAAGARVRQGTAVTDLLVDGDRVTGVRTADGSEIFAGTVV
VATGVWTRPFLARYGIDVPIRVIREQIVLIDPGVEVGKVPVFSDLVSLQY
VRPEVGGEILFGNSDLPGYDAIDPADPDDYLNRATDGFVDLTVDKVGTRF
PGFPDAAISGSYAGCYDVTPDWNPIISVAPLDGLVIAAGFSGHGFKIAPA
VGRLVADIVVDGHSSDSRIPASDFRFSRFAEDDPLKTPYPYVGAGQMR
120406455YP_956284.1 ferredoxin-dependent glutamate synthase [Mycobacterium vanbaalenii PYRMSYSSDDRARLGLRESATFDRATIAAIQRAADTGIYDIRGWGAKRPLPHF
DDLLFLGASMSRYPLEGYRERCATDVVLGDRFAKHPLHLDIPVTIAGMSF
GALSGPAKEALGRGASEVGTSTTTGDGGMTPEERGQSKYLVYQYLPSRYG
MNPEDLRKADAIEIVLGQGAKPGGGGMLLGQKISERVAGMRTLPEGIDQR
SACRHPDWTGPDDLTIKINELREITDWEKPIYVKVGASRTYYDVKLAVHA
GADVVVVDGMQGGTAATQEVFIEHVGIPTLAAIPQAVQALQELGVHRKVQ
LIVSGGIRNGADVAKALALGADAVAIGTAALIALGDNHPRYAAEYEKLGS
AAGFFDDFQDGRDPAGISTQDPELAARFDPIAGGHRLANYLRVLTMEAQT
IARACGKSHVCHLEPDDLVAVSIEAAAMARIPLAGTDWIPGRNGGAW
120406454YP_956283.1 glutamate synthase subunit alpha [Mycobacterium vanbaalenii PYR-1]MEQMRTFDLRTTPLREVNTALHAADLTGDFLIEHPAGAHNVAVGLSAPVK
VTIDGHVGYYAAGMNQHADVIINGNAGTGVAENMMSGSVWVKGDASQSAG
ATAHGGLLVIEGNAAARCGISMKGVDIVVGGDVGHMSAFMAQAGRLVVRG
DAGEALGDSIYEARIYVRGDVASLGADCVAKPMRDEHHSELEKLLKAAGF
EGDDTRSYTRYGSARSLYHFHVDNASAY
120406453YP_956282.1 glutamine amidotransferase- class-II [Mycobacterium vanbaalenii PYR-1]MCGIVGLHLRTPELYPRLGELLTGMLCEMGDRGSDSAGVAVYGDPTWSPA
GRGCVSVADLGTGRTEDADQVAAAVAAALGGDVSGVGVDVSYVLSADVDS
EVLLAALRSAYPDALVAGFGSDMAVLKGVGHPRALTERWGLAKAQGWQGV
GHTRMATESAVTPAGCHPYAVGAGQCMVHNGSFANHATIRRELRAAGVPF
DSENDTEVGARFIARLLTEGRDVEGALKELCATFDGFYTLLVSNRDSFAV
VRDAIACKPAVIAETDEWVAMASEYRALAGLPGVEEARIWEPEPEVVYAW
SK
120406452YP_956281.1 glutamate--ammonia ligase [Mycobacterium vanbaalenii PYR-1]MAEDLATLAEQHGTKFILALFVDLRGKPCAKLVPVEAVDLLSTEGVGFAG
YAVGAMGQEPKDPDLMAIPDPASFTPIPFIKEGLAIVHCDPHVNGEPWPF
APRVILKSLIERCSDAGFEPWVGAEVEYFLLSRNDDGSIAVADTADTAAQ
PCYDARGVTRMYDHLAAVSTAMNQLGWSNYANDHEDGNGQFEQNFKFADA
LTTADRVITLRYLLSMIAAERGMIATFMPKPFGDKTGNGLHFHLSLTSGG
APVFPAEEDERGLGLSDTAYGFIGGILEHACALQAVVAPTVNSYKRTGAV
ATSSGASWAPRLPTYGGNDRTHYIRVPDSDRIEMRGGDGSANPYLAIAAA
LGAGLDGIKRSTDPGAVGQGVSTRALPLTLLHAVEDFEGDAVVTGALNAA
GEGVAAYFANIKREEFFAYHSTVGAWELDNYLTAF
120406451YP_956280.1 ammonium transporter [Mycobacterium vanbaalenii PYR-1]MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGSAALV
GVLWVLFGFSMTFGSSYGGFVGSFTEFAGMKNLTEPMTTIDGLPISLFSL
FQALFAAITVALISGAVADRMKFGAWMGFATLWAVLVYFPVAHWVFAFDG
VVTEDSVGGWIANKLGAIDFAGGTAVHINAGAAALAVAIVLGKSKNWGQL
RKPHNVPLTLLGAGLLWAGWYAFNGGSALAAGNSAAIVMVTTFVATCAAT
LAWIAVEKIKDGHVTGVGAASGAITGLVAITPACGAVTPVGAIILGAIAG
AICVYAVGLKERFGYDDSLDVVGVHLVGGVVGTLLIGFLASETMPNATNG
LFYGGGIDQLWKQAIAAGAVMAYSFAVAFAIAFILKKTVGIRISPDDEEK
GIDAAFHREASYEIQPA
120406450YP_956279.1 hypothetical protein Mvan_5507 [Mycobacterium vanbaalenii PYR-1]MIEPIRRHIVVNAPVERAFTVFTAQFGDFKPREHNLLAVPIVETVFEPRV
GGHIYDVGEDGSRCRWARVLDFEPPSRVVFSWDIGPTWQVESDASRTSEV
EVRFIPETPDRTRVELEHRHLDRHGEGWRSVADGVGGDAGWPLYLRRFGE
LIDR
120406449YP_956278.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MTTYQAADPWHAIADGTRRSIMRRLATGPCAVGELARDLPISRPAVSQHL
KVLKSAGLVSDRAHGTRRVYQLNPEGLETLRAELDRFWTQALVDFKDIVE
QPTQEER
120406448YP_956277.1 nitroreductase [Mycobacterium vanbaalenii PYR-1]MPAAPTDRLADTSVPIHPPIAERWSPRAFDPGADLDRDDLVALLEAARWA
PTWGRRQPVRFVVGLRGDAPFTTIAGLLRRGNSYAKAASALILLCTDDGE
DDRTQRYAAVDGGAAMANITIEAVSRGLIAHPMAGFDVAGASEAFALPDG
LRPVVVIAVGRLGDYADVAPEIAERDRLPRHRLPLSEVVLNWTP
120406447YP_956276.1 aspartate kinase [Mycobacterium vanbaalenii PYR-1]MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDEL
LDLAKQVSPAPPARELDMLLTAGERISNALVAMAIESLGAEARSFTGSQA
GVVTTGTHGNAKIIDVTPTRLRAALDEGQIVLVAGFQGVSQDTKDVTTLG
RGGSDTTAVAVAAALKADVCEIYTDVDGIFTADPRIVPNARRLDTVSFEE
MLEMAAAGAKVLMLRCVEYARRFDLPIHVRSSYSDNPGTIVKGSIEDIPM
EDAILTGVAHDRGEAKVTVVGLPDVPGYAAQVFRAVADADVNIDMVLQNI
SKVEDGKTDITFTCSRESGPGAVEKLTALQDEIGFTRVLYDDHIGKVSLI
GAGMRSHPGVTATFCEALADAGINIDLISTSEIRISVLIKDTELDRAVEA
LHDAFGLGGDEEAVVYAGTGR
120406446YP_956275.1 aspartate-semialdehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MVRIGVVGATGQVGQVMRTLLAERDFPATGVRFFASARSAGKKLGFRGQE
IEVEDASTADPSGLDIALFSAGATMSRVQAPRFAGAGAVVIDNSSAWRKD
PDVPLVVSEVNFERDAGNRPKGIIANPNCTTMAAMPVLKPLHDEAGLTRL
IVSSYQAVSGSGLAGVEELAGQARAVIDGVEQLVHDGSALQFPPPNKYVA
PIAFNVVPLAGSLVDDGSGETDEDQKLRNESRKILGIPELAVSGTCVRVP
VFTGHSLSINAEFSQPLSVARAKEILAGAAGVTLVDVPTPLAAAGADDSL
VGRIRRDPGVPDDRGLALFVSGDNLRKGAALNTIQIAELLAAQL
120406445YP_956274.1 hypothetical protein Mvan_5502 [Mycobacterium vanbaalenii PYR-1]MPGAANATPAPELPPLLPGQVLRLGPAAGTGTPTADYGIGATDLCEFMEF
PSGILQVCGDSFAGQGVGFGGWFSPIALHVVGESLDDPAGVRYDGVTGVD
TPLLADPAPAGASQLPAGVIEINRENWMMVTTTKDLRPQTSRLVKAVAGQ
GNWETIVGSERDAGYAGGRQSQISGYYDPIPTAESPRGWVYIVANNFDRS
GPAVLYRATPASFTDRATWQGWTGVAWGGEPVPLWPDRVGEMSVRQIDGQ
TVLSYFNATTGNMEIRVAADPTQLGTAPVTTVVVAAPWPDRVEDLPPPHD
NRLAQPYGGYISPGSTPDAVRVFVSQWNTTPRGGSPYRVIQFAVNPIKPW
120406444YP_956273.1 hypothetical protein Mvan_5500 [Mycobacterium vanbaalenii PYR-1]MTGSAGLTDDELTAWRSFVDMRHLLERHLVGHLQREFGLSESDFEFLINL
SEATAGRMRSHELGEMTQWEKSRLSHHLSRMERSSPGTWCTTSSCDSSTS
LV
120406443YP_956272.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MTTVLVGQPVGADEVVADYLDHVATLGLSGRAVRDRIRIARDFTARHRDL
HAWMTLPAAERIAEIRDTGAWPLICHTIGTGRLRLDVELAAVKQLTGLGR
AVEDRDPSGFATLRNAGIRLGWRSSWVETVLGECLAVVLAHHGGMVADLT
GDALDDFDATLSRTAVPPSSRRAYRARLASLRQLLFETAVIDTAPKRRRW
ARSHEQRFTEVEMPDPIRQTLLRYIGVRAAVLRPKSVESLINDLLPFAEY
LTAHHPDLTSLRGLDRSCIEGYLKWNRTRGWRGQRAAAGAGRTVSAAVAQ
SAVLSLRNLLDDITAWGWAQAPPRRLVFAADVPKLDQPLPRALAPDVDAA
VMNAVAHLQDPFARIGLTVLRGAGLRAGELLDLELGSIIDYGPAGTWLKV
PLGKLATERMVPLSAATLAALDEWVALRGTHRPLPHPRTGVLTDFLFTRH
GRRLGYTRLRNGLLTAAESAGLHRPDGGVLMVTPHQLRHTWATELANAGM
SLQALMSLLGHVTPQMTIRYATLASPTLRAAYDEAMGKMRRQFTLTPVGK
PILPDKVGWLHSEMLKTRVAHGYCARHESAGACPYANICETCDNYITAPE
FRDTLTNQLADVQDLRTDAECRGWTDEAARHDRVAHALTDHLHRLDH
120406442YP_956271.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MRVLKSDSGYVLEGDWDGQDAANAFLNHLGGRGFSAATVRAYAFDVANLS
RFLVQQAVGLVAVDAPLVFDWIDWQGVRRTDQPTSGHRSSTPPAASTVNR
RVAAVRALFEYLVMTGVCTDNPVPSPRRGQGLRQSQRGLLGHLGPGRARS
GGRLVRQPQRLPESLSTNDVDAFLATLATHRDRAMVLVMLLGGLRSAEAR
GLLLTDVDMGRRRLRVIGKGGKERHVPVDAAFFTELAAYLRWERPPGLAT
PQCFVVLRGPTTGAPVSEAGLRSLFRRHRETSGATRVRPHRLRHTYGTEL
SAAGIDLLTLRALMGHVSPETTARYVHLSIEQLAAEYGAARATLAGARQ
120406441YP_956270.1 transposase- mutator type [Mycobacterium vanbaalenii PYR-1]MTAAHNIDLPAVLAERLTTTHPDVLRELLATFIHTLMGAEADALCGAGYG
ERSTERTNSRNGYRHRQFDTRAGSLDLAIPKLRQGSYFPDWLLERRKRAE
RALTTVVATCYLLGVSTRRMDKLVETLGITSLSKSQVSVMAKELDAAVEA
FRTRPLDAGPYTFVAADALVLKVREGGRVVNVHALIAVGVNKEGYREILG
IDVTTAEDGAGWLTFWRSLTARGLSGVKLVTSDAHAGLVAAIGATLPGAA
WQRCRTHYTTNLMAVTPKSSWPWVRTLLHSVFDQPDSESVAAQYVRIIDA
LSDKLPKVAEHLENARADLLAFTAFPKQIWRQIWSNNPLSVNRPSGDTVQ
AAA
120406440YP_956269.1 hypothetical protein Mvan_5494 [Mycobacterium vanbaalenii PYR-1]MISAMSEATPPREESEPVTAPVGTPPPPVPPQTVYVQQPSGRLNKAALWV
GIVAGSVFIVAAIFGAGVFVGKNIGDGPRNHHIGVMHHGPMMSPMGPQGG
FQRGPGSAGPFGPGGPVMESPRQPAGPAAPTAPPRP
120406439YP_956268.1 catalase [Mycobacterium vanbaalenii PYR-1]MADKFTTTDAGAPIPSLEHSLTVGPDGPILLQDHYLIEQMANFNRERIPE
RQPHAKGGGAFGQFEVTQDVSGYTKAAFLQPGAKTDMVARFSTVAGERGS
PDTWRDPRGFALKFYTSEGNFDMVGNNTPVFFMRDPMKFQNFIRSQKRMQ
ATNLRDHHMQWDFWTLSPESAHQVTWLMGDRGIPKTWRHMNGYSSHTYSW
LNAADELFWVKYHIKTDQGVDFLTQEDADRLAGEDGDYHQRDLYTAIEDG
NFPSWTLHVQIMPFEDAKTYRFNPFDLTKVWPHGDYPLHEVGRMTLNRNV
VDYHAQMEQAAFEPNNIVPGTGLSPDKMLLARGFSYSDAHRARLGVNYKQ
IPVNEPQVEVNAYSKDGAMRIRNVTDPVYAPNSMGGPHADPRRASEVHWA
SDGDMVRQAYALRADDDDFGQAGTLVREVLDDEARDRLAHNIIGHVSKGV
REPVLSRVFEYWRNVDADLGKKVEEGVRNGGG
120406438YP_956267.1 30S ribosomal protein S18 [Mycobacterium vanbaalenii PYR-1]MTARRREAAPAKKRRNLLKSLGIERVDYKDTSTLRQFISERGKIRSRSVT
GLTVQQQRQVTTAVKTAREMALLPYPGQNPTGR
120406437YP_956266.1 30S ribosomal protein S14 [Mycobacterium vanbaalenii PYR-1]MAKKSKIVQNERRREIVARHAERRAELKAIIKSPSTTPEARVAAQSELNR
QPRDASPVRVRNRDSVDGRPRGHLRKFGLSRVRVRELAHQGQLPGVRKSS
W
120406436YP_956265.1 50S ribosomal protein L33 [Mycobacterium vanbaalenii PYR-1]MARNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRITLRKYDPVVRRHVDF
REER
120406435YP_956264.1 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1]MSAHCQVTGRAPGFGNAVSHSHRRTRRRWNPNIQTKTYYLPSEGRRVKLR
VSAKGIKVIDRDGIESVVARLRREGQKI
120406434YP_956263.1 cobalamin synthesis protein CobW [Mycobacterium vanbaalenii PYR-1]MRTPVVVVAGQSDTDGITGVLLDGAGTVLVEHRFDGHVVHRSTTVVQGGL
LDTADEVLELTNCCLSCTVREDLLSHLRRLHRRPDVKRIAVRLGPWMEPE
QVCFAITRLPAARDVAIAAVVTAVDTSTWLRQALGDDELDDGRTVAQVVV
GQVEFADVVVLTGPDPDVVAVTRRLAPRARVAVGAQRLGVALADLDPDAR
RGRSDDPHASLLSGQPPLEAAGPVRLVEFQSRRPFHPLRLHAAVDLLLDG
VIRSRGRLWLANRPGHALWLETAGGGLRVTRTGKWLAAMTSREIAYVGPE
RRAMADLIWGYPHGDRHTSMTVLVCGAEPADIIDALQGALLTDAEMQRPQ
DWGRYEDPFHDTLEGDADEARLA
120406433YP_956262.1 hypothetical protein Mvan_5487 [Mycobacterium vanbaalenii PYR-1]MSSEVVHSAESSSRRRSDATRVAAGIAIAALSVGVAAPASARPSDPGVVN
YAVLSKGSVGNIVGARLGFESTFTDPFQAFYVDNPACNNWADIGLPEVYN
DPDLAAFSGAVAQESPTDARHFVKQAVGVFATTDAANRALHRLVDRTVGC
NGQTTAMHLDNFTTQVWTFTAGPTTATDANWVKQEAGTDRRCFVTTRLRE
NVLLQAKVCQSGNGGPAVDVLAGAMQNTLGQ
120406432YP_956261.1 glutamate--cysteine ligase [Mycobacterium vanbaalenii PYR-1]MACTMTSDGVVEQRFDPLSSAEAAAQHIVDGCLIDGPVGQVGLEVEAHCF
DLTDPSRRPGWDELTATITALPPLPGGSVVTVEPGGAVELSGPPLAEPAS
AISAMAADHTVLRAAFARAGLGLVLVGADPLRPAARVNPGPRYQAMEAFF
RASDSGDAGAAMMTSTASVQVNLEAGPRAGWADRVRLAHALGPTMIAIAA
NSPVLGGDFTGWQSTRQLVWSRLDSARCGPILGASGDDPASDWARYALRA
PVMLVHSPDPTPVTQWVPFADWADGRVLLDDRPPTLADLDYHLTTLFPPV
RPRGFLEVRYLDSVPDATWPAVVYTLATLLDDPAAADVAAEATEEVATAW
DRAAQLGLRDRRLHAAATRCVQAAADRAPRALEESMGHLVRSVEQGRSPA
DDFADRVVAHGIADAVTELAQGEL
120406431YP_956260.1 hypothetical protein Mvan_5485 [Mycobacterium vanbaalenii PYR-1]MTTREALACELTEARDRTLRLVAFDDAELRRQYDPLMSPLVWDLAHIGQQ
EELWLLRGGNPDRPGLLPPQVDQLYDAFVHSRASRADLPLLPPTDARNYC
ATVRGKVLDALDALPDGHPDAFTFGLVVSHENQHDETMLQALSLRSGAPL
LDRGTSLPPGRPQTAGTSVRVPAGEFVLGVDAVTEPYSLDNERPAHVVDV
PAFRIGRVPVTNAEWRQFVDDGGYHRRQWWSDAGWAHRRQAGLTAPLYWN
GDGSRTRFGYVEEIPGEEPVQHVTYYEAEAYAAWAGARLPTEVEWEKACA
WDPETNSRRRYPWGATEPTAEVANLGGRALRPAPVGAYPQSASAYGAEQM
LGDVWEWTSSPLRPWPGFTPMVYERYSQPFFDGTGTGEYRVLRGGSWAVA
PNILRPSFRNWDHPIRRQIFSGVRLAWDDVGAPPACGGPLTRRVDGYV
120406430YP_956259.1 hypothetical protein Mvan_5484 [Mycobacterium vanbaalenii PYR-1]MDMCRHLGWLGDPVSVASLILEPPSGLLVQSYSPRRQKHGLMNADGWGVG
FFDGAVARRWRSAAPLWGDASFASVAPALRSGCVVAAVRSASVGMPIEAS
ASAPFTDGTWLLSHNGLVDRAVLPSSPRAESTNDSALLAALIFDRGIDEL
GATIAGVAAEDPNARLNILAGNGTRLLATTWGDTLSVLRRDDGVVVASEP
YDDDPAWQEVPDRHLVEVDGAHVHLRPLKGS
120406429YP_956258.1 hypothetical protein Mvan_5483 [Mycobacterium vanbaalenii PYR-1]MTFSLENYLAADAADEALRRDVRHGLTQHPKTLPPKWFYDSVGSDLFDQI
TRLPEYYPTRAEAQILHARAAEIAAASGADTLVELGSGTSEKTRALLDAM
RDRGTLRRFIPFDVDASVLKDAGASIEAEYPGVQIEAVCGDFEEHLGKIP
AVGRRLVAFLGSTIGNLTPGPRAEFLASVAELMQPGDTLLLGTDLVKDTG
RLLRAYDDSAGVTARFNRNVLAVINRELGADFGVEAFEHVARWNAAEERI
EMWLRSTRAQRVHIAALDLAVDFADGEQLLTEVSCKFRPSGVDQELASAG
LRRTHWWTDDAGDFGLSLAVK
120406428YP_956257.1 class V aminotransferase [Mycobacterium vanbaalenii PYR-1]MTLAEQWRAARPPVAGVHVDSAACSRQSFAVIEAAAQHARHEAEVGGYVA
AEAAAPALDAGRTAVRALTGMSDAVVHFTTGSNHALDILLGDWTGARTLA
CLPGEFGPNLAIMARHGFSIKVLPVDEFGRLDVNAVGAALSSHQPALVHF
TVLGSHSGIVQPVRDMASACRGHGIPLIVDAAQGFAHLDVAGIGADALYS
SSRKWTAGPRGVGVLASRPGLLADDTRIRLNHAETNVGLQVGFSVAVGEY
VAAGPDAVQSRLREVGAATRTALADVPGWRVVEHVTEPSAITTLQSTDGI
DPLDVRTRLIAEHQIVTTYLGLERAPREMSHPALRVSPHVDVTDADLAAL
ADALATVTR
120406427YP_956256.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MSRLSNPLHSPAFYAGDPFPVYRELRATDPVCWNDEHEFWALLKYEDIRY
VSTNPALFSSARGVTVPDPALENPVMEGSLIFTDPPRHRQLRKLINSGFT
RRQVAILEPKLRAFARAALDAIDPSATEFAEQVAAPLPTRMIAELLGAPD
EDWEQFRTWSDATVGMDDPDVELDTFAAMGELYQYFEAQIARRRDGTLRD
SDDLLSVLVAAEVDGVRLTDQDLLQFCLLLLVAGNETTRNLVALGTLALI
ENPDQFRLLRQRRDLVPTAVEEMLRYASPVANMTRCATRDVDIRGRSIRA
GQYVTMLYGSANRDKDVFGPTSEQFDITRNPNPHLAFGCGEHSCLGAQLA
RLEARVLFEELLNRFDHIELDGDVLRMQATMVPGVRQMPVRLSATAAEPR
ETGTAAVSV
120406426YP_956255.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MARTRRAGAALPYGALDRDHLVKHLLELARRVGVENVTMRALATEAGTSA
SSVYYHVKDKAALLDLLAESVIESIEVPTEGDWEQRTRALYTNAWKVMIA
IPGIAAMLQQRPLTGAADAVDRTVKAIMAESGWTADEVAAAHVVLYIHLL
GSVQLEHHLRHSGIEIKSDDGAESVFQHGLRVILAGLRSCHTETSTPTT
120406425YP_956254.1 iron-containing alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1MKVEDLLKPFPIKEFHPFPRAMMGPGAHEMVGPEALKMGFKRVLLMSSGL
RGTDIVHNMAESLKWHGLEVVVYDQVESNPKDYNVMDAVKLYQQNECDSF
VSIGGGSTHDACKGARISIAHDGRNVNDFEGFNKSENPKNPPHIAISTTA
GTGSETSWAYVITDTTTDPDNPHKYVAFDDASVATLAVDDPVLYYQCPVD
YTAQCGFDVLAHASEPYVSRLNFEPSLGNAIRAIKLTAENLREATWNGTD
LKGREGMMYAQYIAAQAFNSGGLGIIHSISHAVSAFYDTHHGLNNAIALP
RVWAFNMPVAYKRFADIAQAMGVDTYGMTDVQAADAALAAAIRLLRDVNI
IEKFTDVKQDSYSKNRLGQGPTKYYENAPVIKGDKADVDRITNHVLGDAC
TPGNAKECTFDTVRPVVEHCMNGDLDELLP
120406424YP_956253.1 ATPase [Mycobacterium vanbaalenii PYR-1]MLDSVEEVREALAGEGYIADERLATTVFLQTRLDKPLLIEGPAGVGKTEL
AKVLAAATGRRLLRLQCYEGQDETKALYEWDYGKQLLYTQILREKIGQLV
SDAADLTEAVERIGAQESVFFSDRFLAPRPLLEAVRSPEPVVLLVDEIDR
ADEALEAVLLELLGEYQVSVPEIGTFRAVHAPYVVLTSNNTRDLAAALKR
RCLHLFLDYPAAERELEIVRSKNTGLSDALAAQLVDIVRGLRELELRKAP
SISETIDWARTLAVLGVDELSAQVLSDTVSVVVKYDKDVRKSLDALPRLV
DPNATVPEQHSHGHGHGHGHDHDHHGPEHHDHDHGDDGRAARAAKDQPGR
FTDGYYGTPRRAEQAATAGSLGRRRAL
120406423YP_956252.1 VWA containing CoxE family protein [Mycobacterium vanbaalenii PYR-1]MEATLHRFVRLLRLGGVRVSIPEALDAMRCAGQPGVLSSRAVLRTALRVA
LVKDQRDEPIFDEIFEAFFSLVRVGGDGHDAHAHSHAHDDLVDTGELESF
TLSEEPSETPEPGHEHGKPASIRDYFKQEDLAQRYNLHQEANKIDLAALT
DEIAFSKDSRNGADDSYRIQLSTDRLGGAGTAGDLATAAGTPVDAELTIA
EQEALLGWLDDETDYGGDEFDAAELRKRLAGVLENLPQALKRHLEALLAL
ETKIVEGREQREARIDRIGERERAELEDSLRRLARTLHGALTHRRRTAAA
GRVDSGQTMRRNMRFDGVPFMPVTVRRAEDRPRLVVLADVSLSVRATSRF
TLNLVHGLQDLFTQVRSFVFVADVAETTELFRDHPSEKALGLIFGGDVVD
LAANSDYGTVFGEFVAEHSSALTRRTTVLVLGDGRTNAKDPNLAAFEEIT
RRARETVWLTPEPRYSWGLGSCELPAYAEFCDRVRVVRDLTGLESAAHDF
AAEAVGR
120406422YP_956251.1 iron-containing alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1MGARYPTLTPELDRGRAATTPRLLKFHAPEIVFGIDSMVEAAHAAVRLGA
QRPMLVTDPGLIEAGWSDEMVTHLAGMGVRAAIWSDLTPNPKDHEVAAGY
QKYAEHGCDVIVAVGGGSVIDAAKGVAILAANGGDILDYEGVDKAQVPIP
PMVVVPSTSGTGADVSQFCIVTDTTRNTKITILGRALVPDITVIDPRLLT
TMPEWLNAATGLDALTHGIEAFVSLGHNQLTDHHALRAVQMVTDNLVHTI
DRPNEMPARVLMAQAALEAGLAFTNAILGAAHAMSHQVGGLLDLPHGVIN
GVLLPHVIRFNAEADPEPYQVIATSLGVTDPGAPAAEAALALADRIDRLA
RDVGVPRGLAELGVAEDDLPRLARTALQDACMSTNPRPADEAQMHALFRA
AL
120406421YP_956250.1 histidine kinase [Mycobacterium vanbaalenii PYR-1]MTAADPRPPDLATLTGLRSGKGRFYPEFRVTAQRLDRVLAALDTISRALV
QTVEGPENLVRAVAEAARAHLDADWVLLALADGALPEASVRHLILDSGGA
AYAFEGLSGARDPGPSLPDAVLNRLNDILRGQLAEFRLPVIESRHAHVPI
ELDGEVIGAFAAWTPPRRTLDATDGMVMRILAGQTAVALQNSALFSKSVT
LLAQSEARNAELLATQRELGAAQRHQVLNSERHRIARELHDSVAQTVLSA
GMQIEVCRSEIDASGRNRELVDRLDLAKHLTRSATEQLRSAIYALNQPGD
AYRSSLTEMLGQLATVHMPEDLRVTLRVDGSAAELPGEVEHALLRIAGEA
LFNTAMHGNATRAIVRLSYRDDAVSLSIADDGTGDPAKLRLMLRMAEATD
VDGRHRGLANMRARAREHGGTFDVYRSRIGGVRVVARIPRVSESVTS
120406420YP_956249.1 two component LuxR family transcriptional regulator [Mycobacterium vanMKPIRLVLVDDHAILRQGLRSVLERADDLIVVGEAASESEAVAVVGATSP
DVVLLDLKLSAGSEFEGLTLCAKLSAAHPKLGLLVLTTFLDEDLVVRAVH
AGARGYVVKDVDTTELVRAIRAISAGDSAFDSRSAAAVVRSMSGRSESRA
QLTDREVEVLRLLAAGLSNNKIGERLYISATTAKFHVSNIMRKLEVSRRA
EAVYAASKRGLI
120406419YP_956248.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MDMDSAVLNPLAPSPHGVWSSHGVRVLRRRGPHRPHSAPGTVCTPRFCSA
RRGGLLTVEHDLTPDELCDELAVLLADQLVDSGALQGQSEFELVFTGVVR
STVDGGLPAWLRFYRNSLNKLENGSTAFAPIHSHAADLVRGGRLIDLGSC
FGFFPLRLARYGIDVLATDLNDNAMRLLEQVSSRLCRPLTTMACDAADVP
LPDGSADTVTALHLVEHLPDPLVDKIIDEAVRLARRRVIVAVPFEDQPRE
CYGHIQRFDVRRLQHMAGEVVRRHPRLSAAVHEFHGGWLILDR
120406418YP_956247.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MAHMTDVMDWDSAYRGEGDFEGEPPWNIGEPQPELAALWRDGKFRSEVLD
AGCGHAELSLALAADGYTVTGVDLSPTAVAAATAASAERGLSERTSFVAA
DITTLTGFDGRFATVVDSTLFHSLPVESRDGYLQSVHRAAAPGAGYFVLV
FAKGAFPAEMEGGPNEVTELELREAVSRYWIIDDIRPALIDTNVPKLPGM
PPPPLDMLDDRGRLRMQAFLLQAHKES
120406417YP_956246.1 hypothetical protein Mvan_5470 [Mycobacterium vanbaalenii PYR-1]MGEDVSEQLKQSEFSRVHRREYRRKVQLCLDVFETMLAQSSFDFEKPLTG
MEIECNLVDAEYQPAMNNSEVLEAIADPAYQTELGAYNIEFNVPPRRLPG
RAALDLEDDVRASLNAAEAKAGTDGAHIVMIGILPTLMPEHLSGHWMSES
TRYQALNDSIFTARGEDIMIDIAGPERLSLQTASIAPESACTSMQLHLQV
SPADFANNWNAAQVLAGPQLALGANSPYFFGHHLWAETRIELFTQATDTR
PDELKTQGVRPRVWFGERWITSIFDLFEENVRYFPSLLPQLSDEDPVAEL
AAGRTPKLSELRLHNGTVYRWNRPVYDIVNGRPHLRVENRVLPAGPTVLD
MMANAAFYYGMLRALSEEDRPLWTKMSFAAAEANFVAAAQHGIDARLYWP
GVGEVTPDELVLRRLLPMADEGLRRWEVATEVRDRYLGVIEGRAKTGRNG
AVWQSTTVTALQDRGLTRPDALAEMLRLYCERMHSNEPVHTWDLPA
120406416YP_956245.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MPRGGPDASCLDRLLQTDRQEYLDRDSAGDAGLEQTKRSVIRALDWTGEV
FGNHEKFAKIALDEVADVADPRILELGAGHGGLSRKLLEWHPSARLTVTD
VEPASVAAIAAGDLGSHPRATVRQMDATALDAADGEFDLAVFALSFHHLP
PQLAARAIAEGARVADKLLIIDLPRPPAPLHVLRLAAMLPWAPLVPFLHD
GVISSLRAYSPSALRALATHADPAVDIELRGGLLSPQVAVATRR
120406415YP_956244.1 hypothetical protein Mvan_5468 [Mycobacterium vanbaalenii PYR-1]MPLINTAAQTRRRTAACLVAAFAAAPFLANGAAHAQPGPGVPTVDPRAAC
ESPDWGGAYVTITATLSECHYIVSGAFYYDNYDNGVYTGTLVYRDGAKMP
TERPQMPDTFTMPGGVPLLIPFAG
120406414YP_956243.1 glycerol kinase [Mycobacterium vanbaalenii PYR-1]MADFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWVEHNPVE
IWERTGSVLATALNKTKLSTSDLVALGITNQRETSLVWNRHTGRPYYNAI
VWQDTRTDRIASALDRDGRGDVIRQKAGLPPATYFSGGKLQWLLENVDGL
RADAEKGDALFGTTDTWVLWNLTGGHRGGVHVTDVTNASRTMLMNLETLD
WDDELLGFFDIPRQMLPEIRPSSSPEPHGVTVDWGPADGEIPVTGILGDQ
QAAMVGQVCLDAGEAKNTYGTGNFLLLNTGENIVRSKNGLLTTVCYQFGD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQVEDNGGVYFV
PAFSGLFAPYWRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAM
AADSGVHLEVLKVDGGITANDLCMQIQADVLGVDVVRPVVAETTALGAAY
AAGLAVGFWDGADDLRANWQEDKRWSPTWSDDQRAAGYAGWRKAVQRTMD
WVDVD
120406413YP_956242.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMPYPTDNPATWFVTGASRGLGAELVRQLLRRGDNVAATTRSAERLSAALA
GVDTGRLLPLVVDLTDAAAVDGAVAAALDRFGRLDVVVNNAGYGFLGAVE
ETTDAEIRQMLDVQVSGVWNVLRSAVPHLRAARSGHIINVSSILGLTAVP
GWGLYCAGKFALNGMSEALAAELAGFGIRVTIVEPGYFRTDFLTTESLAL
PTAAGDAYPAIREMTEQHLQLQGSQLGDPVKGAAAVIHVAVTGGGPLHQL
LGSDAVSYAEAKIDALVADVKAGRDLALTTDHR
120406412YP_956241.1 XRE family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MMANVADANRELADFLKRARSAVDPARAGLPADGRIRRVPGLRREEVALL
AGVSTDYYARLEQGRRITPSAAVLDAIARALDLGDTGRAHLGRLVGASPT
RRRSSRPVQRVRPGLYQLLDSLDETPAMILGRRTDVLATNRAARVLFADF
DAMPPRERNYARWMFTSEQARNLFADWSVQARTAVENLRLDFGGDPHDPA
VIELVDELSAASAEFRMWWAEHRVFQRTYGTKRLRHPVVGDLSVDYETFT
MPGDAEQTLFVYLAEAGSPSRDALNLLLSWSANSV
120406411YP_956240.1 peptide chain release factor 3 [Mycobacterium vanbaalenii PYR-1]MTTSTAAGPRADLVSAEARRRRTFAVISHPDAGKSTLTEALVLHAKAITE
AGAIHGKAGRRATVSDWMEMEKARGISITSTALQFPYITQAGNTCVINLL
DTPGHADFSEDTYRVLTAVDSAVMLIDAAKGLEPQTLKLFQVCRHRRIPI
ITVVNKWDRPGRHALELMDEIQSQIGLRPTPLTWPVGIAGDFKGVLDRRT
GKFIRFTRTAGGATAAPEEHIDPDKAHDAAGVDWDNAVEESELLSADGAD
FDPDTFLDCTSTPVLFTSAALNFGVNQLLDVLAQLAPSPNGALDVDGNRR
EAAAPFSAFVFKVQAGMDSAHRDRIAYARVCSGTFERGDVLTHASTGKPF
VTKYAQSVFGRERSTLDTAWPGDVIGLANAAALRPGDTLYQDIAVQYPPI
PSFSPEHFSVARGTDPSKHKQFRKGIEQLDQEGVVQVLRSDRRGEQAPVL
AAVGPMQFEVASHRMAAEFSAPIALESLPYTIARICDPADAEALAKMAAV
EVFTRTDGVMLAVFSTKWRLETVQRENPAMELRELVAAGQ
120406410YP_956239.1 aldo/keto reductase [Mycobacterium vanbaalenii PYR-1]MDSYQLGSYSVGRVGFGAMQLPGPGVFGPPRDHDQAIAVLRRAVELGINH
IDTAQIYGPNVANELIREALHPYPADLALVSKVGGKRDAQGNWLPAQEPD
DLYDQLEENLRTLDTDRLAAVNLRVFGSAGGAGPADLNRALFDRQLSTMI
RARDEGLIAGIGLSNIGVDHLRIALERTEIVCVQNAYNLVDRTSQPVLEL
CLEHGVAFVPFFPLGSGFVPDNPVLNHPAVVREARNLGRTPAQIALAWTL
SVAPNVLLIPGTSSVTHLEENTAVRDVELDDETRRELDEAAH
120406409YP_956238.1 PadR-like family transcriptional regulator [Mycobacterium vanbaalenii MNTPFTPPENPFDRRGFGFGFGPEGRRTVHERRRQARREFHDHIREHRGD
AGFGPGPGGFGPGGFGPGFGGFGPGGGKFGPGFGFGPGGRGGRRGGPRGG
GRSRRGDVRAAILKLLTDRPMHGYEMIQEINDRSQQLWKPSPGSIYPTLQ
LLVDEGLLTAAETEGSKKLFELTEDGRAAAEKIETAPWDEITEAFKDEAP
EAMGLRTAVGQLMGAVAQSAHAATPEQQQRIVDIVNNARREIYQILGED
120406408YP_956237.1 PadR-like family transcriptional regulator [Mycobacterium vanbaalenii MSLRIAALGLLAEGSASGYDLLKQFEKSMANVWPATQSQLYSELNKLAAG
GLIEVCAVGPRGRKEYRITDAGRAELQRWVAERQDDPPVRSAGLLRVFLL
GLVPPEQARAHLHAMAEEADGEVRRLTELRESLTGGRAADPTDESFFGFA
ALDYGLRLNAMQAEWARSVIDRLDT
120406407YP_956236.1 carotenoid oxygenase [Mycobacterium vanbaalenii PYR-1]MTETTSDQADSTFVDSSRERSSALFGAGEFFRVGNYAPVADELTAFDLPV
EGAIPSELDGWYLRNGPNPRQPTGHWFTGDGMIHGVRIENGRAAWYRNRW
VRTDSFVDPFPLYNADGTRNLRASVANTHVVNHAGKTLALVESSLPYEIT
NDLETVGAYDFGGKLVDAMTAHPKICPTTGELHFFGYGNIFTPHVTYHRA
DANGELVIDRPLDVPALTMMHDFALTANYVVFMDLPIVFNVDIAVSGRGD
MPYRWDDGYGARFGVLRRDDPFGQVRWFDIDPCYIFHVANAHDDGRTLVL
QAVRYPELWRENGGFDADGVMWTWTIDLQNGTVRESQLDDRVVEFPRIDD
RLATLPARYAVSVGDAGLIRHDLVTGAAVEHRFGTDSAPGGPGEAVFVPS
TSGPADESSGWYLGYVYDPERDGSDLVIIDASDFGAPPVAKIKLPQRVPY
GFHGNWISA
120406406YP_956235.1 RDD domain-containing protein [Mycobacterium vanbaalenii PYR-1]MVAQHQPVVTGDAVVLDVQIAQLPVRVLSALIDVTVVFVVYVLGVILWAV
TLTQFDPAFSGAVLIIFTVLALVGYPTIFETATRGKTLGKLALGLRVVSE
DGSPERFRQALFRALAGVIELWMLTGGPAVLCSLLSPKGKRIGDIFAGTV
VISERAPRQSPPPVMPPQLAWWATTLALSGLSPSQAEIARQFLSRARQLD
PQVRDQMAYRIASDVVAQISPPPPPGTPPALVLAAVLAERHRRELGRLQQ
QPFQPGPVWPAPPQPPAATPPSWPPAPPSAPPPQHPGGFAPPS
120406405YP_956234.1 hypothetical protein Mvan_5458 [Mycobacterium vanbaalenii PYR-1]MDVDAFVLANRPTWNRLEHLVKNRRRLTGAEVDELVDLYQRVSTHLSIVR
SSSSDAVLVGKLSGLVARARAVVTGAHAPLWREFTRFWTVSFPVVVYRSW
RWWVASGVVFYAVAAVIAVWVAHNPEVQASIGTPSEIEQLVNHEFANYYS
EHPAGSFALQVWVNNAWVTAQCIAMSVLLGIPIPYILFQNSANLGVNAGL
MFQAGKGDIFLGLITPHGLIELTAVFVAAGVGMRLGWSVISPGDRPRGQV
LAEQGRAVVAVAIGLAVVLMVAGAIEGFVTPSSLPTFVRVAIGVAAVVGF
FGYVFHFGRRAVRAGETGDVEDAPDVVPTG
120406404YP_956233.1 hypothetical protein Mvan_5457 [Mycobacterium vanbaalenii PYR-1]MEHAVEDLFRNSGGYATTAALLRVMSRQQLDVRVRKGELIRVWHGVYAAT
EPDYLGRLQALDSYIGQPAVACMGTAAVLYGFDNEATSAVHILDPGVRVR
PTVGLMVHQRVGAPLGRVRGRLATSPAWTAVEVARTLHRPRALATLDAAL
RTGLCTPVELHAAVTEQRGRRGIVAVRELLPLADARAESPMESEARLAMH
DYGVPRPELQYVVHGAWDSWRVDFAWPEVLVAAEYESVDWHTGRDAMLKD
KARFAGLQHAAWTVIPITVTDVRISPERLAERIKEHLWRAAHTASSHKLA
L
120406403YP_956232.1 hypothetical protein Mvan_5456 [Mycobacterium vanbaalenii PYR-1]MVLTGRAGLIALLCALPVVLSPYPAATFAVLAALLAVAVLADVALAGSPR
ALELTRGGPTSARLGQPVTAELTVRNSGRARFRGLVRDAWAPSARGAPRV
HRVNIAAGQRVLLETELRPVRRGDQVSALVTARAIGPLGLAGRQGSHRVP
WQIRILPPFLSRKHLPSRLARLRELEGMTPVLIRGQGTEFDSLREYVVGD
DVRSIDWRATARRADVVVRTWRPERDRRMLIVLDTGRTSAGRVGVDPTGS
DPATGWPRLDWSMDAALLLAALAARAGDHVDFLAHDRETCAAVVNASRTE
LLAQLVAAMAPLEPSLIESDARAMVAAVQRRVRRRALVVLLTDLNASAID
EGLLKVLPQLTAKHRVIVAAVADPRVDTLAAGRADAVEVYDAAAAERARN
DRRAVASRLRAMGVDVVDAPPEDLAPDLADHYLAMKAAGRL
120406402YP_956231.1 ATPase [Mycobacterium vanbaalenii PYR-1]MTQPTNHEGARNALMALRAEIAKVVVGQDAVVSGLVIALLCRGHVLLEGV
PGVAKTLLVRTLAAALQLDFKRVQFTPDLMPGDVTGSLVYDARTAEFEFR
AGPVFTNLMLADEINRTPPKTQAALLEAMEERQVSVDGQPRPLPDPFIVA
ATQNPIEYEGTYQLPEAQLDRFLLKLNVPLPPRDQEIAILNRHANGFDPR
DLSFVKPVAGPAELAAGREAVRQVLVGDEVLGYIVDIVGATRNSPSLQLG
VSPRGATALLSTARSWAWLSGRGYVTPDDVKAMARPTLRHRVALRPEAEL
EGATADGVIEGILSAVPVPR
120406401YP_956230.1 hypothetical protein Mvan_5454 [Mycobacterium vanbaalenii PYR-1]MSTAVGATITDRWRGLRWALAAVVAIVAVAALTTWLTAPRPGGHLDPTST
SSDGVLALMTLLREHGVTVVEAASIADVEREAREDTLVVAAQTYHLYDDD
QLRRLAAAPGDRLLIAPIGKTREELAPELRRAETTEFGGLAPDCDLREAN
RAGTVQFGIAETYEAQGSTAVTRCYDGVLARYTDDGRTITVVGSEQFLMN
AGLAEEGNAALAMNLAGTHPRMIWYAPQRSEGGESGGAASLTDLIPAQVY
WMVLQLILAVALLAWWKGRRVGPLVAEALPVVVRASETAEGRGRLYRSRR
ARDVAAESLRTATRQRMLPRLGLTPGAPPEAVSQAVAARCGLDPQTVAHT
LYGQPPDTDADLVTLARALDDIERQVAQS
120406400YP_956229.1 hypothetical protein Mvan_5453 [Mycobacterium vanbaalenii PYR-1]MSTIDIDRDAAQEAAQNELAKAIYPKPSPMDMLYDWIEQLLYRLTASAAK
FPGGWYTVAVLLVLLVVAVVVAVRIARRAMRSDRSTGPALFGDHILSAAE
HRATAERHAASGDWAPAVRHRVRAIARQLEENGVLDPVPGRTATELARAA
GRALPALSGELSTAADTFNDVTYGEQPATEPQYRMIAALDDHLGSRTPSS
VAVHADAAHQPWAEVR
120406399YP_956228.1 putative transmembrane protein [Mycobacterium vanbaalenii PYR-1]MTYNAGGYGPAGPPPPGYPAPGYPGYPPAGYGAPPQYWQPPGYAPGYGAP
GYPPQFGLPPVIKPGVVPLRPLTLSDIFNGAVAYIRTNPKATLGLTAIVV
IASQIVALLLSLWPFAFTGQVASTLDGDEASTEVLVSWMASSLATAITTG
LSTTLLSGLLTVVIGRSVFGADITIGEAWRRLRPRLWALIGFTVLKTLAL
IVWFGVVLLIVVLAVAVIDGPAAFLIAAPLVLASILAAVWVSVMLTFAPA
VIVLERRDIVTSVKRSFALIKSDFWRVFGIWLLAAIVAQFIAGAVSIPFS
IGGQAVLTASATTTAAMISMVLFSVGGAVGQIITGPFSAGVTVLQYTDRR
IRAEAFDLVLQTGAAAGPQAPADSTDDLWLTGPR
120406398YP_956227.1 hypothetical protein Mvan_5451 [Mycobacterium vanbaalenii PYR-1]MTLMRVPAAALVTLTLLMTQPTGTAMAQPHSETETRNLATVHAGFESWRA
GTGSPYDALADDATWEIVGNSAASRVYSGKEDFLTNVIRPFNARMSQRLI
PQIRDIYADGDTVVVFFDAEGTARDGIPYRNTYAWFLTLNDGQIVKAAAF
FDAVAFNDLWQRVPA
120406397YP_956226.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKMRAARMYGYKQPLRLEEVDVPSPGPEEVLVRVGGAGMCRTDFQLIDGY
FDNGLSMDFPITPGHEVAGWVDGVGSAVPKSAGLAEGDQVVVFGSWGDGA
CRQCHEGNEQLCAHGVWAGFGRHGGYQEYLPVNYRYLIKIPGGGELSPDN
LAPLTDAGLTPYRGLKKLRNAGHLGPGRTVAVSGIGGLGSYATQYAKLLG
GGAEVVAFARSDEKLKIAKDNGADHVVNVRDKDTEDVRAELESATGRTEL
DAVIECAGSEDSIRLAFSLLAAEGAVASVGLIGNRVDIPLFPLVAREYTF
YGSFWGNYNDLTEVLALARTGQLKHSVTRVRFDDVNETLEAIARGDVLGR
AVIVYD
120406396YP_956225.1 regulatory protein LuxR [Mycobacterium vanbaalenii PYR-1]MTSSAQPIRPSQESQVELVGRRAERRALDGVLSAVSAGRSGVLVLSGVLV
LSGEAGIGKTALLDEVAGQIAEGLLVRVAGVESETEFAYAALHQLCIPLF
ERIEQIPGPQRAALLTAFGQRRSPTPDPFLVGLAVLSLVSEFVHQCPVFL
IIDDQQWLDRASSIAIAFVARRLSAEPVGVVFATRTVGEELRGLPELVVG
GLTDDDSRELLALNLDGPLDTSVRDRIIVEARGNPLALLEIPRALGRTGL
AGGFGAPGVPLTHSLEGAFRHQLHGLPLPTRRLLALAAAEPAGDASTLWR
AAEVLGIETNAAVPAVEAGLAEIGSRVRFRHPLIRSTAYRSVALSDRQLI
HSALAAVIDRELDPDRRAWHLGHAAIGPDDEVAAELERCATRVRARGGVA
AAAAFLERASALTLDPSNRCDRTIAAASAKAQAGALDVAKDLLKVADAAP
MTELQRAQADLVRAQLAFISNHGNDAAPLLLGAARRLESIDPTLARETYL
DTLSAAIFAGRLAVDGGVLEVSEAASAATRSLNTPGAADLLLDGMTTQHS
AGFEKGLPNVREALRIYGPGMTTEQELRWMFLACVAAAHVWDLDRLMSLA
VRHVQLSRDTGAVSELPLALSCLITPLLFTGRFGEAARAIDELTAAIDAM
GNNLTPYGALSLAAMSGRRDHLQRLGSTAIHNAEHRGEGIGLTVNAWATA
LLENGHGRYHAAAEAAVYATSYPGDCTSAGWALIELVEAGSRTGDDAVAS
AALERLTEMTTPSGTDWGLGVEARSRALTTEGDAAEALYLEAIERLGRAG
MGPDQGRAHLLYGEWLRRRRRRVDARAQLRSAHHLFDSIGMDAFAERARV
ELLATGETAQKRTNSRVAALTAQEAQIARLARDGLSNPEIGARLFISART
VQYHLSKVFAKLGIRSRSQLEHSLPELAT
120406395YP_956224.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MTRFGYTLMTEQSGPKDLVSYAVSAEQVGFDFEVSSDHYFPWLASQGHAP
YAWSVLGAVAHATDRVELMTYVTCPTMRYHPAIVAQKAATLQLLADGRFT
LGLGSGENLNEHVVGKGWPTVARRHAMLREAIQIIRELHSGDMVDWKGEY
FEVDSARLWDVPEVPVPIAAAVSGDRSVEQFALLADHLIAVEPDKDLVDS
WHDARHATGLPGEVRVIGQLPICWDTDRDAAIDRAHDQFRWFAGGWAVNS
DLPTTAGFDGATQFVRKDDVADSIPCGPDLDAIVDAVREYWEAGFTDIAL
IQVGGDSQEAFLKEAAAPLLDKLRSASH
120406394YP_956223.1 PA-phosphatase-like phosphoesterase [Mycobacterium vanbaalenii PYR-1]MQTDPHRPDATTSALRSARRRWTLTLIGATLFLIAVYWLAVRTATGQAVE
NAALYGADQVDPRAFLAARNLLDTITVTSLVAATVLVGAIGLLRRQANLA
MAAMAVILGSQAVTQILKYVVLQRPDLLPTDEYLANTLPSGHTTAAMSVL
FATLIVMPYRFRGVAMFFALTWAVGIGAYTVIAQWHRLSDTLAADAVALA
VACAASQFLARTDRIRAVVSPGAARFTLRTAFVGLVTVVGAVSAALGAVA
LLASLRQDIDAATEWQLFLSAQWLAAAGSIFAALLFWWTWYRLETKRRSD
LTTAR
120406393YP_956222.1 hypothetical protein Mvan_5446 [Mycobacterium vanbaalenii PYR-1]MASKPSAKSLAWPLFDALVDQSPFRTVNPWKADGTFAPDYATLRKLLAVP
LLLGAESRSGVPALALDVWVAYELRRAGLDPDAVWPRAEAPRVVDRDVLA
FIRSVPKNAGRDELLARLRKGAATGGVGAASANIAGKNYFKQVDVIMSSW
QTGPELLISTKRMDSSFGKNAANRVEESYGDAKNLALRHPLAALGFMYSL
RSTAYTEERRQFDWIVDLLTKLGREEDAYDACALVVPEWVGEPLIPDLGP
PEPDDAVLDLFDVDIEDVDRESTADTATQLAALPDVTLRTDLVPDELSPA
RFFEVMLTIVLDNSNITQHEEARLRRSRAVG
120406392YP_956221.1 methyltransferase small [Mycobacterium vanbaalenii PYR-1]MRMLPGDNADLRKARGAFFTPTPVARFLTDWAVRHPEHSVLEPSCGEAVF
LHEIGQRGGHTGPLVGVEIHPGSAEESQRSLRARGIDATIHARDFFSHAE
FGSYDAVVGNPPYVRYQDFAGEARARARQAALRAGVALSNLASSWAAFTV
HSALHLRPGGRLGLVLPAELLSVNYAAGVRQYLMDHFGQVGLVLFDERVF
PGVLEEVVLLLADGYQPDGGRGATHMRLSQVRDAAGLARLTGSRRWSPPG
NGAKWSAGLMSAAGLSAFDSVVRGDAFTFLETWGDTTLGMVTGSNRFFTL
SPDKVDALGLAPSDLIPLSPPGSRHLRGLALTPKALRALGEEGRSTYLFR
PADEPSPAGWHYIASGEDLDVHRAYKCRVRTPWWRVPYLRPADLFLTYMN
ADTPRLTSNRARTHHLNSVHGVYLRDEFRQDGMNLLPLASLNSVTLLGAE
TVGRAYGGGMLKIEPREADVLPVPSPDLVRRNADQLRRIRPAVATCLRDA
RLLDAVALVDEVLLLGTSTLSERALRAVRRDHAGLTARRITRGKVGKAHG
GE
120406391YP_956220.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium vaMSPSGPCRQSRAWVDNAVRLIEADAHRSADTHLLRYPLPASWSADVALYL
KDETTHITGSLKHRLARSLFLYALCNGWIGEDTTVIEASSGSTAVSEAYF
AAMLGLPFIAVMPASTSSSKVALIESQGGRCHFVDESAQVYDEAQRLAEE
TGGHYLDQFTNAERATDWRGNNNIAESIFQQMGQETHPVPEWIVVGAGTG
GTSATIGRYLRYRRHPTRLCVVDPENSAFYPSYQSGDPDVVTAASSRIEG
IGRPRVEPSFIPGVVDRMISVPDSGSVAAAHHVSRVLGRRVGPSTGTNIW
GAFGLLAEMAAQGCSGSVVTLLADSGDRYADTYFCDEWLTSHGIEPAESA
DVLSEFERSGRWP
120406390YP_956219.1 metallophosphoesterase [Mycobacterium vanbaalenii PYR-1]MPSAPSGSPGSILKATAAASVGTLVAGIGYASLIERNAFVVRETTMPVLS
PGSSPLKVLHISDLHMRPSQRRKQAWVRDLARWQPDFVVNTGDNLAHPKA
VPSVVQALGDLLSVPGVFVFGSNDYFAPRLKNPANYLTNPGHRIHGEPLP
WQDLRAAFTERGWLDMTHTRREFEVAGLHIAAAGVDDPHLKRDRYDTIAG
PASPTANLTLGLTHSPEPRVLDRFAADGYQLVMAGHTHGGQLCLPFYGAI
VTNCDLDRSRAKGPSRWGARTQLHVSAGLGTSPYAPLRFCCRPEATMLTL
VAAPTGGSDVGSRAGHSSPTVSAR
120406389YP_956218.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MPEHPSGPPPRAVTVIKLAWCVLLASVVAAGLMFPVVGGFGLMPNRASDV
VANGSAQLVEGEVPQVSTMTDAKGNVIAWLYNQRRFEVPSDQIANTMKLA
IVSIEDKRFADHNGVDWQGTLTGLSGYLSGNLDTRGGSTIEQQYVKNYQL
LVIAQTDAEKRAAIETTPARKLREIRMALTLDKTFTKPEILTRYLNLVSF
GNNAFGVQDAAQTYFGVNASELNWQQAALLAGMVQSTSTLNPYTNPDGAL
ARRNVVLDTMIENLPEHADELRTAKQQPLGILPQPKELPRGCIAAGDRAF
FCDYALDYLARAGISKDQVAKGGYLIKTTLEPDVQASVKNAINEFASPDL
PGVASVMSVIRPGKDSHPVLAMASNRTYGLNLDAGETMQPQPFSLVGNGA
GSVFKIFTTAAAMEMGMGINAQLDSPSRFEAKGLGSGGARGCPPATWCVQ
NAGNYRGTMNVTDALATSPNTAFAKLIAQVGVQRTVDMAVKLGLRSYALP
GTARDYDPESNESLADFVKRQNLGSFTLGPIEVNALELSNVAATLASGGM
WCPPNPIAEVRDRYGELVSVTTETCEQVVPEGLANTLAVAMSKDDTGAGT
AAGAAGSTGWSLPMSGKTGTTESNRSSAFLGFTNQYAAASYIYDDSTAPT
ELCSFPLRQCGSGNLFGGNEPARTWFTAMTPIATAFGDVTLPPTDPRYVD
GAPGSKVPSVAGMNQDTARQRLREAGFQVADQPTPVNSTAPYGAVVGTSP
TGQTVPGSIITIQISNGIAPPPPPPPPGAPPGLPPPPVGQTVIQIPGLPP
ITVPVLGPPPPPPPPPG
120406388YP_956217.1 transcription factor WhiB [Mycobacterium vanbaalenii PYR-1]MSSIKPAARKTTVDPSDQSILHGAEAEARIAWVSQARCRQTDPDELFVRG
AAQRKAAVICRHCPVIAECGADALDNRVEFGVWGGMTERQRRALLKQHPE
VVSWADFFAAQRKHRTAG
120406387YP_956216.1 anion-transporting ATPase [Mycobacterium vanbaalenii PYR-1]MSGRDTMSHTPPTLDMASILRDTSNRVVVCCGAGGVGKTTTAAAMALRAA
EYGRTVVVLTIDPAKRLAQALGIRDLGNTPQRVPLAPEVTGELHAMMLDM
RRTFDEMVLQYSGPGRADSILDNQFYQTVATSLAGTQEYMAMEKLGQLLA
EDKWDLIVVDTPPSRNALDFLDAPKRLGSFMDSRLWRMLLAPGRGIGRLV
TGAVGLAMKGMSTILGSQMLSDAAAFVQSLDATFGGFREKADRTYELLKR
RGTQFVVVSAAEPDALREAAFFVDRLSTEHMPLAGLILNRTHPTLCDLHA
EKAAEAAEELEQTDPDSVAVAALKIHADRASTAKREIRLLSRFTGANPTV
AIVGVPSLPFDVSDLDALRAIADQITGGAAAA
120406386YP_956215.1 anion-transporting ATPase [Mycobacterium vanbaalenii PYR-1]MATTSSASSVPDGTKQLGWPSRLTKARLHFVSGKGGTGKSTIAAALALAL
AAGGRKVLLVEVEGRQGIAQLFDVPPLPYEEVKIATAEGGGQVNALAIDT
EAAFLEYLDMFYNLGLAGRAMRRIGAVEFATTIAPGLRDVLLTGKIKEIV
TRNEKDQPRGKGHVYDAVVVDSPPTGRIARFLDVTKAVSDLAKGGPVHSQ
ADGVVKLLHSDLTAIHLVTLLEALPIQETLEAIDELREMDLPIGSVIVNR
NIPAYLAPDDLAKAAEGVIDADAMRAGLTTAGITLSDDDFAGLLTETIQH
ATRIAARNESAAQLVELDVSRLDLPTLPDGVDLGSLYELAEELAHQGVR
120406385YP_956214.1 hypothetical protein Mvan_5438 [Mycobacterium vanbaalenii PYR-1]MSERTRWEYATIPLLVHATKQILDQWGEDGWELVAVLPNPTGEQHVAYLK
RPK
120406384YP_956213.1 endoribonuclease L-PSP [Mycobacterium vanbaalenii PYR-1]MSGWSERLDELGIALPEVVAPLAAYVPAVRTGNLVYTAGQLPISNGELAA
TGKVGAEVSAEDAKHLARRCALNALAAVDALVGIDSVVKVVKVVGFVASA
PGFDGQPGVINGASELFGEVFGEAGAHARSAVGVSELPRNAPVEVEVIVE
VS
120406383YP_956212.1 beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYMEHPAYGLLRPVTDTASVLLCENPGLMTLDGTNTWVLRGPGSDEMVVVDP
GPDDRDEHIERLAALGPIPLVLISHRHADHTGGIDRIVDLTGAVVRSVGS
GFQRGLGGTLTDGEVIDAAGLKITVMATPGHTADSMSFLVGDAVLTADTI
LGRGTTVIDSEDGDLGDYLESLRRLHGLGHRRVLPGHGPELDDVVVVSQD
YLTHREERLEQVRAALRELGEDATARQVVEHVYTDVDEKLWDAAESSVQA
QLDHLRR
120406382YP_956211.1 CRP/FNR family transcriptional regulator [Mycobacterium vanbaalenii PYMDEILARAGIFQGVEPSAVSALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDREALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
120406381YP_956210.1 hypothetical protein Mvan_5434 [Mycobacterium vanbaalenii PYR-1]MSWLLVALIPGLLMLATFGLERVESGLGRDTVTPSDVDEFLEQARAGGAP
TPARDGSDRAPHAVDRRPGKRDAPHASLVTTITAQGLPTREYLHQLSNTE
FRQTRHADRV
120406380YP_956209.1 endonuclease III [Mycobacterium vanbaalenii PYR-1]MTVKPARGASPRKSGRKWDEETHLGLVRRARRMNRTLAQAFPHVYCELDF
TDPLELTVATILSAQSTDKRVNLTTPALFKKYRTARDYATADRTELEELI
RPTGFYRNKANSLIGLGQALEERFDGQVPRTLDELVTLPGVGRKTANVIL
GNAFDIPGITVDTHFGRLVRRWRWTAEEDPVKVEHIVGELIERSEWTLLS
HRVIFHGRRVCHARKPACGVCVLAKDCPSYGAGPTDPLIAAPLVKGPETE
HLLALAGL
120406379YP_956208.1 redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]MALVIVVALGAALWAELDADESQPRTQRDAISARDRRDADTPEALAGLRA
RAALEPCPTGGDAGPGPETLRGIELECVGDGSRVDVAEAVAGRPVVLNLW
AYWCGPCADELPAMAEYQRRVGSAVTVLTVHQDENESAALLRLTELGVHL
PTLQDGRRTIAAALQVPNVMPATVVLRADGSVAEILPRSFATADEIAAAV
DPKIGAA
120406378YP_956207.1 NUDIX hydrolase [Mycobacterium vanbaalenii PYR-1]MSWDSREGELTPSAAPPWLAPLVDRPGAVKDAYRRRVPAEVLAALTAANA
TAAVTGARRDAAVLVLFSGPQEGSRGTLPDDADLLVTVRASTLRHHAGQA
AFPGGAADPGDQSPVHTALREAAEETGIEAGRLQPLATLEKMFIPPSGFH
VVPVLAYSPDPGPVAVVDESETALVARVPVRAFINPENRIMVYRRQNTRR
AAGPAFLLNQMMVWGFTGQVIAAMLDVAGWAVPWESDKVYELDEAMALLD
AEGSYGDAQR
120406377YP_956206.1 colicin V production protein [Mycobacterium vanbaalenii PYR-1]MNSSQWLDISILALALIAAISGWRSGAPGSLLALVGVALGAAAGILLAPH
VVSHISGPRTKLFVTLFLILALVVIGEIAGVVLGRAVRGAIRSPGLRVAD
SVVGVALQLVLVLTAAWLLGTALVSSPQPNLAAAVQGSKVIAEVDSVAPS
WLRSVPNRLSALWETAGLHDVLKPFGPTPVAEIDPPDPSLATSPVVNTTR
SSVVKVRGVAQSCQKVLEGTGFVVAPNRVMSNAHVVAGSDSVTVEVDGQT
YDAGVVSYDPNADISILDVPNLPSAPLQFVDAEAQPGTDGIVMGYPGGGE
FTATPARVREVIELNGPDIYRSTTVTREVYTIRGTVKQGNSGGPMINRQG
RVLGVVFGAAVDDVDTGFVLTADEVARQMAKVGNVERVATGTCISAG
120406376YP_956205.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MVRPDPSVVRIGGPWRHLDVHANGIRFHVVEAERQAGADDRSKPLTDRPL
VILLHGFGSFWWSWRHQLAGLTGARVVAVDLRGYGGSDKPPRGYDGWTLA
GDAAGLVRALGHNTATLVGHADGGLVCWATSVLHPRVVQAIAVVSSPHPA
ALRASALTRRDQGQALLPSLLRYQVPIRPERLLTRDDGAELERLVRSRSS
AKWQAGEDFSESIRHMRRAIQIPSAAHCALEYQRWAVRSQLRAEGRRFMS
SMKRPLGVPVLHLRGEQDPYVLADPVYRTQRYAPHGRYVSIEGAGHFSHE
EAPAAVNEQLRRFLNQVYG
120406375YP_956204.1 hypothetical protein Mvan_5428 [Mycobacterium vanbaalenii PYR-1]MAGRKPGVSDRRNGVPNTVTSIPLVDPHAPKPDPSIGDLVKDATAQVSTL
VRAEVELAKAEITRDVKKGLTGSVFFIGALVVLFYSTFFFFFFLAELLDN
WLWKWASYLIVFGIMVVLTGLLALFGYLKVRRIRGPQKTIETVREIPEAF
TPGPDKRSVATTNGDQAPPKDPSGW
120406374YP_956203.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium vanbaalenii PYR-1MRISGRSVPVRAAILALTALLTLTIVPAHAATPVPLGGGSGLVVNGETLC
TLTAIGTDNQGSLIGFTSAHCGGPGAVVAAEGAENTGPVGTMVAGNDVLD
YAVIKFDPARVTPVNTVNGFRIDGLGPDPRFGDVACKLGRSTGYSCGVTW
GPGQEPGTILNQVCGGPGDSGGPVTVNNRLVGMLHGAFSEDLPTCVVKFI
PLHTPAVTMSFNTQLADITAKGRPGSGFVPVGATY
120406373YP_956202.1 hypothetical protein Mvan_5426 [Mycobacterium vanbaalenii PYR-1]MGAAPGGPLDAGLQPFLGTITVDSSRAAVLADWWSAVLGGTVDGFEDYHV
WVVRSPRLRGINLAFQQVETPTPGKNRIHLDLGAVDPHATAAALVQRGAS
VVAEQVAGGVTWLVLADIDGNVFCVSDTGPFTPA
120406372YP_956201.1 acetyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MQRLVTTLTTMTETQLDAIASYPPPPEFTESANATAELYDEAEADRLAFW
AKQANRLSWQTPFTEVLDWSDAPFAKWFVGGKLNVAYNCVDRHVEAGNGD
RVAIHWEGEPVGDARDITYAQLKDEVCQAANAFAELGLKAGDRVAIYMPM
VPEAIIAMLACARLGAMHSVVFAGFSASALKARIEDAQTKLVVTTDGQYR
RGSAVALKTAVDEAIESLGDDNPVEHVVVVRRTGIDIAWTQGRDVLWEEV
VPKASTEHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQASYTHY
NVFDIKPETDVYWCTADIGWVTGHTYIVYGPLSNGATQVVYEGTPASPDE
HRHFQVIEKYGVTIYYTAPTLVRTFMKWGRQLPAEHDLSSLRLLGSVGEP
INPEAWRWYRLAFGGDNTPVVDTWWQTETGGIMISPLPGVTHCKPGSAMR
ALPGISAKIVDDDGNELEPSPDYGEHVTGYLVLDKPWPAMLRGIWGDEER
FRETYWSRFAEKGWYFAGDGARYGTDGEIWVLGRIDDVMNISGHRISTAE
VESALVGHSGVAEAAVVGASDEHTGQAICAFVILKSSAHGGEANMVDELR
AEVAREISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTL
LDPSVFEAIRASK
120406371YP_956200.1 hypothetical protein Mvan_5424 [Mycobacterium vanbaalenii PYR-1]MPPALRPSGRLPCPGVTPDDPLAPLTTLPGVAEAGEEAREALGRAHRHRA
NLRGWPKSAAEASLRAARASSVLDGGPLQFANVDDRDPVLAGALRVAEAL
EGGEGALVGVWRRAPLQAIARLHALAAADLADGDTLGRPRRDEGVGRRLE
LLADLVTGGTRVPAPVLAAVAHGELLTLAPFGTADGVVARAVSRLITIAS
GLDPHGLGVPEVHWMRRSGDYRAAARGFASGTPDGLAAWLVLSSEALHAG
AREALSIAQGASS
120406370YP_956199.1 HAD family hydrolase [Mycobacterium vanbaalenii PYR-1]MQSQTGVVNCQFVQSEAVCHAAHAYADDVTSPDPAVGGSQTPPAPTPPDR
PIRTAAFFDLDKTVLAKSSTLAFSKPFYSQGLINRRAVLKSSYAQFLFLM
SGADHDQMDRMRTYITNMCTGWDVEQIKAIVGETLHDIVDPLVFAEAAEL
IADHKLCGRDVVVVSASGEEIVAPIARALGATHAMATRMVVEDGKYTGDI
AFYCYGEGKAEAILALADREGYALEHCYAYSDSITDLPMLATVGHPTVVN
PDRTLRKEAAARGWPVRTFSKPVSLRDRLPAPSGAAVATTAAVGVSALAA
GALTYSLLRRFAF
120406369YP_956198.1 hypothetical protein Mvan_5422 [Mycobacterium vanbaalenii PYR-1]MTATEAILALVDDRALSADIDRVVAAAGVRIVRATDPSSHRVWTGASAVL
LDTAAAQRCAARGLPRRPRVLLISGDAPGPDEWEAAVAVGAQQVVTLPSG
DHELMAELADATEAARHTGLRGPVVAVLAGRGGGGASVFATAVAKVATEA
LLIDGDPWGGGLDLVLGSETEPGLRWPDLSLAGGRVGFSALRDALPTRHG
VYVLSGSRALSGTHSSNDIDAAALGAVIDAGSRGGVTVVCDVARRPTPAS
ETAVASADLVVLVTPADVRSCAAAAATAQWVAGGNPNAGVVVRGPSPGGL
RSVDVARIVGLPVLASMRPQPGIDTLLERGGLRVRPHSPLARAAREVLAV
LSQSPQLEAAAEAVA
120406368YP_956197.1 type II secretion system protein E [Mycobacterium vanbaalenii PYR-1]MSAPLIDRVRERLAMQSSPLRPSVVAAAIRAESGGVLGDAEVLTNLRELQ
TELIGAGILDPLLSGPGVTDVLVTAPDAVWVDDGNGLRRTSVRFADDAAV
RRLAQRLALTAGRRLDEAQPWVDGNLSGFGAGQPGGPLSVRLHAVLPPVA
AGGTCLSLRVLRPANQDLDALIGAGAIEPDAAGILRDVISARLAFVVSGG
TGAGKTTLLAALLAAVPEDERIVCVEDAAELAPDHPHLVKLVARCANVEG
AGEVTVRDLVRQALRMRPDRIVIGEVRGAEVVDLLTALNTGHDGGAGTVH
ANNPAEVPARFEALAALGGLDRAALHSQLAAAILSVTGCGVCRTVTHVGF
RWGFLVGDTVICNGVTDVGSRWVLLCCGGGAVRRVRWRGLVRGFCSRL
120406367YP_956196.1 Tn554 transposase C [Mycobacterium vanbaalenii PYR-1]MTTPRSTDAIVAHAKKRYAATENKIAKAIKDMRRKGLTINPQTVAKHARV
SRKSVYNHSNLLDQIHAESAKPTLNPAPTTPQPDTESSIVTALREQLRTQ
KQRYQTEIAELKAENKTLEQALATAHGELHRLRNTATPTASQRR
120406366YP_956195.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MDPPPPRGAASSPVAVSSWQSQWARVPGQWRKPVYPIDTAPFQEVFLRNQ
FYLRGNRAGAAHDFTPAAPPRFAEEIAWWVWWCWDQQLRKIEPSLLAWLV
RTLPAAISEHTTRTGAAPTSIAELDPTELIRQAALSFQRRNNRLPSPGSR
RNISHLIEHLHLNVSVSCTDTPWWAHDIWDLRADPRIPQRPHEPCHDQTV
RLRGITPDWLREGLRFWLRSALTYDLLTWSSVVDRARNLGSQLGHFATTA
GHLQDPLISTDPDQLRTVFLDYLDYLRSPQAATHSERLTSDTVASLQAQT
QSFYTFMHDHAAEAATATATARWRDITLTHTALWSPINAPKHRRRARELT
WHSTADLQRMLAYLDVLAAEPKQKVVLTGPDGDLSVLAGLGDPQAARIWL
LQALTGRRASEILMLDYDPLEAIPGQDRPVGTEPDNGAFVARLRYQQTKV
DGIVPTILVEQAIVDIIGEQQRWLTTKYPQLQSKYLFLGLKNQHRGQRPR
SYTTYRAMLDKLDKCHTLTDSAGRALRFTQTHRLRHTRATELLNDGVPFH
VVQRYLGHKSPEMTARYAATLAATAEAEFLKHKKIGAHGADIDITPHDIY
EMTQLAARTDRVLPNGVCLLPPLKQCDKGNACLGCGHFATDTTHLDELRA
QLAATEALIATRRDQYRQRAGRELGDDNIWIIERHREIDSLHAIIDRLAA
TADNSVAGPGTGKRLPLLQIQTRGAHQSALDKASRPRTGEQ
120406365YP_956194.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MARTQRIALAEDTDTFTVVGPDFLPIDPAEEFLQFLRDDEASPNTVKAYA
AGLAAWWTVLEHTGTDWREISTSLFGQFLAYLRTGDLPGTARIGAPEGWL
GAASTALRAAAVLACYRYHADAHGLVGPYQRLHTSRGKRGRSRYIPMLAG
VGAARPAKDRPIYTVRRGNRAATPVLLPAQVGLILDGCATQTGHEWSGPA
SGLRDRLLFAVLAETGMRLGEALSLRHHDFHIGAGGTPWIDIAARQDHPR
GARGKTLSPRRVYIGDDLEALYSSYVWHLIDHGADLAVPDLTTHFVFVNL
TAGTPFAPTRPETVYAKVDSVTSRAAGALPQGWSPHWLRHTHATALLLSG
AAPHVVMRRLGHADIQTTLSTYGWVTEDAEMRTLAQWRNYVAGWKGLTP
120406364YP_956193.1 hypothetical protein Mvan_5417 [Mycobacterium vanbaalenii PYR-1]MTVEVFGARVRQARVLRQMTATAVMEHMGWRSPRQTRLEQAETATLDALE
FEALVALLRFPARFFTTAPVSRVAARDLLFRAPKATTVTEKEYLAVFANV
VGDLVDQLNGVEKGPVVALEPLPVGTDVVTAAAKARAWLGREACEPIRYL
TYDLEAAGVPVVLRTKHSRSTGRIDWDTQDEEPAGGLTEKHLGCSARTGE
FRQRPLVLMRSIDSWERSRWTVAHEIGHLVLHRHGEVSDDQENEASRFAS
EFLAPAAAIAAEITDAPTLNHLMPVKLKWGISLGALIMHLRESKLIDEHR
AAMLQRQLYTRINSETGRTWGKTEPGWDARLPEQPRLLIKWVEACYGATS
VEMLAALDLIFPADLLADILAGQRGASAPRPARVDVALAPVGGTDRGDTV
VVAASERFRSRRQA
120406363YP_956192.1 hypothetical protein Mvan_5416 [Mycobacterium vanbaalenii PYR-1]MDLQELVERLMKQHRSAFARLLGEIEAAYDEVVALHARRFPDPRQIPGGM
LCGDVRATVLAMNGMDALTRTGESTREVPTSASCGPDSTLRMTSGSNTSV
RLGDSNMAMARVRKLAPDVVDGLALFLPQATPAAKPGVQLFLDDGAAEPV
MGPPGLEQEYELIVYWWPTPDKASVAGAILAAVADLNTNDERILVFTALP
PAIRPKTAAEEQQAVTDYQPDGDFNEIFGKKSTDTGDPGA
120406362YP_956191.1 hypothetical protein Mvan_5415 [Mycobacterium vanbaalenii PYR-1]MFTRRATITTATILALAGSVAIGLSGGETTTLAQPPGGVSSTSGPALPVQ
GPWDQCWGPNGWDPNCWGPGPWGPGGYGPGMTGPGGYGGPGMMGPGGYGP
GTMDPGQWGPGMMGPGQWGPGQYGPGMMGPGPWDY
120406361YP_956190.1 hypothetical protein Mvan_5414 [Mycobacterium vanbaalenii PYR-1]MRSHRLWLILAIAIASVILGVTTTAIWHPGGPFGRQTPVANAPYPNAPGA
WGPGSMGPGMMGPWRYPAAPPPSCSAPALPGAVVDVTLADMGAMMGPGGM
MGPGMMSRGGMMGPGMMGPGWNGPNGPGQTGYRWPGMGMMRIVVTPASVP
AGPVSFRVLNTGGLSHELVVLPLAQGQYPGWRVTGPDGKVDEAGSLGEAS
RTCGADKGDEQSPQYGIGPGGTGWTTITLTPGRYELICNIAGHYWAGMYA
ELDVTSPPK
120406360YP_956189.1 hypothetical protein Mvan_5413 [Mycobacterium vanbaalenii PYR-1]MYDGWGWGGMGSGGWILMTVLMVLFWAAVITAVVLAIRYLTGPRHTGAHP
PGPGPARAEGLLAERFARGEIDEDEYQRRMTLLREHR
120406359YP_956188.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MTMDSAGCLAGPASGVDAAVALFRGLSDGTRLAIVGRLAHREARVADLVA
ELGLAQSTVSAHVGCLRECGLVAGRPQGRQVFYSLTRPELLDLLAAAETL
LAATGNAVALCPNYGTGSASGSACE
120406358YP_956187.1 heavy metal translocating P-type ATPase [Mycobacterium vanbaalenii PYRMSDTCCGHDDPGAERDERERGPEKLWQVSEIRAAALAGVLLLAGLIVGWA
GGPGPVTLVAEAAALVIAGVTFVPSTLKRLVAGKIGVGTLMTIAAVGAVS
LGEVGEAAMLAFLFAISEGLEEYSITRTRRGLRALLSLVPAVATVRRGGR
EYRVAPTELAVGEVMVVKPGERIATDGVITAGRSALDTSAITGESVPIEA
GPGDAVFAGSINGTGVLDVQITATATDNSLARIVAIVEAEQARKGSSQRL
ADRVASPLVPAVMVAAAIIAVAGSVVGDPRVWIERALVVLVAASPCALAI
AVPVTVVAAIGAASKMGVLIKGGAALEALGRIRGIALDKTGTLTRNQPTV
ITVVPADGVSGGEVMAVAAALEARSEHPLAAAILAATDQLTPARDVESVP
GAGLSGWLDGSLVRLGRPGWIQPGPLAEVIDRMQRAGATAVLVERDGAVL
GAVAVRDELRPEAPEVIGGLRAHGYQVAMLTGDNERTARALAADAGIDDV
HADLRPEDKARIIEELRSRRPTAMVGDGVNDAPALATADLGIAMGAMGTD
VAIETADVALMGQDLRHLPQVLSHARRSRRIMLQNIGLSLAIITILLPLA
LLGVLGLAAVVLVHELAEIVVIANGVRAGRTQPLAGIPQPHGRRVSTRRA
TAQIGNAAHR
120406357YP_956186.1 hypothetical protein Mvan_5410 [Mycobacterium vanbaalenii PYR-1]MTKLALSTTLHTSFDDAVTRTRKALADHGFGVLTEIDVKATMKAKLDVDM
ADYLILGACNPPLAHQAVLSDPEIGLLLPCNVVVRADTTHGNDTVIVDAI
NPALMADLSDAPGVAQVAEQVTTKLQAVIDALDHT
120406356YP_956185.1 hypothetical protein Mvan_5409 [Mycobacterium vanbaalenii PYR-1]MRAAGAVGHRPRCWRTPAIKGRPALVRPANPIVVDGNPDPEACLCRLDIA
DAVELTELLQFVNDWLASDTGRLDASLTHYVGHPGCTADELRADLDRFIF
LLWQRRRTTLRTRIARSTPPMP
120406355YP_956184.1 hypothetical protein Mvan_5408 [Mycobacterium vanbaalenii PYR-1]MTETPESRTEPTAVATEQGRGELSPGSDRPNRLTQSAAWVGIVAGVVFIV
AVIFFSGFFVGKQYGGGYRDGRGMSYPGGMMGPGGMMGPGGMMGPGGMMG
PGGPGGMMGPGGPGGMMGPGSWGPGGMMGPGSWGPGMMGPGQQPSPTTTP
AVPTTPQR
120406354YP_956183.1 type II secretion system protein [Mycobacterium vanbaalenii PYR-1]MTAAALALAAAVLVAPAGSRWRRVLSAPPSRRLRLPVPVCGALLCAVTAL
LLSPAAVLAAALLMATLSVRSRAARRRRNRVTEAAALQGALDVLIGELRV
GAHPVAAMNTAAQESDARIAGALGAVAARALLGADVAAGLRAQGRRSLLP
GHWDRLAVCWHLAQAQGLAIATLMLAAQRDIAERERFRGRVEAGLAGARA
TAAILAGLPVLGVLLGHAIGAEPLSFLFSGGFGGWLLVTGTVFVCCGLLW
SDRITTGVLT
120406353YP_956182.1 type II secretion system protein [Mycobacterium vanbaalenii PYR-1]MTWAALFLAAAALAVPNVSATRMRRQDLQSVRDTRRHPVTDDILAVAASL
DVLAACLRSGMPVASAAAAVAESAPAGLAMLLRRAADLVALGADPNRAWA
NPDGVADRYVDAFLRMARRSASSGTALAQGVEDLAVQLRGEAVDAASARA
ERASVLMAAPLGVCYLPAFLCVGIVPVVAGLAGEVLQSGLL
120406352YP_956181.1 hypothetical protein Mvan_5404 [Mycobacterium vanbaalenii PYR-1]MREHLRDIRTRLLVLAVADDGMSTVEYAIGTIAAAAFGAILYTVVTGDSI
VTALTNIISRALNTNV
120406351YP_956180.1 hypothetical protein Mvan_5403 [Mycobacterium vanbaalenii PYR-1]MALVAVLVVCVAGLTAVSMQVRCIDAAREAARLAARGDDASATRVARQIA
PARAVVAVRRDGDFVVARVTAGSAVLPGIVIAAEGVSAVEPVG
120406350YP_956179.1 hypothetical protein Mvan_5402 [Mycobacterium vanbaalenii PYR-1]MLAVTSGGAILGAAVTARHRAQAAADLAALSAAAGVPAGHTAACGRAEHV
AHAMGARLTECAIDHLDVVVRIEVTVGTGGTGLGPASALARAGPATPAG
120406349YP_956178.1 protein kinase [Mycobacterium vanbaalenii PYR-1]MTGRETLVGRYELRGLLGCGGMAEVRDGWDIRLDRPVAVKLLHPNFNADA
DARARFCDEARSAAALSHPNIVAVHDFGEHDGRPFIVMERLPGRTLADLI
AQGPMAPAQVRAMLDDVLAALDVAHTAGVVHRDIKPGNILLSATGDRMQV
ADFGIAKSGGAAHTMTGQIVGTLCYMSPERVSGAPASVADDLYAVGVMGY
EALLARRAFPQESPVALVRAIVDAPPPALAGLTGGADPVLAAVIDRAMSR
DPRRRFGSAAQMRAALAGDVTALSTAAEPRPLTKVLAAPLPPSAAYPAPA
PRRPATRARRYVVGAAAVMTAFVISALALAMDPFSSSAPRPEPVSTSTSA
PSPTTPPPPPITTPPPSPAPAVTAATQQPEPQQGRDDKGPRGNGRGNGKG
KGEKKD
120406348YP_956177.1 hypothetical protein Mvan_5400 [Mycobacterium vanbaalenii PYR-1]MTHDWLLVETLGTEPVVVAHGAYTKNLVPVATYLRRSPHLMAIQTAIGET
VRGGGGLSSITPKNDRVIRTEVVQMSDGRIHGVQVWVGAPDESPPERPLV
GPLLWDLTAGTATDTTESLRVGGWDPANQSTHGRAFADDLPRRDLNPNEA
EVLSMVIKPEAGVTLCNTWDVTDYRGQPITVGFVARSLPEALEDGGERLI
CRAMNWRSVREGASLQHDLLGQRIVDGLRQPGVYRALVDPRNWTLLKWLD
EPVPFLDRHANRESEQAIHPQDMHVMSAMADQFATGVASGVLRLVGHNGG
WTPVHVTVNRVKLGKGVYAGLASLRKPTPAELTAAGLDCAPESTGRRPKA
LSRKDKASRA
120406347YP_956176.1 DEAD/DEAH box helicase [Mycobacterium vanbaalenii PYR-1]MTDPGPDFGRELLACAVDGTAAGEYPLRHVADLPPRRARAQAWPHWADPD
VVRAFHDRGVEALWSHQLAAAELARDGRHVVLSTGTASGKSLAYQLPILT
ALKENPRSRALYLSPTKALGHDQLRAAAALTAAVPGLADVAPTPYDGDSP
TEVRRFARERSRWIFSNPDMIHLSMLRNHARWAVFLRHLQYLVIDECHYY
RGIFGSNVAMVLRRLLRLCARYSATGADFSGPTVIFASATTAQPAATASE
LIGQTVAEVTEDGSPQGARTVALWEPALIADLVGENGAPVRRSAGAEASR
VMADLIAEGARTLTFVRSRRGAELAALGARARLADTAPELAQQVASYRAG
YLAEDRRALERALAEGELRGVATTNALELGMDIAGLDAVVLAGFPGTVAS
FWQQAGRAGRRGQGALIVLIARDDPLDTYLVHHPAALLDKPIERVVIDPA
NPYVLGPQLLCAATELPLTDAEVRMWGAEPVAESLVDDGLLRRRPSGFFP
APGLDPHPAVDIRGSTGGQIAILEAGTGRMLGSAGAGQAPASVHPGAVYL
HQGESYVVDSLDFEDAVAFVHAEDPGYTTFARELTDINVTGAGERAGYGP
VTVGLVPVSVSNTVTGYLRRRMDGEVIDFVELDMPTRSLETMAVMCTITP
EALQDNGIDPLRLPGSLHAAEHAAIGLLPLMASCDRGDIGGVSTAVGPVD
GLPTIFVYDGYPGGAGFAARGFRTMDRWWEATASAIEACECPSGCPSCVQ
SPKCGNGNDPLDKDGAILVLRMVVRLLTGRTD
120406346YP_956175.1 cold-shock DNA-binding domain-containing protein [Mycobacterium vanbaaMPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAI
120406345YP_956174.1 hypothetical protein Mvan_5397 [Mycobacterium vanbaalenii PYR-1]MFSYRAHTADRPGGRSAGSRWPSVWGVSQLSFFSAESVPPTIADLTGILA
AAGQVVLVGGARDQAARLSVVVDQVWRAEGLAEMIEDAGLAAEISRTDED
SPLVRTAVDTRLVAIATEWTRGAVKTVPPQWLPGPRELRAWTLAAGRPED
DRYLLGLDPHAPDTHSALASAMMRVGIAPTLIGTRGSRPALRISGRRRLL
RLVENVGEPPDDAAALTQWPQI
120406344YP_956173.1 DNA topoisomerase I [Mycobacterium vanbaalenii PYR-1]MADEERGSGKNGAEPRRGNGSSVRRLVIVESPTKARKIAGYLGSNYIVES
SRGHIRDLPRNAADVPAKYKSEPWARLGVNVEHNFEPLYIISPDKKSTVA
DLKDKLKNVDELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEITEP
AIRAAAEDPRDLDNDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGR
VQSVATRIIVQRERERMAFRSAGYWDVTAELDASVSDAQASPPTFVAKLN
TVDGRRVATGRDFDSLGAVRKPDEVLVLDEAAANALATGLRGAQLAVSSV
EQKPYTRRPYAPFMTSTLQQEAGRKLRFTSERTMSIAQRLYENGYITYMR
TDSTTLSQSAIDAARNQARQLYGEEYVHPTPRQYTRKVKNAQEAHEAIRP
AGDVFQTPGQLHSQLDTDEFRLYELIWQRTVASQMADARGTTLSLRIAGA
APATTLGGGTASDVQVVFNASGRTITFPGFLKAYVESIDDLAGGEADDAE
SRLPNLTQGQRVDAKGLTADGHTTSPPARYTEASLIKALEDLGIGRPSTY
SSIIKTIQDRGYVHKKGSALVPSWVAFAVIGLLEQHFGRLVDYDFTAAME
DELDEIAAGHERRTNWLNNFYFGGEHGADGSIARSGGLKKLVGGNLEEID
AREVNSIKLFDDAEGRAVNVRVGRNGAYLERMVADPDNPGELKPQRANLK
DELTPDELTLELAEKLFATPQEGRSLGVDPATGHEIVAKDGRYGPYVTEV
LPEPPDEGEAGATAKKGKKPTGPKPRTGSLLRSMDLETVTLEDALRLLSL
PRVVGVDPASGEEITAQNGRYGPYLKRGTDSRSLATEEQMFDITLEEALK
IYAEPKRRGRQGAATPPLRELGVDPVSEKPMVIKDGRFGPYVTDGETNAS
LRKGDDVLSITDARASELLADRRARGPVKKKAVKKAPAKKTPAKKTAAKK
AAKKA
120406343YP_956172.1 putative adenylate/guanylate cyclase [Mycobacterium vanbaalenii PYR-1]MAAEPIEVGRISAFVRWVARTPWPVFTLGMLQADIIGALLVLGFLRFGLP
PEDRIQLQDLPAYNLAIFLGYLFISFTVASYVTLRMLIPVMRWQRREMLL
GDRDPAETEVARMRALKMPFYRSLISATNWLLGSVVFIVASWPVASKSAP
VVAVATALGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVILRQ
VLSWVLSTGVPVLAILLALIASKLEVLTAPADRLITTILLLSIVALVIGL
SSTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLAERQRLRDLFGRYVGEDVARRALERGTELGGQERDVAVLFVDLVG
STHLAATRPAAEVVNLLNEFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDASGAALAASRELHDELIRVLGETDFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEPGHVLASAIAVADALDAEALCWDVGEIV
ELRGRTAPTQLARPVNLVSPDDVSQEVASDRR
120406342YP_956171.1 DNA polymerase III subunit delta' [Mycobacterium vanbaalenii PYR-1]MTGVFSRLVGQDAVETELTAAARAARGDSPHTSGLDVSGVTGTMTHAWLI
TGPPGSGRSIAALCFAAALQCTSDGTPGCGECRACATTMAGTHADVRRII
PEGLSIGVDAMRAIVQIASRRPGTGRWQIVVIEDADRLTEGAANALLKVV
EEPPPSTVFLLCAPSVDPEDIAITLRSRCRHVALVTPPVDAIARVLIDSD
GLPEKDAEWAAAVSGGHVGRARRLATDERARERRQRALGLARDAATPSRA
YAAAEELVATAEAEAKALTEDRNEVEAEELRTALGAGGTGKGTAGTMRGA
AGALKELEKRQKSRHTRASRDALDRALIDLATYFRDALLVSSGATDVVAN
HPDMAEKVAAMAAHASPEKLLRCIEAVLECREALAVNVKPKFAVDAMVGT
VGQALRS
120406341YP_956170.1 hypothetical protein Mvan_5393 [Mycobacterium vanbaalenii PYR-1]MAVDIFKDPLFTPREVSVYLQIPRSTVYQWLHDGSRGDAPLVHHVEIGRR
GAASVPFAALIEAFVLRALRNELGFTKRQISDTVADVRETFGTDFALASK
RIATDGIDIFIHHADDEFARVGDHQILIRDVVGDYLRYITWDDKGEYAAR
LKLRGFGDDASVVVDPKFAWGQPVIERNKVPIRAVIDLWAAGEPLTVVAD
EYGLSIPEAEEICRVGLKRAA
120406340YP_956169.1 hypothetical protein Mvan_5392 [Mycobacterium vanbaalenii PYR-1]MDSNEPPEFFLDRSLGKRVAAGLTERGWRIHRVVDHFANDAQDIPDEEWM
RYGLVRGWFPLHKDGRIRGTEAERRPLIEFNAPMFYLDNQQLRIDEMVAR
FHAAQRQIYTRTRVAGAACFAVSAHGIRRTWP
120406339YP_956168.1 hypothetical protein Mvan_5391 [Mycobacterium vanbaalenii PYR-1]MRDVAAHTVGYLGQSVPGLIRNMIRDRGDVDRLNARMLPAVAALTPAELV
ELMGRDSTPTGAAGLYGGRVALIECVIHQQDIRRPLGLDFDVPEDSLRVS
LDYARISPVIGGTRRTRGLRLVATDMDWSAGTGPEVCGTAEALLLAMTGR
ADAVRAELSGEGIPHLR
120406338YP_956167.1 hypothetical protein Mvan_5390 [Mycobacterium vanbaalenii PYR-1]MNRVARAAAALIALQLVIRAVLAFGGYFYWDDLILVGRAGTQGLLSPGYL
FDDHDGHVMPGAFLVAGVITRLAPLEWIGPAISLVILASAASLALLRALY
VILGWRPVLLVPLTFALFTPLAVPGFAWWAAGLNSLPMLAAMAWVCADAI
LLVRTGNQRYAWTGTLVFFGGLLFFEKSAIIPFVAFTVAALYGHVTGTAT
VRQVWRRGARLWTAALAVTAAWIGVYLLVVDQQRWSFDLAMTWDLLSRSF
THGIAPGLVGGPWDWQRWAPASPWATPPPAVMVLGWSTLAAVVAVSLLRK
RRIGPVWLAALGYAVACQVPVYLMRSSRFTALELAQTLRYLPDLVVVLAL
LAAVGLCAPNRDRARWLDHSTRRTVVTVCAATAFVVSSLYSTSTFLTSWR
DNPAQPYLQNARAGLARAHASSDAPMLDQEVDPLVLQRVAWPENLASHMF
ALLRDRPEFASATTDLRMLDTAGNLVDAKVTWVRTIRPGPDARCGYLVQP
DFPVRMPLDGPLLPADWTVEINYLGNSDGSMTVSLSEGDEVKVPVRPGLN
RVYVRLPGAGDAITVSANTAALSVCVASGPVGFVAPV
120406337YP_956166.1 UDP-glucose 4-epimerase [Mycobacterium vanbaalenii PYR-1]MTWLVTGGAGYIGSHVVRALRGADLDVVVIDDLSTGRAEFVPDGVPLVRA
NLLDADAVRTTLDAYGVSGVIHIAGYKYAGESVRRPLHTYQQNVSAMVTL
LDAMSDAGVDRIVFSSSAATYGTPDTAVVDETTATRPESPYGESKLIGEW
LLRDIGVATGLRHTSLRYFNVVGSGPDGVFDVSPFNLFPKVFDMLVHGQT
PRINGDDYPTPDGTCVRDYIHVEDVAAAHVAAAHRLESGLPIEPVYNLGS
GSGTSVREIMTTMRAVTGVDFEPDVAARRAGDPARIVAAGDLAARDLDWR
MRHSLTDMVASAWSALPSRATDEAAP
120406336YP_956165.1 putative integral membrane protein [Mycobacterium vanbaalenii PYR-1]MTDATAGPSGAVTRGSVVRVGAATAMSAMCGYAVLYLAARDLEPAGFSVF
GVFWGAFGLASGAAFGLLQETTREVRAPSWNPDGTYTRPMRVAAGVGVGA
AAVIAVTSPLWSGHVFVDARGLSVALLSAGLAGFCLHTTLLGALAGMNRW
SEYGALMVTDAVLRVVVAAATFALAWGLGGYLWATVAGSTAWLLMMLVSP
ATRAAARLLTPGGTATFLRGAGHSIAAAGASAVLVMGFPVLLKATSGDLG
AAGGVVILAVTLTRAPLLVPLTAMQGNLIAHFVDQREHRLKALVAPAALV
GALGAAGVALAAAFGPWLLREAFGAQYHADGTLLGWLTAAAVAIALLTLT
GAATVAAALHRAYAAGWVIATVAATLLLLLPLDLEVRTVVALLCGPLLGI
AVHLSALARARSIRWHTPAPSDTKETP
120406335YP_956164.1 peptidase M1- membrane alanine aminopeptidase [Mycobacterium vanbaalenMTARKRAAKKSSPPVIDPYLPGAGNFGYRVSRYELELEYKVTINRLSGAA
TITAVTLAELKTFTLDLSGALSVSKVTVNGRRPAHYRTSADKLHITLSER
LPAGAAMTIAVRYGGTPRPIRSLWGEVGFEELTDGVLVAGQPNGASSWFP
CDDHPSAKASFRVQIATESAYFALANGKLLTRRARAGMTTWIYEQAEPTS
TYLITLQIGMYERHRMAKNGVEIFAVLPRRLRDDFDHDFGRQPQMMKLFT
KLFGPYPLANGYTVVVTDDDLEIPLEAQGISIFGANHCDGRRGEERLIAH
ELAHQWFGNSVTVQRWRHIWLHEGFACYAEWLWSEHCGERTVDQWARHYH
ERLKNSPHNLVLADPGPRDMFDDRVYKRGALTLHALRNHIGDTEFFALLK
DWTNRYRHSSVVTDDFVGLAARYAHDSLRPLWAAWLYSPEVPELDAGS
120406334YP_956163.1 non-ribosomal peptide synthetase [Mycobacterium vanbaalenii PYR-1]MTAADRTPEIPSQYLLSAFAPESRTLIDILYDTARRYPDAPAIDDGTVQL
TYAELISDVEDSVAWLGARGIGRGDRIGIRMPSGSYALYVAILATLATGA
AYVPVDADDPQERADLVFTEAAVVAVITEQGLVRGPGSSRGWRAAAPLSR
DDAWIIFTSGSTGTPKGVAVTHRNAAAFVDAEAQIFLQDNPLGPGDRVLA
GLSVAFDASCEEMWLAWRNGACLVPAPRSLVRSGMDLGPWLVSRDITVVS
TVPTLASLWPAEALEAVRLLIFGGEACPPELAERLAAGPDSAGREVWNTY
GPTEATVVACAARLDGRSAVSIGLPLPGWDLAVVDKEGRPVAPGEVGELV
IGGVGLARYLDPEKDAEKYAPLPYPSDIAHWTRAYRSGDLVRLELDGLYF
VGRADDQVKVGGRRIELGEVDTALVHLPGVSGGAAAVRRTAGGTPLLVGY
IAVAPGLEGSFDVHEARARLSESLPAALVPRLVVVDELPTRTSGKVDRDA
LPWPVGGDDSDEGADLGGGTLGWLAGLWREVLAAPVDGPEADFYALGGGS
LSAAQLVSALRQRYPEVTVADLYDHPRLGSLAGYLDELAPPPAVETRVVK
PVSRLTQAVQVALTVPLAMLTGMQWVVWLAVANNVAAELSLVDWVKPIDW
WWILGGFLLFVTPPGRMSIAVFGARVLVGSLQPGTYRRGGSVHLRVWLAE
RLAEASGAENMAGAPWLVYYARALGNNVGKGVDLHSAPPVTGMLTLGHRC
SIEPEVDLSGHWIDGDLFHIGAITVGNDATVGARTTLLPGAVVGKNADVA
PGSAVIGKVKNGQYWKGSPAVKSGKAKHPWPDHRPPRAPVWVFVYGVTSV
LLGALPLAALAAGLAVIGWGVRGTPSVTGAVVPALLWLAPATAAALVVYA
LFTVVGVRLLAIGLDEGYHPVRSRSGWQLWATERLMDAARNYLFPIYAGL
LTPWWLRLLGAKVGKGTEISTALLIPKFTVIEDGAFLADDTMVASYELGG
GWIHVARATIGKRAFLGNSGITQPGRRVPDDGLVAVLSATPYKAKAGSSW
LGSPPVRLRRKPTAADALRTFHPSRRLKVLRGTVETFRFVPVVVTFAIGV
AVLWSVQYLAVTFGWIWAGLAAGPILLTAGAVAGGVAAIAKWLVVGRITA
IEHPLWSAFVWRNEVSDTFVETVAAPWFARAATGTPVMNLWLRALGAKIG
RGVWCETYWLPEADLVTLADGATVNRGCVVQTHLFHDRIMRMDTVVLEEG
ATLGPHCVALPAARIGAGATVGPASLVMRGDEVPPSTRWQGNPIAPWHPS
RKKRSDSADPKPKKSTAA
120406333YP_956162.1 integral membrane protein TerC [Mycobacterium vanbaalenii PYR-1]MNVSGLEWAITLTVTLAILLFDVIVIGRRPHEPSRRETATALTFYVGLAI
AFGLWTWFFHGSQYGLEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAIQQFSWVFYIFGAFLLYTAVKLVKD
TDHDDDADNAVVRFAQKRMKFTDQWDGLRLWVTENGQRLMTPMFLVIVAL
GTTDLIFALDSIPAIYGLTREPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILFFIGVKLVLHALHENELPFINGGEHVPVPEIPTLLSLGV
IVVTLILTTIASLYKTRVHDVRKNGASTEKTEADPHPDPSR
120406332YP_956161.1 hypothetical protein Mvan_5384 [Mycobacterium vanbaalenii PYR-1]MADDGGVSELTDGDQQIVRVTAPDLQQARRVRARIRAGSGDVAVILDITV
AVAADFRSAQQVSGPADSRTVHYAGTVAGLAGLISDIASAEVADGVTLIP
ASPRQDVGTVGRDVLGRLAARDQPRAS
120406331YP_956160.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MWSDMSDVAGLCDPRFESVAAALADEIACGEELGASIAVDLDGELVVDIW
AGYVDRAKTIPWQRDTIVNFWSCTKTLTALAALILVDRGELDPFSTVARY
WPEFAANGKADIEVRHLLSHTSGVSGWQTPFGVEDIYDWAKATSHLAGQA
PWWQPGTASGYHAMNYGHLVGELVRRITGTPLKDFVAEQIAVPLGADVQI
GARPEDDHRIAELVPPPPRDRGVDRLPPDHPAVKTFAAFPPGAYGAAHAE
TEAWRRADIGGANGHGNARGLVRALSPISLGGTANGVQVVDPRTVELIFA
EQSSGMDQVLFVPLRFGIGFGLPTPQSVPAVPDGKVCWWGGWGGSLVVMD
LDRRATFAYVMNKMGGGTTGTPRTVRYAKLIDAALQDARG
120406330YP_956159.1 putative OHCU decarboxylase [Mycobacterium vanbaalenii PYR-1]MLHQGIGLDAFNALPMRRAVHAVFECCYSVPLAADLARARPFDTHDRLFR
FADTLLFGLSEESIDSILQAYPDVGKRPGSEKSQAEQCAIVDDRPEMMAE
LAAASKKYLDHFGFGFVMFINGYCADDVLASMHDRMHNDYETERKVVRNE
LARINRTRLERMLGPEGGYDNW
120406329YP_956158.1 inorganic diphosphatase [Mycobacterium vanbaalenii PYR-1]MQFDVLIEIQKGSRNKYEVDHDSGKVKLDRYLFTSFGYPTDYGYIEDTLG
EDGDPLDALVLLPEPVFPGCIVEARPVGMFRMTDEKGGDDKVLCVLADPR
WDHIQDIGDVSDFELDAIKHFFVHYKDLEPGKFVKAADWVGREKAEAEVL
RSIERFKTEGH
120406328YP_956157.1 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase [MRPTRWRRSTYLVVGVSVLLLVVVVVVAAAALVATRQPAEQPAVEAAPAP
ATAAPGVVPVSDSADKPTPQGLTRALQAVLANPDLGRFTGRITDARSGDQ
LWAQGAGVPMQPASTNKMLTAAAALLTLDRDARLTTRVLSASPGVVVLVG
GGDPTLSAAPRNVDTWYRDAARIVDLADQIRRSGVDVKSVQVDVSAYSGP
SMAPGWDPLDIDGGDIAPMEAIMLDGGRTQPVTVESRRSRTPALDAGRAL
AVALRVDPAKVTVLPSAARGTEIASVQSPPLMQRLRDMMNFSDNVMAEAI
GREVAAEVGRPQSFDGAARAVLSTLEDAGIDTAGARLLDSSGLSVDNRLT
AETLDEVVQAAAGDSEPALRPLVDLLPIAGGSGTLSNRYLDTDDGRAAAG
YLRAKTGSLTGTNSLAGIVTDESGRVLTFALLSNDAGPTGRTALDAFAAT
LRSCGCR
120406327YP_956156.1 hypothetical protein Mvan_5379 [Mycobacterium vanbaalenii PYR-1]MSSSSKSGFTVGRAVDWKLAATLGGKLARPEPPATDYTRKQAFEQLAEAA
RASELPVREVTGLIEGGEIPEARIVNRPEWIHAAAQSMRAMTGGGHADDV
KPRAVTGRIAGAQTGAVLAFVSSGILGQYDPFAVGGGELLLVYPNVIAVE
RQLRVAPKDFRMWVCLHEVTHRVQFRANPWLADHMSKALAVLTEDAGEDL
PQVVGRLVDYVRDREVVVKNSEPAMNSTGVLGLLRAVQSEPQREALDRLL
VLGTLLEGHAEHVMDAVGPAVVPSVASIRHRFDQRRQRRQPPLQRLLRAL
LGVDAKMSQYTRGKAFVDHVVAEVGMQRFNAIWTDAETLPKPAEIDEPQR
WIDRVL
120406326YP_956155.1 tRNA(Ile)-lysidine synthetase [Mycobacterium vanbaalenii PYR-1]MDRPGAVAELRTAVAGFVRDHAAASGPWCVALSGGADSLALTAVAAALRP
TTALIVDHGLQPGSARVAATARDQAMALGCVGAQVLCVEVGVGGGPEAAA
RAARYRALEEARRGAPVLLAHTLDDQAETVLLGLGRGSGARSIAGMRPSD
PPWCRPLLGVRRAVTRLACAELGLTPWQDPHNTDRRFTRVRLRTEVLPLL
EDVLGGGVAEALARTATALREDTDALDGIAARIVTVPGADLDTAVLTPLP
AAVRRRVIRGWLLGGGANGLTDKQIRAVDDLVVDWHGQGGVAVPGGLARE
RLFAGRRKDVLTLYREPVAERQR
120406325YP_956154.1 hypoxanthine phosphoribosyltransferase [Mycobacterium vanbaalenii PYR-MHVPTRTAELYPGDIKSVLLSEEQIKAKTAELAAQIAGDYQDAESGQDLL
LVTVLKGAVMFVTDLARAIPVPTQLEFMAVSSYGSSTSSSGVVRILKDLD
RDINDRDVLIVEDIVDSGLTLSWLLRNLATRGPRSLRVCTLLRKPEAVRA
DVDISYIGFDIPNEFVVGYGLDYAERYRDLPYIGTLDPKVYEQT
120406324YP_956153.1 molydopterin dinucleotide-binding region [Mycobacterium vanbaalenii PYMTETALRICPFCEATCGLTLTVDDGRVTGARGDRDDVFSAGFICPKGASF
GELDNDPDRLAAPLIRRDGVLTEATWDEAFAAVAEGLGAVVRDHGGASVG
VYLGNPNAHTVAGALYPPLIIRGLGTRQVYSASTLDQMPKHVSLGLMFGS
PVAFTVPDLDRTDHLVIIGANPLVSNGSLATAADFPGKLRALRKRGGRLV
VIDPARTRTAALADRHLAPRPGTDAALLFAVAHVLFDENLVDLGALADHV
AGVDEVRALASGFAPETVADFCGVDADDIRTLARELVAAPTAAVYGRMGT
STVEFGTLGSWLVDVVNVLTGNLDRPGGVMFPLSPVAPAPRGHRPGRGFD
TGRWHSRVSGYPEVLSELPTAALAEEIETPGEGQIRAMITIAGNPVLSAP
DGDRLDRALDGVGFMVSVDPYLNETTRHADVILPPPPPSRSPHFDFALNA
LAVRNNARYSPPVLPLDGRPDEAEILSRIALVLYGIGYDADPALVDEQVI
ATTLAKETADAGSPVAGRPVEELTAMLPVGPGYERRLDMMLRIGAYGDAF
GARPDGLTLQRLKDAPHGIDLGPLQPRLRDVLRTPSGKIELAPPQLVADA
ERLRAAVGRRTDGYLLIGRRHLRSNNSWMHNLPALAGGSNRCTLRMHPDD
AAELGVGDTAIVKGAGGELVVPVEVTEDIRRGVLSLPHGWGHDRGGTGQL
LAAGQPGVNVNQLNDGSTLDPLSGTAVLNGIPVLVGPAS
120406323YP_956152.1 hypothetical protein Mvan_5375 [Mycobacterium vanbaalenii PYR-1]MPIAARAKTVRNMLTALAAAAATAAALTACDAQSGPSLEPGADSRQVTVV
GAGQVQGTPDTLTVNASMEFVGPDATAAMNQTNERQQAVIDGLVELGIDR
KDIATTAADLQPQYNSDSTSITAYRATNSVNVTLRDLGRASDAIGLIVAT
GGNATRINSISYSIEDDSQLVRDARARAFEDAKDRAAQYAELSGLNLGKV
ISISESGGPTPPVPMQAPRAMEAAVPLEPGQQTVGFSVTVIWELT
120406322YP_956151.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MMRAVLRYGVCRQVDDRAGLIAAARTAFGELGAAAGLADIAGYAGVSPTV
LCRHFGDRDGLVAAVLDDLVASLGDDEDPPIVAAGAVSGAVSGARFHPKY
AVAPLAALATVMPMMPAQATAATSAEPTTATTAVEPAATVLTLTPLWPVW
PLEYALQGSLCESGGCDLIPYLPFSTAAGVSLLTDRLSSTADVSRVASDT
DTVVFGYSHGAVVAAEWLAEHAEDPLAPAAGQLSFVLIGNPTRAYGGTYP
ALPQTQYQVIDVVRQYDPVADFPADPFNLLAMLNIGAGILSSVHLDYTDV
ALDDPGNTVWTEGNITYVFVPTRNLPLLTPLRLIGLGWLADELNEPLKEI
VERAYDRPYLPEAEPVDPPAEPAPDPVVEPVAETLDAATDTAVATPASSP
DDAAAPDTTADGPEVSPADVDPAATEPDTEETTAAATEETTADPAVTVED
VSQESAATAEPDAADTAGG
120406321YP_956150.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MNSRWCFRAVRDRGCPFGESGAMRSRMVQTNGVTLRVTEAGEPGAPVVVL
CHGFPELAFTWRHQVRALADAGFHVLAPDQRGYGGSDKPDAVDSYNVAEL
TADVVGLLDDLGAERAALVGHDFGAVVAWAAPLLQPDRFSSVAGLSLPPV
PRPKVPTTQAFRRIFADRFFYILYFQDRGPADAELARDPAGTFRRLFAMD
VADEQSALRMTEPGPAGFLDRIPDPGRLPDWISPPDFAVYVDEFRRGGFT
APLNWYRCFDLNWELTADPPAPTIGVPALFVGGTADATLAYTPRHRVREV
VTGDYREVMIDGAGHWLTEERPDEVSRILLEFLTAAR
120406320YP_956149.1 ATP-dependent metalloprotease FtsH [Mycobacterium vanbaalenii PYR-1]MNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTSVAMAQISGDNV
KSAQIDDREQQLRLELKNGNGDTENSDKIITKYPTGYGVPLFEALQAKNT
KINTVVNQSSILGTLLIYMLPLLLLVGLFVMFSRMQTGGRMGFGFGKSKA
KMLGKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSQGKP
IADDADLDGLAKRTVGMSGADLANVINEAALLTARENGTIITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIDPIYKVTILAR
GRTGGHAMSVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSHEV
AQIIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRVELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPLPEPA
FKTAIAQASRAAAEQAQKNGGNGSQASNGVPGGPTQPDYGAPAGWHAPGW
PPQAGGPHPPQPQGYWYPPPPPSGWQGAPQAPAYPGYPPYQPHSQPGQPA
PHGGAAAASPKEDPGHEGGGENGRSAPPSNG
120406319YP_956148.1 GTP cyclohydrolase I [Mycobacterium vanbaalenii PYR-1]MTRSHNHSATITTARFDQARAEAAVRELLIAVGEDPDREGLRDTPARVAR
AYQEIFAGLYTDPDEVLKTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGV
AHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERLTGQIADALMRRLDP
RGVIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTDKASRAEALDLIL
RK
120406318YP_956147.1 dihydropteroate synthase [Mycobacterium vanbaalenii PYR-1]MGVVNVTDDSFSDGGLFLDRDRAVIHGVELVRQGAAIVDVGGESTRPGAT
RIDPAVESSRILPVVKELAQLGITVSIDTMHAAVARVALEHGAQIVNDVS
GGRADPDMARVVADAGVPWVLMHWRSVGSDRPHEVPPYGDVVTAVRDELM
AGVDAAVDAGVDPAKLIIDPGLGFAKTAQHNWALLHALPEFVTTGIPVLV
GASRKRFLGELLASPDGELRPPAGRETATAVVSALAGWHHVWGVRVHDVR
ASVDALAVVAAWQAGRDD
120406317YP_956146.1 dihydroneopterin aldolase [Mycobacterium vanbaalenii PYR-1]MTDRIELRGLKVRGNHGVFDHERRDGQDFIVDLTVWMELAAAAASDDLAD
TLDYGVLAQRAADIVAGRPRQLIETVAAEIAEDVMRDARVHAVEVVVHKP
SAPIPLQFHDVAVTARRSRRGTAP
120406316YP_956145.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [MMTSVVLSIGSNLGDRMAHLQSVLDGLAGSALAVSPVYETDAWGGVEQGPF
LNAVVLAEDRELDGYGWLRRAHELEDAAGRVRDQRWGPRTLDVDLVQCHG
PDGEVVVHDDVLTLPHPYAHARAFVLVPWLQVEPTATLTVDGRTDPLTAH
LAAVDAAERAGVRTTDFVLRIADGA
120406315YP_956144.1 hypothetical protein Mvan_5367 [Mycobacterium vanbaalenii PYR-1]MGPTRTRDLAAAATVTAIAGYLLVHVAYRWFPPIDVWTGVSLLGVAAAVG
GWAFYVRARIRDGQIGVGQGRLHPLAVARSVVIAKASAWMGSVVFGWWLA
VVVYLLPRRATLRVAAEDTPGAVVAGLCALALVVAAMWLQHCCRSPEDQS
ENADAATG
120406314YP_956143.1 hypothetical protein Mvan_5366 [Mycobacterium vanbaalenii PYR-1]MTDPTRGARLRRGGRRPGWILMTVLLVLAIAASSALVFTNRVELLKLAVI
LALWAAVVAAFVSVIYRRQSDADQAKVRDLKLVYDLQLDREISARREYEL
AVETHLRRELASELRAQSADEVAALRAELAALRANLEFLFDTDLSHRPAI
ETERTAGRVSSSRIDTQEDFRAAEEPYAPKTDESPIIDVPAEPHPPEGEW
APRGEAGGAHRRSAEQPQWAPPPAPAPPPPPPPPPPPPPPPPAQQPPPPP
QPTPPPAQQPSPEPQFPWLPPAPPPRPQPRTPEPAPTASGWKPVPAEGQW
IPAGEPGSHWAAAHANGDQGEYVGRRRAPDQVEPEPPRGKHSAAGEEPTE
APAAPEAPAEPDADGGAHTGGQSVAELLARLQAAPSGGGRRRRRED
120406313YP_956142.1 NAD-dependent glycerol-3-phosphate dehydrogenase-like protein [MycobacMVQPPAGGDVPHDGFRPARLTIGVISAGRVGTAMGVALERAEHVVVGCSA
VSAASRDRARRWLPDTPILPVDEVARRAELLLLAVPDAELSALVSGLAAT
GAVRPNTIVVHTSGANGIGVLAPLADRGCITLAIHPAMTFVGTDEDVDRL
RGTCFGVTAGDDIGYAIAASLVLEIGGEPFRVREDARTLYHAALAHSSNH
VVTVVLDAVDALRAALWGQELLGQELVGDVPGGLPERIIGPLARAALDNA
LRRGQAALTGPVARGDAAAVAGHLQALREVNPDLAQAYRTNSWRTAQRAH
APQEVLEVLSEAGQS
120406312YP_956141.1 pantoate--beta-alanine ligase [Mycobacterium vanbaalenii PYR-1]MTRRDTPKFTAGQLNVYTRPGDVAAVTRALRATGRRIVLVPTMGALHEGH
LTLIRAAKRVTGAVVVVSIFVNPLQFAANEDLGAYPRTLDADLDALRAEG
VDIAFTPTADDMYPNGMRTTVHPGPLGAELEGALRPTHFAGVLTVVLKLF
NTVRPDRAYFGEKDFQQLALIRQMVTDLDLEVEIQGVPIVREPDGLAMSS
RNRYLDAVQREQAGALSAALLAGMYAAGEGTAAAVDAARAVLDEVPAIEV
DYLEVRDAMLGPAPEVGMGRMLVAGRLGATRLLDNIAIDIGVPSGPGRQA
EFDEHELPWRN
120406311YP_956140.1 aspartate alpha-decarboxylase [Mycobacterium vanbaalenii PYR-1]MFRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLIEGEQVTIVDIE
NGARLVTYVITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEDAEARA
YRPRVVFVDADNRPIDLGVDPAYVPPDAGELLSPR
120406310YP_956139.1 pantothenate kinase [Mycobacterium vanbaalenii PYR-1]MLLAIDVRNTHTVVGLISGSGDHAKVEQHWRIRTEPEVTADELALTIDGL
IGDDAERLTGAAGLSTVPSVLHEVRVMLDQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYHKFGTASIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAERSAALRRVELTRPRSVVGKNTVECMQAGAVFGFAG
LVDGLVSRVRDDVDGFGGGDVNVVATGHGAPLVLADLRTVEHYDRHLTLD
GLRLVFERNRDSQRGKLKQAR
120406309YP_956138.1 hypothetical protein Mvan_5361 [Mycobacterium vanbaalenii PYR-1]MTVPVNAPIDMAVYRTGVRALSDQPLDWSFKGIPARWWGRTPAQIVAQRP
ELFGAGAIGPVCVLRDEALTHNLQTMAGWCRDRGVELAPHGKTHMSPQLA
ARQLAAGACAVTVATIGQAAVYRAFGVRSLVLANELVDGAGLRWLAAELD
RDPGLRFVCWVDSVRGVELMSDALAGARRRVDVCVEVGMPHGRTGCRSEA
DTDEVARAVVNSPRLRLVGVAGYEAALSQTLTAEAVAAVTAHLAQLRATV
IRLSALFETDDVLVTAGGSTYFDDVAEALTGWPSGLSGLSVRTVLRSGCY
LTHDHGLYANTSPLTRGGRTGLRPALEVHAQVVSRPEPDLAILTMGRRDV
PFDQGLPVALAPAAGTVTKLNDQHAYLELGPGGAAGVGQWLRFGISHPCT
LFDKWRLLPVLDADDRVVDLIRTFF
120406308YP_956137.1 lysyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MVHLSWHVVTSPDSPDDIPEQFRIRQGKRDRLLAEGRDPYPVKVDRTHTL
AELRAAYPDLPADTKTGQEVGVAGRVIFARNSGKLCFATLQEGDGTHLQA
MISLDQVGQDSLDAWKADVDLGDIVFVHGEVISSRRGELSVLADSWQIAS
KALRPLPVAHKEMSEESRVRQRYVDLIVRPEARAIARQRVAVVRAVRNAL
ERRGFLEVETPMLQTLAGGAAARPFVTHSNALDADLYLRIAPELFLKRCV
VGGFDRVFELNRNFRNEGADSTHSPEFAMLETYQAYGTYDDSALVTRQLI
QEVADEAIGTRQVPLADGSVYDLDGEWDDIQMYPSLSEALGEEITPQTAV
PRLWRIADGLGVEIPRDRGYGHGKLVEELWEFTVGDKLWAPTFVRDFPVE
TTPLTRPHRSIEGVTEKWDLYIRNFELATGYSELVDPIIQRERFEEQARA
AAAGDDEAMALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGLSIRETVL
FPIVRRHGN
120406307YP_956136.1 hypothetical protein Mvan_5359 [Mycobacterium vanbaalenii PYR-1]MAHWCSRWGVCVHLRRTKGSRLMAKKVTVTLVDDFDGEGAADETVEFGLD
GVSYEIDLSAKNAAKLRTDLKQWVEAGRRVGGRRRGRAVGNGRGRAAIDR
EQSAAIRDWARRNGHNVSTRGRIPADVIDAFHAAT
120406306YP_956135.1 ATPase [Mycobacterium vanbaalenii PYR-1]MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKET
AEAGTGGRGGEAGNPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERV
MQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPETLKDKQLYTL
DLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEP
TVEHTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYINDRFLPDKAI
DLIDEAGARMRIRRMTAPPDLREFDEKIADARREKESAIDAQDFEKAASL
RDKEKQLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLT
EEETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFI
FAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG
YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDG
QGRTVDFKNTVLIFTSNLGTSDISKAVGLGFTQGGGENNYERMKQKVHDE
LKKHFRPEFLNRIDDIIVFHQLTQDEIIKMVDLMIGRVSKQLAAKDMTME
LTDKAKSLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQLV
TVDVEGWDGEGAGEDAKFTFIGTKKPVKIEEPDLAQAGAAGGPSAAE
120406305YP_956134.1 transposase- IS4 family protein [Mycobacterium vanbaalenii PYR-1]MVAYVRKVRTASGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGILLERAR
QIAAEDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPKGAPVPAGRTA
ATHSRLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLA
DLGAEAMSYRTIQRHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVT
TLYFEAENEDDLRKVGYSKERRVDPQIVVGLLVDRSGFPLEIGCFEGNTA
ETTTLIPVVTAFVERHDLGDTPMVIAADAGMLSATNLAALDDAGLGFIVG
SRMTKAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVNDAAHRAEPIW
DPDEHTNAWRAIWAYSAKRARRDQKTLYAQEARARAVINGERAAKSTRFV
KTAAGDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRV
ERSFRMSKSDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIA
NVVKQLRPLRSATIAINGTTETFPPQVPEAQQKILASLNIPEPGH
120406304YP_956133.1 hypothetical protein Mvan_5356 [Mycobacterium vanbaalenii PYR-1]MTSPDLSKTSARAIDFSGTKAALWLSITAFLALVVLYFIGMDQGATSVFG
SNTYIHEFVHDARHLLGFPCH
120406303YP_956132.1 hypothetical protein Mvan_5355 [Mycobacterium vanbaalenii PYR-1]MEKQIIGRGLLAGAVAGVLAFLFARIFVEPQIQLAIGYEEGVGAAHEALE
AAAHTGHSHSHGDGGGFTRGVQMNIGMGLGVLLFSLAVGALFAVVFAVAY
GRVGNVSARLLSLYVAGGMLLSLYVVPTLKYPASPPALSLDETIRQRTLL
YLAIVVLSAALLIGAVYLGRRWASKLGAWNAAVAAGAGYVVAIAVVMLIL
PSIRETPGPLVDDAGTIVYEGFPADVLYEFRLYSLGTQVVIYTTIGLVFA
ALVSRLVGDRKQSVAP
120406302YP_956131.1 phosphoglycerate mutase [Mycobacterium vanbaalenii PYR-1]MSEVVRLTLVSHAMTDAMAAGRFPTDESVNQLGRDQIHRVDLGPAGPAFC
GPEARTQQTAALLGLRATVESGLADLDFGRWRGDVLGRVPPDEMTIWLTD
PTRAPHGGESVVELIARVGRWMDSLTTGRTERTRVVAVTHPAVIRAAILV
ALDAPPKSFWRIDIAPVSRTVMHFRGHAWTLRSAP
120406301YP_956130.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MRGLTPRRYAGRARRRATTAAVALVCVASLACGCAATRPAPADAAYGAPI
QINTPQGLRAKQTMDMLNSDWPIGEVGVRTLAAPEAVEHVGVTLDRIWWD
RPFTVTNVDVGAGHAKLDVLTSYGVAQTIELRTDEAGMVDRFQVQLVPPK
IATWSDIDEQLTKSGARYSYQVAKVTDGQCVKVAGTNTDTSLPLASIFKL
YVLFAVAEAVKADTLEWTDALTITEGAKAVGSSAFDELEPGATVSVREAA
QQMISASDNMATDLLIERLGPGAIERALVAAGHHDPASMTPFPTMHELFS
VGWGTPDLREQWKRATREGRAQLLQQTNSRPYEPDPKRTHLPASDIGAEW
YGSAADICRLHAALQKGAVGEAAPVRDILSAVPGIDLDRDEWPYIGAKAG
NLPGDLTFSWYAVDASGQPWVVSLQSNWPEFRSQTAAAWLMSIARQTFDL
VPNG
120406300YP_956129.1 antibiotic biosynthesis monooxygenase [Mycobacterium vanbaalenii PYR-1MPIGRGSLMIMSTKTPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGF
LGFQLLRPVKGDNRYFVVTQWDSEEAFQAWATGPAVEAHAGERANPVATG
ASLLEFEVVLDVAGTDT
120406299YP_956128.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MDLLTFRGGEGRPLVLVHGLMGRGSTWPRQLPWLTRLGRVFTYDAPWHRG
RDVADAHPIGTERFVADLGDAVQQLGEPALMVGHSMGALHSWCLAAARPE
LVAGVVVEDMAPDFRGRTTGPWEPWVHALPVEFATADEVYAEFGPVAGQY
FLEAFDRTVTGWRLHGLPEKWIEIAAEWGTRDYWEQWRSVSVPTLLLEAG
ASVTPPGQMRAMAEMAHRATYLHVPGAGHLIHDDAPGKYRDAVEAFLTSF
TRDA
120406298YP_956127.1 hypothetical protein Mvan_5350 [Mycobacterium vanbaalenii PYR-1]MSTALAFLILLAPFALAGLLCWAANRAGALRVHLDQFRWAAPLTGRLSDD
RDWSRVQHDTDAIRTRFEQQPSWPASGVSGERR
120406297YP_956126.1 AraC family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAIRSVSALVLDNLAMFEFGVICEVFGIDRSADGVPNFDFKVCGPEAGSP
LRTSVGATIIPDHGLDHLVGADLVAIPAIGGSDYLPEALDAVRRAAESGS
IILTVCSGAFVAGAAGLLDGRPCTTHWMHADELARMYPTAKVDRNVLFVD
DGNLITSAGTAAGIDACLHLVRRELGSEVTNKIARRMVVPPQRDGGQRQY
IDQPIPVKCSERFAPHLDWILANLDKPHTVTTLARRAHMSGRTFARRFVE
ETGRTPMQWVTDQRVLFARRMLEETNLDIDRIAEQSGFGTATLLRHHFRR
IIGVTPSDYRRRFNSTASQDVAVIA
120406296YP_956125.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTDHKAPTKVVVIGGGYSGTLAANHLRLRSDVDITLVNPRPKFVERIRLH
QLAAAGRDATVDYGTLLGEGVRLVVDSASRIDTAARKVWLASGRQLDYVY
VVYAVGSTGAPPAGVPGAVEFAYPVAELEQADRLRAALDDLHPAAPVTVV
GAGLTGTETAAELAEAGRNVTLVCGGGLLPTFSAAGRRSAARWLRRHGVA
VLESDTVAEVRAGAVVFADGAVRPSALTVWTTGFGVPDLAAVSGLATDDI
GRLLTDETLTSVDDPRIVAAGDCAAPSGAPLRMCCASASQLGPQAANTVL
SRIAGEQPSDFDYAFAGSCVSLGRRTGILQFARKDDSPVSVYIGGRVGGS
LKEAICKGTLWGLRRGARKPGSAIWFKGGPRPGQPAVRPRAVTQS
120406295YP_956124.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMTASTDEHGERFTVLRPLLFTIAYEILGSATESEDVLQDSYLRWADVDLA
TVRDTKSYLAQLVTREALNALRARSRRREEYVGPWLPEPLLLDERDASAD
IVLAESVSMAMLVLLETLTPDERAVFVLREVFGFDYDEIAGAVGRSTQAV
RQIAHRAKEHVHARRKRFGPVDSRRTTQITEQFLTAAATGDMEELVSMLA
PGATWTADHGGKATAVRRPVVGARKVAAIMARVFQAVRKTPQMRLETAVY
NSAPAVVVYTEDHLEGVLLFEVVDDKITNLYAMRNPDKLTGITIPRKITR
120406294YP_956123.1 HhH-GPD family protein [Mycobacterium vanbaalenii PYR-1]MIDPDALLDWYEHAQRDLPWRRPGVSAWQILVSEFMLQQTPVARVEPIWL
DWIARWPTPSATAAAGPADILRAWGKLGYPRRAKRLHECATVIATDHDDT
VPDDVETLLTLPGIGTYTARAVACFAYRQRVPVVDTNVRRVVARAVHGLA
DAGSPSSRDLGDVETLLPADDTAPRFSVALMEFGATVCTARAPRCGVCPL
QRCGWRARGFPAGTGPARRAQKYAGTDRQARGRLLDVLRGSDSPVTRAEL
DVAWTTDTAQRDRALDSLLVDGLVEQTADGRFALCGEAGS
120406293YP_956122.1 carbonic anhydrase [Mycobacterium vanbaalenii PYR-1]MPNTNPLTAWKALKEGNERFVAGKPEHPSQSIERRTSLAAAQKPTAVVFG
CGDSRVAAEIIFDQGLGDMFVVRTAGHVIDGAVLGSIEYAVSVLHVPLIV
VLGHDSCGAVGATLAALDEGEVPGGYIRDIVERVMPSILLGRRDGLTRVD
EFEARHVTETGKQLLSRSTAIAEAVRDGKLAIVGLTYQLADGKAVLRDHI
GDIGEA
120406292YP_956121.1 hypothetical protein Mvan_5344 [Mycobacterium vanbaalenii PYR-1]MLDLEPHGPLPRQIYWRRRALALGIAALVIGIVVAVVAVVVMNSTSNEQP
TANESAAPAAEAVPPPLPGENPEVKSPIQPPAQQAPPPTPTPTAAVVPPP
ILKEGDDCPDSTLAVKGITNQPQYVVGDQPKFTMVVTNIGLVACQRDVGA
AVLAAYVYSLDNQRLWSNLDCAPSNETLIKTFQPGEQVTTEVTWTGMGSA
PNCPLPRQPIGPGTYNLVVQLGNLRSATVPFILAQPAQAPPPAPADGAPH
LPVPGPVG
120406291YP_956120.1 DNA integrity scanning protein DisA [Mycobacterium vanbaalenii PYR-1]MAVKSSSARAARTVVPLVRPTLRETIARLAPGTPLRDGLERILRGRTGAL
IVIGYDDSVETICDGGFSLDVRYAPTRLRELSKMDGAVVLSSDGSRILRA
NVQLVPDPSIPTEESGTRHRSAERTAIQTGYPVISVSHSMSIVTVYVAGE
RHVVPESATILSRANQTIDTLERYKTRLDEVSRQLSMAEIEDFVTLRDVM
TVVQRLEMVRRISLEIDSDVVELGTDGRQLKLQLDELVGDNDTDRELLVR
DYHANPDPPTSAQVTATLEELDALSDSELLDFTTLARVFGYPSTAEAQDS
AMSSRGYRAMSGIPRLQFAHVDLLVRNFGSLQGLLAATATDLQSVDGIGS
MWARHIREGLSQLAESTIADRLG
120406290YP_956119.1 DNA repair protein RadA [Mycobacterium vanbaalenii PYR-1]MARTNSKTRSQFRCSECHHVTPKWVGRCPDCGTWGTVNEVALTAVGGSAT
RRAVAPASPAVPISSIDPGSTRHFHTGISELDRVLGGGLVPGSVTLLAGD
PGVGKSTLLLEVAHRWASTGRRALYLSGEESAGQIRLRAERTGCSHDEVY
LAAESDLQTALGHIDAVQPTLVVVDSVQTMSTTEADGVTGGVTQVRAVTT
ALTMTAKTTGVAMLLVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASALR
MVRGIKNRFGAADEVGCFLLHDNGIECVSDPSGLFLDQRPKPVSGTAVTV
TLDGKRPMIGEVQALIGSPASGSPRRAVSGIDSSRAAMITAVLEKRAKLP
VGMNDIYLSTVGGMRLTDSSSDLAVALSIASAFTDLALPTTAIAIGEVGL
AGDLRRVTGMDRRLAEAARLGFTYAVVPSGVTSAPAGLQVLPADNITSAL
QVLRRISQNGAN
120406289YP_956118.1 hypothetical protein Mvan_5341 [Mycobacterium vanbaalenii PYR-1]MKPFNRRSSVLTTLAACGLAASVVLSGCSAGQVSQTATQEPAVNGTSATA
GPIALRNVHIRADQTKDYVQPGTEVELIFVAANTSPDVADKLVSITSDIG
SVTLTGDGEVPVNGVLVVGSPDGQITPLESIEPADAAEAKVELSKPITNG
LTYDFTFKFENAGETIVAVPISAGEAPRREEAAGSGGSAGEGGGH
120406288YP_956117.1 CarD family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVSQGDLTVRVPA
DNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGD
VNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKA
STILDEVLAAAS
120406287YP_956116.1 2-C-methyl-D-erythritol 2-4-cyclodiphosphate synthase [Mycobacterium vMLPSIRVGLGTDVHPIEAGRPCWLLCLLFDDADGCAGHSDGDVAAHALCD
ALLSAAGMGDIGEVFGTGLPQWRGVSGADMLRHVHSMMTAEGLRVGNAAV
QVIGNRPKIGPRRAEAQRVLSGILGAPVSVSATTTDGLGLTGRGEGLAAI
ATALVVGDEGKG
120406286YP_956115.1 cysteinyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDVLR
RWLTAKGFDVAFIRNVTDIDDKILHKAADAGRPWWEWAATYERAFTAAYD
ALGVLPPSAEPRATGHITQMVELIERLIERGHAYTGDGDVYFSVATLPDY
GKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAKPGEPSWPTPWGRGRPG
WHTECVAMCESYLGAAFDIHAGGMDLVFPHHENEIAQAEAAGDGFARFWL
HNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYLGSAHYRSMLEFS
ETALQDAAKAYAGIEDFLHRVRTRVGAVVPGEWTPKFGAALDDDLAVPAA
LAEVHAARAEGNRALDAGDHDTALTHAMSIRAMMGILGADPLDERWESRD
ETSAALAAVDVLVQAEVQRREDARARRDWAEADAIRDRLKEAGIEVTDTA
DGPQWSLLDGTDK
120406285YP_956114.1 RNA methyltransferase [Mycobacterium vanbaalenii PYR-1]MAGNSQRRGAVRKAGTKKGPTVGSGGVRRRGLEGKGATPPAHQRPHHPAG
KRAAKAARQAQGRHKKTDDTEIVLGRNPVLECLRAGVPATALYVALGADS
DERLTESVQIAADKGIAILEVPRHDLDRIAANGMHQGIALQVPPYNYAHP
DDLLAEAKSDAMPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRS
ASVTAVAWRTSAGAAARTPVARATNLTRALKQWADAGLQVVGLDADGDTT
VDQIDGAGPIVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNASVAA
GVVLAEIARQRRSA
120406284YP_956113.1 arsenical pump membrane protein [Mycobacterium vanbaalenii PYR-1]MELILSVAALASVLAFALLRPHRWPEAVIAVPAAALVIASGAISWDDALA
EVGRLAPVVGFLAAVLVLARLCDDVGLFHTAGVMMARATSGGQIRLLASV
FAIAAGVTAILSLDATVVLLTPVVLATARTLAVPPRPHAYATAHLANSAS
LLLPVSNLTNLLAFGAAGLSFLHFAAAMSLPWLAAIAVEFVLLRWFFAKD
LAVEPRRAAVTEPVEVPVFALVVLGLTLLGFAVTSLLGLSPAWAALAGAL
VLGVRALATRHTTVTRIAAAADVPFLIFVLCLGVVVAAVMRNGLESAMRD
AIPEGQGLAALLGIAAVAAVLSNVVNNLPAVLVLLPLVTPIGPAAVLAVL
IGVNIGPNLTYVGSLANLLWRSVVRRDMRVGFAEFSRAGLVTAPLTLVAA
VLGLWAWIQLFGL
120406283YP_956112.1 hypothetical protein Mvan_5335 [Mycobacterium vanbaalenii PYR-1]MRLKLGRPDLQAYSAYFDLPPAPPGAPVTVTWAGVTTLLVDDGESAVMTD
GFFSRPSHLSVAARPLRSSRSRIDDALSRLGVRRLDAVTPVHTHYDHAMD
SAVVADLTGARLIGGRSAAAIGRGHGLDRVDVVAPAETVSVGSYDITLVE
GSHCPPDRFPGTITAPVISPARVSAYRCGEAWSTLVHHRPTGVGLLVVGS
AGFVPDALAGRRADVVYLGVGQLGLQPEGYLVDYWTQTVRTVGARQVVLI
HWDDFFRPLDKPLRSLPFAVDDLDVSMRVLSRLAAEDGVGLHLPTLWQPA
APWS
120406282YP_956111.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMHAPLHPDLLSRRSIDVAVGILMALRRCSEDQAFAEIAAAAHRMGLPLGE
VTRALIAVADAHSGHTSHRDEALRIWGELFSEHPRR
120406281YP_956110.1 50S ribosomal protein L31 [Mycobacterium vanbaalenii PYR-1]MKPGIHPDYHPVVFQDANTGKQFLTRSTLTSARTVEWETSEGVREYPLVV
VEVTSDSHPFWTGSRRIVDAAGQVEKFRRRYGSRKSGASSD
120406280YP_956109.1 cobalamin synthesis protein CobW [Mycobacterium vanbaalenii PYR-1]MNRTPVLLVSGQELTDQISEALLHKSGTLVVRHRFDGQVVLRSVCIRRGD
EPHTSQWPIELMNCCVDCTIRSDLLVLLRRLHRRDDVSRIVVHLPPWLEP
EPLCWDINNVDVVVGPGYIDGPAARDVRIEAVITTVATGQWLTDALGADV
LDDGRTVAQVVVGQAEFADVLLLSAPDRTTQAVLHRLAPRAQIITGTEQL
GSALDALSDSARRGADHDPHEPLLSGEPPLVAEHGVKLVEFQAIRPFHPL
RLHRAIDDLLDGVVRLRGRAWLASQPDVVLWIESAGGGLRVGHAGEWLAA
SAIDEPADPDPERAVLASLRWDEQFGDRHISLTALICGADPEAVTASLSA
ALLTDDELSRPDLWAHWEDPFGEWHEDPCEGLDKADGAATRDRPDEGDPT
GFSRS
120406279YP_956108.1 hypothetical protein Mvan_5331 [Mycobacterium vanbaalenii PYR-1]MNRETENALLLLVGVSAALITFSGAYTRYVKPSLQPWLLASAALLITLAV
VSIVRDVRRGGHTEATHGGHEHRSGIVWLLLVPVALLAFIVPPAIGPLTA
RTSVTAISTDVLRRPFPPLSDERAPEISLPDLLIRIAQDSAGTLDDRVVS
VTGFTIKDGARTDLGRVVILCCAADAQLARIVLGGPAATSAGNLPDGTWV
RVEGKVPAGQSDSSRSFIPQLDVTVVEQIDPPENTYSY
120406278YP_956107.1 permease [Mycobacterium vanbaalenii PYR-1]MAAVAVGTPSTRYRPNSMHVLVIAVVGLALVGGILRGFVAGTPGVATAAT
VFCGIFVQALPFLALGVVISGAVAALVTPDRLARWLPKRPSAAILAAGVG
GFALPGCECGSVPIARRLFGESTVGAAALTFMLAAPAINPAVLVATAVAF
PGEPGMVVARCAASLITALIMGGLWARFGLPRWITRRVPHEHSTGGSRWT
AFSEAARHDFLQASSFLVVGAAAAAALHVLVPAWMFEHLAGQLLLGIAVM
ALLAVVLALCSEADAFVAASLSMLPLLPRLVFLVVGPAVDIKLFAMQVGM
FGRAFAIRFAPVTFVVATATATIVGLLVLGNR
120406277YP_956106.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMVAFDRSIPDTQRWAYPLLLVLSGVALGVSGLPAPLYGIYETNWHLSPLA
TTVVFAVYAVAALAAVLVSGRISDVVGRKPVLVGALVALLIGLGVFLIAD
SMAMLLLARTIHGAAVGSIVVAGAAALLDLRPDHGVRAGQLSGVSFNIGM
TVAILGSALLAQYAPHPLRTPYAVVAVICLVVGVGVLALREPHTARTRGP
IRIARPAVPAEIRADFWFSALGAMASWSVLGVLLSLYPSLAARQTHIDNL
VFGGAVVGTTAFAAALAQLAATRVPARYSAILGDAGMAAALLLTIPVLLT
HQWQLVFVAAALLGATFGLGFGGSLRHLSDVVPAGRRGETMSAFYLLAYS
AMAVPTLIAGWAATRWDLAAVFPWFAGVVAAACMGAAIAGVRSVRLAQ
120406276YP_956105.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MAAEALVGDPSAHPVAPLQQVLAAIHDPVRLEIVRRLHNAGGPMQCGALY
DGINKSTATHHFKVLREAGVTERLVIDGLTYQRLRREQVGAAIPGLLESV
VAGANREAGLS
120406275YP_956104.1 LamB/YcsF family protein [Mycobacterium vanbaalenii PYR-1]MTTVSVDLNADLGEGFGVWTLGDDDAMLDIVTSANVACGFHAGDPATLVR
VCRAAAARGVRIGAQVSYRDLAGFGRRFIDVSAEDLVADVMYQIGALSTL
AAVAGSSVSYVKPHGALYNAITTNHLQAHAVAEAVHTVDPTLPVLGLAGS
VFFTAATELGLRTVPEAFADRAYRPDGQLVSRRERNAVLRDVDEIVDRVI
SMVTTGRVAAVDGSTIPITVESVCVHGDSPGAVQIATAVRERLIADGVTL
APFS
120406274YP_956103.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MTIIFNKGTSATARIDVSAVDFGYPGMPVFRGLTLSVTPGAVTAVVGANG
SGKSTLLSLLAGVLRPATGRVDVDARNIALAVQRSAVTDSFPVTAGEAVM
MGRWRRLGLLRRPKADDRAVVEHWLTELGLSDLRHRALGELSGGQRQRVL
LAQAFVQQAPLLLLDEPTTGLDTDSAGVVIGHLRRLAGEGTTVVTATHDP
AVVQTADHRIDLDRPGPH
120406273YP_956102.1 ABC-3 protein [Mycobacterium vanbaalenii PYR-1]MMHALVDPFQADMVLRALVAGVIAACLCSLVGCWVLLRGNVFLGEAMTHG
MLPGVALAALLGISLLIGGLVAALVMAVGVAALGRSSRLSSDTSVGLLLV
GMLALGVIVVSRSQSFAVDLTGFLFGDVFAVRTADLVVLATALVLTLGAV
IIGHRAFVAVTFDPRKAATLGLRPQLAIPVLTMLMAVAMVASFHVVGTLL
VLGLLVAPPAAALAWSRSIPRVMLLSALIGSAAVYLGLLISWYAGTAGGA
TIAGVAVLIFFASTLLSFGRGNWKRMSVVAASACVVAGCGTGGESPAPAE
HPTSAGEDEVVVEGARELDGALTRLVLVDPATGATSVYDAVDEVETSIGS
YGPVDGISGDGRFAYLRTGGRTTVVDAGAWTFGHGDHDHYFATEPAEVAT
LDVPAASVSAVNSIVAVRTPTNATALFDREKLADNVVEAPAGLALSPDVA
AVAPYGSRLVTVTAAGRMQVTGDTGTTDLVGECPNPSWASPTRRAVVFGC
DTGAVRVTGGDGDLAVTPAPFPADAPAERPRQMEHRDRADVFAGVSAGTV
WVLDSRQRSWTLIPVADAVATNTAGDGTVLVLRRDGTLSAYEVNARAETA
RIPLFPEGIPADGAQPVVDLDSDRAYVNNAATREVYEIDYADGLRIARTL
RTEVAPGLMVEAGR
120406272YP_956101.1 periplasmic solute binding protein [Mycobacterium vanbaalenii PYR-1]MRRWTLVCICAILTAVAACTGGTAASATGEVIVTTNILGDVVRNVVGDAA
DVRVLMQPNADPHSFGVSAQDAAAMGRAGLIVYNGLGLEETVIRNVESAA
AEGVPTLAVTDHVDPIEFAEGDSAGTSDPHFWTDPQRMIMAVDAIEEAVR
EIDGIDRDAVARNAESYRAKLRELDTSMRTGFDTIPAERRKLVTNHHVLG
YLAQRFGFTVIGAVVPSGTTLAAPSASDLQSLVDAIDFARVPAIFVDSSQ
PDKLARVLARDAGVDVEIVPLYSESLSPPGTPGATYLDMMRANTDAIITG
LR
120406271YP_956100.1 hypothetical protein Mvan_5323 [Mycobacterium vanbaalenii PYR-1]MSNPRWLYRVGVLSCAAALTACSSGGDNAESAGTSEPTSPVQSAPIPEPL
VATYDGGLYVLDGETLELRQDIPLDGFLRVNPAGDDAHVLVTTNEGFRIL
DAASGQLTDETFPAAEAGHVVPHGETTVLFADGSGEITAFDPHALADGMP
ETQTFTTPQPHHGVAVILSDGTLVHSLGDAESRTGAVALQGDREIARNED
CPGLHGETVVADEEVVLGCENGALIFANGRFTKVASPTPYGRIGNIKGHD
DSPVALGDMKIDPDAELERPTQFSLIDTTTDKLTLVQLPPSVSYSFRSLA
RGPQAEALILGTDGKLYVFDPVTGAQIKTIDVTGAWTEPDDWQDPRPTVF
TREDVVYVTDPATRQIHLLDLQSGTVTASVTLDQAPNELSGAVGHDH
120406270YP_956099.1 3-mercaptopyruvate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]MTRADIFITAAELARLIAEGAPVNVLDVRWELTRPDGREAYTRGHVPGAV
YVSLEDELSDHAVTGRGRHPLPSGDSVESAARRWGLRRGVPTVVYDDWNR
AGSARAWWVLTAAGIGGVRILDGGLAAWTAAGGRLETGVPAIDPGDVAVE
FRDLYRGALPALTAEDVTGFDGVLLDARAPERFRGDTEPVDRVAGHIPGA
RNAPSVETLSVDGTFLPDDELVRYFRGRGATEGGVGVYCGSGVTAAVTIA
ALRATGVEAKLFPGSWSQWSADASRPVATGE
120406269YP_956098.1 cobalamin synthesis protein- P47K [Mycobacterium vanbaalenii PYR-1]MIIIKNMSSAPAPLLPVTVLSGFLGAGKTTLLNHILANREGRRVAVIVND
MSEVNIDAALVAGQGHLDRTQEKLVELTNGCICCTLREDLIEAVGALARQ
QRFDQLVIESTGISEPMPVAATFSWEFEDGSSLGQLARLDTLVTVVDAST
FLTEIARGEALADRDLTAGEGDARSISDLLVDQVEFADVILLNKTDLVSA
ATLGTAETLVRRLNPTAKLIRTDHGVVDIAEVLDTGLFDPIAAEEAPGWD
EEIADGHTPETEEYGISSMTFHSDRPFHPQRLAESLGKMTRILRSKGFCW
IASRPTIAAIWSQAGPNLVIEPAQYWSSTEIAPGQEIVFIGVKLDRDKVR
RLLEDALLTDAELAEGEQIWTEYADPLPAWGVTHSHAN
120406268YP_956097.1 periplasmic solute binding protein [Mycobacterium vanbaalenii PYR-1]MISSFRGVRVLAATLAVSLPFVLSACGGDDTSAMDTSAAPDCPTTPVNVV
VSVDQWGNIVSQLGGACAEVTTVLAGSAVDPHDYEPAPSDAADFEGAQLV
VLNGGHYDEWAAKLAATSAADAPVVNAVELSGGHAEQGQEHAGEDGHGHA
EEGQEHAGEQGQELGDEGNPHVWYNPTAVTEFAEAVTAQLGKLSPDAAGY
FAERHAEFAESMKPYDEVIAAIKAGATGRTYAATESVFGDMATALGLVDR
TPQGYQVAAANESDPSPADLDAFLQLLADRGVDVLIYNTQTEGSVPEQIR
SAAEQAGIAVVDVTETLPSDAKSFQDWQVAQLDSLAKALDVRT
120406267YP_956096.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MSGPESVEAAPALTFDDVSVDRGGRTIWSESTFRVDAGSFVAIIGPNGSG
KTTLLQVILGLLPPSSGTVRVYGRQPGAANDEIGYVPQNYDANANEAIRA
SDAVLLGLTGRRWGFGRTSTADRRRVDEALGWVDALDIADRRLSDLSGGQ
RQRIALAGALVARPRMLILDEPLASLDLRNQHEIVAVLARLKRDLGVTVL
VVAHDLNPLLTVLDSAIYLLDGHAHHAALDRVVDSQLLTHMYGTRIQVAH
TLQGELYMRSGG
120406266YP_956095.1 ABC-3 protein [Mycobacterium vanbaalenii PYR-1]MTQVLAVEYVALGYQDNWLHILGSSFMRNAWAGGTIVALAAGLMGYFIVV
RHSSFAAHALAHIGLPGATGAVLIGLPAAVGLGVFCVGGALVIGALGKRA
ADREVATGTVLAFATGLGLFFNSLATRNSSTLTNVLFGNLLAITSEQLLS
FFALLVLTAAGIAFIFRPLLFTSVNSKVAEAKGVPVRGLSIVFMVLLGLT
VTMAVQAVGTLLLFALVVTPAATALMVTARPVMAMAVSAVIGLVSVWAGL
AFSAMFNLPPSFVIVSIVCAVWLLVWAGCRVPVRA
120406265YP_956094.1 periplasmic binding protein/LacI transcriptional regulator [MycobacterMPRSPTPRRRATLASLAAELKVSRTTVSNAYNRPDQLSAELRERVLSTAE
RLGYPGPDPVARSLRTRRAGAVGLVITEPLNYSFSDPAALDFVAGLAESC
EAVGQGLLLVAVGPNRSVADGSAAVLAAGVDGFVVYSASDDDPYLPAVLQ
RHLPVVVVDQPRDVAGTSRVCIDDRAAMRRLAEHVIELGHREIGLLTMRL
GRDRPHGGSTPVLADPERLRTPHFHVQGERIRGVYDAMTAAGLDPGSLTV
VESYEHLPSSGGAGADVALDANPRITALMCTADVLALSAMDHLRAKGIYV
PGQMTVTGFDGVPEARRRGLTTVVQPSVEKGRRAGELLHHPPRSGLPVIE
VLDTEMVRGRTSGPPA
120406264YP_956093.1 permease [Mycobacterium vanbaalenii PYR-1]MSTASRDAPAAGPGGPSERTRTLGILLLAAFGWVGAYVLNEHLWDAAVGW
LGLDLHTRAVGAVHFFLYDTVKIFLLLTGLMFVVGMLRASLDLDRARDYL
RGRGLFVGLVLAVFLGVVTPFCSCSSIPLFIGFVAAGIPLSITLTFLIAS
PLVSEIAAIMIGDQFGWHIAAVYVVAGSVLSLVIGWIFSRFDLSRWVEPM
VFTTKVAALRADGRVPSLAERVDAAVDETKDIFRSVWLWVLLGVGIGAVI
HGWVPADFFVRFAGPGNPFAVVVATLAGVPLYVNGAGVVPIAEALWAKGM
SLGTVMAFTMSTIALSVPQAVMLRRVMKPPLLALFFGTVAFGIMIIGFLF
NLVG
120406263YP_956092.1 redox-active disulfide protein 2 [Mycobacterium vanbaalenii PYR-1]MIVKILGPGCRNCHALEEHTREALAQLGLDAEIEAVTDYAEIAGYGVMKT
PGLVVDEEVVVAGKVPSVKDLTRLLAPR
120406262YP_956091.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MFARCRTAAHAGAMTHSPDAAALAEEWDERYTSLADRIPDGTPSAVLIET
AEKLTPGAALDIGCGVGSDAIWLAAQGWKSTALDVSRVALDRATERGRRA
GVDVNWVCSRLEDLPLPPGGFDLVTAHYPALLHSPGADAERTLLAAVAPG
GTLLVVHHADIDVDLAKAHGFDPADYLSHDDVIELLGEEWEVSVEKRRPR
DVPAGIDGQHTHDDIVLARRR
120406261YP_956090.1 HAD family hydrolase [Mycobacterium vanbaalenii PYR-1]MSVDLPSELVSALDSAAATTRLLVTSDFDGTLAPIVNNPADARPLPAAAQ
ALVALADLAATTTALISGRALETLRELSSMPATVHLIGSHGAEFDSGFAH
DIDHDLLRAITDRLRAIASDKPGVAVETKPASVALHVRNASPADGEAALA
AAWEAAPEWEAHVTTGKAVLEFAVIDTDKGAAVDILRGECDATAVVFFGD
DVTDEKAFARLRRSDVGVKVGPGESAAGYRIDSPDAVAAALEHLVASRKR
LA
120406260YP_956089.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSGTSEFAADKSQTSARATSGAGSESRPRQVMNVAVLAESELGSEAQRER
RKRILDATLAIASKGGYEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSA
LGREFERIDAKTDRSAFPAGATAYQRLNIMVGKLNRAMQRNPLLTEAMTR
AFVFADASAAGEVDHVGKLMDSMFARAMSDGEPTEDQYHIARVISDVWLS
NLLAWLTRRASATDVAKRLDLAVRLLIGDGDQPKI
120406259YP_956088.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMSASTSAPTTDDQSAARDLVRTWAAASRAVEAARDVEQGDPDAWRAPYAG
LAELGIFGVALPEEHGGADGTVSDLAAMIDEAAAALVPGPVATTALATLV
LSGPHADLLEELATGERTAGVTLTADLDYADGRVSGSAPYVLGAAATGVL
LLPAGDTWLLVDAAADGVTVESLKATDFSRPLARVVLDGAPAEVLDVPSQ
QVVDMAATLLAAEAAGLARWLLDTATEYAKVREQFGKPIGSFQAIKHMCA
EMLLRSEQASVAAADAARAAGESDADQLSIAAALAASVGIEAAKANAKDC
IQVLGGIGITWEHDAHLYLRRAYGIAQFLGGRSRWLRRVAALTQQGVRRE
LHIDLESVAGLRPEIVSAVAEVAAAPEDKRQVALAEARLLAPHWPPPHGR
AAGPAEQLLIDQELAAAGVVRPDLVIGWWAVPTILEHGSPEQVEQFVPPT
LRGELTWCQLFSEPGAGSDLAALRTKAVRVDDASASGASGPGWKLTGQKV
WTSAAQKAHWGVCLARTDPDAPKHKGITYFLIDMKSPGIVIRPLREITGD
ELFNEVFFDDVFVPDEMVVGQVNDGWRLARTTLANERVAMAQGTALGNPM
EELLRVVAQLEVDGAQQDQLGQLIVTAQVGSLLDQRIAQLAVEGQDPGPQ
ASARKLIGVRYRQALAEFRMDLSDGAGAVENRQVHDFLNTRCLTIAGGTE
QILLTMAGERLLGLPR
120406258YP_956087.1 hypothetical protein Mvan_5310 [Mycobacterium vanbaalenii PYR-1]MTSSGGITFITMNRLAATSAAALATMLMAALTASPPATAASNTATSSIAV
DPATQIQMHVTANCDPAQNRCFFNTSANLLTPNGPTGFPGDTWARQTVTL
RSNSQDVWQEAWYSAPAGTPRELKGANHNNVLSRMLKSLRDVEVSVTYFG
GGPIERFTTDGDSVPTEWTTGLPAKGSDFIVCSQIQVVYGGVNLTTPSAC
AQTTF
120406257YP_956086.1 ferredoxin [Mycobacterium vanbaalenii PYR-1]MTDVAADEPLGTHVLELEIADVIDETADARSLVFKSPADAPVPPEKLRYA
PGQFLTLRVPSDRTGSVARCYSLCSSPFTGDPLTVTVKRTADGYASNWLC
DNAHAGMRIHVLAPSGTFVPRSLDTDFLLLAAGSGITPMLAILKSALSEG
TGKVTLVYANRDEKSVIFAETLRDLAAKYPDRLTAIHWLESVQGLPSVSA
LTELFEPYGAREAFVCGPGPFMAASEEALKAAGLPAERIHIEVFKSLESD
PFAAVKIEEDDSDEGPATAIVTLDGQTHEVSWPRRAKLLDVLLDKGLDAP
FSCREGHCGACAVLKKSGDTEMEINDVLEQQDLDEGLILACQAHPTSDSV
EVTYDE
120406256YP_956085.1 acyl-CoA dehydrogenase type 2 [Mycobacterium vanbaalenii PYR-1]MTSIQQRDAQSVLAGIDDLLPRIAKRSQAAEELRRLPDETVTELDEVGFF
KLLQPEQWGGLQCDPTIFYEAVRRIASACGSTGWVASIIGVHNWHLALFD
QQAQEEVWGSDPTVRVSSSYAPMGAGTVVDGGYLVSGAWQWSSGCDHATW
AFLGGPVIKDGKPVDFGSFLIPRTEYRIDDVWNVVGLKATGSNNVVVKDV
FVPRHRFLSYKAMNDGTAGGYQNNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYDAHVEHQGKRVRAAFAGEKSKDDPFAKIRIAEAASDIDAGWRQLIGN
VGAEYRLLEAGEEIPFSLRAAARRDQVRATARAIASIDLLFEASGATALQ
LDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
120406255YP_956084.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MTSFAAEAAQQQEITFESTSRFAQVREDMRLHYHEAGDPESPTVVLLHGG
GPGASSWSNFGKNIPVLAEHFHVLAVDQPGYGHSDKHTEHEQYNRYSATA
LLNLFDYLGIERAALVGNSLGGGTAVRFALDNGKRAGKLVLMGPGGLSVN
LFSPDPTEGVKLLGKFAAEPTRENIEKFLRIMVFDQNMITPELVEERFQI
ASTPESLAATKAMGKSFAGADFELGMMWRDVYKLRQRVLLIWGREDRVNP
LDGALVALKQIPRVQLHVFGQCGHWAQLEKFDEFNKLTIDFLGGG
120406254YP_956083.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMTIKSLGYLRIESTDVAAWREYGLKVLGMVEGSGSTEGALYLRMDEFPAR
LVIVPGERDRLLVSGWETANASQLQDIRKRLEVEGTPYKEATATQLAERR
VDEMIIFDDPSGNTLEVFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAETLHFYRDVLGFYLRDSMKLPPQLVGRPADGAPAWLRFLGVNPRHH
SLAFMPGETPSGIVHLMVEVENSDDVGLCLDRALRRKVKMSATLGRHVND
KMLSFYMKTPGGFDIEFGCEGLEVDDENWVARESTAVSLWGHDFSVGFKS
120406253YP_956082.1 flavin reductase domain-containing protein [Mycobacterium vanbaalenii MSKPPIDPRTFRNVLGQFCTGITVITTVHDGSPVGFACQSFAALSLDPPL
VLFCPTKASRSWAAIEASGTFCVNILHENQKDVSARFGSREPDKFAGIDW
TPSKTGSPIIDGTLAHIDCSVHSVHDGGDHFVVFGAVHSLSDVPKTKPRP
LLFYQGQYTGIEPDKNTPADWRNDLEAFLTATTDDTWL
120406252YP_956081.1 hypothetical protein Mvan_5304 [Mycobacterium vanbaalenii PYR-1]MNISRPGTVDRIEADDALLACSTLPRVDHVDAHLLRIGRPPVRTPEAWAR
EILEHTSVTMRMRLRTGWSALGITLHHGRHDTIAGWPITANTAEYVRLQG
DSRAGLTGQLVTRVSDEGVTFATFVRLGNPVARMVWAKVLPTHLAIVRSL
VEEAADRVG
120406251YP_956080.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPPPVRTTRDTWIEAGLALLAADGPDAVRVEVLAQRLGVTRGGFYRQFGG
RRELIDAMLDTWERRSIDEVQARVESEGGDARSKVRRAGMLTFSAELLPL
DLAVRDWARRDGEVAARLRRVDNRRMDYLRELIATISDDAGDVEARAMLA
FSLVIGNHLIAAEHPGRPRDRVVRDAARLLLGEMTPM
120406250YP_956079.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MPFLGHERGRAYYRHWAAAEPAAAVVFLHGFGEHTGLYHRYGFALNAAGI
DLWAVDQFGHGLSPGDRGDFGTIEDSSALAEQLTDLVAQQHPGLPLIAQG
HSFGAIVTLFRLLDGAARYRAAVVSGAPLIPIPDLLDADTSFDLDPAWLS
ADPFYVDSLENDPLAFVASDSTALTRELDRGWDRFGTDLPSLSVPTLAVH
GVNDPIAPIGAVRAYAEQIEALQLVEFAGARHDVLNEVQHRDVAAAIIDF
IHRSY
120406249YP_956078.1 LysR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MQLPRAAMAKTAPGICKNAEMSSPVRRPSADDLLVLLAVGRTGRYTTAAD
ELGLNHTTISRRIAALERAMGGRVLARVAGGWELTDLGREALAAAEAVET
AVRSLATDAAGQRALEGVVRISATDGFSAYIAAPAAAAVQRRHPKVAVEI
VATTRRATQQRSGLDIEVVVGEPKVHRAKALRLGDYCLGLYASRDYLAEH
GHPTSVADLQRFPLVYFIDAMLQVDDLDLATSFAPAMRESVTSTNVFVHV
EATRAAAGIGLLPCFMADRHPDLERVLAAAVSIRLTYWLVTRAETLRRPE
VAAVVDAIRDRVREQHDVLLGAG
120406248YP_956077.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMSTQHDARPDGPPSITTGLKRVVVASMAGTVVEWYEFFLYATAATLVFNK
VFFAEGTSEAAGLIAALLTYAVGFVARPLGGVVFGHFGDKYGRKKLLQFA
ILLVGAVTFLMGCLPTYAQIGVWAPILLVVLRFMQGFAVGGEWGGAVLLV
AEHSPNKERGFWASWPQAAVPVGNMLATVVLLVLTGTLSNDAFLSWGWRV
AFWLSAVVVLVGYYIRTKVTDAPIFVAAQEEVERVKSVSYGVVEVLKRYP
RGVFTAMGLRFAENIMYYLVVTFSIVYLKTHVGADTSDILWWLLAAHAVH
FLVVPQVGRLADRFGRRPVYIAGAMLAATWGFFAFPMMNSGDYLLILGAV
ILGLMIHALMYAPQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSLAPAIA
TWLLDRFGTWVPIAVYLAGAAVITLVAAWFTRETNGIDLHSLDVADREQL
AKAGIV
120406247YP_956076.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMSEPPGGLRGRTALVTGGAGGIGAACARALAEQGVTVTVADIDDVGAKSV
AQEIGGKAWALDLLDVEALEGLQLETDILVNNAGVQSIHEIAEFPPEKFR
SMMRLMVEAPFLLIRAAVPHMYRNEFGRVINISSIHGLRASPYKAAYVTA
KHALEGLSKVTALEGGPHGVTSNCINPGYVRTPLVTRQIADQARTHNIGE
DQVLSDILLKESAVKRLVEPEEVGALAAWLASPVAGMVTGASYTMDGGWS
AR
120406246YP_956075.1 acetoacetyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MTVTTIEAQWVPSDRDIAEAQVTRFARFAEERTGKTFADYHALWQWSVDD
VEAFWGALWDYFDLGERADVLDGAEMPGARWFPGATLNYVDQVVRQARTD
RPAIIHVSEDGSDREVSWAELLGRAAAFAERLRAAGIGPGDRVVGYLPNI
PEAVIAFLATAAVGAVWSACGQDYSAKAALDRLGQLEPKALVAADGYLFG
GKYRDKRDDVRALAAGLPTLQATFSTDDLAERSDNALDPVRVPFEHPLWI
LFSSGTTGLPKGIMHGHGGVLLEHLKAVALQSDIGRDDTFFWYTSPSWMM
WNFQVAGLLVGATIVCYEGSPNAPQPDSLWGIAARIRATVLGTSPGYVLG
CIKAEAEPGRTHDLSALRTVGITGSSLPPSSSLWLRDHVGVQIASISGGT
DVVSAFIGGVRTVPVWPGELSAPYLGVALDAWDESGKPVRGEVGELVITK
PMPSMPVGFWNDPDGKRYRSAYFETFPGVWRHGDWITITDHGSVIVHGRS
DSTLNRHGIRMGSADIYQAVESLPEVTEALVIGAEQPDGGYWMPLFVVLA
DGVELTDEVRERINDIIRSEVSPRHVPDEIIRAPGVPHTRTGKKLEVPIK
KLFQGGDPAKVVERSAVDDPALLDWYVTQRRS
120406245YP_956074.1 hypothetical protein Mvan_5297 [Mycobacterium vanbaalenii PYR-1]MFESLFDVDVGASEAELRAAVERCERLKSQAAAAQARATALWAAKRRAAE
QARGVPAARRGKGLASEVALARHDAPVLGNRHLGFATALVEEMPHTLAAL
ECGALSEWRATLIVRESACLSVEHRRALDEELCGDVSRLAGWGNKRVEAE
AKTIAARLDAAAIVERSEKAAADCAVTCRPAPNNMVYVTLRLPLTRGVGI
YAACKRAADTTFDGRPRGQVMTDTVYERVTGRPADTPVPVALNLVMADTT
LAGDDDELGWLDGYGPVPAGFCRTLIGNADDAEAEAEVKATLRRLYRHPT
SGQLVAMESRARIFPKGLGMLLQRRDRTCRTPYCDAPIRHHDHATPDRQG
GPTSALNGLGECEACNYAKEAPGWTVTTGDVDGAHTADFETPTGAVYRST
APPLPGPPVRRRLSLLEGRLSIDLVTFDAA
120406244YP_956073.1 xylulokinase [Mycobacterium vanbaalenii PYR-1]MTLVAGVDSSTQSCKVVVCDSATGQVVRSASSPHPDGTEIHPDRWWEALQ
RTIEAVGGFDDVAAVSVGAQQHGMICLDSAGQVVRDALLWNDTRSAEAAE
QLVDELGGPAAWAERIGVVPVAAVTAAKLRWLADHEPVHADATAAVCLPH
DWLTWRLSGSTDIADLCTDRSDASGTGYYSAETDGYQYDLLALALRGRIP
LAPRVLGPRESAGATPHGAALGPGAGDNAAAALGLGAASGDCVVSLGTSG
VVSAVGRAAPHDPEGIVAGFADATGHQLPLVCTLNGAPVLATVAEMLQVD
FDEFDRLALSAPAGADGLVLVPYFAGERSPNLPQAAGALHGMTMRNLHPA
NIARAAVEGLLSSMAFCIDKIGDQGVAAERIILVGGASRSEAVRRIAPAV
LGATVYVPTPAEYVALGAARQAAWVLSGQDTPPPWSVGEPARYDADATPQ
VLERYRAAAPLTLR
120406243YP_956072.1 ROK family protein [Mycobacterium vanbaalenii PYR-1]MACDTVKAEIEGNGALVRATQGNRTPRVGTSTDDVRRRNLSSVLTMVHRR
RAVSRAELTRHTGLSRSTTKDLVEELVARGLVDESPAPSASQVGRPSPIV
RPGDRVLAVAVTPEVDAVTVGLVSMGGTVREVIRRPTARVPTPADTVTIA
ADAICDIQRTLRDGQTVTAVGVAVPGLVHGRESAVQLAPNLDWHDVEIGQ
MLSAATELPVFAGNDANAGAVAEHRFGNHHNAEHLIYVNGGPSGIGAGFV
VAGGLLEGVAGYAGELGHTFVGGGEQCHCGSVGCLETEVTQAPLTSLLSE
LDGAATRHPSSTERDVLARQSRALAIALGNAVNMLNPGLIVLGGFLRVFP
TFAAPMLRDELARRCMAAPRALVRVVPATLGADTLVIGAAELAFAPVLAD
PGRY
120406242YP_956071.1 xylose isomerase [Mycobacterium vanbaalenii PYR-1]MTVLESSRPVPDALSPRREDKFSFGLWTVGWPGVDPFGVATRPALDAIEA
VDRLAALGAYGLTFHDDDLFAFGSSDGERRRAIDRLTSALSANGLVVPMV
TTNLFTQPVFKDGGFTSNDRAVRRFALRKVLRNLDLAAELGAQTFVMWGG
REGGEYDSAKDVQAALERYREALDVLCQYVIDQGSGIRFAIEPKPNEPRG
DILLPTVGHALAFIETLAHPEMVGVNPETGHEQMSGLNFTHGIAQALYSG
KLFHIDLNGQRGIKFDQDLVFGHGDLVNAFSLVDLLEHGGPDGGPAYDGP
RHFDYKPSRTEDAEGVWASAAANMRMYLLLRQRAAAFRADPDVREAMVAA
KVAELRKPTLAAGETYADLLNDRSAYEEFDTGAYFGGKGCGFVALHQLAV
EHLMGAR
120406241YP_956070.1 solute-binding protein [Mycobacterium vanbaalenii PYR-1]MKRTSSLLFTAVVGVGLTLTACGSNSDSGSTEARSGKVGVILPDTKSSVR
WETKDRPALAAAFQNAGVDYTIQNAEGSADTMATIADGMIADGVTVLAIV
NLDSDSGASIQQKAASQGVKTIDYDRLTLGGSADVYVSFDNNVVGELQGQ
GLVDCLGGRPANVVFLNGSPTDNNATLFSSGAHSVVDATPSITIVGEQAV
PDWDNDKAVTIFEQLYTAADGRVDGVYAANDGLAGSVISILEKNKRAGQV
PVTGQDATVEGLQNILAGTQCMTVYKSATEEANALAEVAIALANGEQPQT
TSTSRDDTGGRDVPSVLLTPKSITKDNINVVFDDGGQSKDEVCSGQFAEA
CSAAGV
120406240YP_956069.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MDTQPPILELRGVNKSFGVVHVLHDVDFCVYPGQVTALVGDNGAGKSTLV
KAIAGIHPIDTGTYLFEGKPVTVHSPNDVSALGVEVVYQDLALCDNLDIV
ENMFLGRELKRRGMLDEARMETMAREALTSLSVRTVKSVRQPVSSLSGGQ
RQTVAIAKSVLWNSKVVLLDEPTAALGVAQTRQVIELVRGLAERGVGVVL
ISHNMNDVFEVADRICALYLGRVAAEVKASEVSHGQVVELITAGRSGSLG
LAPAQAAESM
120406239YP_956068.1 inner-membrane translocator [Mycobacterium vanbaalenii PYR-1]MTTVRSDSDVSLADADFSGDTRADETFGAAVRGYLQRVRGGDMGSLPAVL
GLVVLFVVFGLANDRFLSALNLANLITQAGSICVLAMGLVFVLLLGDIDL
SAGVAGGVSACAMALIVVNLSWPWWAALLVGIACGALIGLAIGLLRAKLG
IPSFVVTLAFFLGLQGVTLKLIGEGGSVRVDDPVIRGLTISNLPVAAGWA
IAGVVVLGFAGLELHQHRRKIALRLSHSPLGVVVARVGAVAAVVLGVTYV
MSVNRSVSAVADIRGIPYVLPLMLVLLIAMTVVLRRTSYGRHIYAVGGNA
EAARRAGISVDRIRVSVFVVCSSLAALSGIIAASYAGKVSASSGAGNTLL
YAVGAAVIGGTSLFGGKGRAIDAVIGGVVVATIANGLGLLNQSSYINFLV
TGGVLLLAASVDAISRRRRSSTGLG
120406238YP_956067.1 aspartate aminotransferase [Mycobacterium vanbaalenii PYR-1]MTVSQRSGIPPFYVMDVWLAAAERRRTHGDLVNLSAGQPSAGAPSAVRDA
AVAALNRNDLGYTVALGIPELRAAIAGSYTARHGLTVDPDDVVVTTGSSG
GFLLTFLACFDPGDRVAIASPGYPCYRNILTALGCEVVELPCGPKTRFQP
TLQMLTELDPPVSGVIVASPANPSGTVIPPAELAAIATWCESSGVRLISD
EVYHGLVYPGAPATSCAWETSREAVVVNSFSKYFAMTGWRLGWLLVPDEL
KRAVDRLTGNFTICPPALPQIAAVSAFTPESIAEAEALLHDYAANRTLLL
DGLSALGIDRLAPTDGAFYVYADVSHLTTDSLAFCSKLLDDTGVAIAPGV
DFDTVRGGAFVRLSFAGPASDLEEALRRIGAWLA
120406237YP_956066.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMSEERDLLRDTVAALVDKHASPEAVRKAAASERGYDEALWKMLCEQVGAA
ALVVPEELGGAGGELGDAAVVLEELGKGLVPTPLLGTTLAELALLSVAEP
DAEALAALAEGAAIGTVVFDPGYVVNGNVADVVIAADGDALTRWNAFTAT
PAVAMDITRPLAAVEATETSPLGADPGLADTAAILLAAEQIGAATRCLEL
TVQYTKDRVQFGRPIGSFQALKHRMADLYVAVQSAKAVVDEAVAEPTATS
AALARLAAGEAFSKVAAEAVQMHGGIAITWESDIQLYFKRAHGSAQLFGP
PREQLRRLEAQVF
120406236YP_956065.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMNFEIDEQQRDFAASIDAALGAADVPAAVRAWGEGDTAPGRKVWSQLADL
GVTALMVPEKFDGIEAHPVDLVVALERLGRWNVPGPVAESVAVAPVLLAD
DDRSAALAAGELIATVAAPPLVPRAVNADTAGLILLAEDGSVSNASAGAE
HESVDPSRKLFEVSAYGDRKAADVARAFEFGALATSALLVGAAQAMLDAS
VEYAKQRSQFGTVIGTYQAIKHKLADVLIAVELARPLVYGAALSLADGST
DTGRDVSAAKVAAADAALLAARSSLQTHGAIGFTQEHDLSLLLLRVQALR
PAWGDPTWHRRRVLEALTK
120406235YP_956064.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDLTFDDATSEFRAEVRDFLAANKSAFPTKSYDTAEGFEQHRRWDKVLFD
AGLSVITWPEKYGGRDASLLQWIVYEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQLDRILPKMASGEEIWAQAWSEPESGSDLASLRSTATRTDGGW
LLNGQKIWSSRAVFGERAFGLFRSDPEAQRHKGLTYFMFDLKAKGVTVRP
IAQLGGDTGFGEIFLDDVFVPDQDVIGGVHDGWRAAMSTSSNERGMSLRS
PARFLAPAERLVAQWKDNPDPAFTDRVADAWIKAQAYRLHTFGTVTRVSN
GGELGAESSITKVFWSELDVALHQTALDLRGADGELTDSVTEGLLFALGG
PIYAGTNEIQRNIIAERLLGLPRK
120406234YP_956063.1 long-chain-fatty-acid--CoA ligase [Mycobacterium vanbaalenii PYR-1]MRTTPAVLDRIARELPDHPAVVTTAGGAGNPAVAGESGNPAAARTLTYAE
LRAEVRQAAAALIDLGIEPGDRVAIWSPNTWHWVVACLAIHHAGGVLVPL
NTRYTASEAEDILVRTAAPLLFASGEFLGADKAASVDRDAVPALRHVVRI
PIEKSDGTWDEFMSRGANLDAVDERVAAVTGDDVSDILFTSGTTGRSKGV
RCAHRQSLDASAAWAACGQVTSDDRYLCINPFFHNFGYKAGILACLQTGA
TLFPELTFDPENAMRAVQEHGITVLPGPPTIYQTLLDHPKRGDYDLSSLR
FAVTGAATIPVVLIERMQSELDIDIVLTAYGLTEAAGFGTMCRADDDAVT
VATTSGRPIADFELRIGDQSEVLLRGPNVMLGYLDDPEATAAAIDADGWL
HTGDVGELDDAGNLKITDRLKDMYICGGFNVYPAEIEQVLARLDGVAEAA
VIGVPDERLGEVGKAFVVRLPSAELDEKTVIDYAREHLANFKTPRTVEFL
DALPRNPGGKVVKPLLRQHSERA
120406233YP_956062.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMIEVQEFRAEVRDWLAENLVGEYAALKGLGGPGREHEAFEERLAWNRHLA
AAGLTCLGWPEEHGGRGLSVAHRVAFYEEYAKANAPDKVNHLGEELLGPT
LIAYGTPEQQQRFLPKILDVTELWSQGYSEPGAGSDLANVSTTAVLDEEG
RQWHINGQKVWTSLAHWAQWCFVVARTEKGSKRHAGLSYLLVPLQQPGVE
IRPIIQLTGDSEFNEVFFDDARTDADLVVGEPGDGWRVAMGTLTFERGVS
TLGQQIRYAREHSNLVELAKRTGAADDPLIRERLTRSWAGLKAMRSYALA
TMDVEQPGMDNVSKLLWANWHRELGEIAMDVQGMAGLTLPGGEFDEWQRL
YLFSRSDTIYGGSNEIQRNIIAERVLGLPREAKG
120406232YP_956061.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTDLSVAPTEIEGHGLLKGKVVLVTAAAGTGIGSTTARRALLEGADVVVS
DYHERRLTETRDELAAFGLGKVDSVVCDVTSTEAVDALITSTVEKAGRLD
VLVNNAGLGGQTPVIDMTDDEWDRVLNVTLTSVMRATRAALRYFRDAPHG
GVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEYGVRVNAVS
PSIARHKFLEKTSSSELLDRLAEGEAFGRAAEPWEVASTIAFLASDYSSY
LTGEVISVSSQHP
120406231YP_956060.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSSGQAPQANTRRDELLQLAATMFAERGLRATTVRDIADSAGILSGSLYH
HFSSKEEMVDEVLRGFLDWLFDRYQQIVATEPNPLERLKGLFMASFEAIE
TRHAEVVIYQDEAKRLSAQGRFAYVEERNKEQRKMWVDVLTQGIDEGYFR
PDVDVDLVYRFIRDTTWVSVRWYQPGGPLTAQQVGRQYLSIVLGGITAEP
TSKESTNG
120406230YP_956059.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MAEAYVIDAVRTAIGKRNGSLAGMHPVDLGAAGWRGLFARNDVDPGAVDD
VIAGCVDAIGPQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGA
QAILSGTADLIVAGGMQNMSQIPISSAMIVGEQFGFTSPTNESKSWLHRY
GDQEISQFRGAEMIAEKWDISREDMEQFALTSNQRAQAAIRAGHFENEII
DVDGFRVDECPRETTLEKMAGLKTLVDGGRLTAAMASQISDGASAVLLAS
ENAVKVHNLKPRARIHHISARGADPVFMLTGPIPATQYALDRAGLTIEDI
DTVEINEAFAPVVQAWLKETKADPEKVNPNGGAIALGHPLGATGAKLFAT
MLNTLERTGGRYGLQTMCEGGGTANVTIIERL
120406229YP_956058.1 aldehyde oxidase and xanthine dehydrogenase [Mycobacterium vanbaaleniiMRITVNGTDRTDDPRPGQCLRTFLRDLGHVEVKKGCDAGDCGACSVLVDG
AAVHSCVYPAFRADGRTVTTVAGLGTPKDLHPMQRRFVEAAGFQCGFCTA
GMVTTASALTADQLEHLPQHLKGNLCRCTGYRAITDAIAGVVNTEKSGGS
DVGRSIGAPAGVRVVTGTEEYTMDDTPVGLLHMAVLASPVPHARIRSIDT
AAAESIPGVRLVLTHRDSPAVRFSTARHESRDDDPDDTVILDDTVRFVGQ
RVAAVVADSVAVAEAACRAIVVDYEPRPAVFDPDTARRPGAPLLHADKGP
ESRIADPSRNLVAELHGEVGDVAEGVRAAEAGGGAVVRGSWRTQRVQHAH
LETHGCTGWRDDAGRLVIRTSSQVPFLVRDELCHIFGLDTDEVRVFTRRV
GGGFGGKQEMLAEDLVALAVLRLGAPVRYEFSRTDEFTVAPCRHPFRVEV
TVAAGRDGRLTALAVDALVDAGAYGNHSPGVMFHGCGESVAVYRSPNKRV
DAEAVYTNNLPSGAFRGYGLGQISFAVESAIDELAARLGIDPFEFRRRNV
VVPGDTFVDSHVLEDDLTFGSYGLDQCLDLAEAALRAGNGATAPAGWAVG
EGMAVAMIATIPPRGHFTEVSVSVDADGVYTLDVGTAEFGNGTTTVHVQL
AAAELNTVPERIVVRQSDTATTGYDTGAFGSAGTVVAGLAILAASRELRT
ALVTAAAELTGAAPSSCVLGRNGVQCDARLVDFGSLPTPMNRTARHDGTP
RSVAFNVHAFRVAVDTETGEVRILQSIQAADAGVVINPQQCRGQVEGGVA
QAIGSALFEEILIGPDGAVMTKALRDYHIPQVADVPATEVYFADTHDDLG
PLGAKSMSESPYNPVAPALANAIARACGARVCQLPMTPARVWRAVRASR
120406228YP_956057.1 FAD-binding molybdopterin dehydrogenase [Mycobacterium vanbaalenii PYRMDLNTVEAVHIPTRRDEVWPVGPSDAILAGGTWLFSEPQPQVSRLIDITR
LGWPPITFSDDGMEIAATCSLAEIGSLTNTLPSDRPDWPAAPLFGQCCAA
LLASFKILGSATVGGNICLSFPAGAMISLASALDGTVTVWSADGSDYVVP
IGEFVTGAGSNVLRSGDVLRSLWLPAHALRSPTAFRKLAPSPLGRSGVVV
VGRRDEDDGQFVLSVTAATVRPHVFRFPLPPTAGEIRTALAAIAETEFTR
DAHGDPDWRRAVTLTLAEQIRRELT
120406227YP_956056.1 amidohydrolase [Mycobacterium vanbaalenii PYR-1]MRAYRGHLIHIGGSPRLDSAREHLVSVPDGVLVVNDAGSIAYSGSYQEMP
AYPDTEMHDCRPGFLLPGFIDTHIHYPQTHCIDSYGGGQLLDWLQHCIFP
AEAKLADRDYARDVARDFCRRRVAVGTTTALVFGSAFPDAQDTLFEESAR
IGLRTISGRGIQTVGPEAAGPLLTDDDTAIALTHSEIDRWHNAEGGLVKV
AVVPRFALSVTGRTLHALGELYDAVRGRGVYFHTHLSENVTEIDAVRTTY
GVENYLDTYDGRFDGGGLSLLGPRSVFAHAVHCTDGELNRLSETGSSIAH
CPTSQLFLGSGTMPWRRTVASGVNVALGTDVSAGDEWLIPRVLNDCFKVH
ISEPGGQGLSISPAALLFTATLAGARALQMEDRIGNLDVGKEADFVVIDP
RCQPLLSELLTPIAPDDADRLLFTLLLSMREDAVGGVYVRGRLLSPR
120406226YP_956055.1 FAD-binding monooxygenase [Mycobacterium vanbaalenii PYR-1]MKVVIVGAGMGGMSAAIALRQIGIDTVVYERVTENKPVGAAISVWSNGVK
CLNYLGLQEETAELGGKVETMSYVDGHTGDTMCRFSMHPLIEQVGQRPYP
IARAELQLMLMKAYGIDDINFGMKMVGVENDTAGSAAKATFADGTTVSAD
VIIGADGAGSITREYVLGGPVSRRYAGYVNYNGLVSTDDAIGPATEWTTY
VGDGKRVSVMPVSDDRFYFFFDVVEPQGSPYEEGRVREVLRAHFAGWTPG
VQTLIDTLDPLATNRVEILDLDPFHTWVKGRVAVLGDAAHNTTPDIGQGG
CSAMEDAIALQWAFKDHPDDVHAALAAYQSARTERAADLVLRARKRCDVT
HAKDPQVTSRWYDELRNEDGTNIIRGIVGNIVGGPLTPVTAATEG
120406225YP_956054.1 transthyretin [Mycobacterium vanbaalenii PYR-1]MTLSTHVLDATTGRPAANVAVTLTAADTPVADGLTDADGRITGLGGELAS
GIYRLHFDTGAYFAARHVASFYPEVVIAFEITDPSGHYHVPLLLSPYSYS
TYRGS
120406224YP_956053.1 putative OHCU decarboxylase [Mycobacterium vanbaalenii PYR-1]MKAIGLAGFNALSERQRMHLLFEVCSSTIWARRVVAGSPFRDAEALYDRA
DRVLAELPDAEIDAALDGHPRIGAKADNPSSAREQARVADSGPEVKAALA
AKNREYEDRFGYVYLVCASGRSADELLDILTERLGNDADTERRVMRNELG
KINRLRLERLLHEPT
120406223YP_956052.1 uracil-xanthine permease [Mycobacterium vanbaalenii PYR-1]MSAPTKSPKKRVHPVDEVLPLPKLATYGFQHVVAFYAGAVLVPILIANAI
GLSGEELVMLITADLFTCGIASIIQAVGFKNIGVRLPLLQGVTFAGVAPI
IAIGLAHGGGTESLLYVYGAVIVAGVFTFLIAPMFVRLLKFFPPVVTGTL
ITIIGLCLVPIGALDAVTNPATHEPDPTNLRWVLYALGTIAVIVAIQRLF
RGFMSTIAVLLGLVAGCTVAFTLGDMNFDRVAEASMFGFTPPFAFGMPRF
DIVAIITMIIVMMIIAVESTGSTIATGEIVGKRVRPSDIGNVLRADGVAT
TIGGIFNSFPYTAFSENVGLVRLTGVKSRWVVAAAGVIMILLGFLPKVAA
IVASIPNPVLGGAALTLFATVAVVGIQTLGKVDFTDHRNVIIVTTSLALA
LLVTSYPDISSQLPAGLDILFGSGISTGAITAIVLNIVFFHIVKKGPRVA
GSGSITLDEVNAMTRERFTEVFGHVVQGVSWAADRAFDQRPFADTAALRE
AFQDAVLTGNAEQQQELLDAFHDLGAEDETGQVLAVDHVALSNLDEEDHQ
DVVTLAAAYREHFGFPLIICARETERFDRVLRNGWSRMDNSPATEKAYAL
IEVAKIANYRFTDLVADANPIAAARFGRLNELS
120406222YP_956051.1 L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium vanbaaleniiMSRGAGIASRTWTAAAKSTVVRSNSWARFLRRPSDRDAIAMHRLVADTRV
LDVNSTYTYLLMATDFADTTIVADRDGELCGLITAYHPPVRPEVLFVWQV
AVAESARGTGLAGVMLDTLVDRVRRDRHGHPVTVEATVSPDNTASRAFFG
AFAKRHGVLLVEQPHFTSAQLDSDGNHEDEPLLRIGPIATPMVD
120406221YP_956050.1 diaminobutyrate--2-oxoglutarate aminotransferase [Mycobacterium vanbaaMSTPATIVRPGEPDLPAVYSSVESEVRSYCRNWPATMAHAQGSWVTDVSG
RRYLDFFAGAGALNYGHNNPILKQPLLDYLSSDMIVHSLDMATEAKTRFL
ETFERLILRPRGLDYKVQFPGPTGANTVEAALKLARKVTGRESIISFTNA
FHGMTLGALSVTGNSMKRAGAGIPLVHATPMPYDNYFGGVTEDFHWFERV
LDDSGSGLNRPAAVIVETVQGEGGLNVARVEWLRGLAELCQRREILLIVD
DVQMGCGRTGPFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFRRQLDVW
TPGEHNGTFRGHNPAFVTAAKALETYWETETFVEDTLAKGRRVRERLVGI
AGNHPGVTARGRGMAQGLKFEDAAVAGAAAGAAFERGLLVETSGPADEVI
KLLPPLTTSEEDLDSGIDILAEAIAVTVA
120406220YP_956049.1 L-ectoine synthase [Mycobacterium vanbaalenii PYR-1]MIVRTTDEITGTNRDVAAEHWRSKRIILADDGVGFSFHETTIDANSVSEF
HYQHHVEAVWVVEGTGTLTNHETGEVHPLRPGTMYLLNGHERHRVTCDTT
MRMLCVFNPPVTGREIHDENGAYPAAVQAS
120406219YP_956048.1 ectoine hydroxylase [Mycobacterium vanbaalenii PYR-1]MSSRHLSQSTDRYPTRLDTQIDPIAREEPTVWGSAANGPLAAADLDSMAS
NGYMVRRDAVEAAWLPALTAELDRVAATADPRDPRIIREPGGSIRSVFQP
HLFSDLISEVVTLDTVLPVARQLLGSDVYLHQARINMMPGFTGTGFYWHS
DFETWHAEDGMPEMRAVSCSIALTQNFPYNGSLMVMPGSHRVFYPCVGAT
PRDNHASSLVKQEIGVPSHATLTAAADRHGIDQVTGPAGTALWFDCNIMH
GSGSNITPYPRSNIFLVFNSVENRLLAPYRAETPRPEYLAARTSQPFSAT
ALTT
120406218YP_956047.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGPGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHVRGQDVGVMALVGTFSQYGTVPEASI
VKIDDDIPLSRACLLGCGVTTGWGSAVNTADVSPGDTVVIIGLGGIGSGA
IQGARLAGAEKIVVIEPVESKRELAFRFGATHFVTSMEEATALVADLTRG
VMADSAILTVGLLEGSMLEEAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMRAGRNIRGVILHDH
120406217YP_956046.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MSRLSTPLTELVGIEHPVVQTGMGWVAGARLVSATSNAGGLGILASATMT
LEELTTAVAKVKAATDKPFGINIRADAGDANARVDLLIREGVKVASFALA
PKPDLIARLKDAGVVVIPSVGLAKHAKKVAGWGADAVIVQGGEGGGHTGP
IATTLLLPSVLDAVADTGMPVIAAGGFFDGRGLAAALSYGAAGVAMGTRF
LLTSDSTVPDAVKQRYLDAALDGTVVSTKVDGMPHRVLRTGLVEKLESGS
PIRGLSAAVLNAQKFKKMSGMTWKSMITDGLAMRHGKDLTWSQVVMAANT
PMLLKAGLVEGNTDAGVLASGQVAGIIDDLPSCAELVPAIVAEAVEHLQK
ASQHIR
120406216YP_956045.1 putative CoA transferase subunit beta [Mycobacterium vanbaalenii PYR-1MISATRAEVCAVACAELFRDAGEIMVSPMTTIVSIGARLARLTFSPDIVL
TDGEARLIADTPAIGAAATIEGWMPFGRVFETLAWGRRHVVMGANQIDRY
GNQNLSAFGPLQHPTRQMFGVRGAPGNTINHPTSYWVGNHSKRVFGTEVD
IVSGIGWDKVDPDNPAYRFVNVYRVVTNLGVFDFNGPDHQMRAVSLHPGV
EPDQVAENTSFEVHGLAEAETTRLPSGDEQKLLREVIDPKSLRDKEVKV
120406215YP_956044.1 coenzyme A transferase [Mycobacterium vanbaalenii PYR-1]MSDKRTTLDEAVSSIQSGMTIGIGGWGSRRKPMAFVRALLRTDVTDLTVV
TYGGPDLGLLCSAGKVKRVYYGFVSLDSPPFYDPWFAKARTSGSIEAREM
DEGMLRCGLQAAAQRLPFLPIRAGLGSDVRAFWGDELKTVRSPYPTGSGY
EELVAMPALNLDAAFVHMNIGDAKGNAAYTGIDPYFDDLFLMSAQKRLLS
VERVVSTEELVKSVPPQALLINRMMVDTVVEAPNGAHFTTAEPDYRRDEK
FQRHYAEAAGSDETWAEFVKTYLSGSEADYQAAVRKFTEDREAAK
120406214YP_956043.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MPITTKTVEPGIVSVTVDYPPVNAIPSRGWFELADTITAAGRDHSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCYEAFRAVYECAVPVVAA
VNGFCVGGGIGLVGNSDVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRLFFTAATVTADTLHHFGSVHEVVPRADLDEAALRVARDIASKDTRV
IRAAKEALNFIDIQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTEKGK
A
120406213YP_956042.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTDAVDSARRGIALGLTGRVVLVTGGVRGVGAGISKVFADQGATVVTCAR
RPVEGSPYEFRSCDIREDDSVKGLVEGIVSDHGRLDVVVNNAGGSPYVLA
ADASARFSAKIVALNLLGALSVSTHANAAMQAQAAGGSIVNITSVSGRRP
TPGTVAYGAAKAGMENMTATLAVEWAPKVRVNSVVVGMVETEQSELFYGD
ADSIAAISKNVPLGRLAKPEDIGWATAFLASDAASYISGASLEVHGGGEP
PHYLATTTADIKTQG
120406212YP_956041.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQAVVDEIVGAGGEAVTSGANVADWAQAEGLIQTAVDSFGTLDVLVNN
AGIVRDRMFANTSEEEFDAVTAVHLKGHFATMKHAAAYWRAKSKAGESVD
ARIINTSSGAGLQGSVGQANYSASKAGIAALTLVAAAEMGRYGVSVNAIA
PSARTRMTESVFADMMATQDKDFDSMAPENISPLVVWLGSVESRDVTGRV
FEVEGGKIRVAEGWAHGPEIDKGARWDPAELGSVVPDLLAKARTPVPVYG
A
120406211YP_956040.1 putative GAF sensor protein [Mycobacterium vanbaalenii PYR-1]MVSVSGFDDWLNRLVMELADKAGLSPDRYVAEAVAMRLMDDVTTNDGVHD
ELLAHLSNAQIPVPAQWQWPQSIITDPERLRVLYATGLLDSPAEKVYDRI
VDMAAAALAAPGAAVSLVDHDRQFFVSMHGSTGQEPESRETSIQRSLCQY
AVASGQPLVLADARTDPVLQHNPAVSDGSVVAYLGIPLIGRDHHAVGTLC
VWDNTPRDWTSGHVTTLRDLAQLAADHIFPRAQRGQAP
120406210YP_956039.1 phosphoglycerate mutase [Mycobacterium vanbaalenii PYR-1]MRDVRRTARRLLTILAATLAAAVLFAASAFAAADIVLTFVRHGQSQANAD
GIINTEVPGPHITALGQQQAALVAGVLAAGGYQGIYASDMVRTQETAAPL
ADILGESVTVLPGLREIDAGIYEGSSETDGLGRLGYGLTPALWTLGLRSA
WIPDSTDTNGNVFSDRMSEAVQIIYEDGWARPVAFSHGATIMFWTMMNVD
NPDLGLLLSHQLPNTGVVVLEGNPEDGWTLVSWDGVAVDPDPSFLTKTFV
NVRELITTPQTAVYNVKKAFATGDLAAITDSFAQAVIDVVLAPVRFVGAV
ATDVLELVFPPAPSVQVEAPMSAESTTDESDVPADVPDDVVAVAPSEDVE
SRTPEPASDEAETREESAAPESEATEPEISASQSEESEVETETTEETTTA
GTTGDDDTDETDDGAAVKEAA
120406209YP_956038.1 hypothetical protein Mvan_5261 [Mycobacterium vanbaalenii PYR-1]MAQPPRPLTPKQVENLNSKAVGVAIKWMSKFNTWAYKATGGRIGYNWRLG
SNRFSAPPPVGILTTIGRKSGQPRESPLLFLREGDRVVLVASQGGRASNP
MWYLNVKANPAVTFQIRNEKLKLIAREATDAERDEYWPKLDAMYPDFANY
RSYTDRQIPILICDPDSR
120406208YP_956037.1 hypothetical protein Mvan_5260 [Mycobacterium vanbaalenii PYR-1]MIADADRIAAAQAYISALATHRADDVPFAPGCTRVEVGLKTGFSGNHLRR
SLNRGLQYRVIREVTAPEFTVDGDTVRARFELFTKPSLAGRRVGARIDEM
FLIPADDPSGRAQIHHIKASIRPFLTR
120406207YP_956036.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIEAGMVEQ
VIGGCVTQFGEQSNNITRVGWLTAGLPEHVGATTIDCQCGSAQQANHLIA
GLIATGAIDIGIACGIEAMSRVGLGANAGPDRSIIRASSWDIDMPNQFEA
AERIAKRRGITRADVDALGVASQAKAKQAWAEGRFDREISPISAPVLDEN
KQPTAEWAPVTRDQGLRDTTAEALAALNPVMEGGIHTAGTSSQISDGAAA
VLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTARVLEKAGM
KMGDIDITEINEAFASVVLSWARVHEADMDTVNVNGGAIALGHPVGSTGA
RLITTALHELERTDKTTALITMCAGGALSTGTIIERI
120406206YP_956035.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MPGPNSCPISPEFDFLDASLNLERLPVEELAELRKSEPVHWVDVPGGTGG
FGDRGYWLVTKHADVKEVSKHNEIFGSSPDGAIPVWPQEMTREAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAVGRLEDELRARAQRIAATAATEGSG
DFVEQVSCELPLQAIAELLGVPQEDRDKLFRWSNEMTAGEDPEYADVDPA
MSSFELITYAMKMAEERAKNPTEDIVTKLIEADIEGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSRNPDQWELYKKERPETAADEIVRWATPVS
AFQRTALEDTELGGVQIKKGQRVVMSYRSANFDEEVFENPHSFDIMRNPN
PHVGFGGTGAHYCIGANLAKMTINLMFNAIADAMPDLKPIGDPERLKSGW
LNGIKHWQVDYTGQCPVQH
120406205YP_956034.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFSPDEGQQAVADVVTSVLERDNTWDALVSGGVTALGVPERLGGDGVGF
AEMATALTEIGRHGTISPALVTLGTTAVLLDLASEAQQDRYLGGVAKGSV
LTLALNEPGAQLPDRPAVALAAGKLNGTKVGVGYAAQADWIVVTTDNGVV
VVPGKADGLTVTKTPTSNGSDEYVLAFADVAVADADVLEGATPHRVNQLV
LAAVGAFSAGLVAGALRLTADYVATREQFGRPLSTFQTVAAQLSEVYIAS
RTISLLSTSVAWQLTEGRDAADDLAILGYWLASQAPPAMRLCHHLHGGMG
MDITYPMDRYYSSIKDLTRLLGGPSHRLDLVGA
120406204YP_956033.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMYIDLTPEQRQLQAELRQYFSTLITPDEAAAMETDRHNEAYRAVIKRMGS
DGKLGVGWPKEYGGLGFGPVEQQIFVNEANRADVPLPLVTLQTVGPTLQV
YGTEEQKKKFLPGILSGDIHFAIGYSEPDAGTDLASLRTTAVKHGDEYIV
NGQKMWTTGAHDADYIWLACRTDPEAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVRVPADMLVGEENGGWKLITTQLNHERVGLGPAGR
VAGIYDQVHAWASKPGSDGVTPVEHDDVKRLLGQIKAIWRVNELLNWQVA
ASGETIAVADAAATKVFSTERIQEVGRLAEEIVGGYGNPADPETAELLDW
LDKMTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
120406203YP_956032.1 hypothetical protein Mvan_5255 [Mycobacterium vanbaalenii PYR-1]MREERTIGMSDLQSAIAEIKAAGRSKPRAGRDPVNQPMIHHWVDAIGDKN
PIYVDDEAAKAAGHPGIVAPPAMIQVWTMGGLGQGRSDDDPLSKMMKLFD
DAGYVGVVATNCEQTYHRYLQPGEEVTIAAELTDVIGPKQTALGEGFFIN
QKITWQVGDEDVAEMMWRIMKFKPAERAKGAQVPEDLDPDKLMRPASSRD
TQFFWDGVNAHELRIQRRPDGTLQHPPVPAVWQSQDAPIDYAVASGNGTV
YSYVVHHAPKVPGRTLPFVIALVELDEGVRMLGELRGVDPDQVEIGLPVR
ATYIDFPDSEVSPAWTLYAWEPVR
120406202YP_956031.1 MaoC-like dehydratase [Mycobacterium vanbaalenii PYR-1]MSAPALEVGTKLPELKIYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRYLTDWAGPTARIKSIGLRLGVPWYAYDTITFTGEV
TAVDDGVATVKVLGSNSLGDHVIATATLSLGDR
120406201YP_956030.1 lipid-transfer protein [Mycobacterium vanbaalenii PYR-1]MLSGKAAIAGIGATDFSKNSGRSELRLAAEAVLDALDDAGLTPSDVDGLV
TFTMDSNLETAVARSTGIGDLTFFSQIGYGGGAAAATVQQAALAVATGVA
EVVVAYRAFNERSEHRFGQVMTGLTVNADSRGVEYSWSYPHGLSTPAASV
AMIARRYMHEYGATSADFGAVSVADRKHAATNPKAHFYGKPITIEDHQNS
RWIAEPLRLLDCCQETDGGVAIVVTTPERAKDLRHRPAVIEAAAQGAGAD
QFTMYSYYRDELGLPEMGLVGRQLWEQSGLSPEDIQTAILYDHFTPYTLI
QLEELGFCGKGEAKDFIAGGAIEIGGRLPINTHGGQLGEAYIHGMNGIAE
GVRQLRGTSVNQVPDVEHVLVTAGTGVPTSGLILG
120406200YP_956029.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MRRTCACRFRARHNTLPAHGATPRSPTRSRRYRLGAEQRPAPANSSCHHG
VVSVALISAVDPYPTDAGKKVVLAGFVDYLADRHGADNVHYIKVGTARRE
NFPVQLHEVPGPRRVDVLRNVAARVATGRASLQEAFLGSRQTMEAITQIL
EDIKPGLRIYDTVRMAQYASDDIAANSICYLDDLFSERYDRMLKAAARYP
DVELSPLGNFAEHVPKRLQPLATDRVSQSALLRLERRLVLRSEDRAARRF
GRCLLLNSGETAQLQRRTGVAPGRIQCVPPLLNIVASSGRTYRGTKEFIF
LGLLSLPHNEDGLESFLRTAWPLVLARMPDAHLTVIGRDASPRLLALTTE
LAGSVTVAGYVPDLDDALNGAAALINPLRFGSGIKLKVFEALRRSLPVIS
TTVGAEGIDSGPGTGILIADDAAATADLLCSLTSVERNAEVSDEAREHFA
STYSRDAVFAVYDRAFTL
120406199YP_956028.1 polysaccharide biosynthesis protein [Mycobacterium vanbaalenii PYR-1]MPSTGRQTAWNYLIFALSKSSTLLMTIVVARILSPTEFGIFALAVLVVNL
FDYVKDLGVAAALVQNRREWRILAPTGLTLSVLFGLGASGVLAATAGVAA
RALGQPELTGLIRILAVGLAISALSTIPAAWLRRSMNFSARLMPEFAGAA
TKTGLTIGLAAAGFGVSSLAYGQLAAVVVMTVLYWRVAHIRPSLGFDSRV
CRELIRFGLPVTAVTLLAYAIYNVDYLAIGERLGATELGLYTMAYRIPEL
LVLSLCVVVSEVLFSALSGLQDDRDALTGHYMQALTVVAALTFPIGVGLA
VAAQPLVGTLYGVDYAGSAPILSVLAIYTALYSASFHAGDVFKAIGRPGI
LTAINAGKLAVLVVPIWWAAGHSALMVAFALLGVEALHFLVRMTVLHRLM
GTSWLSIAGALCRPAAAAVPMGLVLLGLARVTDGLADPLELVVLAFVGLC
VYVLILRFTAAQLVKAAFGMVRQRLSRSTAASATTAKEGP
120406198YP_956027.1 hypothetical protein Mvan_5250 [Mycobacterium vanbaalenii PYR-1]MTKRRMLIAVLAVLGAVLGAGIGVFAVAAPSRYSASADVAFLPAPNLTTV
EASDFWEVLTRGQVTRTAAIVYDDPRWLPSAADAAKVPRDDLTLEAVALP
DTTMLTVTVSAGSAGAAEAALNNVLTTATPEVSSLVAPYFVKVLWPPENS
AWPEASPGRLQLAAAGALGGFLIGAGIGWLVQRRRGDAGSPGKHSDGSTH
GAPPGS
120406197YP_956026.1 O-antigen polymerase [Mycobacterium vanbaalenii PYR-1]MTGSTRVSQGELAGLVVAVGFVSIGSLLVFGSRSTLLLIAAPIGAIALFV
VARRPVLALSIMVVIEFANLSGLLAPKTGLPIFPASLLLGLIAVGFALRD
PQCRGRINGWTAVCAGLLAVYLATQAVAGIGSVDTAESVAILQRHVIDCV
FVMVVLVLVQVTARPWTVAAVIVVTLAALCTLTVISQVVYGGAATFGGLS
TVTTASGEMVTTLRYGGPLPDSNFWGRHLVMGLPMAAALMTRALRSARRA
TAAPWAIALALLLCGIYLTQSRGTFLAAGVAIVVWFVAVDRAVRRWALIL
IPLGVAVFAVPGVGNRMVAAFEDFTHAQVQTDIDPSVVQRISAQQQAWLM
FNERPTFGFGPATFPGQVINFADRTDIAPRDPTNAPHNLYAELAAESGWV
GLLGWMVVILGFLTITVLGNLANPFRRDRVLAAAVCAAIVAWSVASIGLH
MAYFRTFGVVLALVGALAPMWPVPAEPVRRLVHGVITWGTAGLLGFAAFW
IFLSANSSAAVTARQPMTLVPAGPVDGWYAYALDIRSRAELLPTVARLLE
DPRSPVDIIADPARGVLIFTATADNVDRARTDIQRAAAHAEAALHSAIGY
QQYSLQTVGSMRAQTTRQPSPGTLIVAIGVGVGTMLIVRAVWLRAATRRR
TGAVDDRPTTREATSVPAASP
120406196YP_956025.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MLVELSPSGGLFQFAFELGSALAARGERVELWTGPRPELASSQPGFTVRP
VLPTWHPGDTGVHSRAFRLARRGFRAGQLIFAWTVLSVRLLAARPHAVLW
SQWRFAFEPMFVVAVSTLLRSSILGLIAHEPVPRSDAKDTSTAKAGALLT
RAFRAAWRRLDVAFVLGPRTRDLAVTHWQPRCPVYVIPHGAEPGVRGGRS
VRPVADTEPVVLFFGVWAKYKGIEVLLDAFARVRAELPESQLVLAGDVGA
DIDLPSVLDRAGQIGNVDARPGYVAIDDVAALFDAARVVAVPYIRATQSG
VAHLAFTFGRPVVSSAVGDLPEVIEDRVTGLLVEPDDADGLAAALVELLR
NPSLAATLGAAGEQRVNDAWTTAAARVCDALAEAATVRSRKGD
120406195YP_956024.1 hypothetical protein Mvan_5247 [Mycobacterium vanbaalenii PYR-1]MAVTGRPDRIMVPRVCALVAALAVVVGGGTSCSSPSASGALASPFDASSP
WRQVIPADAPVDPNSTAMIASVQPTPALNANLVAYGIPIYAAGRDTPTYA
VACTRVDYGLCPFAGWPVAIPDGAEPNTGSDGVLVSVQESSGIIFEFWRA
VRDGETWTTAFGAVNSLHGSGWGGAATGSGASRLAGVVRVAEIADGEIPH
ALALQSNNACPTFRAPALKSDGTSTRADCIPEGARLQLDPELDLGSLDLR
PGELAVARAMQRYGGYLMDVANTPLSVSFEREADPAADEVGQTYSDAGFR
WDYDAMENVPWDKLRVLK
120406194YP_956023.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MTRGISALVLIDAFRMGGAETLLAPMIVASRDTDVTMDVVSISPADWNSE
KTMAILADAGIATRSLGIRRLLDPVALPRLVKTIRQGRYDIVHAHLEMAM
TLAVPAAALVGRPAVCTFHHVARPLQGRAAWRERLAVEAATRSRRALFVS
EASRRSFAETYRPNRMPKNWEVMHNGIDISNFSPGQADPRVRSELAAGTQ
GPVVVLPAAFRDFKGIPVAIKAWPAVKQRFPTAVLALTGGGELEGELRRL
VADLGLGDSVNFVGVRTDMPEVYRAADVVVLPSTHGENLPTVLIEASATA
CAIAASRVGGIPDIVLDGATGLLFEPGSADGLAEAVCRLLDDVELRRRMG
AAASERARTEFSATAWLARLRTTYLEAMGVPR
120406193YP_956022.1 group 1 glycosyl transferase [Mycobacterium vanbaalenii PYR-1]MSRRDVVYLVSRFPVTSETFIVREIEALDRSGKFHVEIRSLFPSPDEPVH
DIARRWSRHLVRPTARDAATGLAWALLTRPIAVMSVLATVTSGYLRRPPL
LVRALTTVPIACAHARDLARRGRPCHVHAHYATYPALAAWVCRRLAGISY
SFTVHAHDLYVDMSMLDRKIADACYVVTISQYNRALLEQHNSMGTPIRVV
HAGIDVGAYRFRARGVPAEGEVRALTVASLQQYKGHAVLLEALAMGGPEV
DRITLDLIGDGVLRGDLEALVDRLGLRDRVRFLGSCSEEAVRAALDAADL
FVLPSIVADDGQMEGLPVALMEALACGVPAVSTKLSGIPEIVVDGVTGLL
ATPGDAASLNATLTAMVQRGTAAVEFADAGRALVSREFDLRESIAALTGL
LDEYLPPVAS
120406192YP_956021.1 hypothetical protein Mvan_5244 [Mycobacterium vanbaalenii PYR-1]MTDAGSATTLWFYGNTSQTTLSFPVAPGLRPATLNATLNLPFAMRSGTLS
VTQDDRLVSKVALPLTDFAPVVIPLDSVEVVDDSATVTLKLTGLAEEGYC
LDEENPVGLVNGSITYTGTVSPPSTVADFLPPVLRTVTIGLPETPTQAES
DTAVQLAAALQARYRAQAPQINVVPLPADATTVGGPAQPLERRIVVKEGA
EEGLSLAGGDDPQLLISGPPDQLTNQARLLTDSSLDMAVSTSAVAGELRP
EPAPPGDSATLAQLGTTNLSNIGVAPQVSIALDQTRFGHATQEFRLHLLG
THTPVPPEVGAQMTASVDGQIIDTWQAGADGNIDRWVDVPGRLVARYTSV
VVGLDTSGYIGRCNDFRPITLTIAGSTVVESTPAAPPLSAGFAALPQALM
PRMAVGINPDSFVDTARAVQIVLGLQRLSVVPLQTEVTSLQQAIDGDGPA
VLVSADGWTDPSIQLPVRSDGQQLTLTGFDDDRETTLTLDPGIRFGSLQT
VSEGQRPLLIATSNGVAAQLDELLRWLNDDPRGWSRLRGNAVVAIEGAEP
QLVPGRNTLSVYGPPTATSTDDQEQGGEGVPTWWIAGGVVAAAAIGIAAY
WLGTRRRATGGGSPGDSDSDSDRQA
120406191YP_956020.1 hypothetical protein Mvan_5243 [Mycobacterium vanbaalenii PYR-1]MSSHRDAPPHSGEASAAGPTQSNFEFADAKFARTSITGPSPSSRATDLKR
IGRIGALAVALGVGAAIAAVPGVAFADTAEGGSPESSAERSQESSSGTEA
APPQHRSAREKPADRDDKPSPPTRRGATRTAATEAASGRDRPTRDTESPA
SGVGESAVTSDGDDRQPAEQSVATTTTTLRSATSSSSQPAGVPDSPAQES
VLLAASASIGRPNEARTAIPSPAARSAQTSVLTEAPQQASSTAADDADAQ
DRDVVIDADSLTVSRPSNGTTYTDPTASGGTALLLHRNATASTTVTLPEF
TSLVIRAKGDQYRGAPEMRVSVNGKVVSKVAVTATSWTDYTVPFSGPAGT
YTLSVAFTNDRYSRRNGDRNLRLDTVTVVSAVVDPEPPTPPSTGSPGYFE
GADWLWKPIATNPVLATNSATWVNYLAAPDKLRIANLYDYSVALVSASEI
TSSTPRYDVAFTEPWGSDPFGNTTVPIPLGTKVPPGSDGHVAILDPTTGL
AYGIWQAKYNSSTNTWSGSWGGMTDLDGDGIDQSGSATAAAIARYAGVVT
AAELSAAIAANTGINHALAFSTDLAGPDFVYPAAKSDGQNWAGVAVPIPE
GYRIQLDPSIDVDAIPGMTPGERVIAKTLQTHGAYVVDQGSARMAFAFEL
LDDATSTSPGSVWVDAGFAWDYYDMNAIPWSQLRVLAPTSVSV
120406190YP_956019.1 hypothetical protein Mvan_5242 [Mycobacterium vanbaalenii PYR-1]MSSHEPEPDDADTGPLHVSRLRTPLGEGPGDREPRYDAPLSVNPRPVHRD
RRPVVLVAAAAAALVGLGALAWVFWPSSGGEGHAGAPTTTTETESREEAE
TRLLDMVPPGYAADACEAVVPVNGALAQVSCDKNDDTGGPLTATYTLAKD
GRALRELFDGVVNASAVVNCPGNIQSPGPWRRNATPEQTAGTLVCGFQQS
RPTVAWTTDTDLMVSEVQSGPQGPNMVQLYTWWASHS
120406189YP_956018.1 FHA domain-containing protein [Mycobacterium vanbaalenii PYR-1]MKFKPTVAAIITTAAAAAVGVVGAGSASADAEVQYLGQPGELVNGSVIQH
WTVTGLKPSSDVIPYRPVGTLWEATATDEAIAGTVTPIVSNLNARAENGD
TYRVLFGVATEQGVNPSTLAQGQKTTGKIYFDVTGQQPDSVFYSDGGSEV
LLWLEAPPAPATGSAGSGASGYGSEASPSAAADTATPETPGTTPAAETPT
SVVPTPVAAPAGSSGTPLPEGSSGTPLPEGSSGTPLPAGAAPVEAGPAPV
PAGVAPAPHGSSGTPLPAGAPAVEGVQPAPAPGAPTTTVVVPAPPA
120406188YP_956017.1 PE-PGRS family protein [Mycobacterium vanbaalenii PYR-1]MARHAKKSDRSMAIRTYLTAGLTAGVTGAALAGVGTLLLADGDVSGPAQI
EVQLVSNEEDILWLSLNGGSDRRSAAQSAVVQQSSANPALRPMIGDGGWL
IGNGLDAADDCQGDACNGGDGGILWGNGGNGAHGGTGGDGGFWFGHGGNG
GDGDAVLDANGNVVRAATAGGAGGKGGYMFGNGGAGGKGGDAVYQNGVKK
NGALAGGRGGDSGYLLGNGGNGGAGGSDSNNLNVADDPATTNVNESAQNN
AAGGAGGAGGVGGILNGNGGHGGDGGSADSANGNATGGSGGRGGLAHSNA
GGTGGNGGNGGDAEADDAGKTAKGGNGGAGGTSGTGQGGSGGNGGNAVGD
DAHAVGGSGGAGGGVRLGTGGDGGDGGDAVSEDGNATGGKGGDGGSVDLT
GGGGGAGGEGGDADGDEKATGGSGGSGGTGGLGGDGGAGGDGGDAVADDE
GGATAGSGGDGGFGGTDGDDGSASDGADAPATD
120406187YP_956016.1 putative alanine and proline rich membrane protein [Mycobacterium vanbMALMWRYDRPMPDFGNASTRTNQLVIAALVVAVAALGVAVWALISSPSSS
ETSSATADQSTDPKTRVCSAFELVRGAVSLQTNANLGEDPVAVQAVAANA
RLATLGGGQFLLSRLDGDVPDDLAGAVRTFANNLEYIGMSQLAGAPGDDP
TQANRMNDAQAASTKITELCK
120406186YP_956015.1 dehydratase [Mycobacterium vanbaalenii PYR-1]MPINLDEAIGAELDPVEFAWTSSDIQLYHLGLGAGMDPMDRAELRYLVDD
TPQVLPTFGNVAQSFHMTAPPAVKFPGIDIELSKVLHASEAVTVPGPIPA
SGTGIAVTRFTEIWDKGKAAVIWSETTVKDPDGTLLWTQKRSIFARGEGG
FGGDRGPSGSSAAPDRAPDLEITVPTSPQQALLYRMCGDRNPLHSDPDFA
AAAGFPRPILHGLCTYGMTCKALVDNLLDGDVSGLKSYGARMAGVVFPGE
TLRVNVWKEDGGYSATVTTPERDNAVALAGVEFVPA
120406184YP_956013.1 4-oxalocrotonate decarboxylase [Mycobacterium vanbaalenii PYR-1]MLSVEVREKLAADLAEAERSRVPISPLTDGQPGIDVVDAYEIQLINIRQR
VAEGARVIGHKVGLSSEAMQKMMNVDEPDYGHLLDEMQVFENVAVKSANY
LYPRVEVEVGFILSDDLPGAGCTEDDVLAATAAFAPAIELIDTRITNWQI
KLCDTIADNASSAGWVLGEARVSPKDVDIKNIDAVLTNNGEVVAEGRSDA
VLGNPVTAVAWLARKVESFGVRLKAGDIVLPGSCTRAIDAPAGSHFVADF
TGLGSVRLDFE
120406183YP_956012.1 acetaldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MADKKSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKL
GLETSHEGVDWLLAQSELPDMVFEATSAYVHKAAAPRYAEAGIRAIDLTP
AAVGPGVIPPANLRAHLDAPNVNMVTCGGQATIPMVYAVSRVVEVPYAEI
VASVSSASAGPGTRANIDEFTKTTSAGVQNIGGAQRGKAIIILNPAEPPM
IMRDTIFCAIPEHADHAAITQSIKDVVAEVQTYVPGYRLLNEPQFDEPSV
VNGGNHVVTVFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLAAT
AGGAQA
120406182YP_956011.1 4-hydroxy-2-ketovalerate aldolase [Mycobacterium vanbaalenii PYR-1]MSTDEIYFNPIWDVRMTDTSLRDGSHHKRHQFTKDEVQAIVAALDAAGVP
VIEVTHGDGLGGSSFNYGFSKTPEQELIKLAAETAKESKIAFLMLPGVGT
KEDIKEAQSNGGSICRIATHCTEADVSIQHFGLARELGLETVGFLMMSHT
IPPEKLAKQARIMADAGCQCVYVVDSAGALVLEGVADRVAALVAELGSDA
QVGFHGHENLGLGVANSIEAVRAGAKQIDGSCRRFGAGAGNAPVEALIGV
FDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFL
KHAIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQETAKS
120406181YP_956010.1 ATP-dependent DNA helicase RecQ [Mycobacterium vanbaalenii PYR-1]MTTRADAQAILEQLAGPGAVLRDDQWTAIEALVVHRRRALVVQRTGWGKS
AVYFISAKLLRAAGHGPTVIVSPLLALMRNQVAAADRAGVHAATINSSNV
TDWAEIHDRVRSGDLDVLLVSPERLNNPDFRDQVLPSLAHDAGLVVVDEA
HCVSDWGHDFRPDYRRIRTLLADLGADVPVLATTATANDRVVADVAAQLG
VGDFGREDQDGGSDTLVLRGGLDRESLRLSVVNAGNPAQRAAWLVAQLDS
LPGSGIVYTLTVAQAHDVASLLAEQGHKVAAYTGATEASEREQLESDLLD
NRVKALIATSALGMGFDKPDLGFVVHLGAPSSPIAYYQQVGRAGRSTASA
EVILLPGREDQEVWRYFASVAFPSESMVRNVIGALETDRPQSTAALEPLV
DLNRSRLEMVLKVLDVDGAVRRVKGGWVATGRPWAYDEQRYRTLDEARRR
EQQAMLDYQSTDGCRMAFLRRQLDDPELGADERCGRCDNCAGSSYSADVD
AAVAEDSRQRLMRPGVEISPRKQWPSGLAKLGVDLSGRITDGPAPGRVIG
RLTDLGWGARLRTLLEQDDAEVPDDVVQAAVKVLAAWDWQVRPTAVMALD
SDTHPLLTSSLARRLAELGRLTDLGVLRYTPERRPVTAANSAYRVAALRG
AWESPDPDAISAAGGPVLLVDAMTDTGWTLTMAARVVRSAGAPAVLPFAL
AATS
120406180YP_956009.1 hypothetical protein Mvan_5232 [Mycobacterium vanbaalenii PYR-1]MNASVTTVRRGLFGMFAGGLLAFGSAAIVAPVANSQPAPDCSASNVAGTV
SSVAASEGAYLAANPQTDQALSAIATQPEPESQAAYGAFFAQNPQVEDQL
QAIHQPVSALKNQCGVEVTPTPISAALTDA
120406179YP_956008.1 hypothetical protein Mvan_5231 [Mycobacterium vanbaalenii PYR-1]MLNAGPLNRESLTTACAFAAAGVLVCGCVAPSMESRSVRSEVRVVQLASR
SATVADPLGGLAESLPDAVGVDADVVAAALRLPTVDPADVSAAVPPVLAS
LSTDEITEVTEASVGGPMIATRLISLLLQPLVWLVQVLPDPLKPIAGGFL
FMATFVGGVVGAAIDAVVDPILRLFGFGALAAAPLAAVEAVAGDPAADDS
VVVAAEPENATSQTITVVDAESTEVTGGVEVAGLDETEDASTQSESPLQE
EVPSDAVHSADDLTESGLTDLDSTEIDISDDQADAQAAQQESEVTAGDDG
SSEAGRAAEDSTPSPEPSGDVADS
120406178YP_956007.1 regulatory proteins IclR [Mycobacterium vanbaalenii PYR-1]MSEPPAPGRASPPTDRVVRVLDFLARHPQERFGVSELARRVDLTKPTCLG
IVTSLRDAGYLVRDPADKTYRLGPSLITLGHKAQESMRVSPAAREQLRRL
STRFGATAALSAVVDDRITLLDLVAPVGARPGVEVGQSYPFAPPVGLMFV
LWDDEAVRDWLAMEPTVPLHPSRTDPDRLHRVIRRCRADGYLVERLTPGG
RRLYSLMAGMSSTLPDELRALLGELVSDIGERVYLPDEKPGRKRHDISVI
SAPVFDHYGRQVMVASMHIGKALTDNEIRERAKALIGTADAVTAQLGGAR
PTSWPHTVGKGPDRDH
120406177YP_956006.1 hypothetical protein Mvan_5229 [Mycobacterium vanbaalenii PYR-1]MTPDRTRSSFGAVFTQPLAEAIAEAEKLVAAAPFIESEADLLEGLQYLAG
CVAACTHVAFDYDRDHPFLHSGTGPFTKMGLDNPDTMYFGTRVQPGHEYV
VTGRRGTTTDVSFQLLGGEYTDEVVPDSETAFDDRKLDIAADGTFEWRFT
PKVPSQLVIREVYNDWSAQRGTFAIARTDTAGTAPPPLTRELIEKRYAVA
GKQLVQRVKTWLQFPQWFYNDTQPNSMVAPRLTPGGLATQYSSAGQFDLA
EDQALIITLPVTDAPYLGFQLGSLWYISLDYINHQTSLNGTQAQADPDGM
IRIVVADRNPGVTNWVETLGHRKGFLQFRWQRVSRELTPADGPTVELVDI
DKVAAALPYYESNTISEQDWRARIALRQKQIGERMVG
120406176YP_956005.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MAFGLLRDKVVVISGVGPALGTTLARRCAEEGADLVLAARTVERLDDVAR
QITDLGRRAVSVGTDITDEAQVNNLVDESLKAYGKVDVLINNAFRVPSMK
PFADTTFEHMRDAIELTVFGALRMVQAFSPALAEANGAVVNVNSMVVRHS
QAKYGAYKMAKSALLAMSQTLATELGEQGIRVNSVLPGYIWGGTLESYFT
HQAGKYGTTVEEIYKATAAASDLKRLPTEDEVASAILFMASDLSSGITGQ
ALDVNCGEFKA
120406175YP_956004.1 hypothetical protein Mvan_5227 [Mycobacterium vanbaalenii PYR-1]MTPRTDVGTVEDLHASAVKACGLDDFGSDDDNYREALGVLLESYRRDADL
TELGSKMQRFFVRNALVARLVSEAAFKQYPEHADVAIERPIFVTGLPRTG
TTAVHRLLAADPRHQGLELWLAEFPQPRPPRETWSQNPVFQALDAQFTKA
HEENPDYTGLHFMTADEVEECWQLLRQSLHSVSYETLAHVPTYSQWLARQ
DWTKSYQRHRRNLQLIGLNDREKRWVLKNPSHLFALDALMATYPDALVVQ
CHRPAETIMASMCSLAQHTTEGWSNTFVGDVIGADSMETWSRGLELFNAE
RAKHDPAQFYDLDYFALIKDPVGAVGDIYRSFGIDFPHAARAAMTATHEE
SKKGPRAPKHTYSLSDYGLTDEQVKERFKGL
120406174YP_956003.1 hypothetical protein Mvan_5226 [Mycobacterium vanbaalenii PYR-1]MSDAPDVDRLARSMLLLHGHDDEEHEHGHTPAGDGPGSWRKAPDFASDPD
RAAAVREGTRRDRERYLTAGLASVDCRFCHVSVQVKKLGPAHTSVQWTSD
ATQRCAHFAEIREAGGDPARERSCPRLTDSIRHAVAEGCLEEYSSAPSPG
DG
120406173YP_956002.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMSTEASAGTAHIREIDTGALPDRYARGWHCLGPVKNFLDGKPHGIEIFGT
MLVVFADSQGELNVLDGYCRHMGGNLAQGEIKGDEVACPFHDWRWGGDGK
CKLVPYAKRTPRLARTRAWHTDVRGGLLFVWHDHEGNPPQPEVRIPEIPE
WSSGEWTDWKWNTLLIEGSNCREIIDNVTDMAHFFYIHFGLPTYFKNVFE
GHIASQYLHNVGRPDVNDMGTAYGEASLDSEASYFGPSFMINWLHNKYGD
FKAESILINCHYPVTQDSFVLQWGVIVEKPKGLDDGTTQKLADAFTDGVS
KGFMQDVEIWKHKTRIDNPLLVEEDGAVYQMRRWYQQFYVDVADVTPEMT
DRFEMEVDTTAAVQKWNVEVEENLKARETETQST
120406172YP_956001.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMTVVAVAAATTRPSGRSARRWLAVAAATFAIAWGGNEFTPLLVMYRTQDG
FSALTVDLLLFAYVLGIVPALLIGGPLSDRFGRRPLMLPAPVLAAVGSAI
LALGAQSAPVLGVGRVFSGVALGLAMAVGGSWIKELSSPPWEDGDAGARR
AAMSLTAGFGLGAGTAGVLAEWGPAPTVLPYAVNIAMALAAAVFVSTAPE
TRTRHDSGRPWWTDLAVPGASHRRFLLVVVPVAPWVFGAGATAYAVLPAL
MAGRVSSAPIAFSALMCLVALGVGFTVQQLGRHLGAGGRRGVVTALALLV
VGMLLAGWAAAVLTVWSALVAAAVLGAGYGMALLAGLQEIQRIAGPDDLA
GLTAVFYSLSYLGFAVPAVLAFAVRSFSYPAMFGFGAFAAAVCLLVAVLG
SRRTAAIS
120406171YP_956000.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVEAGSAARRGRPRSEAARSAVLTAAAELALEGGPAAATVEAIAKRAHVS
RTTIYKWWPSAASIVLEGLLDAVRASITRPSGSTSVQALVHHVSSLNAIL
ADPAVGPLLRNVIAASTSDPAIERAVLDQWIAPRRAAVAVTLREAVDRGE
LPGDVDIEVAVDALVSPPYYRLVLGMPPLAAEAVDRLVETVWSGCRH
120406170YP_955999.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MASKKLAAVLGTGQTKYVAKRKDVSMNGLVREAIDRALEDAGVTLADIDA
VVVGKAPDFFEGVMMPELFMADATGATGKPLIRVHTAGSVGGSTAIVAAS
LVQSGKYRRVLTMAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVR
AYIRRSGAPTHIGAMVAVKDRLNGAKNPLAHLHQPDITLEKVMESPMLWD
PIRYDETCPSSDGAAAMVIGDEASADARVAEGHPVAWIHATALRTEPLAY
AGRDQVNPQASRDAAAALWKSAGITSPIDEIDVAEVYVPFSWYEPMWLES
LGFAPEGGGWKLTEAGETAIGGRIPFNPSGGVLSSNPIGASGMIRFAESA
IQVMGKAGEHQVPGARKALGHAYGGGAQYFSMWVVSADKPA
120406169YP_955998.1 lipid-transfer protein [Mycobacterium vanbaalenii PYR-1]MNDVAVVGFAHAPHVRRTDGTTNGVEMLMPCFASIYADLGITMSDIGFWC
SGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKILTG
EVETALVYGFGKSSAGTLRRVLALQTDPYTVAPLWPDSVSMAGLQARFGL
DTGKWTAEQMAQVALDAQAAAPRVDSLEPGNSIEELLERPYFADPLRRHD
IAPITDGASAIVLASGDRARELRERPAWITGFEHRIETPVLGARDLTTSP
STAASAQAAAGGDTASIEIAELYAPFSHQQLILKEAIGLPDSTRINPSGG
ALAANPMFSAGLERIGFAARHIFDGNASRVLAHATSGPALQQNLVAVLEG
QS
120406168YP_955997.1 hypothetical protein Mvan_5220 [Mycobacterium vanbaalenii PYR-1]MTTSQSSPVQIDPHEPPLSAPLKLAFDYTRSVGPLLGEFFTALRERRIVG
VRGSDGKVHVPPAEYDPVTWEQLSEIVPVASVGTVQSWTWQPEPLEGQPL
DRPFAWALIKLDGADTPLLHAVDAGSSDAISTGTRVHAHWVDEPVGAVTD
IAYFALGDQPEDVPPAPEGLDPVTMIVVPTSIEIQHTASRPESAFLRALE
QGKLLGNRTGADGKVYFPAREADPATGVQLDEYVELSDKGTVTTFAIINI
PFAGQRIKPPYVAAYVLLDGADIPVLHLVSDIDADKVRMGMRVQAVWKPE
DQWGLGIDNIEYFRPTGEPDADYDTYKHHL
120406167YP_955996.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MKLGLQLGYWGAQAPTNHAELVATAEEVGFDTVFTAEAWGSDAYTPLAWW
GRETTRMRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGAKFPKPLARTREYIDILRQVWAREAPVHSDGPHYPLPLTGEGTT
GLGKNLKPITHPLRADIPVMLGAEGPKNVALAAEICDGWLPIFYSPRIAA
MYNEWLDEGFARPGARHTRETFEICATAQVVVTDDRAEMMELMKPHLALY
MGGMGAEDTNFHADVYRRMGYAEVVDDVTKLFRSGRKDEAAKVIPDELVD
DSAIVGDLGYVQEQIKAWEAAGVTMMVVGARSPEQIRDLAALV
120406166YP_955995.1 hypothetical protein Mvan_5218 [Mycobacterium vanbaalenii PYR-1]MTQVTSQHTIAGTVLTMPVRVRTAHQHTAMFVVDADAAQRMIDYSGLRVC
RFGRGHRKAMVVLMLMRYEDTDLGQYYEYGTNVMVNPPGSNATGMKALQS
AGAFVHHLPVDQSFTLEAGRTIWGYPKVMADFTIRNGRHFGFDVSIDGLH
AVSMDFAPGIPVPAAFASKPQVHSTYSHLDGVTRETEGRMVLSGVRYRPG
GVSLRLGEHPYAAELSALGLPKRALVSSSAANVDMTFADSRTVGEA
120406165YP_955994.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTSTLPALDVDLADGNFYADGRAAREAYKWMRANQPVFRDRNGLAAATTY
QAVLDAERNPELFSSTGGIRPDQPGMPYMIDMDDPAHLLRRKLVNSGFTR
KRVMDKVPSIENLCDTLIDAVCERGECDFVRDIAAPLPMAVIGDMLGVLP
DERDMLLKWSDDLVCGLSSTVDEQTIQKLMDTFAAYTAFTTEVIADRRAN
PRDDLFSVLVNAEVEGQRMSDDEIVFETLLILIGGDETTRHTLSGGTEQL
LRHQDQWRQAVADPELLPGAIEEMLRWTSPVKNMCRTLTADTEFHGTSLK
AGEKIMLMFESANFDEAVFENPDEFDIHRNPNSHMAFGFGTHFCLGNQLA
RLELRLMLTKILQRLPDLRLADESMLPLRPANFVSGLESMPVVFTPTAPV
GA
120406164YP_955993.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MSDPQKGPDALVEQRGHTLIVTLNRPEARNALSTEMLSIMVDAWNRVDED
PEIRTCILTGAGGYFCAGMDLKAASKKPPGDSFADGSYDPSKIEGLLKGR
RLKKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGG
SAVRLPRQIPYTIACDLLLTGRHITAAEALQYGLIGHVVPDGTALDKALE
IAEVINNNGPLAVQAILKTIRETEGMHEEEAFKPDTANGIPVFLSEDAKE
GPRAFKEKRAPNFQMK
120406163YP_955992.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MALNIADLAEHAIDAVPDRVALISGDEQLTYAELEEKSNRLAHYLIDQGV
KKDDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELKYLFENSD
MVALVHERRYADRVANVLPETPNVKTILVVEDGTDEDYQRYGGVEFYSAL
AQGSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIADEYGLAKQAVESGPMVRYPIPPMIHGATQSATWMALFSGQTTVL
TPEFDAEAVWRTIHEHKVNLLFFTGDAMARPLLDALLAAQDAGDQYDLSS
LFLLASTAALFSTSLKEKFLELLPNRIITDSIGSSETGFGGTSIVAKGES
HTGGPRVTIDKNTVVLDEDGNPVTPGSGVRGIIAKRGHIPVGYFKDEKKT
AETFKTINGVRYAIPGDYATVEADGSVTMLGRGSVSINSGGEKIYPEEVE
AALKGHPDVFDALVVGVPDPRFGQHVAAVVQPREGTRPALADLDAFVRTQ
IAGYKVPRSLWLVDEVKRSPAGKPDYRWAKDVTEERPADDVHANHVGAK
120406162YP_955991.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MKTELCDRFGIEYPLFVFTPSEKVAAAVSKAGGLGVLGCVRFNDADDLEN
VLQWMDANTDGKPYGVDIVMPAKVPTEGTSVDINKLIPAEHREFVDKTLA
DLGVPPLPADEERSEGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKD
VIDQAHQAGVPVAALAGSAKHALRHVDNGVDIVVAQGHEAGGHTGEIGSM
VLWPEIVDAIEGRAPVLAAGGIGTGRQVAAALALGAQGVWMGSAFLTSAE
YDLGVRLPSGRSVVQEAMLNATSADTVRRRIYTGKPARLLKSRWTDAWDA
DGAPEPLPMPLQNILVSEAHQRMSENSDPTAVAMPVGQIVGRMNEIRPVA
DIIAELVSGFEEATRRLDAIRDN
120406161YP_955990.1 hypothetical protein Mvan_5213 [Mycobacterium vanbaalenii PYR-1]MNGARSLLTTLVDQGVDVCFANPGTSEMHFVAALDTVPGMRGVLTLFEGV
ATGAADGYARMSGKPAAVLLHLGPGLGNGLANLHNARRAHVPMVVVVGDH
ATYHKKYDAPLESDIDALAHTVSGWVRRTLDVGDIAVDAVDAVAASRAGV
VSTMIVPADVSWNDGEPTEPLPAGHPAPGIDDDAVREAADALNSGVPTVL
LVGGDATLAPGLSAAVRIAERTGAKVLCETFPARLQRGAGVPAVERLAYF
AEGAEAQLVGAEHLILAGAASPVSFFAYPGRPSDLVPQGCEVHVLAGHSG
AAAALEQLADDVAPGTTASVAPLMRPDLPTGELTAFSAAAVIGALLPEGA
VVVDESNTAGVGVAAATAGAPGHDVLTLTGGAIGYGMPAAIGAAMAAPDR
PVLSLQADGSAMYTVSALWTQARENLDVTTVIFGNGAYDILRIELQRVGA
ENAATPGPSALRLLDLGSPTLDFVKIAEGMGVPARRVSTAEDLAAALTEA
FAAPGPHLIEAVVPSLVNT
120406160YP_955989.1 LpqN [Mycobacterium vanbaalenii PYR-1]MKLTGVIRSAVTAAALAVIATGCTTSTTGTGEIASSESTGATTSSETTST
RATAAPPTGRITPRQEAPEGPAPTIADYIAENGIEESPVKRGDPGAPIID
LPIPEGWEDAGGDTPEWAYGAIIYNGPGAGEYSPNIVALVSKLVGDVDPE
ALLDAAAGEATNLPGWTPMSDGKFTTLGEFPAFQLGGTWVQDGVTKIAAQ
KTVVFPGSDGSWYVLQLNADGLENQIDIIGPATIAIDDETTITPQ
120406159YP_955988.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMTDVREIDTGSVMTRFARGWHCLGLADAFRDGRPHGVDAFGTMLVVFADT
GGSLRVLDGYCRHMGGNLAQGEIKGDEVACPFHDWRWGGDGRCKLVPYAK
RTPRMARTRAWPTTEVNGQLLVWHDPERSSPPTELIPPTIAGYDEGRWSP
WQWSSILIEGAHCREIVDNNVDMAHFFYIHHAYPTYFKNVIEGHTASQFM
ESKPRPDFTANPEKLWDGTYLRSEATYFGPAYMINWLHNDLAPDFTVEVA
LINCHYPVSHNSFMLQWGVAVQEMPGLPADKAAKLAAAMNRSFGEGFLED
VEIWKNKSPIENPLLTEEDGPVYQHRRWYQQFYVDAADVTADMTGRYEQE
VDTTHANDLWQQEVERNMAARKPGSV
120406158YP_955987.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSPNEWDEVTDVLVAGSGAGGVTGAYTAAREGLEVILVEATDKFGGTTAY
SGGGGMWFPCNPVLTRAGADDTLDDALEYYTAVVGDRTPRALQETYVRSG
APLIEYLESDELLKFSLLPWPDYFGKAPKARADGMRHIAAKPLKVSAAPE
LRELVRGPLDSDRLGRPRPDDYFVGGRALIARFLAAARRYPNSSARLNTA
LTELVVEDGRVVGAIVDTGGGRSAIRARRGVLLAAGGFEHNDAMRARYGV
PGASRDTMGPEGNQGLAHLAGMAVGADTDLMDQAWWSPGLTHPDGTSAFA
LWFTGGIFVDDHGRRFVNESAPYDRLGRAVLAAIADGTVTLPFWMIYDDS
EGLVPPVKATNVSTVEPERYVSAGLWRTADTLEELAVAIGVPPQNLVETV
ARFNGFTRTGVDEDFGRGDEPYDRAFSGGAAPLYPIAKGPFHAAAFGVSD
LGTKGGLRTDTAARVLDRADNVIPGLYAAGNTMAAPSGTVYPGGGNPIGT
SMVFSHLAVLDMAGGHS
120406157YP_955986.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MTARRDDVAAMLLDRTGDRRPGLRTRERDWTWDEVVHESAVRASIASTLS
DLDPPHIGVLLDNVPDFVFWLGGAALAGATIVGLNPTRGAADLAADIRHA
DCRLIVTDAAGADRLRGLDHGVPPDHLLRVDSPDHAQLLDAHRVEPVAAP
GVGAKSLFLLLFTSGTTGTSKAVRCSQGRLARIAYAATDKFGHHRDDVDY
CCMPLFHGNAIMALWAPALANGATVCLTPTFSASRFLPDVRYFGATFFTY
VGKALGYLMATPEAPDDADNTLQRGFGTEASPEDQKEFRRRFAAELFEGY
GSSEGGAVATPDPAAPPAALGRPAHDDVVVVHPETLCLCPTAVLDASGRV
LNPDEAVGEIVDRRGAADFEGYYRNDAADAERVRNGWYWSGDLGYLDGAG
FLYFAGRRGDWLRVDGENISTLTIERVLRRHAGVIAAAVYGVPDPRSGDQ
MMAAVEVADPGSFDVDAFASFLVAQDDLGRKGFPRLLRISAKLPATGSNK
VLKRDLQAQRWHTDDAVHRWVGRGHPRYRLMTDADRGALDAEFTVHGREH
HVAE
120406156YP_955985.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MATVSSLLAELTEVDDRGVRWVDPETGSVSFVSWRNHIRDGAALAAALRD
RLDPDRPAHVGVLLGNTPFFGTVLVAAALSGIVPVGLNPTRRGAALQRDV
DHADCQLVLADRSAPHDGIAAVDVESSLFADELATHRGAAVDFPDPDPDD
LFMLIFTSGTSGHPKAVRCTHEKVAFPGVMLAQRFGLGAADTCYLSMPLF
HSNAIMAGWAPGVAAGASIALRRKFSASQFIPDVRRFGATYANYVGKPLS
YILATPEKPDDADNPLRVAYGNEGAPRDLRRFAERFGVTVVDGFGSSEGG
VSIARTPDTPEGALGPLVGGVTIVDVDTGAECPPGVVGELVNTEGPGQFR
GYYRDPDAEAERMRGGVYHSGDLAYRDERGFAYFAGRLGDWMRVDGENLG
TAPIERILMRFPGVTEAAVYPIPDPAVGDQVMAALVLPDIAAFDPDSFTQ
FLCEQSDLGPKQWPRFVRTATALPRTETFKILKRELSAEGTDCPDPVHPI
RRP
120406155YP_955984.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFKTTEASEDLGGLVRTITESVCTPEHQRELDGLRPEAGGRFDRDLWGK
LIDADILSTTSPESLGGGGFGVLEEVAVLVALGRQLAAVPYLESVMLAAG
ALATFGSASLQQDWAAQAIKGEKVLAVAFDGEMGEGPVLAQGSGDGYTLT
GSRTQVAFGVNADAFLVPAETDSGTAVFLVGSADDGVAVTALDTTGHGSV
AGLQLQGVAIGSDRRVGGPEVLDWLVTRHALGRSAYQLGVLERALELTAS
YAREREQFDRPIGSFQAVSSRLADGYIDIKGLRLTLTQAAWRLSEDLPAD
LDVASAAFWAAEAGHRVAHTTVHVHGGVGIDIDHPVHRYFLAAKQTEFAV
GGATGQLLRIGRELADTPA
120406154YP_955983.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMRIGYTPEQEELRRELRAYFTKLMTPERAEALAASDGEMGRGNVYRETVA
QMGKDGWLTLSWPKEFGGQARPPMDGLIFNDEAAIANVPVPFLTINSVAP
TIMAFGTEEQKKFFLPKIAAGDLHFSIGYSEPGAGTDLAALRTTAVRDGD
DYVINGQKMWTSLIAYADYVWLAVRTNPEAKKHRGISMLIVPTTAEGFSW
TPVHTMSGVDTSATYYQDVRVPVSSLVGEENAGWKLVTNQLNHERVALVS
AQPIFVALNGVREWAQNTKDVHGKRLIDSEWVQLNLARVHAKAEVLKLIN
WELASATDAAPSPADASAAKVYGTELATEAYRLLMEVLGTAATLRTNSPG
ALLRGRIERMHRSCLILTFGGGTNEIQRDIIGMVALGLPRVNR
120406153YP_955982.1 3-ketoacyl-ACP reductase [Mycobacterium vanbaalenii PYR-1]MTHTDLSGHVAVVTGAAAGLGRAEAIGLAKAGATVVVNDIAPALDKSDVL
DEIAAAGSKGVAVAGDISQRSTADELVETADGLGGLAIVVNNAGITRDRI
LFNMTDEEWDAVIAVHLRGHFLLTRNAATYWRSKAKQGGPGVENGQIYGR
IINTSSEAGLSGPVGQPNYGAAKAGITALTLSAARALGRFGVRANAIAPR
ARTAMTAGVFGDAPELPEGAVDPLSPDHVVNLVRFLASPAAEGVNGQLFI
VYGPTVTLMAAPTAERQFSADGAEWDPADLSDTLRNYFADRDPERSFSAA
MGLGDPH
120406152YP_955981.1 hypothetical protein Mvan_5204 [Mycobacterium vanbaalenii PYR-1]MSLDTFVKTFRRPFQFREFLEQTWMIARVSLVPTLLVAIPFTVLVAFTLN
ILLREIGAADLSGAGTAFGTITQLGPVVTVLVVAGAGATAICADLGARTI
REEIDAMRVLGIDPIQRLVVPRVLASTFVALLLNGLVCLIGLSGGYVFSV
FLQGVNPGAFINGLTVLTGLGELVLAEIKALLFGVVAGLVGCYRGLTVKG
GPKGVGNAVNETVVYAFICLFVINVIMTAVGVRVLDS
120406151YP_955980.1 hypothetical protein Mvan_5203 [Mycobacterium vanbaalenii PYR-1]MSYDATIRFRRLLRFFPRAVDTVGEQALFYGETFRYVPNALTRYRKETIR
LIAEMSMGTGALVMIGGTVGVAAFMTLASGGVIAVQGYSSLGNIGIEALT
GFLSAFLNVRIVAPVIAGIALAATIGAGATAQLGAMRVAEEIDAVESMAV
HAVSYLVSTRLIAGLIAIVPLYALSVLAAFFAARFTTVYINGQSAGLYDH
YFNTFLIPSDLLWSFLQAIVMSIAVMLVHTYYGYNASGGPVGVGIAVGQA
VRTSLIVVVTIVLFISLAVYGASGNFNLSG
120406150YP_955979.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MADGNAKRSHVRIAAAILAALVLAAAVFTYLSYTAAFTPTDKVTVLSPRA
GLVMDVDAKVKYRGIQVGKVESIEYAGDAAKLTLAINRGDLRYIPADAPV
RIGGTTIFGAKSVEFLPPEYPNGQALSPGAEVKADSVQLEVNTLFQTLTD
LLDKIDPIELNATLSALGEGLRGNGDDVGALLSGLNYYVGQLNPKLPALQ
EDLRRTAVVADIYGDAGPDLVRVLDNAPAISKTIVDEQDNLNAALLAATG
LANNGTATFEPAADDYIAAVQRLRAPLKVAGEYSPVIGCTLKGTANAIDR
FAPIIGGIRPGLFVSSNFLPGSPAYTYPESLPIVNASGGPNCRGLPDVPS
KQYGGSWYHTPFLVTDNAYVPYQPNTELQFDAPSTLQFLFNGAYAERDDF
120406149YP_955978.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MRDKTLINVGVFTVAMLLVAAMLVVVFGEFRFASEDKYHATFTDASRLKA
GQDVRIAGVPVGTVEGLTLNPDNTVDVAFTVNDRYQLYTSTKAVVRYENL
VGDRYLEITSGPGDLVKLPKGGTITHTEPALDLDALLGGLKPVVKGLDGA
KINEISNAVIELLQGEGGALSAMLSNTSAFTQNLAARDQLIGDVINNLNT
VLGTVDEKGAEFNASVDQLQKLITGLAEGRDPIAGAIGPLATAENDLTAM
LEASRRPVQGVIENVRPFAQRMDERKGDVNKVIEPLAENYLRLNALGAYG
SFFNIFYCSTRLKINGPAGSDILVPFGGPPDPSKGRCAEVE
120406148YP_955977.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MPKLSSSEDSNPLRTGIFGIALVTCLVLVSFGYTSLPFWPQGKSYEAYFA
DAGGITPGNSVNVSGISVGKVSAVELAGDAAKITFTVDREVKVGDQSLVA
IKTDTVLGEKSLAITPKGSGESTVIPLGRTTTPYTLNTALQDLGQNVSAL
DKPRFEMALQTLTDSLKDATPQLRNALDGVANLSRSLNARDEALDQLLAR
AKNVSDTLAQRSGQVNQLITDGNLLFAALDERRQALSNLIAGIDDVATQI
SGFVADNKREFKPALEKLNLVLDNLLERREHISEALKRLPAYATALGEVV
GSGPGFQINLYGLPPAPIAEVLLDTYFQPGKLPDSLSDMLRGYISERMII
RPKSP
120406147YP_955976.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MKRSRWLRTALVGVLVATLAIGAYLVWPNRAGHKVTAYFTSAVGLYPGDD
VRVVGVPVGTIDSIEPRAGDVKITMTIDGDVKVPAEAKALVIAPNLVSAR
FIQLAPAYTGGTVMADGAEIGLDRTAVPVEWDEVKEQLTQLSTQLGPHEG
SVQGPLTDVVNQAADTFDGNGDTFRRAVRELSQTAGRLGDSRTDLFGTIR
NLQILVDALSNSNEQIVQFSNHVASVSQVLADATTDLDVTLGTLNQALTD
VRGFLGESNEALIGQVNKLTDFTNILTAQSDDIEQILHITPNGLSNFYNI
YNPAQGTVGGLLTLPNFGNPVQFICGGTFDAAATTDNYKRAEICRQRMGP
VFKRIAMNYPPLLFHPINSITAYKGQIIYDTPATEAKAETPVPYLQWQNA
PGVTPPQIAPDADLTSLLVPAEGPEASTSHAGGPETGPAPAAPVAPGPAE
AGR
120406146YP_955975.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MIRRVLGLSSIPLLLAGCQFGGLNSLNMPGTAGHGNGSYTISVQLPDVST
LPQNSPVMVDDVTVGSVSGVDAVQRPDGTFFAELQLSLDGNVKLPANATA
RVAQTSLLGSQHLELAAPADGSGTGTLAEGSQIPIERTGNYPTTEQVLSS
LGVVVNKGNLGALQDITDETYNAVVGRSGTFADLIPRLAELTASLDRQTD
DIIAAAEGLNRFAGILARSKDSLGRTLDTLPEALQVLNDNRAQIVDAFTA
LRSFATVASRVLQETKDDFAADFKDLFPVIKALNDNADFFIKDLEFLPTF
PFHYKYLRNAVRGDYLNVYTTFDLTLRRVGESVFTTSLGLDPNMKRMSEV
VNPPDFLTGAVANLSGQAADPFKIPPGTATQHEGAP
120406145YP_955974.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MLDRLTRLQLMIFAIVTVLSVGAVSLFYLHVPSAVGIGAYNVTANFVAGG
GIYQNANVTYRGVTIGHVKSVGLSDTGVVAHMQLNSGTPVPENVTATVKS
VSAIGEQYIDLVPPQEASDATLRDGSDIGVDRTAIGQDIAGLLAEAENLV
QSVSNSRLQDLLSETFKAFNGSGPELARLIQSSRLLVDEANANYPEVSQL
IDQAGPFLDAQIRSGDDIRSLAEGLGRLTTEVADADPQLRTTLQTVPGTA
EVVNETFDGIRPSFPMLAANLANFGRIGVIYHKSLEHALVVFPALLAALN
TVAGGVPTDEGGKLDFKIHLQDPPPCSTGFVPATQIRSPADTTLRELPTD
LYCKVPQSDPSVVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGNNPWR
GPPVPVGTPIQDGRNILPPNKFPMIPPQVDPDPGPPSVQLPPGVAPGPGP
APHAPFPLPVPPNEQGPPPPPWPYFAPPDQVVPPYGRPPLAPPPAPPAPA
PAPAEGSPALPAEAPLASGTSVATYDQNGKFVDPAGGVGVYAPGSDKLAP
AENWVDLMLAPKQV
120406144YP_955973.1 hypothetical protein Mvan_5196 [Mycobacterium vanbaalenii PYR-1]MQESVTPPQRVRRRASRAAGPVGDSATPAPASVSVEVTTPVRPVRPVGPP
PRRRPHRRLVAILSIAVTFVAVAALVVAVAVMVNQQRTIEAQQERERRFV
DTAAQSVVNMFSYTQNTIDESVDRFVNGTSGPLRAMMTQEGNVENLKLLF
RDTNATSEAVVNGAALEKIDEIGKNAAVLVSVRVTVTDLDGNNAPSEPYR
MRVIIHEDDNGHMTAYDLKYPDGGN
120406143YP_955972.1 hypothetical protein Mvan_5195 [Mycobacterium vanbaalenii PYR-1]MRDWPAKLIAAIGVLLATGFVALSAVGGALYWNRVELNGEEQARAELPSL
AAQQIPLVFGFDYQTVERTFAEVYPLLTPEYRKEFQDRVTNEIIPQARDR
QLISQAHSVGAGILDAHRTSASVMVYMNRTVTDKAKESVYDGSRLRVDYK
KVDGKWLIAYITPI
120406142YP_955971.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MRALLEAQHTIRLLVLPQEQDAPVIRRLRSLGDVSVIVGDVRAESTVTAL
LTGVDAVVHAAGVVGTDERRAQLMWDINAYATEQVLTRAVELGLDPVVSV
SSYSALFPPPDGIISADSPTSSGRSSYAKTKGYADRVARRLQDAGAPVVV
TYPSSVVGPAFGTAAGVTERGWEPIVRARVAPRVRAGMQMIDVRDVADVH
VRLMRPGRGPRRYVCGGVMLTFDEMIDALEAGLGRPVRRVPLSPKVLLAV
GRLSDAVGRYVPLGDGLSYEAALLLTSATPTDDRATTEDLGLHWRSPRQA
IIESFGVAGRLGDPVS
120406141YP_955970.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MGTYAITGSASGMGAAAVARLRADGHTVITVDIKDADVVADLSTSDGRAA
AAAQVLTACDGRLDGAVLAAGLGPSQGAERLRMIATVNYLGVVELLERWR
PALAAAANAKVVVIGSNSTTTTPAVPARAVRALLAGDVDKALRATRLYGP
GRPAMVYAASKIAVTRWARRHAVRPEWAGAGIRLNVLAPGAVMTPLLQEQ
LDNKRQARFVERFPVPVGGYGQPEQLAEWMRFMLSDAADFLCGSVIFVDG
GTDSLFRRDDWPRPVPARRIIGYVQRFRGRG
120406140YP_955969.1 alpha-alpha-trehalose-phosphate synthase [Mycobacterium vanbaalenii PYMAPQSGPEARSGGADFVVVANRLPIDMVRRADGTTEFKRSPGGLVTALEP
LLRRRHGAWIGWPGVPEDADDPNAATEPIEQDGMTLVPVRLSSEDVAEYY
EGFSNATLWPLYHDVIVKPIYHREWWDRYVDVNRRFAEATAHTAAEGATV
WVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPWRTEIIEGL
LGADLVGFHLPGGAQNFLILARRLIGATTSRGNVGVRSRFGEVQFGFRTV
KVGAFPISIDSAELDQHARSRATRQRAKEIRAELGNPRKILLGVDRLDYT
KGIDVRLRAFSELLEEGRIDPEDTVLVQLATPSRERVESYVAMREDIERQ
VGHVNGEFGEVGHPVLHYLHRPIPREDLVAFFVAADVMLVTPLRDGMNLV
AKEYVACRHDLGGALVLSEFTGAAAELRQAYLTNPHHIEGVKDAIEAALT
QAPEEGRRRMRAMRRQVLAHDVDRWARSFLDALASKEPVEG
120406139YP_955968.1 hypothetical protein Mvan_5191 [Mycobacterium vanbaalenii PYR-1]MPAKSDPAEIGDVEPIADSTERQARRVVAAYATDADECRVFLSMLGIGPA
KPGD
120406138YP_955967.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MQRVATLEQVTYETLDEGRIARIWLNRPDAQNAQSRTLLVQLDEAFGRAE
ADDEVRVVILAARGKNFSAGHDLGSEEAIAERTPGPDQHPTFTFNGGTRD
AISERTYLQEWHYFFNNTSRWRDLRKITIAQVQGNAISAGLMLIWACDLI
VASDDARFSDVVAVRMGMPGVEYYAHPWEFGARKAKELLLTGDAIDADEA
HRLGMVSKVFPRAELEDKTLEFARRIAERPTMAALLVKDSVNAASDAMGF
TEALRHAFHIHELGHAHWAAYNENRYPVGLPPNVPDWRTLGAPKLSRRDQ
P
120406137YP_955966.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MLLSLSERTYLVTGGGSGIGKGVAAAVVASGGNAVLAGRNADKLAAAAEE
IKAQTGDGAGEVIYEPADVTDEDQAARLVEAATAWHGRLDGVVHSAGGSE
TIGPITQIDSAAWRNTVDLNVNGTMYVLKHSAREMVRGGGGSFIGISSIA
SSNTHRWFGAYGPSKAALDHLMMVAADELGPSSVRVNGIRPGLTRTDMVA
PIVDTPALSEDYAACTPLPRVGEVEDIANLAVFLLSDAASFITGQVINVD
GGHGLRRGPDLSAMLEPIFGADGLRGVVST
120406136YP_955965.1 hypothetical protein Mvan_5188 [Mycobacterium vanbaalenii PYR-1]MFDSGLAGLDEPALLAAIERAACEESRAGARKSAAIAALVHESVTFDDVR
DQWVWDSWIETACELGAVLNTSHRRASALMRIAVALRDRLPKVAALFAAG
RLSTRLIGQVTWRTRLVQDPQLLALLDTAIADKATRWEPLSDDKLTAALD
AVIERYDPDAVIRAREHVSGLDFRVGASDDPDALVTVWGKILGCDAAVLA
ARIAELLKGLCDNDPRSVCVRRSHAVGAIVRGQDHLRCRCGSPDCTAAAV
VPGSSNVVISVLADPAALDAVRQLIADQDRDQQDKLADKQAKAKEQGKAE
SQPQTEPIPQPEAEAEAEPEPEAEVEVEPEAETETAIESEPAPVKPVAPS
NPAACVRDSGVALLPGVKILPLVALAEAIRSGAATKTLWLPGPDPEPHYR
PSAKLAAFVRARDLFCRYPGCDVPAEHCDLDHVVPYPYGPTHPSNLNCKR
RTHHLGKTFAEGWQEQQLPDGTVLWTTPAGQRCTTVPGSWLFFPGWDTTT
AELPPMAQPPPDPDRLAKMPKRRRTRAADQAARIKVEREHNATQRALETE
RAKTPEQARRAEQVRYAGLPPPASPQPDYGNDPPPF
120406135YP_955964.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKIGFIGLGNMGSAMAANLLSAGHEVLAYNRSRDRVVALAERGATPVPTV
AAACEGDVVFTMLADDTAVESVTFGDTGIVAALAPGAIHVSASTISVALS
EKLTAAHAEAGQMFVSAPVFGRPEAAAAAKLFVVAAGPHDAVTSLQPAFE
AIGQRTYVMSEEPKTANLVKLSGNFLIASVIESLGEAMALVSKAGVDRQT
YLELLTSTLFAAPAYQTYGGLLARKQFEPAGFAAHLGLKDVRLVLAAGEQ
LEVPLPVASLIRDRFLTLLAGGGRDLDWSALGALADWEAGGPRPGSG
120406134YP_955963.1 2Fe-2S iron-sulfur cluster binding domain-containing protein [MycobactMHELPVEVSVNGRRYAGTVEPRVTLADYLRERCGLTGTHLGCEHGACGAC
TVLLDGQAVRSCLIFAVQVDGQEVTTVEGIAGEDGELSPVQAAMRECHGL
QCGFCTPGFVTSITALLRDNPNPSDEEIREGLSGNFCRCTGYQGIVNAVK
RAAETTG
120406133YP_955962.1 carbon-monoxide dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKAAPFAYHRPDTVADAVSMLGEFGDDAKILAGGQSLVPMLAMRLTHFEN
LIDISRVDELRNIEPRGDAVRIGAGTPHALVGMDDEVAESVPLLTLSTPH
IGHFQIRTRGTLGGAIAHADPAAEYAAVALALDAEMEATSARGTRRIPAA
EFFTGLWETALAADEILTAVSFPVWTGHCGFAVQEFARRHGDFAIAGATL
AVELDGRDRVARCGIGLLGMGSTPERGTPAEQAVVGRPVTDITAEEVGRL
AVSELHDVPADLQGRPAYRSKVGATMVARAWSQATTAALETREALNA
120406132YP_955961.1 carbon monoxide dehydrogenase subunit G [Mycobacterium vanbaalenii PYRMELNNEFRVAVPAATVWDVFTDVERVAPCLPGATLLSIDGDTFNGAVKVK
VGPITVSYKGVASYQEKDAVARRIVLRAEGKETRGNGTAAATVTAQLKDE
GESTYVGIVTDLAISGKAAQFGRGVLADVSSNLIAQFARSLEAELLGGAA
PSGQASENGSAPAASVAAAPPAEDSVDLLKVVAVPMAKRYAPVLAAAAVA
GVIGYLIGRRRRRGPAAVLADDLQAALARLLS
120406131YP_955960.1 carbon-monoxide dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTDTATNAVTARYAGQRVPRVEDSRLLTGHGRFVDDISRPGMLHACFVRS
PFAHATINGVDASAALALPGVHAVFTAADLNPDVKEAWHAVAGKDVPDTP
RPPLAEGEVKFVGDPVALVVADSRYLAEDAVDLVEVDYDPLPAVADFRKA
VGGAEAGVPVVHAAYPDNVAGGMGGMPPDEEIFATAAHVVEEHIYQQMYV
PVPMETRGMVVEWTSTTNELTVWASTQTPHELRAFAARLLGIPAQGVRVI
MRDTGGAFGQKVVPMREDMCILLAARKMPTATSNAQSGVAVKWIEDRREN
LMSAGQSRHVDGKVRMAFDSDGKILAADIDFVQDVGSYPTPYPVLTTAAI
GMFFPGPYRVPKASFNYKTVFSNTPGLHAYRGPWQYETLTREMLLDSAAR
KIGMDPVELRRINILRGDEMPFFNPNGMPYDNCAPADTFEQAVKILDHEG
FRKEQADALAEGRYIGLGFSAYIEPTGAATGNLATEGATIRMESTGKINV
YVNGGSAGNSIETTVVQLTADALGANIEDVATIQGDTAVTPYGAGTQGSR
SAPMTAGAVNEAGAILRRQIIAIGAQILGVEESEIELANSRAGVRNDPER
SVSFADIAYRSYYDPAQLGGVSPTLEATARFNSQAMIHWANATHVCTCEV
DVETGQVTLTRYIVSEDVGPMINPNIVEGQVAGGTVQGIGGALLEKLAYD
DAGNPVASTFVDYLLPTATEVPPIEFGHVEIPGPGVGGYKGAGEGGAIGS
PPAVINAINDALAPLGVTLTQLPATPATIVELIERAGKDH
120406130YP_955959.1 hypothetical protein Mvan_5182 [Mycobacterium vanbaalenii PYR-1]MRDVLDELLAVWRSGETAGLSTVVRTMQSAPRPPGAAMVVGPDGAVAGSV
SGGCVEAAVYEVANDVVASGVPELQRYGISDDDAFTVGLTCGGTIDVFTE
PVSRETFPQLQQVADDIAAHRPVAVATVIVHPDPKRVGLRLVVGRDSRHG
SLGSSRTDDAVTDDARGLLLAGRSGVLTYGADGQRQESGMEVFVCSHAPR
PKMLVFGAIDFASALARQATFLGYRVTVCDARPVFATAARFPAAEEVVVD
WPDRYLRAQAEQGEIDSRTAVCVLTHDPKFDVPVLEVALRLPELDYIGVM
GSRRTHHDRVRRLREAGLTDKELARLSSPIGLDLGARTPEETAVSIAAEI
IARRWGGDGRPLSQTDGRIHHPA
120406129YP_955958.1 peptidase M15D- vanX D-ala-D-ala dipeptidase [Mycobacterium vanbaaleniMSVVALRCLIIGALAAVASIGPSATGAASPVPPVSDAARAAGFVDVRSVV
PDAIVDLRYATPDNFVGIPLYPAGARCMVHESLAPGLAVAADLVRPHGER
LVFWDCYRPHAVQVRMFEMVPDPAWVARPGPYARSHVAGRSVDVTLAGPD
GLVDMGTGFDDFSPRSLAYAADGVSPAAQANRARLRDAMIAGGFTAYDGE
WWHFDGPGAAVERPILDVPVD
120406128YP_955957.1 hypothetical protein Mvan_5180 [Mycobacterium vanbaalenii PYR-1]MGAAAYVGRVGGLAVALGVGTAVFAGQGVAWADDTESSTNGASSAATSDS
VQTDTTSDTVDTPEADTEDETEPDPEPEDQAEPDPEPEDQAEPDPEPEPE
PQDEPDPDQDQDQDADDSEGADADQEPPKATETNTETSTKPEPEPEPEPE
PTEKTTATVTDDGSDDPAVPPQEPKKVAVFATATSLAESSPKTLSPKVAA
LLTTEQDEAAAAKKPNLITAVVNVVTSMLDWARQKADAKPGDAPQPPFLW
ALLSFARRELDNLFAARSTTNAPRTTSVTPTSLALTDDATTAALIPSYSP
WLNPQVSPSTRFVSWVTGKYVYLDDDTLANTLARFSVYGTDVGVMWDNGM
VDDPSTPDINEHQILIAVGDTFGAKGMTGRHIYNTLFRSSDTDLSDGMTI
PDGEWFNGNMFGGAPLDGPTQARPIINRPSWLPNSVTLIPTAGVSLPTEV
TEDTPFGTIQYVSFMSVSNWGSSGRWTTNYSAIAYSTDNGENFKVAPESV
RYNSIFSGNRNFQQSAFVKGDDGYVYVYGTPNGRQGAAYVARVNNENILD
VSEYEYYKAASTGWFGSSEARWVKGNPSSASAVIGKTGGACGSTEPGYTV
SEMSVQYNEYLQKYIVLYGDQFNNIVMRTSDTPEGAWSDATVLMGQQSGG
IYAPMLHPWSPSTQGTGSDLYWNLSLWSDYNVMLMKTDLTKL
120406127YP_955956.1 hypothetical protein Mvan_5179 [Mycobacterium vanbaalenii PYR-1]MAEAGLWVAWGVPTRGRERSALDLLVETEGYLSDLQGRGRIEGFDRVVLK
PQSIELGGFILIRGSKEQIDGLRRDHDFELWLTRVQLVADQVGVADAWLG
DGIAEAVSLYEKALENLD
120406126YP_955955.1 trehalose synthase [Mycobacterium vanbaalenii PYR-1]MESEPEDQGTDSSESPELTFDEHLHPARPRSLRFRPRVRAPFTRRSLARD
GSPTGDNPAYVSWLISQSMLADANEISQQFSGQGSMWQNPYATPSPRGAV
ETASVWFTAYPLSLITRSNESFLKAMADVEMWKAFAEIGIEAVHTGPVKR
AGGISGWELTPSVDGHFDRISTEIDPAFGTEDEFRQMCGTANWYGGTIID
DIVPGHTGKGADFRLAEMKYADYPGIYHMVEVDPRDWEHLPDVPPGADSV
NIDPATEQWLDKAGYIIGKLQRVIFYAEGIKETNWSVTRPVVGIDGVERR
WVYLHYFKDGQPSINWLDPSFAGMRLVIGDALHSLTDLGTGGLRLDANGF
LGAEKTAAEDSAAWSEGHPLSEAANHLIASMVRKVGGFTFQELNLTIDDI
REIGEAGADLSYDFITRPAAHHALATADTEFLRLTLRTTLELGVDPASLV
HALQNHDELTYELVHWSTGHRDDVYTYKGEEITGEVLGETIRSDLSEKLT
GENAPYNLVFTTNGIACTTATVIAATLGIAALDDIVDDEQIDRIRRAHLL
LAMFNALQPGVFALSGWDVCGMLTLPPSQITELLHGGDTRWIHRAAHDLM
GVNPTATRSPAGMPRGRSLYGSIPDQLAEDTSFLRQLQAILKVRSHYGIA
TSRQIDIPEVSHRGMLVLVHQLHEEGRYQLTVLNFANEDVAGTVRSLKLP
PGSEVSDMFSGRPLATVDDLHSFGVELTAHQGLSLLVEAPVPDAGTEGDH
VQ
120406125YP_955954.1 HNH endonuclease [Mycobacterium vanbaalenii PYR-1]MSRTCLGCGVDLQTRQQKVFCSNACQQSYRRRLLLEAWLATGVCGRLSYQ
GHYIRDYVYEQQGGCCALCGIKNTWNGLTLALIIDHIDGDSGNNRRENLR
LICPNCDSQLPTYKARNRGKGRFYRRQRYRDGLSY
120406124YP_955953.1 hypothetical protein Mvan_5176 [Mycobacterium vanbaalenii PYR-1]MNLGRSLTDLAFAPVRAGLAIAEVGLGMASGAMDIAQRSLGDSGNGARQA
PTSFASMLGVQDAVDRANRLARLMDEDQPLGRALAPDGPIDRLLRPGGVV
DRLTAPGGVLDRLTEEEGGLMRTLEPGGLVDQLLAEDGLVDRLLAEDGVA
DRLFAEGGVVDTLTARNGPLEQLAAVADTLNRLAPGLEALEPTIEALREA
VIVLSQVVNPLSNIADRIPLPGRRMRPRPTSRPVTSQRIVEADD
120406123YP_955952.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMPVPENVPEARVLVVDDEANIVELLSVSLKFQGFEVHTASNGPAALDKAR
EVRPDAIILDVMMPGMDGFGLLRRLRADGIDAPALFLTARDSLQDKIAGL
TLGGDDYVTKPFSLEEVVARLRVILRRSGRGHEEPRTSRLTFADIELDED
THEVWKAGEPVSLSPTEFTLLRYFIINAGTVLSKPKILDHVWRYDFGGDV
NVVESYVSYLRRKIDTGDKRLLHTLRGVGYVLREPR
120406122YP_955951.1 integral membrane sensor signal transduction histidine kinase [MycobacMDGGDGPTLNNGGVPGRIRRGVPLRVGLVAAMLLLVACGLLASGIAVTTI
MQHSLMNRVDDTLLDASRGWAQVPRRVLTVPMEGPNPARPPSDFYVRAVD
PDGHVWMEVNDREAEPALPEDNDVGSEPVTVASVDHSHVQWRAMTVRGLS
GELTTVAIDLSDVKSTVRSLVYTQAGFGVAVLVVLGIAGYAVVHRSLRPL
SEVEQTAAAIAAGQLDRRVPERDPRTEVGRLSLALNGMLAQIQRAMASSE
ASAEQARTSEDRMRRFITDASHELRTPLTTIRGFAELYRQGAARDVEMLM
SRIESESRRMGLLVEDLLLLARLDAQRPLDRHRVDLLTLATDAVHDAQSI
APKRSIKMEVFDGPGTPEVLGDEPRLRQVLSNLVANALQHTPETAAVTVR
VGTDGNDAVVEVCDEGPGMRPEDAQRVFERFYRTDTSRARASGGTGLGLS
IVDSLVYAHGGRVSVTTAPGQGSRFRVSLPRIADAGPDAGPDAEVPVSSA
QLG
120406121YP_955950.1 histidine triad (HIT) protein [Mycobacterium vanbaalenii PYR-1]MLDGMATVFTRIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPREEI
DNWQDIDPAEFARVMEVSQLIGKAVCKAFDTERSGVIIAGLEVPHLHVHV
FPARNLSDFGFANVDRNPSPESLDEAQARIKAALAELS
120406120YP_955949.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MFGLMQDRPLMISSLIEHAAAFHGDTEIVSRLPEGPVRRTTWREINEHSK
QVANALAELGIEQGDRVATLAWNSDRHLALYFGVSGSGAVMHTVNPRLFP
EQIAYIVNHAEDRVLFFDITFAPLVAQLAGELGTVETFVAMTDRDHMPDI
PQIPDGRLRCWDDFIGGQSTAFDWPEFDERSASSLCYTSGTTGNPKGVLY
SHRSTMLHTLMIAARDAIDIHSGSVILLVVPMFHANAWGTPYTAAMVGAK
LVMPGPHLDGQSVYELMKAEGVNQSQGVPTVWMMLFSYLDEHPEIDAHEL
GLRVAGTGGAALPLSMIERFHRDFGAESMQGWGMTETSPLCVVGRLLPKH
EGLSDAEKNQIRLKQGRGVWGVDLKIVDDDGNRLPWDGKAFGEVWVRGPW
IASGYFRGEGGEKLDAEGFFPTGDVATIDPDGYLQLVDRAKDVIKSGGEW
VSSIDLENAALGHPAVAEAAVIGVPHPKWQERPLLIVVLRKGHHATREDI
LEYLAGEVVKWWLPDDVVFVDELPHTATGKVLKLKLREQYRDHRLSQPE
120406119YP_955948.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTSGRRVLITGAGQGVGRGLALAFGAAGAEVLVNDLHRERSENVVDEIRA
AGGSATPAPFDVCDYASVVTAVAATGPVDVLVNNAGNAGAEGFGGRARFA
DTEPVDWDSFLRVNLYGVLHCTRAVLPTMIANTWGRILTVVSDAGRTGDP
GGAVYGAAKAGAAGLMRSVALENGRFNVTANNISLGTMRTPLTEPLWAEH
GDSPQAKEILRNYAIRRPGVPDDVTELALLLASDHGSWITGQTICVNGGY
SFGL
120406118YP_955947.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTDLASADFFSDYALSQDPHPYWDHLREQNPVYREPHYGVVAVTGYQEVL
AAFKDHDSFSAVNAIGGPFPPLPFTPEGDDITEQIEAHRHLFPIHEHLVV
MDPPAHERARSLLNKLLTPRRLKENEDYMWQLVDSQIDQVIGKGRCEFLS
EYAKPFATSAIIDLLGVPEEDRPEFLAALGAEQPDGARVGALDGEPVGLD
PLQYLDDKFAGYLAERRREPRGDVLSGMATAVYPDGSTPELIEVVKPATF
LFAAGQETVTKLLSAAVKTLAEQPEYQRILRAHPDRIPTFIEESLRMNAP
TKVDFRLVRKTTTLGGVHLKAGTIVMLCLGAANRDPRKFEDPHEFRPERK
NVREHIAFGRGIHTCAGAPLARVEGQITVRRWLDRTDEIHLDESVHGPAG
QHHFAYDPTFLLRGLSQLNIEFTAAT
120406117YP_955946.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAASPKGRGSDPNARQRLIEATARVMRDEGYAAATSRRVAAEAGVKQALV
YYYFPTMDDLFVEVLRAGGESALEHMRAALTNDDPLHALWLINNDASRTG
LNTEFMALANHRKAIRVELRAYAERVRDIETAAVTVALRANGVDLDEHPP
VVISMLIAQVARSLCNEVAVGVTLGHDEMRAYVERQLKLLAPVTGG
120406116YP_955945.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMGGRVEGKVAFITGAARGQGRSHAVRLAEEGADIIAIDVCGPISTHTDIP
AATPDDLAQTVDLVKGIGRRVVAAEVDVRDYAAVKAAVDSGVEQLGRLDI
VVANAGIGNGGQTLDHTSEEDWNDMIDVNLSGVWKSVKAAVPHLLSGGRG
GSIILTSSVGGLKPYAHTGHYIAAKHGVIGLMRTFAVELGQHSIRVNAVC
PTNVNTPLFMNEGTMKLFRPDLENPGPDDLAVAAQFMHVLPVGWVEPVDI
SNAVLFLASDEARYITGLPVTVDAGSMLK
120406115YP_955944.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRLVFALPHMLRLPAMSQPWEASVTGADQTRMARCADQWGYDMIAVPEHF
VIPAEHVELSGPHYLQSTVAQAYLAGATERIRLNSCITVLPLQHPVVLAK
ALATADWMSGGRMMVTFGVGWLQGEFEALGVPFRERGRMADEYLAVIKEL
WTSDAPSFEGKYVSFREVAFEPKPVQKPHLPIWIGGDADAALRRAAKYAS
GWWSFLTPPEKLAERLDFIKSQPDYDGRPFDVVHGLGTNRVGEGHVAQHD
PDARPGMSAAEIVDRLSWLGAQGVTVSAVPIPKVRGVEEYLDYAQWVIEE
IKPQVP
120406114YP_955943.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMVVGGTRGVGLAVAELLAALGAGVVVNGRDEVAAGQAAERIPRAIGFSGS
PSDPDVADALIDTCVREFGRIDILVNCAGTAEPVGSSILNVTPAQFQELI
DAHLGTAFQTCRAAAPLMARQGSGAIVNTSSFAFLGDYGGTGYAAGKGAV
NSLTLAIAAELKEHGIRANVVCPGAKTRLSTGSDYESHIAELNRRGMLDD
VSYQGALDAAPPEYAAPTYAYLVSDLANHITGQIFIAAGGFVGRFDRQTP
ALVAYRGHHDEPPWTVEEIAAQVG
120406113YP_955942.1 nuclear transport factor 2 [Mycobacterium vanbaalenii PYR-1]MTETTDLTPVVAASRNSWRCVQSGDREGWLALMADDVVLEDPIGEAVTNP
DGTGVRGKDAVAAFFDTNIGPNQLRVTCEETFPSSSPTEIAYILVLETTF
PNGFVATVRGVFTYRVNDAGLITNLRGYWNMDAMTFSQKESAD
120406112YP_955941.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MKTKGALIWEFNQPWTIEEIEIGDPVKDEVKIQMEASGMCHSDHHLVTGD
IPMAGFPVLGGHEGAGVVTEVGPGVEGLEPGDHVVLSFIPSCGSCPSCQA
GMRNLCDLGAMLLQGTAVSDNTHRIHAKDGTPVIPMTLLGTFSPYMVVHK
SSVVKIDPSIPFEVACLVGCGVTTGYGSAVRSANVRPGDDVVIAGIGGVG
MGALQGALNAGARTIFAIDPVEWKRDQALKFGATHAYPDIFSAMAGVAEV
TQGRMASKTIITTGELHGEEIDNYLNITAKGGTCVVTAVANMASSEVTMN
LSMLTLLQKNLQGTIFGGGNPHHDIPQLLSMYKAGRLNLDDMVTRQYKLE
QINEGYKDMLEGKNIRGVIRYTDADR
120406111YP_955940.1 hypothetical protein Mvan_5163 [Mycobacterium vanbaalenii PYR-1]MASREQLEDWVQRWLKANQDAEAAGDWKPLAEFYTEDATYGWNIGPKEDV
MCVNKQEIRDVALGLEMEGLENWVYEYQKTLIDEKQNEIVGFWKQIANKG
DGTRDEIYGIGGSWFRLNDQLLIEWQRDFFDFGHVQKAFMKLIESGDLTP
TMQKRIERSLAGERLPGYYPIGEAPVPIW
120406110YP_955939.1 hypothetical protein Mvan_5162 [Mycobacterium vanbaalenii PYR-1]MSGNRGYRVHVDEDLCQGHAMCELEAPDVFRVPKRGVVEITDPEPPDELR
EAVELAVEMCPTRALTIIEKE
120406109YP_955938.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTAVKEVPRVSGGEEEHGHLEEFRTDPIGLMKRVREECGDVGWFQLADKQ
VILLSGAEANEFFFRSSDSELNQAEAYPFMTPIFGEGVVFDADPERRAEM
LHNTALRGEHMKGHATTIEAEVRKMIEGWGESGEIDLLEFFAELTIYTST
ACLIGLKFRNQLDSRFANYYHLLERGTDPLCYVDPYLPIESFRIRDEARA
GLVELVQDVMHGRIANPPKDKSDRDMLDVLVSIKDEDGNPRFTANEITGM
FISLMFAGHHTSSGTSSWTLIELLRHPEFYAKVQQELDDLYADGQEVSFH
ALRQIPSLDNALKETLRLHPPLIILMRVAQDEFEVAGYPIHKGQMVAASP
AISNRIPEDFPNPDDFDPDRYEKPRQEDLINRWTWIPFGAGKHRCVGAAF
AQMQIKAIFSVLLREYEFEMAQPPESYQNDHSKMVVQLARPAKVRYRRRV
RD
120406108YP_955937.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MPRFDPLPDRRPALVAGASSGIGEATAIALAAHGFPVALGARRVEKCQEI
VDKIRADGGEAIAVHLDVTDPDSVKSAVEQTTVELGEIEVLVAGAGDTYF
GKLDAISTEEFESQIQIHLIGANRVATAVLPGMIERRRGDLIFVGSDVAL
RQRPHMGAYGAAKAALVAMVTNYQMELEGTGVRASIVHPGPTKTAMGWSL
PAELIGPALEDWAKWGQARHDYFLRAADLARAITFVAETPRGGFIASMEL
QPEAPLASVKDRQQLKVDKEALNS
120406107YP_955936.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTISEVRLDPYNYDFHEDPYPYYKRLRDEAPLYRNEELGFWALSRHADVL
KGFRNSTTLSNKFGVSLDPASRGPHASKTMSFLAMDDPAHLRLRTLVSKG
FTPRRIRELEPRVTEIAVTHLDAMLEQATTGDAVDYVDEFAGKLPMDVIS
ELMGVPDADRVQVRAWADAVMHRDDGVTDVPDSAIEASLNLIVYYQEMVA
ERRKKLTDDLTSALLEAEIDGDRLTDDEIIGFMFLMVIAGNETTTKLLAN
AAFWGHRNPDQLTSVYQDLARVPLWVEETLRFDTSSQILARTVSGELTLY
DTTIPDGDVVLLLPGSAHRDERVFENPDDYVIGREIGSKLMSFGSGAHFC
LGAHLARMEARVALAELFKRIRGYEVDEANAVRVHSSNVRGFAHLPIRVE
IR
120406106YP_955935.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSNDAVAQLTEEPGNPPRNRRQEETFRKVLAAGLEMLRESSYADLTVRAV
AARAKVAPATAYTYFSSKNHLIAEIYLSLITKVDYFTDVNDSTAVRVEKT
LRSMALMIADEPEVAAACTTALLSGNDAAVRTVRERIGAEIHRRIRAAVG
PDPDPRTLAALEMTFFGALVNAGSGAFTYHQIADRLSYVVGLIVGDDK
120406105YP_955934.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MAILADRESRLLIDGKLVAGSSGTFTTVNPATEETLGVAADASAEDMSAA
IGAARRSFDETDWATNTDLRVRCIRQLQQAMRDHVEELRELTIAEVGAPR
MLTSAAQLEGPVEDLSFCADTAESYAWTTDLGIASPMGIKTHRTIAREAV
GVVGAITPWNFPHQINLAKIGPALAAGNTLVLKPAPDTPWAAAVLGELIA
EHTDFPAGVINIVTSSDHGVGALLSKDPRVDMVSFTGSTNTGRAVMADGA
ATLKKVFLELGGKSAFLVIDDADLAGACSMAAFTASMHAGQGCAITTRLV
VPRDRYDEAVEAAAATMGGLKAGDPTKPGTVCGPLISERQRERVQGYLDS
AIAEGGRFACGGGRPADRDTGFFIDPTVIAGLDNNAKVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVFSADPERAAGIAARMRVGTVNVNGGV
WYSADMPFGGYKQSGIGREMGLAGFEEYLEIKAIATAAN
120406104YP_955933.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MGLYGDQFKEKVAIVTGAGGGIGQAYAEALAREGAAVVVADINTEGAQKV
ADGIKGEGGNALAVRVDVSDPESAKGMAAQTLSEFGGIDYLVNNAAIFGG
MKLDFLITVDWDYYKKFMSVNMDGALVCTRAVYRKMAKRGGGAIVNQSST
AAWLYSNFYGLAKVGINGLTQQLATELGGQNIRVNAIAPGPIDTEANRTT
TPQEMVADIVKGIPLSRMGEPEDLVGMLLFLLSDQAKWITGQIFNVDGGQ
IIRS
120406103YP_955932.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSERADELRVGYIGLGNQGAPMAKRLVDWPGGLIVFDVRTEAMTPLVEMG
ASAADDVAGVSAADVISVTVLNDAQVRDVVGELAAHAEPGTVIAIHSTIE
PDTAPELAEQLRPKGIHIVDAPVSGGAGAADKGELAVMVGADEHAYDRVK
PVFKQWASMVVRAGEPGAGTRMKLARNMLTFVGFTAACEAMRLAEAAGID
LQKLGRVVRHSDAQSGGPGAIMVRDDMLPLAPEHFLYDMFVHTRGLGEKD
LRLALGLGESTGVELPLAEIALRDLAAGLGVPHTTSTTEE
120406102YP_955931.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MSTDELRRKGLEKMNEVYGWEMPDVQGDPYYDLTVEHLFGSIWTRPGLSM
RDKRMMTLTVVTALGNSDLAEIQVNAALHNEELTEHELKEMAVFLTHYLG
FPLGSKLDGVVSKVAKQRKKAAERGEGENKKANVNAAVQMHSGGKVHDDH
DQ
120406101YP_955930.1 hypothetical protein Mvan_5153 [Mycobacterium vanbaalenii PYR-1]MMTTTSRYAALSRAELATLVPELLLIGQLIDRSGMAWCISKFGREEMLQI
AIEEWAGSSPLYTKRMQKALNYEGVDVITVFKGLQLDIGAPPQFMDFRYT
VHDRWHGEFHLDHCGALLDVEPMGEDYVRGMCHDIEDPTFDATALATNRK
CQVRPIHRPPRAPADRHPHCAWTVIIDESYPEVDFVPQLEIVAASRAYNT
ELAPIDPSDEGLADYSGPLLSDVDFGAFSHSALVRIADEVCLQMHLLVLS
YNLAVRARANGDAALEESIRYKSLIGIAGVAAERIKNALGISADATGALR
VLELHPLMNPAAYVSVDVDPDFLHVRRSPAYEDGAWISLVSPVADLPLQA
IAAAVNPYLRAEVSGTESDWTVRVVETDTAAKELPEVEVCKFSGGASWEF
ENRKSLPLTVV
120406100YP_955929.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTGLAYSSLVRTHGWSGAKPASDEEAVARILAAAGKVIEERGADFSISDV
ARTVGVTRQTVYRYFPSTEALLVAAAVHAVDGFLERLTAHMAGITDPAEA
VTEAVATALEWLPREKYIGLIMVPGRSTHVQSVTSDIALRFGRDMVGRLD
VDWAAAGFDDADLDQLSEHLLRIIQSFVVDPGRPPRHGEQLRTYLRRWVG
NALPLR
120406099YP_955928.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTATQSCPFLPHGYDFTDPDVLLKGIPVTEFAELRRTAPVWWNEQADSIF
DDGGYWVISRHEDVKAISRNSTQWSTNTKGAVMRLPDGVTAEQLDLTKAL
LINHDAPEHTRLRKIVSRLFTPRAIAGMEDRLADAAREIVRSAAEKDSGD
FVDDVAMMLPLQAIADLIGVPEEDREKLFHWTNAIMNTDDPEFDADPTMA
NAELMGYAYSMAEERRRCPADDIVTRLVQADIDGESLGEVEFAFFVILLA
VAGNETTRNAMTHGMNAFFDNPAQWELFKRERPETAIDEIIRWATPVHCF
QRTALEDVEVGGVTIAEGQRVGLFYSSANFDEDVFDRPFDFDILRDPNPH
LAFGGNGAHFCIGANLARMEIKLMFNEIADQIPDISKLAEPQRLRSGWIN
GVKNLQVAYR
120406098YP_955927.1 phosphoribosylamine--glycine ligase [Mycobacterium vanbaalenii PYR-1]MLLGCASVHVLVVGSGAREHALLLALRRDPEVEALSVAPGNAGTAAVADQ
YEVDVTSGEAVTALARRIGADLVVIGPEVPLVLGVADAVRAAGIACFGPS
KDASRIEGSKAFAKDVMTAAGVRTAVSEIVDNPAHLDAALDRFGPPAGQA
AWVVKDDGLAAGKGVVVTTDRDAARAHAASLLDAGHPVLLESFLDGPEVS
LFCVVDGETVVPLLPAQDFKRVGDGDTGPNTGGMGAYTPLPWLPADVTRR
IVDEIVKPVAAELVRRGSAFSGLLYAGLAITSNGPAVVEFNCRFGDPETQ
AVLALLESPLGQLLRAAAIGELAGQPPLQWRDGAAVTVVVAAENYPGRPR
VGDVIHGAADGDTVLHAGTARRDDGALVSAGGRVLSVVGTGADLVAAREA
AYATLAAIRLPGSHFRHDIGQAAAEGRIAL
120406097YP_955926.1 putative esterase [Mycobacterium vanbaalenii PYR-1]MMSRMPTLNRREMLALGLRAGLAATAASALGTAVASAAPAPTFVTGSFAS
AARGGAVTNWVIARPPDQTAPLRPVILLHGKDSSAEMVMSMGVERFLADA
VRAGLPPFAMAAVDGGNGYWHRRASGDDPGAMVLDEFLPLLATQGLDTSR
VAFLGWSMGGYGAMLLGSRLGAGRTAAITAVSPALWTSPGAAAPGAFDGA
ADYEANSVWGLAALNGIPLRIDCGFDDPFYSATEQFIAQLSTPPAGGFSP
GGHNAAFWSSQLTSEMTWAAPLLAT
120406096YP_955925.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTAAVTPKGERRRYALVSAAADLLCEGGFDAVRHRAVARRAGLPLASTTY
YFSSLDDLIAKAVEHVGTRESEQLRTRVETLSRRRRGAESTADIIVDLLV
GDNPERVTEQIISRYERYIACARQPGLRDIQRRILRQRSDAVVEVVERSG
RSVRTELVTALVCAVDGAVVAALVGDGEGPRATARATLIDVIDVLAPFN
120406095YP_955924.1 amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-MSESVAGPRSPEKQPELKRVMGPGLLLLFVVGDILGTGVYALVGDVAGEV
GGAAWLPFLVAFAIATVTAFSYLELVTKYPQAAGAALYAHKAFGIHFITF
LVAFVVMCSGITSAATASRAFAANFFEGAGIDASKLGVVVLALLFMAALA
AVNYRGVGESVRLNVVLTIVEITGLVVVVLVGLWAFTGGADVDFSRITAF
ETGEDKNTFLAVTAATSLAFFAMVGFEDSVNMAEETKDPVNTFPKILLSG
LSIAGVVYVLISIVAVALVPVGRLEESDTPLVEVVRAGAPGLPIDAILPF
MTMFAVSNTALINMLMASRLIYGMARQHVLPPVLGTVHPTRRSPWVAILF
TTLIAFGLIIYVSTFASSNAIAVLGGTTSLLLLAVFAVVNVAVLALRRDV
REAGGHFKTPTALPVIGFLASLFLVTPLSGRPAQQYIVAATLVAIGVVLF
FVTQLINRQLGIRDGHITDPTRLGSGTD
120406094YP_955923.1 RelA/SpoT domain-containing protein [Mycobacterium vanbaalenii PYR-1]MYFVGLDLAWGEKNQSGLAVIDADGRLLQVGTAHDDDSIEAALAPFVADE
CLVAIDAPLIVKNPTGHRPAESQFNKDFQRFEAGARPAFTDRPEFKHPRA
ARIAERLGLDTDPSSSSPRRAIEVYPHPATVVLFDLEKTLKYKRGVFEDR
QRELLRLMTLIEGLDDATPRLRVNRSAAWVELRKRVEAATKPSHLDRDED
PVDAVLCAYVGLYWYHRPEDVTIYGDAASGYIVTPSLPEGRRPRAARTSR
TSPSAAPSPAVAEYASRRPALVAATEHYLGLVKGLLDEAGINYLSVTART
KTVESFAAKADRRSGDGKPLYSEPLVEITDLIGLRVITYLREDVATVADL
LAEEMRLLDDRDMGQETAREGRWGYASRHLLFGVEGVQQPASIQVRTVLQ
HAWAEFEHEIRYKGSIPAAHAPDLDRRFTLAAGLLELADREFSAVRERLR
DAVPDTSAPEATDDPRIPTPVLATYLGNRFPDAGWSRTDHYAWIAGLLLD
LGIESIDAVDTVLDGVDTDAVNAAMDYRYPAGAVRRLDDALLAVYGRRYL
ELDGNSHRPTLLDNRLQRLVEKLG
120406093YP_955922.1 adenylosuccinate lyase [Mycobacterium vanbaalenii PYR-1]MPHYLPVQGPISCVFVSNPVPVPDVLAHRYASEEMVAIWSPEAKIVAERR
LWLAVLKAQAELGVGVPDGVVADYERVLEEVDLASIAARERVLRHDVKAR
IEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLELVHARGIAVVARLA
ERAALYRDLVMAGRSHNVAAQATTLGKRFASAAEELLVALQRVRELIDRY
PLRGIKGPMGTAQDMLDLFDGDTDRLADLERRVAGFLGFTDIFTSVGQVY
PRSLDHDVVSALVQLGAGPSSMAHTIRLMAGHELVTEGFAPGQVGSSAMP
HKMNTRSCERVNGLQVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPD
AFFALDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILIAAVRAG
VGRETAHEVIKEHAVAVALAMREKGAEPDLLDRLAADPRLPLDRQALDAA
LADKQVFTGAAGDQVDRVVAAVDDLIARYPEAAEYTSGAIL
120406092YP_955921.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MRVAGALAAVDFTDLDNFAAGFPHGLFALHREQAPVYWHEPTENTPDGEG
FWSVATHAETLAVFRDPETYSSVTGGERAFGGTLLQDLPIAGQLLNMMDD
PRHSAVRRLVSSGLTPRMIRRVEDDLRERARRLLDEVEPGTPVDFLTDIA
AEVPMQMICILLGVPESERHWLFEAIEPSFDFGGARKASITRLSVEEAGS
RMFEYGQELIAAKRAQPGDDMLSVVVNSGDPQLSDLESYLFFNLLFSAGA
ETTRNAIAGGLLALIENPDAYRALRADPGLLPTAIEEMIRWTSPSPSKRR
TATRRATLGGHTIEAGQKVLVWEGSANRDAAVFASPDHFDITRKPNPHLG
FGQGVHYCLGANLARLELRVIFEEILRRHPAAHLARPVEWTRSNRHTGIR
HLVVEFASR
120406091YP_955920.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MRILVLGGDGFCGWPTALHLSDAGHDVLIVDNEIRRRMDVELGVQSLTPI
VSLPERIEAWREVSGRCLQLEMFDVARDYDALLNTLRTYRPDAVVHFAEQ
RAAPYSMKDAAHKCYTVDNNVNATHNVLAALVEARLDSQLVHLGTMGVYG
YETSAVDLPEGYLTISYPDRHGAVVTREALYPTKPGSVYHLTKSLDQLLF
QFYAHNDGIRVTDLHQGIVWGTQTAETRRDPRLINRFDYDGDFGTVLNRF
LMQAAIGYPLTVHGTGGQTRAFINIQDTVRCVRLAIESGDQVGRRVRIMN
QVAETLRVRDLAELLERLVGAAVAYLPNPRAEADENELAVRSDNLKRLGL
DPILMEAGLLGESMEIAKEYANRCDVSKIPSVSYWNAERRCAAQKVSR
120406090YP_955919.1 hypothetical protein Mvan_5142 [Mycobacterium vanbaalenii PYR-1]MTDPESQPTHHGAAERRHAVRRWIPGGAAVILVIILALVAVFILVRPGWF
ETPFQEGPPPELAYIKSLADLGERDGVRLSDDGTLAKAVTAPLPVDSRVD
HAHLLLAGRAQVAEASTVFLRVLADGESVYVDELKPGNHDVKAEILLPPG
VLDDGSVTVQMRLTGALDEGTCNPTNELGSFVLLDPAETRIEATLYNPVY
SVRDAVGALNRDVTLEVAAPKEDRAWFETAARMGVALTQRGYRVSYHAVA
DSPPGNWRSRILLGPVDRLTELGWTAPEDAGPRTWQVGRIDDTAVLALTD
PAAQAAAPFLLTDAVTTADSAANESRVDSPEEPVGDAVSLAPLGMDTAVQ
RIGDRRVWRTPYWLTELPGGRVPREVRLQLRLPLIGEEARWMVQIQLNGQ
LLDSVQLAGGSATQDVTVPIPEGIEALRNDLAVTLLRDRDLVGCTTRSPS
YDVQLLPTSSLVLGGPGAGLTAVPADFAAGFDILLPSSSTDDPATSLAAL
VPTLAHFRGWLQPMSFVWDGLPSDRPFFLFGNPPSGVDVPVRLVDGRLVA
AGFDLQAFQNGLVVERASAGAARGLVVIAVGRPPDNPVPYGREAARLVTG
VDGGVVVSDPGGILTPAPTERFP
120406089YP_955918.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MSDPGPRGVEEHYRSIDSAPPEYSVNRPPSAVNGALMNFFSLSVVALLAA
TEIVRRIDPYAPRDLVFIRAEGQSAAIPVRVFLLLIASAVALSLATNWWR
RLAVGGEMVGKGLLICLVVDLSAYIGHSLGLFEAEVVGQQLASSLASLVV
FPFVILRHARLPKPVDLPPVGRIRWHAWVRLIVPLVVAFVLAAWIEQRTP
LTTEFMREWALLGGVGPGIFLVQQLFVIITASIGLLMVRWSRRARFAPPL
AVMVPAHNEAHDIAAAIEAVDRAAARYAAPVHLYVIDNASTDATTAAAEA
ALAACAHCTGEVRPCAQPGKAVALNYAISIIREEFVVRIDADTVIGENCL
DVTLRHFANPKVGAVGGMPRPPRVRTFFDRARMVEVLLKHGFFQVSMMGF
DGILGEPGMFVVYRRRAVLEAGGIVEGMNGEDTDICLRMSSQGYLNMAEP
TAVYLSEVPQTWAHLREQRIRWFRSIYHVTAHNRRALLDRSSMAGVVVLP
FQLANAARRAMMLPLLLFGLLIFGLFQKTYPGLSEPRLWAVFLGLPMLVA
IAVCLSRQPRAVLYIPEYLVFRVVRSYFTLAAVLSLNFPPLHPRLRRRAS
GEKPVATPRQAPAKRSSHLTRQHSRVAPAGRRSSSVES
120406088YP_955917.1 hypothetical protein Mvan_5140 [Mycobacterium vanbaalenii PYR-1]MMDFEHPDIRASDADRAAVTRILENAVGQGMLTLDEYSERVDVVLAARTR
RELDTVIADLPHIRHRPAPAPPEVLRGWMSSMSRRGQWTVPARLRLVTRM
CSTTLDFTSAVLQSPVVHIDIDDYFGSTELVLPDGATADLNGVGNVASST
TVKVTASPPSQRLHVVVAGKMRFGSLTARHPFGTTLKRLLS
120406087YP_955916.1 putative transmembrane protein [Mycobacterium vanbaalenii PYR-1]MKSRWVPYATTPGRLMAQLFSDVVVVGWTAIWIFVGTAVHSAVATIADFG
YQVESGANGVAGNLDSAGQSAEDVPLIGGAIGGPLTAAGDAAREIAGAGQ
TLGVTAGWLAWLLALAVAAPPILALMMPWLFLRVRFFRRKWTAVTLSSTW
AGEQLLALRALANRPLPKLAAISTDPVGAWREQDPVAIRGLAALELRASG
IRAANLKRAK
120406086YP_955915.1 phosphoribosylaminoimidazole-succinocarboxamide synthase [MycobacteriuMRPALTDYQHLASGKVRELYRIDGGHLLFVATDRISAYDHILKSEIPDKG
RVLTAMSVFFFDYLSRTAAVSNHLAGPPDDERIPEEVLGRALVVEQLEML
PVEAVARGYLTGSGLIDYQQTGTVCGIALPSGLVEASRFDEPLFTPATKA
ELGEHDVNISFDDVVGLIGAERAEELRDRTLRTYSQGAAHALTRGIIVAD
TKFEFGVDARGELKLADEVFTPDSSRYWRADDYAEGQVQNSFDKQFVRNW
LTGPDSGWDRHGDQPPPPLPPDIVDATRARYIEAYERISGLRFDDWIGVS
A
120406085YP_955914.1 oligopeptidase B [Mycobacterium vanbaalenii PYR-1]MKPSEMAGPPAPIAKRIDTRREHHGDVFIDPYEWLRDKDNREVVDYLEAE
NAFTEHVTEKLAPLRQQIFDEIKARTKETDLSVPTRRGDWWYYGRSFQGK
QYGVQCRCPVTDPDDWTPPQFDENTEIPGEQVLLDENVEAEGHDFFSLGA
ATVSVDGNILAYSVDVKGDERYTLRFKDLRTGQRYDDEIVGIGAGATWAA
DNNTVYYVTVDEAWRPDTVWRHRLGSGLPAERVHHEPDERFWVAVGRTRS
NKYVIIAAGSAVTSELRYADAADPQAEFTTVWPRRDSVEYSLDHAVVGGE
DRFLILHNDGAENFTLVEVPVAEPTDVRTLIEHRSDVRLDSIDAFAGHLV
VSYRKDALPCIQLWPVSDTGYGDPQDITFDSELMSVGLSANPNWSAPKMR
IGATSFITPVRVYDLDLATGERTLLREQPVLGDYHPEDYVERRDWAIAED
GARVPISVVHRAGLEGPAPLLLYGYGAYEACEDPRFSIARLSLLDRGMIF
AVAHVRGGGELGRPWYEHGKLLEKRNTFTDFASVGRHLVDTGTTRPENMV
AYGGSAGGLLMGAVANMAPDLFAGILATVPFVDPLTTILDPSLPLTVTEW
DEWGNPLEDPEVYAYMKSYSPYENVESRNYPAILAMTSLNDTRVYYVEPA
KWVAALRHAQTDPAADAVKVLLKTEMNAGHGGISGRYERWKETAFQFAWL
LDAAKAGHDGGA
120406084YP_955913.1 hypothetical protein Mvan_5136 [Mycobacterium vanbaalenii PYR-1]MIVVVTLIVGTLAARLVGLLGPQSWDYLDSWPKAVAVGLAAMFVLTGVAH
FVNPLRRDMIAIVPPRLPAPAALVTITGVLELLGAVGLLYPPTRAAAACG
LALLMVLMFPANVYAARMPDAPTSMATRLGPRTVEQVGFLGAAVVAGFGG
IQ
120406083YP_955912.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSSRGTYHHGDLRATILARAADLVAERGADGVSLRELARAAGVSHAAPAH
HFTDRRGLFTALATEGFRSLAEELSRARPEFLDAALAYVRFALANPGHYE
VMFDKSLYHADDPALVDAETAAGSELAAGVGTLDDPRAKDDPQAAALAAW
SLVHGFALLWLNGAVNTTGDPMATVRRVAGMLFGGEPVTCPT
120406082YP_955911.1 glutathione peroxidase [Mycobacterium vanbaalenii PYR-1]MTDTPLTEIALTTLDGRTTTLAELADGAALVVNVASKCGLTPQYGALEQL
AKDYGPRGLTVIGVPCNQFMGQEPGTAEEIQTFCSTNYGVTFPLLEKAEV
NGPNRHPLYAELTQTADDAGEAGDVQWNFEKFLLAPGGKVVKRIRPRTAP
DDPEVIAAIEAVVPR
120406081YP_955910.1 hypothetical protein Mvan_5133 [Mycobacterium vanbaalenii PYR-1]MGVAGHLIVSISGISDRTLADVAAFRAALDDRGVPASFLVAPRLKGGYRL
DHDPTTVDWLVERRAQGDAVVLHGFDEAATKQRRGEFATLPAHEANLRLM
AADRIMEHLGLRTRLFAAPGWNVSQGALTALPRNGFRTVAGLTGITDLVH
RTTVRARVLGIGEGFLTEPWWCRTLVLAAERTARREGIVRVAVAARHLRR
TGPRQAMLDAVDLALMHACAPTVYEWRPRAALTDAA
120406080YP_955909.1 putative FAD-binding dehydrogenase [Mycobacterium vanbaalenii PYR-1]MADVSSAPHVRAADVIVVGAGLAGLVAACELADRGRSVLIVDQENSANIG
GQAYWSFGGLFFVDSPEQRRVGIRDSHELALQDWLGTAGFDRPEDHWPRQ
WAHAYVDFAAGEKRSWLRDRGLQIFPLVGWAERGGYGANGHGNSVPRFHI
TWGTGPALVDIFARRLIGNPRVRFAHRHRVDELIVDDGAVVGVRGAVLEP
SSAVRGAESSRNVVGDFEFRAQAVIVASGGIGGNHELVRKCWPKRMGRVP
EQLLSGVPAHVDGRMLEISATAGASVINSDRMWHYTEGITNYDPIWPRHG
IRILPGPSSLWLDAAGKRLPVPLYPGFDTLGTLEYIAQTGQDYTWFVLNS
RIIAKEFGLSGQEQNPDLTDRSIRAVLERGRKGPAPVHAFVDKGVDFVTA
TSLRELVTKMNAVPDVVPLDFDVVEAEVTARDREVTNRFTKDGQITAIRA
ARAYLPDRISRVVAPHRLTDPKAGPLIAVKLHILTRKSLGGLQTDLDSRV
LHDDGTVLPGLYAAGEAAGFGGGGVHGYRSLEGTFLGGCVFSGRAAGRHA
ASAVG
120406079YP_955908.1 beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYMLQLTHFGHSCLLASFDDGSGAQTTVLFDPGNFSHGFEGITGLDAILITH
QHPDHADTARLPALVEANPQAALFADPQTAAQLGGSWQAVNVGDQLSIGH
LTVRGAGGTHAVIHPEIPVIDNISYLVGDGEHPAKLMHPGDALFVPGEPV
DVLATPAAAPWMKISEAIDYLRAVAPVHAVPIHQAIIDPIGRPIFYGRLT
EMTDTDFRVLEQESAVTF
120406078YP_955907.1 hypothetical protein Mvan_5130 [Mycobacterium vanbaalenii PYR-1]MFARVVLALAVAVSGLVLTPGQAGGVPGECPPVCNAIPDSAWMVSSSVPL
YPVYRWPGLHGVAVTAATPRFEFESWCASPGREADPRDYSVAAQARVTNP
AGQWNLHVQVMHWRGDTVTGGPTALQTLEWARMALASCHLTAPQVSPSLT
TSNAMDLAAVISDGGRRVMHTYLLAEPANSSLVELTLWSTLPSAVEWRGV
APDTQVLDAMAAPLCAAYLGSCR
120406077YP_955906.1 phosphoribosylformylglycinamidine synthase subunit PurS [MycobacteriumMAKVVVHVMPKAEILDPQGQAIVGALGRLGFDGISDVRQGKRFELEIDGD
IDDDKLAEIAESLLANTVIEDWTVTREGQA
120406076YP_955905.1 phosphoribosylformylglycinamidine synthase I [Mycobacterium vanbaaleniMTARVGVITFPGTLDDIDAARAVRLAGAEAVSLWHADADLKGVDAVVVPG
GFSYGDYLRAGAIAKFAPVMGEVIEAAGRGMPVLGICNGFQVLCEAGLLP
GALTRNAGLHFICRDTWLEVASNTTAWTTRYEQGADLLVPLKSGEGRYVA
GEAVLDELEGEGRVVFRYRENLNGSMRGIAGVSSANGRVVGLMPHPEHAT
EALTGPSDDGLGIFYSALDAVLVS
120406075YP_955904.1 hypothetical protein Mvan_5127 [Mycobacterium vanbaalenii PYR-1]MLVDPELLRAFAAQVDAAAATIRGTDVGTTAGAAGDGLPGSETQWSARQV
GVHLKLIAEDIAKDIAAMGHAVRGAGDSYEVTDEALAGDFKKLF
120406074YP_955903.1 hypothetical protein Mvan_5126 [Mycobacterium vanbaalenii PYR-1]MLPTRSRLRSWSPDSLTVAAASLRASGTEFYETVRELHDGIDRMDEAETW
QGSAHTAAAAMFGRATDRASAFKDYTERAAATLQRGGSLISNYRTQVQSK
ADEIDAGPLNVSDQWVVFIDPAGMSAERAAELEAQANAVQAELNPLLAAL
DEADSTASTSLLATQATEGISPDLPVKPPIPLTRPPGDEVPSPDTEEGRQ
FQEIARSQDMATTVRDITDIEDRDGNRVTTYTMMDGSTQVATEFIDQGLP
SQQVYPAGTTRVLHSDKNGNWISETMTTPLEDGGIKTNVSWADGTTITMT
ETADGVRTGSCITADGRESVLPDEFFTDPLPTLAAGALSGLESKAGQGIP
ALTSAELDKVKTGAKWGGPAIGLATMAYNMVSAETLHDACVAGVSGTFGT
VASIATAAVGGAAFGPAGAFVGSLGGSWAFGYVGSVVGEVLCPK
120406073YP_955902.1 hypothetical protein Mvan_5125 [Mycobacterium vanbaalenii PYR-1]MKPLSAVAVVAVLFGGLGSFCIMWVVRLLQQGRYASMVVAVGFAVFAFSV
LAMRVIVAAGKVAPRVEYGGGGTLLRPDPTVDRISLIGLLAALATLLLYG
VVASFGIAGLPGLAGDQRWLGLASIAAAILGLPSLRRVAGQRGMSYLRLT
AAGYEYSDAWSRTETEWDELSDISDRPTHKPWLLIAGSTYLTTSDGRSRT
LASDWYTPGGRAVRKLVRFYWRHPECRGELTDARAARRLADPW
120406072YP_955901.1 hypothetical protein Mvan_5124 [Mycobacterium vanbaalenii PYR-1]MTYKLSRKWLLHIVSITVLFAVGGCHTEGEPQAAPPELPQQVLLTESMRE
QPVPGWTAASTALGLPPGAVVKPVNNIGDHGIFLGIADGQRWLFGLDVTS
GEQLFGPVQLGTGGDGSGFGCVVNGPPAVLCIRQSRDLAAPSRAWVVDAD
SGEMIFDGTTEVRISRQDGRPKLDRIGDHAIATVTGKGIYGVGPHGELTW
FVPGDGILTAQFAGWNRDTVPSELAVQNSGAVADVVFSVVDGRVVKPSVP
EGLSLERAMVYPRGVGYEYTAADGRRGVTFFDDAGQALGNLAQRGALETR
SADLPTVVTESHDRVMTLDGRTLVELPATLPAVEARLIGTRLFLANDPNH
TMWQQFDLRTGDAGAVCETDALGFYFIASDGEVAVALNDDTPARAVDLAT
CEVLWSMPRPGPDEAVEVWKVGSALIRRTNDRISSLVAPG
120406071YP_955900.1 Linocin_M18 bacteriocin protein [Mycobacterium vanbaalenii PYR-1]MNNLYRQLAPVTDAAWAQIEEEATRTFKRYIAGRRVVDVSEPGGPVTAGV
STGHLRDVASPGDGVVAHLRDAQPLVRLRVPFSLKRIDIDDVERGSQDSD
WDPVKEAAKKLAFAEDRAIFEGYEAAHINGIRRSSSCPALALPEDPREIP
DVISQALSELRLAGVDGPYSVLLSADVYTKVSETTAHGYPIREHLNRLVD
GDIIWAPAIDGAIVLSTRGGDFDLQLGTDVCIGYLSHDAETVQLYLQETM
TFLCYTAEASVALSA
120406070YP_955899.1 Dyp-type peroxidase family protein [Mycobacterium vanbaalenii PYR-1]MPAPLPQPVLAPLTPAAIFLVATIDEGGEEAVHDALGDIAGLVRAVGFRD
PAKRLSVVTSIGSRAWDRLFSGPRPAELHPFIELDGGRHHAPSTPGDLLF
HIRAETMDVCFELATKLVAAMGAITVVDETHGFRFFDNRDLLGFVDGTEN
PDGPLADSATQIGDEDPDFAGGCYVHVQKYLHLMDAWNALSTEEQERVIG
RTKLDDIELDDAVKPANSHVALNVIEDEDGTELKIVRHNMPFGEIGAGEF
GTYFIGYSRTAAVTERMLRNMFIGDPPGNTDRVLDFSTAVTGSMFFTPIM
DFLNNPPPLPNSASDTVAPTDVTPVGYAGSLAIGSLKGQPQ
120406069YP_955898.1 putative aminopeptidase 2 [Mycobacterium vanbaalenii PYR-1]MPASPQGLCEFIDASPSPFHVCRTAAERLLAAGFTELSESDPWPGAGDHF
AVRAGSLIAWRSPDGSRALPFRIVGAHTDSPNLRVKQHPDRFVAGWQVVA
LQPYGGAWLNSWLDRDLGVSGRLSVRDGNSIRHTLVRVDDPILRVPQLAI
HLSEDRKGVELNPQRHVNAVWGTGTGARSFLDFVAGRAGVVGDDVLGFDL
MTHDLTPSRLAGVDDNLVSAPRLDNQATCYAGLEAFLSARAGADAVPVLV
LFDHEEVGSQSDHGAQSELLLTVLERITLAAGGSREDFLRRLPASMVASG
DMAHATHPNYPDRHEPGHLIEVNAGPVLKVQPNLRYATDGRTAAAFALAC
AQAGVNLQRYEHRADLPCGSTIGPMTAANTGIPTVDVGAAQLAMHSAREV
MGAADVADYSAALAAFLSPG
120406068YP_955897.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMSLKVEMVTFDCVDPDALADWWSKAAGGEVNAVAPGEFVMVVREGGPTLG
FQRVPDPTPGKNKVHLDFHAEDREAEVARLVGLGARETGRNNFGPEFEWA
VLADPEGNAFCVA
120406067YP_955896.1 phosphoribosylformylglycinamidine synthase II [Mycobacterium vanbaalenMTQEVDTVERAAATPDHPQPYRELGLKDDEYERIREILGRRPTDAELAMY
SVMWSEHCSYKSSKVHLRYFGETTTEKMRETMLAGIGENAGVVDIGDGWA
ATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAA
DAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDASYAGNPLVNALCVG
VLRKEDLKLAFASGAGNKIILFGARTGLDGIGGVSVLASETFGGDESGAG
RKKLPSVQVGDPFTEKVLIECCLELYAADLVVGIQDLGGAGLSCATSELA
SAGDGGMRVELERVPLRAANMTPAEILSSESQERMCAVVTPDNVDAFMAV
CRKWDVLATDIGEVTDSGRLEITWHGETVVDVPPRTVAHEGPVYERPVQR
PDSQDALVANTTASLERPSTGDELRATLLQLLGSPALCSRAFITEQYDRY
VRGNTVLAEHADGGVLRVDEQTGRGIAISTDASGRYTALDPYAGAQLALA
EAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGAAALGI
PVTGGNVSFYNQTGTTAILPTPVVGVLGVIDDVKRRIPTGFGTEPGETLI
LLGDTRDEFDGSIWAQVTADHLGGVPPTVDLDRERLLAEVLTAASRDGLV
SAAHDLSEGGLIQAVVEASLAGETGCRIVLPEGWNPFVTLFSESAGRVLV
AVPRTEESRFTAMCEARGLPANRIGVVDQGPDGGEPAVEVQGLFTVTLEE
LRRTSEGVLPGLFG
120406066YP_955895.1 hypothetical protein Mvan_5118 [Mycobacterium vanbaalenii PYR-1]MTASDTEERPAYLWAWRLLRLDFIGVAFGALFFCLSLTPSLLPRDWLFQG
LIGGLNAAIGYGIGVFLAKILRRFVLANRRWWPPPPKVLYASKAVIVVVA
ASACVLMVIPAAAWQRQVSALMGMDGPSTTSYFRTLLLAAVVGGVCVATA
RVLLEFIKTLARVLIRRWRLSDEIALFVGTAVVVVLVITLVNGVLFRGFL
AGANAVFQPQNATTAEGVVQPALPEKSGSPDSFAQWDSLGFQGRSFVAGG
LNADELARINGRPAKEPVRVYVGLQTADTDEGRMAVLLSELERTGAFDRE
VLVIAPTTGTGWINPIAARSIEMMYNGDTAIVGSQYSFLPSWISFLGDQE
KSMKSGRSMIDAVHERWAKRPPDRRPRLLLYGESLGSMAGQGAFDWLPDI
PRMGFSSVLWVGPPNASPLWRGITARRDPGTPEVLPRYDNGRTVRFSQGN
NAAQIAADTAAPWDGTRVLFLQHPSDPIVWLSQELLFTRPNWLSEPPGPD
RTASMRWYPIITFWQVAADMTNAVSVPPGHGHNYNDFILDGWAGVAPPRG
WTQEDTERIRLALEEAGSEGGGY
120406065YP_955894.1 abortive infection protein [Mycobacterium vanbaalenii PYR-1]MRDGVRATALAMLLLGWSLAAPRLPQRWNPLPQTMFGAGVAALAGAPLGL
RPPMLWRGLQWGSAAVAPVALSVAAATTSPPVRAGMVARDLPDPAASWLL
LRIPFGTVWSEEATFRAALGATAERAFGRTAGRLFAATVFGLSHVPDARA
AREPILGTVLVTGTAGWAFSWLYAKSGSLVAPMLAHLAVNEAGAVAALAV
QRRRSARGRPADGARSPGRRSRS
120406064YP_955893.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMTFTTLEIDFMKQADLGRLATIQPDGTPQNSPVGFTYNEQLGTIDIAGYE
MAKSRKYRNLADNDRVALVVDDITPRDPLRTRGAIQPLRTRGAIQPERTR
GAIQPERVRCLEIRGTAVQAEDGGRPIIRVTPRRVISFGIDDQETEPHQL
VAHVRNVGVEQQVPQRLPLR
120406063YP_955892.1 hypothetical protein Mvan_5115 [Mycobacterium vanbaalenii PYR-1]MASSGAGTSRPCGALRTWVMAARRTVDPAQTRAAVAALADWLRDPDAPAP
ARAQLADAVRFTARTLAAVAPGAAVEVRVPPFVAVQCIEGPRHTRGNPPN
VVETDARTWLLLSTGLLTVADAAADGALQLSGSRAAEIADALPLVALPD
120406062YP_955891.1 amidophosphoribosyltransferase [Mycobacterium vanbaalenii PYR-1]MTAEQLESEPREECGVFGVWAPGEEVAKLTYYGLYALQHRGQEAAGIAVA
DGSQVLVFKDLGLVSQVFDEQTLAAMHGHVAIGHCRYSTTGSTTWENAQP
VFRNTAAGTGVALGHNGNLVNTAELAARARDEGLMSSRGAATATTDSDIL
GALLAHGAADSSLEQAALELLPTVRGAFCLTFMDENTLYAARDPYGVRPL
SLGRLDRGWVVASETAALDIVGASFVRDIEPGELLAIDADGVRSSRFAPP
SPKGCVFEYVYLARPDSTIVGRSVHATRVDIGRRLAREKPVDADLVIGVP
ESGTPAAVGYAQESGIPFGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNP
LKEVIRGKRLIVVDDSIVRGNTQRALIRMLREAGALEVHVRIASPPVKWP
CFYGIDFATPAELIANASNAEADEDEMLDAVRHAIGADSLGYISQQGMIA
ATEQPASRLCSACFDGDYPIELPGETALGKNVIEHMLATAARTGIPLQVD
NDNVSALRRP
120406061YP_955890.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MSTEQVRCLVTGATGYIGRRLVPELLDRGHTVRAMARTPAKLDDAAWRDR
VEVVRGDLTEPDSLASAFDGVDVIYYLVHSMGTSRDFVAEEARSARNVVA
AAEKAGVRRLVYLGGLHPQGKTDLSRHLASRVEVGDILLGSTVETVVLQA
GIVVGSGSASFEMVRHLTDRLPVMTTPKWVHNTIQPIAIADVLYYLAEAA
TAEVPESRTWDIGGPDVMEYGEAMQIYADIAHLRRRVMVVLPFLTPTIAS
LWVGLVTPIPSGLARPLVESLECDAVAHEHDIDTVIPPPEGGVTGYRDAV
TQALRDDGTAAKGGRRHLLRFSKVVPQ
120406060YP_955889.1 cupin 2 domain-containing protein [Mycobacterium vanbaalenii PYR-1]MPFSLIMRLAQRLWMASGVAVAAVAAVAAVGSAGASATPGEGVDAVTLSE
SSVDGKSYVARMITIAPGGTTGWHYHPGDVFAVVRAGTLTHYAAASCAVD
GVYGAGAPISEASGPGYVHVGRNEGAEPLVMWVLYANPPATPLAIDVPDP
GCPLPGAG
120406059YP_955888.1 phosphoribosylaminoimidazole synthetase [Mycobacterium vanbaalenii PYRMAGSPTTCAERTPGRIGCSRRPVALWPMSDRAEQHGISYASAGVDIEAGD
RAVELFKPLAKKATRPEVRGGLGGFAGLFALRGDYREPLLASSTDGVGTK
LAVAQAMDKHDTVGIDLVAMVVDDLVVCGAEPLFLQDYIAVGRTVPERVA
ELVSGIADGCVLAGCALLGGETAEHPGLMAPDHYDISATGIGVVEADDVL
GPDRVRPGDVIIGMASTGLHSNGYSLARHVLLEIDHMNLAGHVEEFGRTL
GEELLEPTRIYAKDCLALAAETQVRTFCHVTGGGLAGNLERVIPHGLVAE
LDRGTWTPAPVFGMIAQRGRIERAEMEKTFNMGVGMVAIVAPEDTDRALA
VLTARHLNCWTLGTIEKGGKDGPRAVLVGQHPRF
120406058YP_955887.1 hypothetical protein Mvan_5110 [Mycobacterium vanbaalenii PYR-1]MGRGRAKAKQTKVARELKYSSPQTDFERLQRELSNAPDNDRLNGSDPSPD
ESWADEDDWRR
120406057YP_955886.1 glycine cleavage T protein (aminomethyl transferase) [Mycobacterium vaMSAVPAPDIGPDAGAVWHYGDPLGEQRAAAQGAVVVDRSHRAVLSLTGAE
RNSWLHTISSQHVSDLADGTVTENLSLDGQGRVEDHWVQTQLDGRTVLDT
EPWRGEPLLSFLRKMVFWADVVVEPADLGVLSLLGPGLTDPAVLDAVGLP
ALPAPNSAVELPGGGFIRRLPGPAVEVDVVVPRDELAAWRDRLVAAGVRP
AGVWAYEAHRVAARRPRLGVDTDERTIPHEVGWIGGPGVGAVHLDKGCYR
GQETVARVHNLGKPPRMLVLLHLDGASDRPSTGDPLLAGGRTVGRLGTVV
DHVDEGVIALALLKRGLPADTALTTGGEVHAAATIDPDSMPPADGVGAGR
LAVDRLRGGTA
120406056YP_955885.1 4-amino-4-deoxychorismate lyase [Mycobacterium vanbaalenii PYR-1]MADHPGVVVTLDGQLHDPDAPLLYADDLAAVRGDGIFETLLIRGGRPCLL
DAHLGRLAHSARQVDLPPPDAARWHAAVGIAVDSWLRTGGDEGVLRLVYS
RGREHGSDPTAYATIGSVPARVADVRRNGLAALTLQRSLPAEGVDAMPWL
LAGAKTLSYAVNMAALRHAERHGAGDVIFISTEGHILEGPRSTVVIATSS
PDGRTCLLTPPPWYPILRGTTQQALFELARNKGYDCDYQALTPADLIAAQ
GVWLVSSITLAARVHTLDGNPLAAAPLSDEIAALVDAAILCDR
120406055YP_955884.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MSCPSVAGWRTAAAVLVVLAGPACAAPVGVTAPTLDSSKCSRDVLATQYP
GILTFGADQPVYPPWYMGDDPTNGDGFESALAYALAAKLNYTGDDVRWVR
VPFNTALAPGAKTFDVNLSQFSITEQRRAAVDFSTPYFDVTQAVVAVRTS
PAAAVTTLDGLRPLRLGAQVGTTSHTAATELGGSVPVQAYNTNVDAKMAL
LDGEIDAMVVDLPTALTMAEELRHGVLVGQLPADGEHLEQFGIVLSHGSP
LTRCVSWAVDSLREDGTLAGLQNRWLTDTGPVAVLR
120406054YP_955883.1 hypothetical protein Mvan_5106 [Mycobacterium vanbaalenii PYR-1]MRRIGVAALAAAGAMMAGCSAPSQPPPPSTPSSAVPSVGHGSFAYCLSQH
GVPAAPGPVSEPPPGMDAATWEAAMSECSSLAPGPAG
120406053YP_955882.1 hypothetical protein Mvan_5105 [Mycobacterium vanbaalenii PYR-1]MSSGDEAVAAAAQRARVTAARNIPVFGDLPLPADTANLREGANLDDALLA
LLPLVGVWRGEGEGRAAHGDYRFGQQIVVSHDGGDYLNWEARSWHLDDDG
EYARPGLRETGFWRFVSDPGDPEESQAIELLLAHSAGYIELFYGRPLNQS
SWELVTDALARSKSGMLVGGAKRLYGIIEGGDLAYVEERVDADGGLVPHL
SARLTRFVG
120406052YP_955881.1 hypothetical protein Mvan_5104 [Mycobacterium vanbaalenii PYR-1]MVLFFELLLVAAVVVITWFALYALYRLVTDES
120406051YP_955880.1 hypothetical protein Mvan_5103 [Mycobacterium vanbaalenii PYR-1]MKITIACAASAAFAAVALIGAPAALADPEGDFLTVIGNGGITWPSDKTQQ
VIETGYAVCQDWDNGASFEQEVADLTSVTDWSDYQAGYFIGAATGAFCPQ
YEWKVS
120406050YP_955879.1 hypothetical protein Mvan_5102 [Mycobacterium vanbaalenii PYR-1]MCSAPKQGLTLPAGVDLEKETVITGRVVDGSGQAVGGAYVRLLDSSDEFT
AEVVASATGDFRFFAAPGTWTLRALSPAGNGDASIAPSGAGIHEVDVKVA
120406049YP_955878.1 thiosulfate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]MARSDVLVTADWAESNLEAPKTVFVEVDEDTSAYDTGHIPGAVRLDWKTD
LQDPVKRDFVDAAQFSKLLSERGIANDDTVVLYGGNNNWFAAYAYWYFKL
YGHQDVKLLDGGRKKWELDARPLSKDAVERPQTSYTAKEPDNSIRAFRDE
VIAAIGTKNLVDVRSPDEFSGKILAPAHLPQEQSQRAGHIPTAINVPWSK
AANEDGTFKSDEDLAKLYAEAGLDGEKETIAYCRIGERSSHTWFVLQELL
GHKNVKNYDGSWTEYGSLVGAPIELGS
120406048YP_955877.1 hypothetical protein Mvan_5100 [Mycobacterium vanbaalenii PYR-1]MSNITQSSAPTQIDVRGPRFVAWVTTVVLVATLLVSAQHPAAAAVLLGAQ
AVVFAIGAVSGPRRHPYGRVFAALIAPRLAPATDREPVAPLKFAQLVGFA
FAVVGVLGFASGLAPLGLVATGFALVAALLNAAFGICLGCQLYPLVTRLN
PTR
120406047YP_955876.1 thioredoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1MSSSWIAVIAVLIAAFGLAFVIGRLLTLRSGLIKGAAEWPALDDSDVDAL
GLSRTGPTVLHFSAVWCGPCAGVRRVVDQVCAELPEVTHVEIDLDADPES
ARKLSVLSLPTTFIFDADGRQRYRTSGVPTAADLRSALQPLLA
120406046YP_955875.1 hypothetical protein Mvan_5098 [Mycobacterium vanbaalenii PYR-1]MVRKLVIGALATLVAVVLGVVGTDFGAAIYAEYRLARSVRSSANLDWDPS
VAILGFPFITQAQRRHYDEVEIKASGVDHGVVGKASLEATMHSVGLPDSW
LIRPGSTLTVGKLESRIIIDSTHMGRYMGIPDLLIEAPTRETEDSTGGTT
ESGISSNTGLVFTGTPDKAGFHERVSIAVDVSITGPESTTLVLTATGVLT
EPGTADQAVPEDRVPAVLAAFSTTLPGQKLPFGIAPTTEGARGSDLIIEG
IAEGVTINLDEFRLS
120406045YP_955874.1 response regulator receiver protein [Mycobacterium vanbaalenii PYR-1]MDLLLLTVDPHPESVLPSLALLAHNVRTAPTEVSSLLEAGTADVAIVDAR
TDLAAARGLCRLLGTTGTSVPVVAVVNEGGLVAVNVEWGLDEILLPSTGP
AEIDARLRLLVGRRGGMANQENLGKISLGELVIDEGTYTARLRGRPLDLT
YKEFELLKYLAQHAGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYEALIGTVRNVGYKAVRPARGRAPAAGADLPSDDLDGDDPYEDGVGS
LDRDGVPEALGDALRSQ
120406044YP_955873.1 N-acetyltransferase GCN5 [Mycobacterium vanbaalenii PYR-1]MTSQDSVDWQDVLPVDERQRIRDLISDATSADGVAPVGDQVLRELGQQRT
RHLVALQDGALRGYLNLAPAGDGAPPMAELVVHPDARRRGIGSAMIRTAL
SVGGPDTRIWAHGDLEPARATAAALGLSAVRELLQMRRSLADLPTAPPVD
GVRFATYAGPQDDAEVLRVNNAAFSWHPEQGGWTEADIAERRDEQWFDPD
GFFLAFDEDSGRLLGFHWTKVHSATLGEVYVVGVDTAAQGRGLGGALTLI
GLHHLADRLLSSGHDADVMLYVEADNTAAVKTYRRLGFEVVNTDVAYAVE
G
120406043YP_955872.1 arsenite-activated ATPase ArsA [Mycobacterium vanbaalenii PYR-1]MSKVEVFEPALCCATGVCGEDVDQQLVTFSADLDFVSGRGGDISRYNLAG
EPRAFAENDTVRAFLHVAGSVGLPLVLVDGVTVMTGRYPDRSQLAAWAGI
DTPDGKIPLDIEDTTAAGGGCCGSDSSGATQLLLESARPMTLRFLDAPPR
FLFFTGKGGVGKTSIACAAAIHLARNGKRVLLVSTDPASNVGQVFGLRVG
NAITTVPAVEGLSALEIDPEQAAEAYRERIVAPVRGLLPDREVQSITEQL
SGSCTTEIASFNEFTELLTDSDALTGQFDHVLFDTAPTGHTIRLLQLPGS
WTDFLNEGKGDASCLGPLSGLDKQRAIYAEAVEALADPLRTRLVLVARAQ
RSTLAEITRTHRELAAIGLTRQYVVINGVLASPAGNGDPLAAAIHTREQQ
AIAALPDELRGLPLDQVELKATNIVGVDALDSLFTSDARIPEGDDGTGLP
VVDAPLSALIDELAEGDHGLIMCMGKGGVGKTTIAAAIAVALADRGHPVH
LTTTDPAGHLSGTLHGTLPNLHVSSIDPVEATRAYRDHVLATKGAALDEQ
GRSMLEEDLRSPCTEEVAVFQAFSRVISESRNKFVVVDTAPTGHTLLLLD
ATGSYHREVARQLGNRHFTTPLMRLQDPELTKVIVVTLAETTPVLEAAGL
QSELERAQIQPWAWVVNNSLAAAHPTSPLLRQRAVAELPQIDKVRTDYAD
RVAVIPLLACEPVGIPALEALAGSRTAAV
120406042YP_955871.1 protein tyrosine phosphatase [Mycobacterium vanbaalenii PYR-1]MTGSTAPEAHPQLRRDLSIDQRLALKSAATQLEKEFDGIYGVETIELFLH
SSYDQFAGRASIVNFLPLLAERFARQRLRALAKVEGKSQDGKPTVLFLCT
HNAGRSQMAMGFFTALAGDAAVAWSGGSEPGDEVNPAAVEAMAERGIDIS
REYPKPWTEEIVRAADVIITMGCGDACPVFPGRRYEEWKLDDPAGQSVDD
VRPIRDEIERRVRTLLVELDVPAQG
120406041YP_955870.1 protein tyrosine phosphatase [Mycobacterium vanbaalenii PYR-1]MSIEITGTTEKRAAIFAALADPSRLAIVDHLLLADASPSELRAVLGIQSN
LLAHHLGVLKTAGLVRQTRSEADRRRTYLQLDHQALESLVPATGRKATRV
LFVCTQNSARSQLAAAIWNRRSELPAASAGTHPASGVHPGAVAAARRHKL
HLRPHTPRYLGDVLGPGDLVIAVCDNAHEELPVELPRLHWSVPDPVRTAQ
AEAFDAAVDDLTDRIEHLVPHLKSA
120406040YP_955869.1 phosphate ABC transporter periplasmic phosphate-binding protein [MycobMKANRTGAALSLLAAGTLLLSACGSDNNTASSGSGEGGTAAPAGDCGGKE
SLKASGSSAQANAMTRFINAYEKDCPGYTLNYTSSGSGAGVSEFLGGQTD
FGGSDSPLNAEKGEIEKAKERCGGSEAWNLPAVFGPIAITYNLEGVDGLV
LDGPTLGKIFNGTVKTWDAPEIAALNQGVTLPAQPINVIFRSDESGTTDN
FQKYLDAASDGAWGKGAGKSFAGGVGEGAKGNEGTSAAIKNTPGSITYNE
WSFAKAQNLSIAKIVTSAGPEPVELSTESAGKAIDGVKFKGEGNDLVLDT
TSFYKPSEPGAYPIVLAAYEIVCSQYPDAEVATAVKAFMHSALGNGQTGL
EENGYIPIPEAFKTRLTEAVDAINATS
120406039YP_955868.1 phosphate ABC transporter permease [Mycobacterium vanbaalenii PYR-1]MPTTPGKGSALRQGGGRWGDTVFKSIAIAAGATIIGAIALMALFLIIKAL
PSIQANQANFLFSTEFLTSDPDNLRFGIRDLFMVTVLSSVFALVIAVPIA
IGIAAFLTNYAPARLARPFAMLVDLLAAVPSIVFGLWGIFVLAPWLTPVA
TFLNDNLGWFFLFSEGNVSLAGGGTIFTAGIVLAVMILPIITSVTREVFA
LTPRGHVEAAQALGATKWEVIRMTVFPYGRSGMIAASMLGLGRALGETIA
ILIILRTAAQAGHWSLFDGGYTFASKIASAAAEFSAPLPTGAYIAAGFVL
FALTFIVNALARAAAGGRVSGG
120406038YP_955867.1 phosphate ABC transporter permease [Mycobacterium vanbaalenii PYR-1]MTATLDEAVKGPTFHPLSAARKFKNGLATTLFTASFVVAMIPLVWLIYTV
LAKGVAAIVSSTWWTNSLAGVLPEEFAGGVYHAIYGTLIQAAIAALLSVP
LGVMAAVYLVEYGQGRFAKVTTFMVDILAGVPSIVAALFIFALWIATLGF
EQSAFAVSLALVLLMLPVVVRNTEEMLKLVPDELREASYALGVPKWKTIA
RIVVPTALPGMISGILLALARVMGETAPVLVLVGYSRSINMDAFEGNMAS
LPLLIYTELVNPEAAGVLRVWGAALTLILIIAALYIGAAFINRYLMRNRV
120406037YP_955866.1 phosphate ABC transporter ATPase [Mycobacterium vanbaalenii PYR-1]MAKRLDLKDLNIYYGSFHAVADVGLSVMPRSVTAFIGPSGCGKSTVLRTL
NRMHEVLPGARVEGSVLLDGEDIYASGVDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRRNLDDIAEKSLKGANLWNEVKDRLDKPGGGLSGG
QQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLISELKQDYTIVI
VTHNMQQAARVSDQTAFFNLEATGKPGRLIEVDDTEKIFSNPSQKATEDY
ISGRFG
120406036YP_955865.1 phosphate uptake regulator PhoU [Mycobacterium vanbaalenii PYR-1]MRTAYHEQLEALSNRLGDMCGLAGVAMERATQALLQADLALAEQVITDHE
QIAALSARAEEEAFVLLALQAPVAGDLRAIVSSIQIVADVDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGHSAQEVLITQDPEKAARI
REEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLGRYYERFSDHAVEV
ARRVIFQVTGNTPTEQEVSEHY
120406035YP_955864.1 cell envelope-related transcriptional attenuator [Mycobacterium vanbaaMEDAAATHRRPHPGDEWLTRSARPKRGAAPWERTTDTPPSAQEPESVDES
APITVADLIAKIHGEAPPSEPTRHRAEPELDYEPEPERHGQPEPAPYGQP
EPGLYGQPELGRYGQPELGLGEEPEPYPDGDDLDTMVLPALDPSRADLPD
LTATRPPAHTLPKPRLRPSGRIAVVGRVAAALVAVLALVLTGGAWQWQSA
KNNLLNRVSALDPDSRDIVDPNAQFGDENFLIVGTDSRLGENAGIGAGTT
EDAAGARSDTVMLVNIPANRKRVVAVSFPRDLEIEPMKCEPWNPETREYG
PISDPESPMYGMDEAYTEYKLNSAFAVGGPKCLVKVIQKLSGLHVNRFMA
VDFVGFSKMVDALGGVEVCSTTPIEDYELGTVLATAGRQIVDGHTALNYV
RARQVTTETNGDYGRIKRQQLFLSSLLRSLISKETFFSLSKLNNVVNMFI
GDSYVDNVDTKDLVDLGQSVQGVNAGRITFVTVPTVGYADEWGNEIPRTE
DMQALFDAIINDDPLPEERNADNTPVPGTPESLTNPAPAQPDQGQSGGEI
VDAITTDPQSVTVQVSNSTGSTGLGSTTADALQAYGFNVTTPDDYPGPLP
RTTVFFSPGNEEAAATVASSFADATIERVAGMDDVVQVVLGSDFNAVTAP
SPSGSPVQVHVIRGTKTPATTLPEDLTVTNAADTSCD
120406034YP_955863.1 nifR3 family TIM-barrel protein [Mycobacterium vanbaalenii PYR-1]MRIGPIALHSPVVLAPMAGVTNVAFRTLCRELELSRAGTVSGLYVCEMVT
ARALVERHPVTMHMTTFAPEESPRSLQLYTVDPANTYAAAKMIVDENLAD
HIDMNFGCPVPKVTRRGGGAALPYKRRLFGQIIRAAVAATEGTDIPVTVK
FRIGIDDAHHTHLDAGRIAADEGAAAVALHARTAAQRYSGSADWEQIAAL
KAHVTNIPVLGNGDIFDARDALAMMAATGCDGVVIGRGCLGRPWLFAELS
AAFNGTAPATPPTLGEVAQIIRRHGELLAAHFGEDKGMRDIRKHVAWYMH
GFPAGADLRRSLALVKTISELDDLLDQLDPDVPFPAAANGPRGRQGSAAS
VTLPEGWLDDPDDCTVPAGADVMHSGG
120406033YP_955862.1 fatty acid desaturase- type 2 [Mycobacterium vanbaalenii PYR-1]MSKDLTDLQLLTELEPVVEPLINRHMRMTKDWNPHDYIPWSDGKNYYALG
GQDWDPEQAKLSEVARVAMMVNLLTEDNLPSYHREIAMNFTMDGPWGFWV
NRWTAEENRHGIALRDYLVVTRNVDPVELEMLRLEQMTRGFSPGQNEQIE
ADLFADSLFDSVIYVTFQELATRVSHRNTGKACEEPVADQLLQRVSADEN
LHMIFYRDVSEAGFEIAPDQAMKSLHKVLRNFKMPGYTIPDFRRRAVTIA
SGGVYDPRIHLEDIVMPVLKKWRIFEREDFNGESARLRDDLGLLVEELQE
AVDKFEVAKQRREERLRQMAEKKAAKNLLVGSSAS
120406032YP_955861.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPSGQRRGRWSGVPLQDRQALRRDELITAGISLLGSPGGPHLTVRAVCKA
AGLTERYFYESFTDRDEYVAAVYDNVCTAAMSTLMKSDSMRDAVERFVAL
MIDDPARGRVLLLAPEVEPVLARSGARWMPNFIDLLQRNLTQISDPTTQA
MVATGLIGALTALFTAYLDGRLGATRERFIDHCAELLLSRAVT
120406031YP_955860.1 hypothetical protein Mvan_5083 [Mycobacterium vanbaalenii PYR-1]MTQDTSEADPLTSGSAADSVPVAAGCPVTSGGYDSVPQPLGPDSLTWKYF
GQWTGLFQGPWAGSMQNMHPQLGAAVKDHSIFFMERMPRLLRSIYPIGGV
VFDGDRAPKTGAQVRDYHIGLTGVDDQGRRYSALNPDVFYWAHATFFKST
LLAAERFHGGLTEDQRRQLFDEHVTWYRMYGMSMRPVPKTWEDFQEYWDH
MCTNVLENNWATREVLDLSTMPKHPSLEWVPDWLWKQNLKVMQRFLLFMT
VGLYDPPIRELMGFTWSPRQEWLHRRVGNMLHLATRLLPDRVTMHPRKRS
AMDRAFGRLPADAPLVETPARNLPPVEYRDNPHYYSPKV
120406030YP_955859.1 protein kinase [Mycobacterium vanbaalenii PYR-1]MQAPELIGGRYELRGVLGRGGMAEVRDAWDKRLGRPVAVKLLYPSVSAHP
DTRRRFAIEARAAAALNHPHVVAVHDSGVHDGRHYIVLERLPGQSLADVL
AHHGPLPVDHVRAIMRDVLSALRAAHTSGVLHRDIKPANILFTHFGGVKI
ADFGVAKSADTPQTLTNRVFGTMAYLPADRIAGRPATPSDDLYALGVVAY
EALTARRAYPQENLTALADAIAAGHLAPVATLRPDVDPALATTIERSMAR
DPRWRFATADQMLACLDGPAQRPQRTGVVLAAAALLAVFVLAALLVVV
120406029YP_955858.1 hypothetical protein Mvan_5081 [Mycobacterium vanbaalenii PYR-1]MLLGVGRHSIAKKRRNPSVYVVSALAPAAVFLAVKADTSAIRVAVEEEPV
AAPAPAPVEEQFVPCCVEVVAAPASGPGPARLTDDGVADVEPASLVSASR
WRVVSRTLPAGVAPENGLQVRTILTARSISAVFPEINNIGGVRQDALRWH
PNGLALDVMIPNPTSQAGIALGNQIVAYVMANAERFGIQDAIWRGAYYTP
GGAKAGGYGHYDHVHVTTTGGGYPDGDEVYFR
120406028YP_955857.1 chorismate mutase [Mycobacterium vanbaalenii PYR-1]MAALLPLFAPAAAAQPQTTLVDLVDAATRRLQVAEPIAANKFHTGGLIED
PVREQQVLDAVSAEATALDLDPAYVTTAFRDQIDATVAIEYSRLAQWKFD
PATAPVDAPDLASSRGIIDALNREMVTLMADEWDKLHAPTCRAELDQAKA
TVAAQRGLDPLYRQAVDHATRNYCR
120406027YP_955856.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MNDFRQRLLDALEASIAEDGYARTTVADIVRRAKTSRRTFYEHFDSREAC
FVALLSDANADQIRQIYAAVDPSAPWQKQVRQAIEAWISSGEARSALMLS
WIRDVPALGAAARGLQREAMEHFVDMVGALGATDEFRAAGVGPFSRRRII
MLLGGLRELTASTVEEGGRMSDVTDEAVEASIALLSPPAR
120406026YP_955855.1 beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYMKVHHLNCGTIRPTGVGTMVCHVLLVESADGLVLVDTGFGTHDCEDPNRF
GRIRSRFIRPNFDRGETALNQIRQLGFRRSDVRHVVVTHFDADHIGGLAD
FPDALVHVTTTEAFGAMRSPSIQERIRFRPPQWAHGPRIVEHDIDGEAWR
GFAAAKELTQIGPGFVLVSLPGHTRGHACVAVDAGHRWLLHAGDSFYHPG
TLAGAPPVPKWTARLEMLVASDKQKVKQNHVRLAELYRRQDPDLMILCSH
DVTLYEQARATAQT
120406025YP_955854.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVRPAQTARSERTREALRQAAVVRFLAQGVEDTSAEQIAADAGVSLRTFY
RHFASKHDLLFADYDAGLHWFRSALAARSPEESIFESVQSAIMASPYEDW
AVTKIAAMRAKELDTGRIVRHIRQVEADFAEAVEQHMAAAGAAAPGTDER
MRTTVTARCIAAAVFGAMEVWMLGEDRSLPELDRLCRQALTLLRSGIEDP
VG
120406024YP_955853.1 FAD dependent oxidoreductase [Mycobacterium vanbaalenii PYR-1]MADFDAIVVGAGHNGLTAAALLQRAGLRTLCLDAKLYAGGMASTVELFDG
FRFEIAGSVQVPTSAVVSDALGLAELPTVDLDVMSVQLRGIGDDPLVYYT
DPMKLLTHLNEVHGAEAVNGMAGLMAWCQAPTRAVGRFDAAQRPKSLDEM
FACATNEFERQAISDMLFGSVTDVLDRYLPDREKHGALRGMLAFLAVNTT
YRGPATPGSAAALAFGLAVPDENATLIKKFRGGMGAVTEHLLQMFSAAGG
ELRLRSKVDEIIVEDGRVAGVRLEDGSTLAAPMVVSAVAPDLTVNTLVDG
GAVPPDVRERFSRIDHRGSYLQMHFALDGAPTFAEPYEMLNDPGYQSAIG
IFTTPEELQQQWEDSRRGVVPADPAIALQIPSANDPGLAPPGKHAVSAFA
LWFPLSEERASYGEMKAEMGQRVIDKITRLAPDFESLMLRHTTFTPKHMG
TMFGAPGGDYCHGLIHPEQMGPNRPGPKGYADQPIPVDGLYLASAGCHGG
PGITFIPGYNAAQQVLADRT
120406023YP_955852.1 hypothetical protein Mvan_5075 [Mycobacterium vanbaalenii PYR-1]MTKEKPKTTETDAGSEHADDDVVSDPSKGTEDRVDWSDEGGATESGPAT
120406022YP_955851.1 hypothetical protein Mvan_5074 [Mycobacterium vanbaalenii PYR-1]MSDAPDGMVDPTVPPSGTGCVECDADGGWWVHLRRCAACGHIGCCDDSLE
RHASAHWRATGHPVIRSFEPGEDWFWNFDTGAYYDGPELAAPQSRPADET
APGPRGRVPSDWMAQLQARRG
120406021YP_955850.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MATSVVYGRAMATKDSREVVIEATPEQILDVIADVEATPTWSPQYQKAEI
LDRYDNGRPKQVRMTVKAAGLTDEQVIEYTWGDNEVSWTLVSATQLKAQD
AGYTLTPAGDKTKVKFDIAIDLSVPLPGFIIKRTIKGGVETATEGLRKQV
LKVIKG
120406020YP_955849.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MAVRASSEVVIEAPPEAILDALADIEAVASWSSLHKDAEVVDRYPDGRPH
HVKATVKIMGLTDKEFLEYHWGDDWVVWDAERTSRQRCQHGEYNLTSVGE
QRTRVRFDLLLDLAAPYPGFLVKRAKKMVLDIALQNLRQRVLAGAE
120406019YP_955848.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MAIRASREVLIEAPRDAVMEALADVGALPSYSSMHKRAEVMDRYPDGRPH
HVRVKIRLLGLVDTEILEYRWGPDWLVWDAQPTSQQYAQHVEYRLSSDDH
GECTRVRIDITVEPVVPIPEFLIRRACGGVLDAATTGLRELALRDAGT
120406018YP_955847.1 aminotransferase [Mycobacterium vanbaalenii PYR-1]MTVRRLQPYAVTIFAEMSALAARVGAVNLGQGFPDEDGPPAMLKAAENAI
AEGVNQYPPGLGIAPLRQAIADQRRRRYGSEYDPDTEVLVTVGATEAIAA
AILGLVEPDSEVLLIEPFYDSYSPVIAMAGCHRRAVPMVRDGRGFAIDVE
GLRRAVTPKTRALILNSPHNPTGSVASDDELRAVAELAISADLLVITDEV
YEHLVFDGRRHRPLADYPGMAGRTITISSAGKMFNVTGWKIGWACGPSDL
IAGVRAAKQYLSYVGGAPFQPAVAHALATEDAWVDALCASFQSRRDRLGS
ALSDIGFEVHESFGTYFLCVDPRPLGFTDSAAFCAELPERVGVAAIPMSA
FCDPAAGHAEEWKHLVRFAFCKREDTLDEAIRRLRALPRSR
120406017YP_955846.1 NADH:flavin oxidoreductase [Mycobacterium vanbaalenii PYR-1]MAFTLGAGSALLKPIQVGGVTAENRIFMAPLTRSRADADGTPSSLAAQYY
AQRAEAGLIISEATAVCEQANGAYLNTPGLYTDRQQEAWAEIASAVHGAG
GKMFVQLWHVGRMAHPEISGFENVGPSPIAADLVTHTPSGKKPLPVPRAL
TAAEIAEIIGLFRAAARRAVDAGMDGVEIHSANGYLLHEFLSDVVNQRTD
AYGGSPQNRARFTAEVVEAVAAEIGPERVGLRISPGNNAGDMTEVDQISA
YELLLCRIASLNIAYLHVVSEPSAPAFAAIRTQWEGTLVLNTPRAVDTDF
AELENLATWGVISAAAVGRAFLANPDLVQRLTSGAELNEPDVATFYAPGP
AGYIDYPTLDELAEPQSA
120406016YP_955845.1 hypothetical protein Mvan_5068 [Mycobacterium vanbaalenii PYR-1]MATYRVLNPRGDVVDTKDIESADDAHAWFVDQKADNSELGWRMEVEHDGE
WSFFDDTEGSPD
120406015YP_955844.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MSEEAFIYEAIRTPRGKQRNGALNEIKPVNLVVGLIDEMRVRFPDLDENL
ISDLILGCVSPVGDQGGDIARTAGLVAGLPDTTGGFQLNRFCASGLEAVN
LGAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAWAGDPETNYRIGFVPQG
IGADLIATIEGFSREDVDAYAARSQERAAAAWAGGYFAKSVVPVKDQNGL
VVLDHDEHMRPGSTVESLGKLKTAFDGIGAMGGFDDVALQKYHFVEKINH
VHTGGNSSGIVDGAALLLIGSEAAGKSQGLTPRARIVATATSGADPVIML
TGPTPATQKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRGAKRALMTLCVGGGMGVATII
ERV
120406014YP_955843.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium vanbaalenii PYR-1]MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVEKLVAEKE
SITGVVIASAKKTFFAGGDLKGMMNVGPDNAAESFAEVEFIKADLRKLET
LGKPVVAAINGAALGGGLEIALACHHRIAADTKGVVIGLPEVTLGLLPGG
GGVARTVRMFGIQKAFMEILSQGTRFKPGKALEIGLVDRLVQSVDELIPA
AKAWIKANPEAHTQPWDQKGYKMPGGTPSSPGLASILPSFPALLKKQLKG
APMPAPRAILDAAVEGAQVDFDTATRIESRYFVTLVTGQTAKNMIQAFFL
DLQAINGGASRPDGIAKQEIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKD
VTLEAAQKGKAYSEKIEAKALERGRTTKEKSDALLARITPTADAADLKGV
DFVIEAVFENQELKHKVFQEIEDIVEPNALLGSNTSTLPITGLATGVKRQ
EDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTPIVVND
SRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGSQAGYPAAPLQLSDEL
NLELMQKIANETRKATEAAGGTYEPHPAELVVNKMIEIGRPSRLKGAGFY
SYIDGKRVGLWEGLAETFGAGSGHGPATMPLQDMIDRMLFAEALETQKCL
DEGVLTSTADANIGSIMGIGYPPYTGGSAQFIVGYQGELGVGKDAFVARA
KELAAKYGERFNPPASLTS
120406013YP_955842.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MNTSQIWQELDRQVTAGRIPGYVAAVRRTGIGEVHASGRLSFDAGAPAML
SDTPFRITSLGKPLGAALTLALIEDGVLGLDDEIRRWLPEFAEPAVLREV
TGPLSDTGPADRPITVSHLLAMTAGWGMLLQDCPLQSGIDEREIGSGPVP
PQMTGDEFVRRLAELPLAFQPGTGWLYDTPVKVLSVLLARAAGMPLGDLL
AQRLTQPLGMTDTGFWTDADRLPAPYRPAGDGVEDIELPDGAFVRPPLFE
DLSCGLVSTAPDLLRFFSAMADGGAPVLHPESVRLMTTDQLTVDQRMQGL
PILGPGVSWGLGVAVDVEAVSPWMAPGRWGWTGGSGTSAHVHPDGSVAVF
LSQRELADAQDGFDDFWAAVSVG
120406012YP_955841.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MPDNDTVTEGFTERFAAALDGYGERPCIEYDGRWYSGDEVMSYGAQIASV
LHSAGVTGDAPVGLIVRNRLQHAAAIAGFLAAGRTVAMIYSFQSPDAIAR
DIEQLNLAAVIADPEDWTEPVVTGAARVGSAGVAISLSAPTVAGVVGLER
CDTARRHAPSEPGVALKILTSGTTGPPKRQSIRFNVLERTVFSVTAGEKA
SGDAPPEFAYWQFGGIGVCQLIAGLYNGRRIAMLERFTVDGWVDAVRRHR
VTRCGVQPAVIRMLLDADVPKEDLASLEFLISASGPLDPETRDEFEQQYG
IPIRLAYGATEFAGSLCAWTPELLQQYGESKRNSVGRALPDTELRVVDPE
TGGERAVGEQGLLEAKVAPIGPDWIRTTDIASIDEDGFVTLHGRADGAIN
RGGFKVLPEAVRRVLITHPDVRDACVVGVPDARLGQVPFAAIEVSAGTAA
PSDGELRELVRQSLPVYNVPVAFAAVEELPRNPALKVSLPAVAALYSGHT
GD
120406011YP_955840.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMALTKDEREQFLAEPHIAALSVSAGDGRGPLTVPIWYQYTPGGDLWFTTG
AGSRKHQLIQSNGHVSLMVDRVEPTVRYVAVEGPVLRIEPGTDAQLVEMT
RRYLAPEKVDGYLEFARREHGESVAVFVKPARWLSADLGAV
120406010YP_955839.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRFGIFVPQGWRLDLVGIAPRDQWQVMRDLASYVDEGGVWDSLWVYDHFH
TVPVPTAEATHEAWSLMSAYAATTSRIKLGQMCTAMSYRNPVYLAKVAAT
ADIISGGRIQMGIGGGWYEHEWRAYGYGFPSAGVRLARLDEGVQIMRDAW
RDGTVTFDGKHYQADGAIVAPRPLQQAGIPLWIAGGGEKVTLRIAAKYAQ
YTNFTSEPEGFAHKSQVLAEHCRDVGTDFDKIVRSANINAVVGSSESDVK
DRLARVRSRISALTGEPAADAMLNSMSSPEAGSGTPEQLIDTLRRLRELG
CEYVICYFPEAAYDRSGIELFEREVIPALS
120406009YP_955838.1 hypothetical protein Mvan_5061 [Mycobacterium vanbaalenii PYR-1]MCASPARHRAARNGSSGSQRDFWSAKDLVEGVADGGPARHARKTPSKISI
HVGRVGALAVSLGVGLAVANSSGVAYADSDTESSVSSSGADATPAGSSTP
GGADESPEAQTGPDSGGDADDDEDGEDAEAGDTDEPGDVLDPDSDPESGA
DDEQAAEESGDNSAAPGDSGETSGTAPVVEPSVPPRESDALEEADESAVD
ADLDVEVSTPDGAHEDAAIPATEAVSLSGGSAVAPASPAEEESLESVSLF
AAVVSNVVAPLADPEAPAPAPWFGVPLKKWTRLA
120406008YP_955837.1 integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1]MSRFELIAAECADHDIATLTELLGVSRSGYYAWEARQRRTEPTARQQWRR
DLEVKILAHWKESKRTYGSPRITADLHAAGVSVSVNTVAAIMAEMGIEGI
SPRTFKVKTTVVDPAASFPPDRVGRIFDQGRLDAVWTSDITYLTCGEGDA
YLCAIRDEHSRRVLGWSVADHMRTELVEQAVDAAVFTRGGSVAGTILHSD
RGSQYTSHDLAKACSDHGLRRSMGATGICWDNAGSESLWSTVKHEYYKRH
AFTTYANLTAGLDNYLHYYNHDRRHSSLGMISPIDFEIAARINQQSS
120406007YP_955836.1 transposase IS3/IS911 family protein [Mycobacterium vanbaalenii PYR-1]MSRTRRSFTTEFKVEAARRVIDGGRPVSEVARELNLHESLLGKWVRQERV
RDGAASDARHGPPEGDLTARDNAELVRLRAELAEKDRDIAFLKKVSAYFA
AQQHR
120406006YP_955835.1 hypothetical protein Mvan_5058 [Mycobacterium vanbaalenii PYR-1]MDALLAWVRRQINHTFFNKTPVYGPISTEQILTGQLLIDLHASDPNGDPL
TYDIIQPEHGWVFRDLITGRFVYTPDELVAGDPLVDSFQVVIRDDSEHLS
GTLGSIQKLLHGVARLFGLAQADNVTVTVPVFVDPVIQLPPLITPIAGPG
YTLGGDPVKLVSSVLVADGDSDELSQVVIKIATLGQDGDLLEYVAPQGNP
ITATWDAQTMTLTLSGVATTAQYQQAIEAVTFSATDGALLVRGVTLSATD
EHGVDNIAPGFVAVGVWPAIKLPPLVTPLPGLGYTIGDDPVKLVSAVDIA
DGDSDYLSKLVLKIATLAQSGDVLSYVAPSDNPITATWDAGAKTLTLSGV
ATKAQYEEALMAVTFSATEGALLVRGVTMSATDADGVENIAPGLVTVGVW
PALALPPLVTPVPGLGYTLADDPVKLVSAVDIADGDSDYLSEAILKIATL
AQSGDVLGYVAPSGNPITATWDAGARTLTLSGVATKAQYEEALKAVTFSA
TQGALLVRGVTISVTDADGVENIAPGLVTVGVWLATQLPPLVTPVGAPTY
TLGSTPVKLVSAVDIADGDSDFLSEAVLRIALLAQSGDALGYVAPSGNPI
TATWDAGARTLTLSGVATKAQYEEALKAVTFSATQGVGIVRTITIDVTDD
TGVQSLTSGLVLAGARWSLPPLVTPVGAPTYTLGSTPVKLVSAVDIADGD
SDFLSEAVLRIALLAQSGDALGYVAPSGNPITATWDAGARTLTLSGVATK
AQYEEALKAVTFSATQGVGIVRTITIDVTDDTGVQSLTSGLVLAGARNPL
PPLVTPFGGRSYTIGNQPVKPVAAVDIVDADSDYLTSATVEVTLFGRSGD
VLQFNGLAGVPISGSYDAGSRTLTLTGTATKAQYEAALKAITFTATGGAW
TTRTLAIRVTDDAGVRSSAGLLTLSVW
120406005YP_955834.1 hypothetical protein Mvan_5057 [Mycobacterium vanbaalenii PYR-1]MCATPARHRAQRQGVVPEAGFWAAKDLLELTAQGRSGKHARKGTSKYTLH
IGRVGALAVSLGVGLAVANAGVAYADSDTDSSVSESQADDSAAPPSSPQV
DATDQTGVDNDEEPGTADDVDDEEVGEDLAPEEADPSASEDTDVDSDEEL
PGSSGGSGESPGGSDSTPDEQQAADPDVTAPDSEQVDSSPDETVVSTPED
DGAEEGPALDDAHPQGDVAVVDVVNTTTEPVERASATPSESVETVDIVTA
LVSTVVSPFASPDAPAQVPWFDALLAWVRRQITHTFFNKTPVYGPITVEQ
IFTGQLFIDLNATDPNGDPLTYEIVQPNHGVVVRDVITGNFIYTPTTIVT
GEPLQDTFQVVIRDDSEHLTGALGSFQKLLHGVARLFGLAQRDNITVTIP
VTIDPLVQLPPTVVTAGLPIFKLGDSPVKVLSSAIIADADSDQIFQATIR
ISTAGQDGDVLNYVAPDGSPITATWDVTTKTLTLSGLATAEQYEQALLAV
TFSTTKGGLPRGVSISVTDETGVQSLVPGAAIVTVIGLPPTVTVFGLPIF
KLGGSPVKVVSSVTLGDLDSENLSEASIVIATAYQDGDVLSYVAPSGNPI
TASWDAATRTLTLSGVATLDQYEEAIKAVTFSATEGGLSRGISFSVTDEA
GVQSLVPGAAIVNVIGLPPTVTVFGIPIFKLGGAPVNVVSSVTLGDLDSD
NLSEATIVIATAYQDGDVLSYTAPSGSPITASWDAATRTLTLSGVATLDQ
YEEAIKAVTFSATEGGLSRGISFSVTDDAGVQSLVPGAAVVSVIGLPPTV
TVFGVPIFKLGGAPVKVVSSVTLGDLDSENLSEASIVIATAYQDGDVLSY
VAPSGNPITASWDAATRTLTLSGVATLDQYEEAIKAVTFSATEGGLSRGI
SFSVTDEAGVQSLVPGAAIVNVIGLPPTVTVFGIPIFKLGGAPVNVVSSV
TLGDLDSDNLSEATIVIATAYQDGDVLSYVAPSGNPITASWDAATRTLTL
SGVASLDQYEEAIKAVTFSATEGGLSRGISFSVTDEAGVQSLVPGAAVVS
VIGLPPTVTVFGVPIFKLGGAPVKVVSSVTLGDLDSENLSEASIVIATAY
QDGDVLSYVAPSGNPITASWDAATRTLTLSGVATLDQYEEAIKAVTFSAT
EGGLSRGISFSVTDEAGVQSLVPGAAIVNVIGLPPTVTVFGIPIFKLGGA
PVKVVSSVTLGDLDSENLSEASIVIATAYQDGDVLSYTAPSGSPITASWD
AATRTLTLSGVASLDQYEEAIKAVTFSATEGGLSRGISFSVTDDAGVQSL
VPGAAVVSVIGLPPTVTVFGIPIFKLGGAPVKVVSSVTLGDLDSENLSEA
SIVIATAYQDGDVLSYVAPSGNPITASWDAATRTLTLSGVATLDQYEEAI
KAVTFSATEGGLSRGISFSVTDEAGVQSLVPGAAIVNVIGLPPTVTVFGI
PIFKLGGAPVKVVSSVTLGDLDSENLSEASIVIATAYQDGDVLSYTAPSG
SPITASWDAATRTLTLSGVASLDQYEEAIKAVTFSATEGGLSRGISFSVT
DDAGVQSLVPGAAVVSVIGLPPTVTVFGIPIFKLGGAPVKVVSSVTLGDL
DSENLSEATIVIATAYQDGDVLSYVAPSGNPITASWDAATRTLTLSGVAT
LDQYEEAIKAVTFSTTEGGIARGISVSVTDDAQVQSLVPGAAIVSVIGLP
PTVTVFGVPIFKLGGAPVKVVSSVTLGDLDSENLSEASIVIATAYQDGDV
LSYVAPSGNPITASWDAATRTLTLSGVASLDQYEEAIKAVTFSATEGGLS
RGISFSVTDEAGVQSLVPGAAVVSVIGLPPTVTVFGIPIFKLGGAPVKVV
SSVTLGDLDSENLSEATIVIATAYQDGDVLSYVAPSGNPITASWDAATRT
LTLSGVATLDQYEEAIKAVTFSATEGGLSRGISFSVTDDAGVQSLVPGAA
VVSVIGLPPTVTVFGVPIFKLGGAPVKVVSSVTLGDLDSENLSEATIVIA
TAYQDGDVLSYTAPSGNPITASWDAATRTLTLSGVATLDQYEEAIKAVTF
SATEGGIARGISVSVTDDAQVQSLVPGAAIVSVIGLPPTVTVFGVPIFKL
GGAPVKVVSSVTLGDLDSENLSEASIVIATAYQDGDVLSYTAPSGNPITA
SWDAATRTLTLSGVATLDQYEEAIKAVTFSTTEGGIARGISVSVTDDAQV
QSLVPGAAIVSVIGLPPTVTVFGVPIFKLGGAPVKVVSSVTLGDLDSENL
SEASIVIATAYQDGDVLSYVAPSGNPITASWDAATRTLTLSGVATLDQYE
EAIKAVTFSATEGGLSRGISFSVTDEAGVQSLVPGAAIVNVIGLPPTVTV
FGIPIFKLGGAPVNVVSSVTLGDLDSDNLSEATIVIATAYQDGDVLSYTA
PSGSPITASWDAATRTLTLSGVATLDQYEEAIKAVTFSATEGGIARGISV
SVTDDAQVQSLVPGAAIVSVIGLPPTVTVFGVPIFKLGGAPVKVVSSVTL
GDLDSENLSEASIVIATAYQDGDVLSYTAPSGNPITASWDAATRTLTLSG
VATLDQYEEAIKAVTFSTTEGGIARGISVSVTDDAQVQSLVPGAAIVTVI
GLPPTVTVFGTPIFKLGGAPVKVVSSVTLGDLDSENLSEATIVIATAYQD
GDVLSYTAPSGNPITASWDAATRTLTLSGVATLDQYEEAIKAVTFSTTEG
GLARGVSVSVIDDAGVQSLVPGAAIVNVIGLPPTVTVFGTPIFKLGGAPV
KVVSSVTLGDLDSENLTEATLVISSAYQTGDVLSYTAPSGNPITASWDAA
TRTLTLSGVATLDQYEEAIKAVTFSTTEGGIARGISVSVTDDAQVQSLVP
GAAIVNVIGLPPTVTVFGTPIFKLGGSPVKVVSSVSLGDLDSDNLSEATI
VVATAYQDGDVLSYTAPSGNPITASWNAATRTLTLSGVATLDQYEEAIKA
VTFTTNQGGLSRGIQIHVTDDSAVKSLVPGSAIVTVVGLPPSVATIGAPT
YTIGTAPVKLIASASIADADSDSMSKATVTIATLGQDGDVLGYIAPSGNP
ITASWNAATRTLTLAGVATKAQYEEALEAVTFSATGGALLVRGISITVTD
DTNVDSLLPGAATANVRYSLQPSVVTVGTPTHTIGTAPVTLLSSATITDA
DSDMFSSARVTIETLGQSGDVLGYVQPSGNPITATWDAGSKTLTLTGIGT
KAQYEEALEAVTFSATGGILFVRGISVSVSDDTGVSSSGLLNGLATATVR
ENSAPGLWITGGKSYDRNDPPMNPVVTLDISDDLGYLSGATLKVTSFVQS
NDTLGYVQPSGNPVTASWDSGSKTLTLSGTATVEQYEQALRAVTFWANQG
GWTTRTIAVTVTDNGGKSASGSMTVSVW
120406004YP_955833.1 type III restriction enzyme- res subunit [Mycobacterium vanbaalenii PYMTDGPLIVQSDKTVLLEVDHEQAGAARAAIAPFAELERAPEHVHTYRITP
LALWNARAAGHDAEQVVDALVTFSRYAVPQPLLVDIVDTMARYGRLQLVK
HPAHGLTLVSFDRAVLEEVLRNKKIAPMLGARLDDDTVIVHNSERGRVKQ
MLLKIGWPAEDLAGYVDGEAHPIELAQDGWQLRDYQQMAADSFWDGGSGV
VVLPCGAGKTLVGAAAMAKAGATTLILVTNTVAGRQWKRELVARTSLTEE
EIGEYSGERKEIRPVTIATYQVITRRTKGEYKHLELFDSRDWGLIIYDEV
HLLPAPVFRMTADLQSRRRLGLTATLIREDGREGDVFSLIGPKRYDAPWK
DIEAQGWIAPAECVEVRVTMTDNERMMYATAEPDERYKLCATAHTKIAVV
KSILERHPDEPTLVIGAYLDQLDELGTELNAPVIQGSTKNAEREALFDAF
RRGEIRTLVVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPK
ADGGGAVFYSVVSRDSLDAEYAAHRQRFLAEQGYGYVIKDADDLLGPAI
120406003YP_955832.1 hypothetical protein Mvan_5054 [Mycobacterium vanbaalenii PYR-1]MSVKSPGVPLGAWLAELDDARLIRLLRLRPDLTQPPPGSIAALAARAAAR
QSVKAATDDLDFLHLAVLDALLTLHAETTAVTLAELAGTFGERIDKTDMR
AALDELSARALVWGDGALRVVAEAASSLPWYPGQVSLESPTQTGAEVAAA
LETVDGPARDLLDKLLEGSPIGRTRDAIPGTPPDRPVQRLLAAGLLRRID
DDTVILPRLVGQVLRGESPGPVTLSAPDPTVTSTTAADVDAVAAGAAIDF
MREVEVLLETLSAAPVPELRSGGLGVREVKRLTKVTGIDERRLALILEVA
AAAGLIAPGMPEPDPLDGAGSHWAPTVAFDRFVESPTSAKWHLLVSSWLE
LPGRPSLVGSRGPDNKPYAALSDSLFSTAAPLDRRLLLEVLADLPPGCGA
DADSASEAMLWRRPRWSVRLQTGPIGDMLTEAHAVGAVGRGAVASPVRRM
LAGDGDDAVVAAMEKVLPAPIDHFLLQADLTVIVPGPLERALAEQLAAVA
TVESAGAAMVYRIDEASVRRALDTGKTAGEIHALFNRHSKTPVPQALTYL
IDDVARRHGQLRVGMASAFVRCEDPALLAQAVAAPATERVELRLLAPTVA
VSQAPIADVLAALRTAGFAPAAEDATGAVVDLRSRGARVPSPGRRRGYRH
GPTPTDQTLAAIVAVLRKVASTPSPGMRLDPAVAISELQHAALHQESVVI
GYVDPAGVATQRVVAPINVRGGQLTAYDPASGRVREFAIHRVTSVVSADS
G
120406002YP_955831.1 hypothetical protein Mvan_5053 [Mycobacterium vanbaalenii PYR-1]MADDKKNRYVDPGWPTTDPDDHAVSELATDRTGALSPFGDVTFPLPADEL
PFIQAVTVINR
120406001YP_955830.1 molybdenum cofactor biosynthesis protein MoaC [Mycobacterium vanbaalenMPDRLSHLDETGAAHMVDVTAKDATKRIAVASGTVHTRPDVVELITANGL
PKGDALATARVAGIMAAKRTSDLVPLCHPLAITGVDIDFTIGGDDDLGAV
AITATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDRAARIDDIRVVRK
EGGKTGTWVR
120406000YP_955829.1 molybdenum cofactor synthesis domain-containing protein [MycobacteriumMTRSGVVLIASTRASAGVYDDRCGPVLVDWLNDRGIDTPAPVVVADGEPV
DQALRAALSDHPDLILTSGGTGISPTDATPQITAALLDYEIPGLADAIRR
SGLPKVPTSVLSRGVCGVAGRTLIVNLPGSLGGVRDGLGVLADVLDHALD
QLQGKDHPR
120405999YP_955828.1 molybdopterin biosynthesis MoaE [Mycobacterium vanbaalenii PYR-1]MTAVLRAALTEQPIGTIEHEELVAHEAAGAVVTFAGVVRDHDGGRTVTRL
EYSAHPTAEQTLAEVAAEVAAESRGVRAIAVSHRVGTLHIGDAALVAAVA
ADHRGAAFETCARLVDRVKERLPVWKHQFFADGSDEWVNSA
120405998YP_955827.1 FHA domain-containing protein [Mycobacterium vanbaalenii PYR-1]MSGRHRKPAPSAVNVAKIAFTGAVIGGGGLALAGQAGAATDGEWDQVARC
ESGGNWAINTGNGYHGGLQFSPGTWSGHGGGEYAPAAYLATKEEQIAVAE
RVLASQGKGAWPSCGGPLSAATPRNVVAEPPAPVDPVGLNGLLPPPPVDP
FAPPPAPAPVDALAAPAPLPPAPEALPPAPAPAAPFDAMSAPAPLPPAPE
ALPPAPAPAAPFDAMSAPAPLPPAPEALPPAPVVDAANIAPLDAPLPPPA
PVDAPPAQSAIIAAANWDTAPVPGEHPQLWSLGVDAPLQPAPVLPPAPAP
APAPAAVAAPAPDPLAPLGAVEVPAPAYDIANQAISGELPVPSEVPHLAS
PDNLPPGTAMAPQGPRQSPNVTYLKEIWHAIQTQEISGADALLALTQRPL
TTPDTPGGTPPIAPGAPGAPVAPLAGPAPAPAPVPAPAPVLPPA
120405997YP_955826.1 hypothetical protein Mvan_5048 [Mycobacterium vanbaalenii PYR-1]MPAEVGVRVTVRYFAAARAAAGTESETVDLHAGATVAELVESLKARDAAL
SKVLARCSYLRDGVAVRDMRTELGTAATIDVLPPFAGG
120405996YP_955825.1 molybdenum cofactor biosynthesis protein A [Mycobacterium vanbaalenii MTVVALGVPSVHRPQSPAPEEGPLVDTFGRVATDLRVSLTDLCNLRCTYC
MPAEGLDWLPSDEKLNPDELIRLLGVAVTRLGITSVRFTGGEPLVVPHLE
DVVAATAALRPRPEITLTTNGVGLAKRAAGLKRAGLDRINVSLDTVDPAR
FAAITRRDRFTEVVAGLRAAKEAGLDPVKVNAVLDPVSGLDDVVSLLRFC
LEHGYQLRVIEQMPLDAGHSWERERALSADVILSALRRHFTLTPDPRPRG
SAPAQLWQVHDDGHVTGHIGIIASVSDAFCSTCDRSRLTADGQVRNCLFA
RDETDLRALLRSGADDAALEDAWRAAMWAKAAGHGINDPGFVQPDRPMSA
IGG
120405995YP_955824.1 hypothetical protein Mvan_5046 [Mycobacterium vanbaalenii PYR-1]MRLALNVIWLVFGGLWLALGYLLAAIICFVLIITIPFGFASLRIAAYALW
PFGRTIVEKPGPRPGALVGNVIWVIVAGVWLAIGHITTAVAMAVTIIGIP
LALANLKMIPVSLMPLGKEIVPVDEAGQRRIVGAVP
120405994YP_955823.1 cold-shock DNA-binding domain-containing protein [Mycobacterium vanbaaMPTGRVKWYDAEKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
AAGRRGPQALSLKLIDPPPSLTRTRREAAAVEHKHSPDELHGMVEDMITL
LESAVQPELRKGRYPDRKVARRVSEVVKAVARELDA
120405993YP_955822.1 hypothetical protein Mvan_5044 [Mycobacterium vanbaalenii PYR-1]MDPFLGTEALAAGSLTRYRLKTRFELVHRNVYALNREQLTPVQKARAAWL
WSGRRGTLVGLSAAAVLGSRWIDARLPAELNQRSQHKTPGIVLRADTLGP
DEIVTARGMPVTSPARTAFDLGRRRGLTLAVIRMDALMRTTGATTSDIAT
LLTRHKGARGLVQLRRALELVDPASESPQESRTRLLLVKAGLPPERSQID
VFDRDGYHVGRVDMGWETWKVGVEYEGEQHWTNPEQYAHDIDRQAALEAE
GWRIIRVSAEILRDRPTTIVSRVWLALRAAGAPVQPPNLNL
120405992YP_955821.1 putative glutathione S-transferase [Mycobacterium vanbaalenii PYR-1]MTYVADPSSSGGEFNRDTEYISTRITADGRDGYPVEPGRYRLIVARACPW
ANRTIIVRRLLGLEDVLSIGFCGPTHDERSWTFDLDPGGVDPVLGIHFLR
DAYNKRVRDYPKGVTVPAVVEVATGEVVTNDFAQITLDFSTEWTAYHRDG
APQLYPEPLRDEIDEVAQRVYTEVNNGVYRCGFAGSQRAYEKAYDRLFTA
LDWLSERLSRQRFLVGDTITEADVRLFTTLARFDPVYHGHFKTNRSKLSE
MPVLWAYARDLFQTPGFGDTIDFVQIKQHYYIVHSDINPTGIVPKGPELS
NWLTPHGREALGGRPFGDGTAPGPTRDTERVPEGHTAGDSQPG
120405991YP_955820.1 hypothetical protein Mvan_5042 [Mycobacterium vanbaalenii PYR-1]MSLTRGGRPAGSSRPFRPTLRWAQVGVAGTGMAFALLAAPAVATADTGAD
EGGADSSATTDAASTPSPRADSLSRHTAVGDSTGESDARSAEDEAERVLG
TLHPETSERAVSPPGPRTEHEALSDDPEPAVEPDPPEAGPALDTPSRDTA
PTPGKPESTHDPQDGDAETAADGARATSATSTPSARMTLRGPTAPGSSTA
PLSDTAQMANEAGSPMLSPDPQDESVTEPGGVEALPLGALHAAASSTSYP
AYPAPVDAPVTWRSIVSDALSWIGLGMATDQHIPDGPINDLLAGLWVGMR
RLHYTFFNSSPELDHGAATEDPDTGIITGDLEAHDADGDVITFVLTGAPT
HGTVSFAEDGRYTYIPDTAFAATGGTDTFTVTATDTGGANPWHTNLPRLL
WSALRPLLSALGFTAPVDSSSTTTVTVTVTPQACRTDGAGAECAAARAPK
ITLHNNSEHTIWVYNLPSSGDYSIGADFTPVSIAKGASAPVTLAVGTGSP
GSPQNRIYIVEGETGFTLPVSSSSGVDAFNPTAPSEGNSFLNYNFVEYYL
YPDGGGGYQYTIDTSYIDEWSLPIQYKFTLNGARWSGAVDGHTYGFDDYD
TVVNQLNAAGGPYKHLVWGGGTPWAPQPPSTVHRIIGPDKVWTAQASQPA
SNVNMNHVGWVPTSYQDFVQYDSHTEPDGHVVYPYAQNGTKYSRDGNFSF
WKNEVDAPASTPYPIALRTAAVLDGFPAKNGVYGFFTYPNDETAGQFTNI
PTSVSLDIYVHGSSDGVSDSVIEGGSWFYTSTTSPSGRGLANRRHVVTGS
SATDTFILDSVFTRSRTAPVVVAEAVQGDIVVIDRTALGATSYEVDVVDR
AWFLGGGLAKYDSQFVYDRSTGILYYDQDPDRFGYTGVLANLSCSSADAA
SVVFVL
120405990YP_955819.1 hypothetical protein Mvan_5041 [Mycobacterium vanbaalenii PYR-1]MKRVVAVLAAVALLSAVGTGVLVWQLMRDHSPELPEISAYSHGHLTRVGP
YRFCEVLNPTDCVVSADQGELPVTPSDPVQLSIPGEIARAPWVLLRAYED
ADLVEEFRPGTTLAVTIPTVDAQRGRLTGIAVQLPTLVRDESGNEFPVPH
AEWSVRTVWRAG
120405989YP_955818.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMTGSRRDHRDPDGQQGGRYYPPRPPAGEHPGMANYPSDPAMSPGNRRSGR
PGPSSQSANRWLPPLDDSSRPHGHSYPPPPGRGADEKVTVTRAAAQRSRE
MGSKMYGLVHRAATADGADKSGLTALTWPVVANFAVDAAMAVALANTLFF
AAASGESKSRVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALAASFSL
RTVLAVVLIANFDSATGSFPSWVLYPCALGMMVLSKSFSVLRSAVTPRVL
PPTIDLVRVNSRLTTFGLLGGTMIGGGIAAAAEWGFQLFQMPGALYVVVA
VTIGGAVLAMRIPKWVEVTAGEVPTTLSYHGQTEGLRREPHGAVSAKTRQ
PLGRNIITALWGNCTVKVMVGFLFLYPAFVAKAHDASGWEQLRILGMIGA
AAAVGNFAGNFTAARLKLGHPARLVVRCATAVTVMALATALSGNLLVAAA
ATLVTSGASAIAKASLDASLQDDLPEESRASAFGRSESLLQLAWVAGGAT
GVLIYTELYAGFTTITAILILGLAQTVLSYRGESLVPGFGGNRPVLAEQE
GVWTDAAVTRE
120405988YP_955817.1 hypothetical protein Mvan_5039 [Mycobacterium vanbaalenii PYR-1]MTEPDPQATEPGHETGHAPDEAAPEPTFDGPAPDLEALLLGAVEEARAAI
VEFSGDGTVGEYLGAGFEDPSSATHRFLAEMPGYRGWQWAVVVAACPGAA
HATISEVVLVPGPTALLAPKWVPWDERIRPGDLSPGDLLAPPAEDPRLVP
GYTATGDPQIDEVAVEVGLGRRQVLSLWGRNDTAQRWHDGDYGPGSAMAR
ATRRVCRDCGFYLPLGGALGVLFGVCANEYAADGHVVDAEYGCGAHSDTP
AAPGNGSPLFDPYDDGVLDLVEKAD
120405987YP_955816.1 activator of Hsp90 ATPase 1 family protein [Mycobacterium vanbaalenii MAAPVLQAEIDINAPVSKVWELVSDLRKMPQWSPQCRLMKPIGQLRPGAR
TINFNRRGFLFWPTSCRITEVIPEKKLAFQVAENHTVWSYELEPTEAGTR
LTETRHAENGTTAVSAFLVDKFMGGTTTFEQELIEGMNASLTRIKSAAES
120405986YP_955815.1 hypothetical protein Mvan_5037 [Mycobacterium vanbaalenii PYR-1]MDTDSDPQPPPLPASLLNPWPVIVVITCGWVIATVLAFTVAALHQWRPVT
VAGLAVGALGTTIFLWQRHAVRRGHRGAQSGLT
120405985YP_955814.1 tRNA/rRNA methyltransferase SpoU [Mycobacterium vanbaalenii PYR-1]MIANNVEVVDVTDPADPRLDDFRDLNSVDRRPDLPSGKGLVIAEGVLVVQ
RMLASRFVPRALLGTDRRLTELGTDLAGLDAPFYRASAEVMADVVGFHLN
RGVLASASRAPELTVPHVLDGARTVAVLEGVNDHENLGSVFRNAAGLGVD
GVIFGSGCADPLYRRAVRVSMGHALLVPFAKAANWPGDLELLRDQGFRLL
AMTPDPTVQTLAQAMSGLAEQRVAILVGAEGPGLKEHTMRASDVRVRIPM
SRGTDSLNVATAAALAFYERDRLGR
120405984YP_955813.1 hypothetical protein Mvan_5035 [Mycobacterium vanbaalenii PYR-1]MSDETPWATGLTVAAFVAAVIATAVVVLSIGLMRVHPLLAAGLNLVAVGG
LAPTVWGWRKVPVWRWFVLGAGVGVAGAWVALLVIAASGV
120405983YP_955812.1 hypothetical protein Mvan_5034 [Mycobacterium vanbaalenii PYR-1]MRELRVVGLDVDGRRIICETGDSGEKFVLRSDDRLKAAVRGDRAGSNQTT
IDVEVPTLLRPREIQSKIRAGASVEQVAASAGVDIARVERFAHPVLLERA
RAAELASAAHPVLADGPSVLTLLETVTSALIARGLDPDGANWDAWRNEDS
RWTVQLAWKAGLSDNVAHFRYAPGAHGGTVTAFDDAAAELIDPNFARPLR
PVAAVAQLALGEPEDPHAPVQAATPAPEPAPVETPEPAPTVKTPRPRKSR
PAVPAWEDVLLGVRSSGGQR
120405982YP_955811.1 phosphoserine aminotransferase [Mycobacterium vanbaalenii PYR-1]MAENLEIPADLKPADGRFGCGPSKVRPEQLKALAASGDLFGTSHRQAPVK
NLVGRVRDGLRQLFALPDGYEVILGNGGSTAFWDAAAFGLVDKRSLHLTY
GEFSAKFASAVAKNPFVGDPIIVKADAGSAPKPQSDPSVDVIAWAHNETS
TGVAVPVVRPDGSGDALIVIDATSAAGGLPVDITEADAYYFAPQKNFAGD
GGLWLAILSPAALARVDAIAAAGRWVPEFLSLPIAIENSLKNQTYNTPAI
ATLILLAEQIDWLLGNGGLDWATKRTAESSSRLYSWAEAASFATPFVADP
ALRSQVVGTVDFSDSVDAAAVAKVLRANGVVDTEPYRKLGRNQLRVGMFP
AVEPDDVSALTACVDWVVERL
120405981YP_955810.1 hypothetical protein Mvan_5032 [Mycobacterium vanbaalenii PYR-1]MAVKEARTRIIRRWRRNMEIGDGPEDRAYVEKLATLSEGSVRRNFNPYTD
IDWDSPEFAVTPDDERWILPDTDPFGGHPWYQSQPRQKQIEIGMWRQANV
AKVGLHFESILIRGLMNYAFWVPNGSPEYRYCLHESVEECNHTMMFQEMV
NRIGADVPGMPRLLKWLSQFIPLVAGPLPIPFFFGVLAGEEPIDHTQKNV
LREGRSLHPIMERVMAIHVAEEARHISFAHEYLRKRVPNLNRRQRFLLSL
NVPIIMRVLCQAIIVPPKSFWKEFDIPRSVKKEIFFGTPEARQFLRDMFG
DVRMLCHDTGLMNPFAKLMWRICKIDGPPSRYRSEPARQHVVSAA
120405980YP_955809.1 4Fe-4S ferredoxin [Mycobacterium vanbaalenii PYR-1]MPHVITQSCCSDGSCVYACPVNCIHPTPDEPGFATAEMLYIDPVACVDCG
ACVSACPVGAIAPETGLAPDQLPFVELNAAFYPKRDGKLPPTSKLAPVLE
APEVRRRPGGPLTVAIVGSGPAAMYAADELLTQQGVRVNVFEKLPTPYGL
VRAGVAPDHQHTKRVTKLFESISGLPGFTLYLNVEVGADLTHDELLAHHH
AVLYAVGAPDDRRLDIDGIGRPGTATATEVVAWYNGHPEFAHLPVDLSGD
RVVIIGNGNVALDVARILTAEPDVLARTDIADHALAVLRDSRVREVVIAA
RRGPAASSFTLPELIGLTSTCEVVLDPADHERVLTDLAAATDPLTRSKLE
IMSKLGDATAPVTRPRIRLAYRLTPRRVLGEERATGVQFDVTGTGETCEL
TAGLVLTSIGYRGKPIRGLPFDEAAAVVPNAGGRVVDPETGEPVRGSYVA
GWIKRGPTGFIGTNKSCAAETVHHLAADYNAGLLADPSHKASALDRFVRG
RQPAVIDACGWRAIDAAEVARGAGLRPRDKFTTVAEMENVAAAAAAPPMS
KRLLEALRR
120405979YP_955808.1 glycoside hydrolase family protein [Mycobacterium vanbaalenii PYR-1]MKSAQVVGRVGALAVALGVGAAVFTGSGVAWATEDAAGETTAESGATTSE
PADDGDAVEPADDGDTVEQVESDDDDEAVGQVEPEEEAEADEDEAVVEPD
EDEVAPDVEEAADADGAPSEDGDGGFQVPAAPREDDAPPTEPDEDTGSAA
AVASSETGSSEADGVEPAVDTVAVQRLTVEPTAAVSTTVASPPEVPSWRP
WPTAFDLRSAVTYVVDLATSFVDALLSPFAAGPPRPPADPSGWALLAWVR
REFFNGTPAPVENPLPHTQSLTADGGVVITGNVGVVDPDGDALTYSVIGR
PHNGGTVAVDADGNFVYRPMNAMAAVGGTDTFTVAVSDEHDGLHVHGLFG
WLQFVPILGNLLNPGGGHGRTVTIAVTVTPVDGIDLSLPDDFRWGVAHSG
FQAEGGPGSPVDTRSDWYRWVHDPVNRLLGLVKGVPEDGPGAYVSYDGDA
ALARDELGMNTFRMGIEWSRIFPESTAAVDISDEGGALSLADLEALDELA
DQDEVAHYRAVFAALRRRGLDPFVTVNHFTLPVWVHDPIVARPLIQLGLP
APAAGWLSSNTAEEFEKYAAYVAWKYGDQVDNWATLNEPFPPVLTEFLAI
PWVVPNWPPGVLRPDLASTFVVNQAIGHVAAYDAIHTWDTTAAAADGPAA
FVGFTHNMIPARPANPVNPLDVQAADAWNHFYNKWFPNAVIDGWVDANFD
GVKTADEIHPEMAGKVDFLGVQYYGSQPMVGFGVAPLPGFPFLRGFPIRC
SGEEPTCSDFNQPTDPGGFREVLELAGSYGKPLWVTENGIADADDSKRPS
YIVNHVAVVQDLVAHGADIRGYTYWSFVDNLEWSEGYELQFGLYGSDPET
PELERIPKPASIAALSGITTANGLPVSLLQTYIPS
120405978YP_955807.1 hypothetical protein Mvan_5029 [Mycobacterium vanbaalenii PYR-1]MLAASDIFAGPIVRRSSPPRIAVWLATTKPVELDGLVRKAGTAEWIGQTT
TVDRIKLFDGLFAYLVQIAPTAGHFPTGTLLEYSLGTVGKDGEADHSWFK
SVVAEDGLAYPGFELPTLYLQAAGAKLNVLYGSCRKPHDIDGGDNDALAY
GDSLVLNNVTTLAARPTILCLAGDQIYADDVHDATFDAINTVATKLEGST
PEKMPNGATVPGRGQRLKWTTDKAGFTSGEAANHLVTFAEYVAHYGLAWN
RRNWPTVSVAKEVVSYRDGLPAVRRLMANTPTYMMFDDHDVTDDWNFSIN
WAAQVKSSAVGTRIITNALAAYWIFQAWGNDPKVSARETPHMRDALAKRL
TDPVELETVVGTKSTLNEWEFQTPTIPVLYFLDTRTNRGYKDDFKRADGG
EPAFLKSAAAWLPTRDRLNKIVDVQQRSVPLVLVTAAPVFGFETIDSAQM
AVSGKIVPTSYFDLEGWAANRAHLFLFLTLCRDHDVVVLSGDVHYAFTST
ASFAVFDAAFVRGAAARVPGMTLPGVSGSTATNAHLYTSRFVQLNSSGTR
NSVGGWGKTKMMSGMANNQGESGYMFAGNPMSPEPARFKNGRLYTPITVM
GVTVWRERDLADVQPNFVYEQRINDPGNTRFINKHNLGYAQFLGRKVQNG
FLVDGKLDPSNSTSFDFGSGAAWTPAAP
120405977YP_955806.1 hypothetical protein Mvan_5028 [Mycobacterium vanbaalenii PYR-1]MKRVQDLTPYESVLPYASEIFGVYQPLIGWSSKRQLTRIKRGFDIDRAKM
VTGLLKKVTPALDVAIGEAGRGATIRSLGVGSIDTSRIRGTGTFLGDRIA
AELPPLEEYDDSVWDRLDTGRLNEILRAEVTQEVQNWQRAQPVSREGSDA
VTRAATQLARESAFAGLLTHLKLTSQFDVLKDLFYKPDRNLQKLLSVLKY
RDPLEYIDPKHDIERANLSPIGIVHLFRQYFFEFDTFLGPPVGHVWLSPG
SMVELVEVSTRRTLVERTIEQATESVVKTEKSTTEEDEISDAIKEENRND
TKFGMNSTVNQGWITGSATASASLNIDSTQSKAREQTHRRMRQQTEKLST
EIRRNFKSTFRTVTETTDTSSKRYVLNNTTDDLINYELRRKMRQVGVQVQ
DIGTYLCWQTFVDDPGRNLGIAKMVHIAKDPDLGAIPPPESIPQPGRHST
SVNVDIPFVPKTEDTEPDEDMDEAYRYGVEVNTDDNEGTPEKIQYEFGGF
RGFCELAGYEYSSIEFDYGGQDVRIEVYDVDADTPGEVKFKIRLKHINFH
NSPNVRVIAQINWTPSEALRAEIDGKNKDNVAAFNEATRREFEKAYLEAA
RDRINKAGEVRSRPFEELREEERIVVYRALIQDMLTRGIPMPDDRTRHVV
SELLNSIFDIDKMLYFVSPEWWRPRMHASHQALGKAPASAEGGAAGGGSV
SAGFATQASVFTEVSTAKSAGVLTGNAIKKLLAFRKEDTTIPASSTVSWG
GTGENRADNYYVTEDSEPAPLGASLGWLLQLDGDNMRNAFLNAPWVKAVI
PVRPGKERAAMNWLEQVHVEGTEGLDSFYSGPAAELAEIPSAGDRPTIRE
AIHYLCDKVAAKHAESQKVDKFPKEVTDDANKVAATPVDKVFEHGFYPLD
GGFRVTPTADENFEVFDQWVEVLPTDQVVPVPVTYDPKTGRQV
120405976YP_955805.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMAAKEEANQPKLVPHLVVDDAAAALDFYAKAFGAEEMVRMPGPGGKLIHA
CMQINDAMVFLNDDFPEFNDGKSSTPTALGGSSVTIHLHGPDVEGRFQRA
VDAGATVVNPLEDQFWGDRYGVLRDPFGHLWSLAETVREVDMNEVLAQMA
SGS
120405975YP_955804.1 hypothetical protein Mvan_5026 [Mycobacterium vanbaalenii PYR-1]MYAAATDFFTALVRQVPDDRWDDPGLGEWTVRDLIGHTSRSLTTVSTYLK
APAQREDVADAVDYYVRMHEYSASLGAAAIVERGRQAGRDLGDDPVAAIE
ALALRVQTELAAVEDPLIEVIGGLGIRLSSYLPTRTFELAVHGLDIGRAV
GVDFEPPVEVLTEATALAARIGVALGHGPTVLRALTGRGGLPPGFSVV
120405974YP_955803.1 citrate synthase 2 [Mycobacterium vanbaalenii PYR-1]MTAVSKDFVPGLAGVVAFETEIAEPDKDGGALRYRGVDIQDLVSHRVTFG
DVWGLLVDGRFGRGLPPAEPFPLPIHSGDVRVDVQAGLAMLAPIWGYPPI
LDIEDETARDQLARASVMALSYVAQSARGIYQPAVPQRTVDECDTVTARF
MTRWQGEPDPRHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALS
GAIGAMSGPLHGGAPARVIPMIEEAERTGDARSVVKGILDRNEKLMGFGH
RVYRAEDPRARVLRATAERLQAPRYEVAAALEQAALTELRERRPDRAIET
NVEFWAAVILDFAQVPPKMMPAMFTCGRTAGWCAHILEQKRLGKLVRPSA
IYVGPEPRSPEAVEGWDLLSH
120405973YP_955802.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium vanbaalenii PYR-1]MGTSDYLARMRVEYGSVEKDGSSDLDVDWLGPDPATGWVTLLHQWMAEAE
QAGAAEPNAMVVATVDDRGRPVTRTVLCKSVDASGVSFYTNYDSEKGRQL
AAAPYASATFPWYLVGRQVHVHGAVTKVSAEETADYWSKRPRGSQLGAWA
SQQSLPIASRAALMQQLTEVTERFADVEEIPVPPHWGGYLIAAEVVEFWQ
GRENRVHNRIRVCGGQVERLQP
120405972YP_955801.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MRERKKRRTRATLIDAAVGLCDRQGYDATTVDQIAHVAEVSPRTFSRYFA
TKDAIALALIDEVLVHTAVELVRQPRYLPHMEALRRAYVAMAEASKLAPP
GALSAQRLLQILRIIVSSPTLRQAAVGYRAGPVDAVVAERMGATVDDRRV
KLVAAVWGVVLMTALQDVCRSAVDFGVDDVIAAVEATYAEFAGEIAGVVQ
PV
120405971YP_955800.1 type II citrate synthase [Mycobacterium vanbaalenii PYR-1]MADNADAGQEHATLVYPGGELELDIVKASEGADGIALGSLLAKSGYTTFD
GGFVNTASTKSAITYIDGDAGILRYRGYPIEQLAEKSNFIEVSYLLIYGE
LPTADQLEDFTTKIQRHTLLHEDLKRFFDGFPRNAHPMPVLSSAVNALSA
YYQDSLDPFDPKQVELSTIRLLAKLPTIAAYAYKKSEGQPFLYPDNSLTL
VENFLRMTFGFPAEPYEVDPEIVRALDMLFILHADHEQNCSTSTVRLVGS
SQANLFTSISGGINALWGPLHGGANQAVLEMLSKIRAEGGDVKEFVRKVK
NREDGVKLMGFGHRVYKNYDPRARIVKEQADKILGKIGVQDDLLDIAKSL
EEIALTDDFFVERKLYPNVDYYTGVIYRAMGFPTRMFTVLFALGRLPGWI
AHWREMHGEPNKIGRPRQIYTGYTERDYAGFDSR
120405970YP_955799.1 EmrB/QacA family drug resistance transporter [Mycobacterium vanbaaleniMTPRRKAIILVSCCLSLLIVSMDATIVNVAIPSIRDDLSATPAQMQWVVD
VYTLVLASLLMLSGATGDRFGRRRVFQIGLAVFALGSLACSLAPTIDALI
GARLLQGIGGSMLNPVALSIISQIFTQPVERARALGIWGGVTGISMAAGP
IVGGLLIDTIGWRSVFWINLPICAAAILLTAIFVPESKSQTMRNVDPIGQ
GLAIMFLFGTVFTLIEGPVLGWTNPRVVVAAVVVALALVAFLRFESRRHD
PFLDLRFFRSIPFTTATVIAISAFAAWGAFLFLMSLYLQGERGFSAMHTG
LIYLPIAIGALLFSPLSGRLVGRYGARPSLVIAGVTITAAATMLTFLTAT
TPVWSLLMVFAVFGIGFSMVNAPVTNAAVSGMPLDRAGAASAVTSTSRQV
GVSIGVALCGSLAGSAMATGGADFAAAARPLWFVCMALGLVILGLGLFAT
SQRALRSAERLAPLVSGAPEPVGGAHVR
120405969YP_955798.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSGNPLADDVWRDLAALVLDHRDGWKRAVVEQSGLPFSRIRILKRLSKTP
MSVKQLAEAATIDAPAATVAVNDLEQRGLVVRTVDPSNRRCKTVSLTEAG
RDTLRAIDAVHDPAPDMLAALGDDDLAALRVILDKLDAG
120405968YP_955797.1 hypothetical protein Mvan_5019 [Mycobacterium vanbaalenii PYR-1]MSEGRVDTVIVGGGHNGLVAAAYLAKAGRSVRVLERLGHVGGAAVSLYPF
DGIDARLSRYSYLVSLLPRRIVDDLGARIRLARRRYSSYTPDPSDGGRSG
LLIGPESTFGAVGAAADEAGFGEFYRQCATVTSALWPTLTEPLRTRSEAH
RAVVGAGGRDAWQWMIERPLAEAITSAVGDDLVRGVMATDALIGTFARLD
EESLVQNRCFLYHLIGGGTGDWDVPIGGMGAVSEAMAAAATGFGAEIVTG
ADVYAIDPEGQVRYRCADDEHVVAARHILANVTPAVLARLLGEAEPELAP
GAQVKVNLMLTRLPRLRDESVTPEQAFGGTFHINETYRQLDAAYRQAAAG
SVPDPLPCEIYCHTLADPTILSDSLRAAGAHTLTVFGLHTPHSLADSATP
DRLRDTLTSAVLTSLNSVLAEPIQDVIMQDSSGRLCIEAKTTSDLDDALG
MTDGNIFHGALSWPFVEDDEPLATPAQRWGVATAHDRILLCGSGSRRGGA
VSGIGGHNAAMAVLER
120405967YP_955796.1 hypothetical protein Mvan_5018 [Mycobacterium vanbaalenii PYR-1]MLTATAVLCSALGSGAATGPTASAQPAQAPAEAIAACTQFARALDLASLT
YSGFADVIALGEVYPDYSDPLVSSANTSGRTGLRAAVSTALSASRTPGLA
PQLAAPMRSWALAATKLLLLMGLRADVDRFNAAAAQVNEDTENAQRACAE
AGTRA
120405966YP_955795.1 hypothetical protein Mvan_5017 [Mycobacterium vanbaalenii PYR-1]MRIWSLVLAAICVLAPVGAMPRAVAQPAPEPGSPPAVDGVPALPPSPAAV
PSSPPGYLATPDGWELTVAARDETQVAVAPLTTALTTREYLVGGTFTGTV
TGAGSTELSGGSLVVGYRIGCGIVGGPVELFATVGANPNIGPNAVLGAVE
FPVNGQAKVNLRPGTVTVVPVGEKSFKGSDVRVTVTGFRVKVDGCVGQSF
LQSYATLTGSTTDTSDIVTYAGQVKVV
120405965YP_955794.1 hypothetical protein Mvan_5016 [Mycobacterium vanbaalenii PYR-1]MSVIAARVLGLALLLCALGFAGQIPPAPAQPDTRVPPVADVPPPVAEVPP
PTGAVPPPAGAVPSGPAGTVLTPDGWELTVAARDEYQVAVAPLTTALSSR
EYLVAATFTGSVKGSGTSGLAGGTLEVGYQIGCGISLNVVKLNGSVGITP
SVTPTGLGNTRIPVTAQIEVFPQPGEVITVQLTQKEFEGTDPRVTVKDVH
VKIDGCIGQSFLRSYAILTSSTDTADDIVAYYGIAKAV
120405964YP_955793.1 hypothetical protein Mvan_5015 [Mycobacterium vanbaalenii PYR-1]MLRRVISAVAVVGVGLMAAANADAEPSPPPPPPVPPAANPLFPLAQNGSP
VTVGGLPALPDLSGHTGNEFVLGQHAVPSAPGSAPAAPPHLNPFNNQYLL
PQHLVPSAPGEGVLFGVEPGQENADISGIDYLKRLYESYRAGGLEGSLLG
RRPVEQVGKPLEPNP
120405963YP_955792.1 hypothetical protein Mvan_5014 [Mycobacterium vanbaalenii PYR-1]MTLRALRRSSVAAVSAACLVVTSVTPIAVAAQRNTSSAQPVLVVHSERLD
APAQPSRSALVSLASDESPLAHSVTPAPIEFANAVGAAAYLAFAVPSLLF
TIPLQLLTGQRSAIVTSLNNIITAVNTILALVGRSIPPIPTGTREAAQDT
RSDALVSDDGRNRPERSASEGPGPGASVGDPAESVDGTAGEIDEAEDSDN
DAADTTPVATDVEAPEQDDDEDRNVVPAEEEDADVDPDTASTPEDPSAVG
NDGNGDERQTDDNDGTSDASQTEHTDESP
120405962YP_955791.1 hypothetical protein Mvan_5013 [Mycobacterium vanbaalenii PYR-1]MARLPYFAALTLAGGLIASAVTAPTAFTQPPAPVAGSESPGDTIRELTNQ
GFDVQINWVAGQPSNIPLSQCTVTRIDTSAPPTAWVSINCPPDGSQ
120405961YP_955790.1 hypothetical protein Mvan_5012 [Mycobacterium vanbaalenii PYR-1]MATNNTGNTDQDILTQVHELVAEERELREKLQQREIDQSEEHTRLRSLEV
QLDQCWDLLRQRRALRASGGDPDDAQVRPEGEVEGYLG
120405960YP_955789.1 peptidylprolyl isomerase- FKBP-type [Mycobacterium vanbaalenii PYR-1]MATKPEIEFPDGPAPAGLVIEDIVVGDGPEAVPGANVEVHYVGVEYDTGE
EFDSSWNRGESIEFPLRGLIQGWQDGIPGMKVGGRRKLTIPPEQAYGPAG
GGHRLSGKTLIFVIDLLATR
120405959YP_955788.1 integral membrane sensor signal transduction histidine kinase [MycobacMIALSRIFRRTPSLRTRVAFATAIAAAIVVGIVGTVVWVGITNDRQERLD
RRLDEAAGFAIPLLPRSLDEIPKSPNGQDALITVRTGGQVTSNSNVVLPE
LEPGYADTYVDGVRYRVRTVALSTPEPMSVAVGATYDATIADTNNLHRRV
LIICTLAVGAATFGGWLLAAFAVRPFKRLAQQTRQIEAGGEAPDIDIRGA
TEAVEIADAIKGLVERVWEEQGRTKAALASARDFASVSAHELRTPLTAMR
TNVEVLATLDLSEEGRKEVVNDVIRTQSRIEATLGALERLAQGELSTEDD
HVPVDITELLDRAAHDAMRVYPDLEVSLVPAPTVIIVGLPAGLRLAVDNA
IANAVKHGGASRVQLSAVSSREGVEIAIDDDGVGVPEEERTVVFDRFSRG
STASHSGSGLGLALVAQQAELHGGTASLEASPLGGARLLLRLPGPR
120405958YP_955787.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMDSGAGSPKVLVVDDDPDVLASLERGLRLSGFDVYTAVDGAEALRSATET
RPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEA
GADDYLVKPFVLAELVARVKALLRRRGSTATFSSETITVGPLEVDIPGRR
ARVDGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVV
DVFIGYLRRKLEANGAPRLLHTVRGVGFVLRQQ
120405957YP_955786.1 Ion transport 2 domain-containing protein [Mycobacterium vanbaalenii PMVTAEPKLAVWERRTEWPLAAMAVVFLAAYTVDVLDQPAGVAAAAVRVSM
AVAWLMFAVDYVVRLNLAGNRWSWFYRHLFDLAIVVLPLLRPLRLLRLVT
LVAVLQRAVGHAIRGRVVMYTVSGAVLLVFVSSLAVLESERGQPGGQITN
FAEALWWSMETITTVGYGDLTPVTSTGRVIAVLLMIGGISLVGSITATLA
SWIVQRVADEDTAGRVVTTAHIDRLLEEIHQLRSEVQRLGDASPAGDGPH
G
120405956YP_955785.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MSLETVARQSLYRQTHARGGDLHSLADRRLLGRIWRFAARHHRRLAVFVG
VSVVGATLTVATPLLAGRVVDQITGAGSAGVVVMLAVVIAAVAVAEAAVS
LLTRWLSSTIGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLGNDV
MGAQRAFSDTLSGVVANLVTLTLTLAVMLSISWQITLAALVVLPLFLIPA
RRIGTAMARLSREAAAHNATMNTQMTERFSAPGATLVKLFGDTAAESREF
AVRAGRVRDIGVRTAMLQSTFMNSLTLMSALALALVYGLGGALALGGHLQ
AGQIVALALLLTRLYAPLTALANARVEIATALVSFERVFEVLDLVPLIRE
RPGAVEVPRGPDHRGVAVEFDDVRFSYPAADQVSLASLEEVAELDHRGGE
EVLHGISFTARPGQVVALVGPSGAGKSTIASLAARLYDVHSGAIRLNGTD
IRDVTFASLKDTVGMVTQDGHLFHESIRANLMLAAPEATDDELWAALRRA
RLDDVVAAMPDGLDTVVGERGYRLSGGQRQRLTIARVLLASPQVVILDEA
TASLDSESEAAVQQALAEALKGRTSIVIAHRLSTVRAADVILVVEDGRIV
ERGEHQELLARGGRYADLYRTQFGSNPRRNCIPAGPHSNFRCRNASSAGE
LTACVQWEDVLSG
120405955YP_955784.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MADTGFDSLRAAPSIGPPPKRVKPSSDLWRMMPYLLPYRGRWIVMIVVAL
ASLAATISIPLMTKAVIDGPVRHQDQQGLWLVGAAAVAVGVTEAVLWFIR
RWLVARATMGVEADIRKQLYARLQILPMSFHGQWQSGQLLSRIMNDLSTI
RRFMSFGLIFLMLNVLQITVVTAILLAMYWPLGVVVLVSIVPITLTVLHF
QQEYTRLSRLAQDQAGHVATHVEEAALGLRVIKSFGREDYVYERFDDQLT
DLYDTQVSRVSVSAKFWTLLEIIPNLTLIVVLGFGAYAAGHGYVTMGTLV
AFITMMLSLVWPIASLGFLLSMTQESFTAANRIAEIFDAPREITDGPRDQ
APRGGRLEVVDVGFRFPDSASGDWALRHVTVTVEPGETLALVGATGSGKS
VLAGLLSRLYDVTEGEIRIDAQDIRELSLDALRRTVATAFEDPTLFSMSV
AENLRLGRPEATDDDLRRAIDVAAAQFVYDLPFGLDTRIGEQGMSLSGGQ
RQRISLARAILADPRILVLDDTLSALDVHTEAVVEESLRRVLHDVTAIVV
AHRASTVLLADRVALLRNGTITHVGTHAELLANVPEYRYLLAADDELDDG
SERECDWEEQEERARLDRDEECARVDHEVLGRRA
120405954YP_955783.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MSADGEWRGKYDEHTDLPIDETVPRRREARSLLYLLLRPYRWVVLALAVV
VVVENAARLSVPLLVQKGIDDGIPPLLAGERATTLLTIVAALCGVVVVQA
CSRMYFLRRSGRIGQKVLLELRRRVFRHFGRLDIAFHDRYTSGRVVSRST
NDVEAIQDMLETGFDSLITAVLTLVGTAVLLVVLDVKLGLMCLAAFPILV
LLVMWFRRESSKTYREVREISALVIVQFVETMTGIKAVQAYRREPRNQQI
FEDIADRYRVINEKTFKLLAVFMPGVKLVGNLTTGVVLLYGGYRVLHGEM
TIGTLAAFLLYLRMFFEPMQEISQFFNTFQSAASALEKLAGVLAEKPGIS
DPPHPVALGEVRGEIALRDLTFEYVPGRPVLPGLDLVIPAGQTVALVGTT
GAGKTTIAKLITRFYDPVAGTVMLDEIDLRDVAQAELRRHVVMVTQENFM
FGGTVADNIRFGRPDATDDEVRAAARAVGAHTFIGALPDGYDTDVAKRGG
RLSAGQRQLVAFARAFLADPAVLILDEATSSLDIPSERMVQRALETVLAD
RTAVVIAHRLSTVQIADRVLVLEHGRIVEDGAPDELTARDHGHYAALHRS
WVQSLA
120405953YP_955782.1 hypothetical protein Mvan_5004 [Mycobacterium vanbaalenii PYR-1]MGYAQFVGRVGALAVALGVGAATVALPGAAWAEPSDAASSSSADNTKAED
TAEDSTAADDARPDDAVDDEVNSGEDHDEEAPQSEDGGDGSDEDGGQPEK
KTRGSYGSNRSEGELTGEDADEARADREDTDTEADVDVVAPEAEPTADEA
DDEADGGDPAEVAEPGVADDVAVEQPAEVSDDAPEPVESPISAPSSIVTA
LFAPKSWGDTAPADPVESPLLWTLLAFARRQFGQPRTEIGDSGTPTGTTE
LVDPGAAAVPEPGEVTKGDPGIFTGTVRGQVKATDPDGGWLTYSGSTSTE
KGTVTVTPWGTFRYTPSATARHAAAADGASTEAKTDTFTVTVKDAAGNAV
EVPVTVDILARNADPFGARARADNPSLTTGTAIIRVSAYDFDRDPLDITG
PLSTGKGELVDNGDGTFTYTPTAAAREAASDPDAPDDARIDTLTFTISDG
HGGIRTATVDVIVAAYAESSASTPGRAAGPVLVSSNGTIYQVTYDLDSTN
NPIRTRVSILDEDGQVLKTTDVIPGYPVEQALPVVRPDGSLLVTTYKASS
NTSTVSIVDGQGEVKTLGTVIGQPSAPMTVAPNGAVFFKTRQFASGSGDR
LVRVSATGGLRVYQLGVAADSPSVAPDGSVYIVSRSFGVTSVLAVGPGGN
SRRVSLPLGADTVNDVVIGQDGRGYLTVERNVFGTKTTRVYTFTGTSNTV
REIPGTPDGAKVITADGVYQYTYDESTGKSYISRITADTIETSDPIDGRV
INPISVTPDGTVYVAVRNSATGTDSVAIISTSGEVTTVDIPGTIFPVLPS
VSPAVTGDDANPNIGDNGYVAYQSGGVSYLAVVNPDGTIARTVTLPAGAV
VATPVDFGPDGAAYQVIETRDEQGRVTSRAVLALSTDTVTPMLPGAPLQP
NYPSIQFGPDGSGVLITVETGQSPFEYHFLRFDQDGATIATADLSGFLQS
AQQDYVFWQEGVVFGPDGTPYATLTGADQGVWALTSTGPVKVLELDLGQG
ELVEPVKFGPDGTPYVTVSERVDGSYVTTVHTFTPVTML
120405952YP_955781.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMTMTISTPADRETATADSDPELAARFEREALPLRDVLLRGARRLTTNEAD
AEDLLQDTLLAAYKGFRTFTPGTNIQAWLFRIMQNRWINNFRRKQRRVDE
VTMDGITEGALAAGTRRAPAAPHSVEAELFGGIADDDVTAALGALPEGYR
LVLYYAEVEGYTYAETAAILSIPPGTVMSRVYRARQRLRIALAHKAVGRG
AELDDEIAA
120405951YP_955780.1 regulatory protein LuxR [Mycobacterium vanbaalenii PYR-1]MDTRLDTRHPAGHRARPPLRGRGHECRELQNLIAAVRTGASRSLVLRGEA
GIGKTALLDHVVAQAEGFRTTYVAGVESDMELAFAGLHQLCAPLLTHLDE
LPDPQRDALTVAFGQGAGATPDRFLVGLAVLSLMAAASTGGPLLCVIDDA
QWLDQVSVQTLAFVARRLLAEPIAMVFAARDTGAEALSGLPELAVPGLSD
GEARDLLDSVVVGRLDDRVRDRIIAETRGNPLALLDLPHNHVGTELPGSA
ATPGSRPLARRLEQSYARRIKALPPQTQLLLLAAAAEPVGDAAVLIRAAA
QLGIAVDMLTPAEAAGVIELGTRVRFRHPLVRSAAYQAADLADRRTVHRA
LAEATDSATDPDRRAWHAANAATGPDDAVAAELEASAARAQARGGVAAAA
AFLERAAALTSDPALRGARALAAAQAKRDAAAPAEAQELLSTAELGRLSE
LQQAQAARLRAQMEFTRRRGGDTGARPLDETASQLLTAAASFEQLDGYVS
REAYLEALAAAMFAGRLGDPGAVPRIAAAASAALDRLPESARPVDALLRG
IVARITGGVSAGAAPLRLAMDLMQEQARNNDHRVARWMVPAFPIMQETAA
LELWDETVVHHLASVVVRRARDAGALEALPQVLAYRAGAHLLAGELSSAA
TLLEEAASITAATNNYTPVRYQTLTLAAWRGEPADAEAVIEAAIADANAR
GEGRVLGAADYAFAVLYNGLGRYQEACSAARRACEYEDLGVHSWVLAELV
EAADHCGDTALAVSALERLQERTADTGTDWGLGTLAGAQALVADDDHAEA
LFEESIDRLARTRVAVHLARAHLRYGEWLRRALRRNDAREQLTLASGMFT
RFGAAAFAERTRRELIATGEKARRQPVTSGAQLTAQESQIARLAGDGLTN
QEIGAQLFISTHTVDWHLRKVFVKLGITSRRQLRSASWAS
120405950YP_955779.1 NmrA family protein [Mycobacterium vanbaalenii PYR-1]MLIVVIGGTGLIGSKLIRQLSEHGHRAVAAAPSTGVDTVTGDGLADVLAG
ADVVVDVSNSPSFDDDAALEFFEKSTGNLLAAEAQAGVGHHVALSVVNTD
QLAEQSGYFRAKALQERLIRQSPVPYTIVHATQFYEFVKGIADAATDGDI
VRLAPVLIQPMAAADVAEAMAIAAVGKPHNRIVEVAGPQLYRLDELIRTA
LTAHGDPRTVVADAAARYWGAELGERSLVPDGDALLFDTRFEGWILETLT
TS
120405949YP_955778.1 RNA polymerase sigma factor [Mycobacterium vanbaalenii PYR-1]MLSGQCGTRRRRRDRQNRHGHGNDRGRRRMTGVDARKPTLVELLDERRYL
LDMVTGTPGWAAHAELVVRLTYRRWFALAPHDRARIGDPRNWLARVARRI
CSDVTGSAAPVGAQPPIVTDDGPAAEDAHDAVVHAFAAGCCAGDGAALHA
LLAESVTSVADTGGGLRLDPAPVRGAVRVNGFLCGLFASQPELAMTERWV
NGAVGLAVYRRAEVVAVLALDVRRRRVHHVWIVLNPDKLRGWNRLRVNV
120405948YP_955777.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMSPARNTESCLTVGVSEARTGDADGDLADAVAAFTAVRPRIFGVAYRMLG
SVAEAEDVLQEVWLRWQKCDRRAVRDPAAFLITATTRLSINERQSARARR
ETYIGPWLPDPVDTGADPTLGAERAEALEFATLMLMERLTPAERAAYVLR
EAFDYPYGLIAETIETSQANARQLVSRARRHLAEARRHDVDPAEQRQLLT
AFVAAAQNGDMATLESLFAEDIVSYTDGNGIRNAARHPVVGRETVARFVC
AFRRRVFADAVLTWVTVNSAPAVVISHGGGPFHDGGVFETFVALTPSERG
ITQLLWHRLEGKVSHLG
120405947YP_955776.1 epocide hydrolase domain-containing protein [Mycobacterium vanbaaleniiMAHIQPFRIAIPDADLADLTARLQRTRWPEAECVDDWSQGIPLSYTRELA
AYWADEYDWRAREASLNRFEQFTTEIDGLPIHFIHARSTRPDAFPLIITH
GWPGSVVEFHKVIEPLTDAGFHVVCPSLPGYGFSGKPRSTGWGVERIAAA
WDELMVRLGYRRYGAQGGDWGGAVTTQIGRNIGHCVAIHTNMPIGRAPKD
LSDPTPDEQAALERLGYYQRWDSGYSKQQSTRPQTLGYGLVDSPVGQLAW
IVEKFWSWTDCDGHPENALTRDELLDNVMLYWATGTGASSARLYWESFGS
FAGGGAVTLPTGVAAFPLEILRSPRHWCEPHYNITRWTTMPRGGHFAAFE
QPGPFVEEVGSFFADFR
120405946YP_955775.1 hypothetical protein Mvan_4997 [Mycobacterium vanbaalenii PYR-1]METPTLILIAATTLAACLCLGGAVYEALVVDPYWPRRPGIIQSRNGGVSR
VRFWLPAPLIFEVLLVVTLVVTWGDARVGAALLVALASHAAMRLWALFDL
IPRAAEFERTDPADVDERAAVRWTRKNLLRLPLLAVTSCAMLTALALA
120405945YP_955774.1 hypothetical protein Mvan_4996 [Mycobacterium vanbaalenii PYR-1]MPDSSAPDVAVTARAITMRGPWGPVYGPVDLDIAAGGVTVLVCPPGSGRT
ALLMTLAGRMRPASGSLSVFGRTRVHDIFAHAALAGIDELDTVAESVTVR
DLITEQLRWDADWYKLIRRAGEDDVARVCGPVFGDLPLPPLSEYVEELTE
LDGLLLRIALANTGRPPLLVVGNLEQVTSDPERDLLVSRLVELGREQTVV
TAGVNGVSDHPVVQIEVENTTRAELANQQKGGA
120405944YP_955773.1 ABC-2 type transporter [Mycobacterium vanbaalenii PYR-1]MALAGMSLGTDLKRYSRGLMPRIALITIILMPLLYGAMYLWAFWNPFAEV
NKVPVALVNEDRGASAQGQPLRAGDDVATALMQSGQLDLTEVSAQQAADG
VARGDYYFSITLPPDFSERVASPSGDDPQQAQIRFTFNDANNYLATIIGQ
NASREVLNQVNAKIGERTVGTVLTGLTDAGQGLEQAADGAQQLATGLDTA
DDGAQRLATGAGTLSSGLDSARAGSAQLAAGTRQLAGTVDTATGPLLEML
DRVAGLSLNPDEVAVAAQHLSGAVRSTTDRIAALNVNSAQAAAIVDQAVG
FLQANPDPAVRDAGHALAGAQRLLRAQNIDPTTDEGLIRLRDSASRLEGE
LGDPNSKLRVFLARALDGGLRSDVAKLRDGVDELNSGAQRLNAGLVQLAN
GGRELSSGASQLADGTEKLRAGGQELATKLRQGTAEVPSWTPQQRTEMAQ
TLVTPVGLDLVNTNPAATFGTGFAPFFMPLALFIGALIIWMLLTPLQSRP
IVNGLGALRVVLASYWPGLLVAVCQVVVMYAVVHFGVGLQAEYPLATVAF
LVLIAATFLAMIQAFNAVFGVAVGRVVTLAFLMLQLVSAGGIYPVETTAK
PFQIIHPFDPMTYAVNGLRQLTVGGVDSRLWIAIAVLAGLLVASLAASAW
SARRNRQYTMERLHPPIEV
120405943YP_955772.1 hypothetical protein Mvan_4994 [Mycobacterium vanbaalenii PYR-1]MGASSYVGRVGGLAVALGLGAVVFSGHGVASAAPDTESSAETSESVGSAS
TDDRGTVQPSTSSSAAGDHRSPDSSDDAQDASRAGSPDAETPETPQAKPA
ARSSSSRGRLEARASRLAEADPATATPGMSSPHQSIPSEVSSETAVASTA
EVVPTPVPMVTVDVADGAPPGPSEDEPQTPDTPGAVWTLLAGAHRESVVK
RQAVVLPGPVAVAEGPPSVQDDADSVSDTAVVDLPPMPVTEGSSFTVSTD
FMEGFVADYLARGGDPTDNARFFFGDLAVASLDALVNPNVQPEEARLLLG
NLTASGYFGGLWLRDSLRDNATGADTPAPADDSRDERPLDEAATATLAPA
AIAIRLFDALATFLNKAAAGKHPWVVRTVARIAVPVQLFLYGYNRGYLEF
VLENPPPGVPSRKDSLTWAGFLDCNSTAFPLELATRYDSALDRLDAPATL
RWGEMAVWTKFIEGAAGVGRSVWKVITGLTGGFSPTTYNALVDLSSAFLM
VTKAATLSSMLAYADRDVDLGRSSLRLQSGLWMWVGSYFAGLISAAPAGT
MPEIVAS
120405942YP_955771.1 carboxyl transferase [Mycobacterium vanbaalenii PYR-1]MSRIRALALRDALLDEGSFVSWDGPPLAVPTSAEYRRELAEAEAATGLDE
SVLTGEGRVFGRRVALIACEFDFLAGSIGVAAAERIIAAVQKATAERLPL
LASPSSGGTRMQEGTVAFLQMVKIAAAVELHKKAHLPYLVYLRHPTTGGV
FASWGSLGHVTAAEPGALIGFLGPRVYEHLYGEPFPAGIQTAENLHRHGV
VDAVIPPGILRATLDRALRVVSDAPDVPPAAPDAEPLPDVPAWESVEISR
RPDRPGVSALLRYGTTDRVLLSGTGQGEAATTLLALARFGGQPAVVLGQQ
RVVGGLVGPAALREARRGMALAAGLKLPLVLVIDTAGPALSTEAEEGGLA
GEIARCLAELVTLDTPTVSVLLGQGSGGPALAMVPADRVLAALHGWLAPL
PPEGASAIVFRDVDHAPELAAAQGIRSADLLRNGIVDAIVPEHPDAADEP
QAFTQRLSATIAVELHRLRTVPDEQRLAARLERYRRIGLP
120405941YP_955770.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MLMIGVTRDGNVMTLELQRPERRNALNAELVDGLREAIEKAAAEEVRAMV
LTGAGHVFSSGADLSGGQGVADELPDKARALNLAIDRAPFPVIGAVNGPA
IGAGVILSMICDLRVVAPEAYFQFPVAKYGIALDNWSIRRLTSLVGAGRA
RGMLLAAERLTADMALHTGMANRIGTLADAQAWAQEIAGFAPLALQHAKR
VLNDDGAYEEPWPAHQELFDRAWSSQDIIEAQVARIEKRPPRFQGA
120405940YP_955769.1 hypothetical protein Mvan_4991 [Mycobacterium vanbaalenii PYR-1]MEVRTALRFGFGTASLFAGGWVLRALQGTPAALGATPPEIAPVARRSPHY
QDGKFVNLEPPSGITMDRDLQRMLLRDLANFASQGTPPGPIPLADPPVVD
PTPAPAAASWYGHSSTLIEVDGYRVLADPVWSNRCSPSRAVGPQRMHDVP
VLIEALPAVDAVIISHDHYDHLDIDTIVALAHTQRAPFVVPLGIGAHLRK
WGIPESRIVELDWNEAHRIGDLTLICTPARHFSGRLFARDSTLWSSWVVT
GPTHKAFFGGDTGYTKSFAEIGAEHGPFDLTLLPIGAYHPAFADIHMNPE
EAVRAHLDLADVDNSLMVPIHWATFRLAPHPWAEPAERLLTAADAERVRV
AVPMPGQRVVPESTFDPWWRF
120405939YP_955768.1 beta-lactamase [Mycobacterium vanbaalenii PYR-1]MKPRARVAALALTAALLAGCGTEGAEPAASSTPAPSPASDVPPPLVPAMP
LPENAVADAVAKLDGLAEDLMSKSGIPGMAVAVVHGGKAVYAKGFGVRNN
TMSDEPHNEVDADTVFQLASLSKPLSATAVAALVGQNQVSWDTPIVSRLP
WFALSDPAVTQMVTVGDMFSHRSGLPDHAGDQLEDLGYDRRQVLERLRQL
PLDQFRTSYAYTNFGLTAGAEAVATGAGKSWEDLAADTLLRPLGMGATSY
RFSDYESRRDRAVGHIRIDGGYQPRFVRDAQAQSPAGGASSSVNDMTRWM
AMVLADGRHDGNQLIDPTALLPAITPQVTSSRGSEPAMRSGFYGYGFNVG
TTSAARTQLSHSGAFELGAATNVLFLPSADVAIVALTNATPTGIPETLTA
QFADLVQFGEIRQDWYALYAKAFEDMDKPVGSLVGQQRPANAQAHGPLAA
YTGVYRNDYWGPATVTERDGHLELALGPRGVFKLQPWDGNVFTFPVSSEN
APPGTVSAATFDAGSLTLEYFDDEGKGVFTR
120405938YP_955767.1 P-type HAD superfamily ATPase [Mycobacterium vanbaalenii PYR-1]MTVSVVTGLSEAEVAQRVAEGKTNDVPTRAARSVSEIVRGNVFTRINAIL
GVLLIIVLATGSVINGAFGLLIIANSAIGIIQELRAKQTLDKLAIVGQAK
PLVRRKSGTGSVSLPLAPSEVVLDDVIELGPGDQIVVDGVILEESNLEID
ESLLTGEADAIAKGIDDHVMSGSFVVAGSGAYRATKVGREAYAAKLAEEA
SKFTLVKSELRNGINKILQFITYLLVPAGALTIYTQLFTTDAGWRRAVLA
MVGALVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVNELPAIEGLARVDVV
CADKTGTLTENGMRVSEVKRIDARPTGEERSDRGMGTVADVLAQLAADDP
RPNASMAAIAEAYKMPPGWTATATAPFKSATKWSGTSYGDHGNWVIGAPD
VLLDPTSTAAEEAERIGAQGLRVLLLGSSDRSVDAPDAPGTVTPSALVVL
EQRIRPDARDTLDYFASQKVSVKVISGDNAVSVGAVAGSLGLGGETMDAR
RLPDQPDALADTLEQCTTFGRVRPDQKRAMVHALQSRGHTVAMTGDGVND
VLALKDADIGVAMGSGSSASRAVAQIVLLDNKFATLPYVVGEGRRVIGNI
ERVSNLFLTKTVYSVLLAVLVGLGGLSAKLFGSDPLLFPFQPIHVTIAAW
FTIGIPAFVLSLAPNNERAHPGFVRRVMTSALPSGIVVGAATFTSYLLAY
QGRAATEAEQTQASTAALITLLVAGVWVLSVVARPYEWWRVALVAVSGLA
YVVIFSIPLARELFILDPSNTALTSMALGIGLAAAVAIEVIWWVQGRVLG
EHRRLWRVRER
120405937YP_955766.1 hypothetical protein Mvan_4988 [Mycobacterium vanbaalenii PYR-1]MGFLDKAKDLLSKNADKVDTVIDKAGDLVDKKTQGKYASTVDKVQEAAKK
AVADNAGPVPPGQQSGHVPPPQPPPTTPPQQQPPTAPPTS
120405936YP_955765.1 hypothetical protein Mvan_4987 [Mycobacterium vanbaalenii PYR-1]MAKLSVSVDVPLPPEKAWESASDLSRYREWLSIHRVWRSKLPDVIEKGTQ
LDSIVEVKGMPNRISWTVVHYRPPEAMTLNGHGVGGVKVKLMGKIRPSEQ
EPTASTVTFDIHLGGPALFGPIGMVVAGALRGDIQESLDRFRTVFAPS
120405935YP_955764.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MRVVIAGGHGKIALITARLLSVRGDSVAGLIRNPDHADDLRVAGAEPVVV
DLENTTNGVVSTHLRGADAVIFAAGAGPGSGAARKETVDRDAAILLADAA
EAAGVPRYVMVSSMGADAAAPDDAGDDVFVAYLRAKGAADDVIRARTSLL
ATIVRPGLLTDDEPTGRVRIAEHTGRGSIPRADVAAVLVAVLDTPDTAGR
TFEVISGDAAVADAVAALT
120405934YP_955763.1 hypothetical protein Mvan_4985 [Mycobacterium vanbaalenii PYR-1]MKFRVDPDVLHSVAEQVAGLPLDGGELITRTVELLADAYPGLIDDGPGRW
VGSKAGGVLGKVRFLYFSPREYLVVFGSPTGTQGFSGRYKHVDIHKFLLA
GRIDSYDLESDDTTALPPLLPGGHTCLDRGHARGLTIHPGSWHLEYGRGA
VATTLPFAMVDTLLVSLEFESVRRSTVEFAKLVRRRRR
120405933YP_955762.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTAAATKPSVFDAGLPTLSYDVTDTPQQIYPQFRAAQRIAPIALGPIGPE
VLSYEMARTVLRDPRFVIPPGIHLSAHGITSGPLWDRVTRSILNMEGDEH
RRLRSLVSRAFTPRATARMHDAIHLVVNELLDAIQDTGRCEFVAEVARPY
PIPIICALLGAPREDWQLFSRWAEDIFKIVSFDCDLAEEEPVVLKAWAEF
DDYIDGMIADRRRHLSDDLLSDLIRIEDGGDRLDAAELRMLAFSVLVAGT
DTTRSQLAASVQVLCEHPDQWALLRADSDLAMRTVEETMRHSPSMCSTVR
SVTADVEVGEYTFPAGTFILVNTYAANRDHTVYDDPTRFDITREDPPPIL
TFGGGVHHCLGANLARLELAEALKILSHRFRYARRTGPVPWKPLLGLSGP
TSLPLEFGP
120405932YP_955761.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MSALPHVLYGDLPMAADRGAGWATLREFGPVAYGDGWYYLTRRDDVLAAL
RNPEVFSSRIAYDDMISPVPLVPLGFDPPEHTRYRRILHPFFSPQALGVL
LPSLQAQAADIVETIAQRDACEVMAELATPYPSQVFLTLFGLPLQDRERL
IAWKDAIIAFSLTNDPTSVDLTPAVELYGYLTEAVARQREKPREGILSHL
LHGDEQLTDNEAVGLSLVFVLAGLDTVTSTIGATMLELARRPELRAALLG
DPDGIAGFVEEMIRLEPAAPVVGRVTTREVTVAGVTLPKGAEVRLCLGAI
NRDGADEHSGDDFVLDGKLHKHWGFGGGPHRCLGSHLARMELRLVVTEWL
SRIPDFELAPGYVPEITWPSATCTLPTLPLILTRKTP
120405931YP_955760.1 hypothetical protein Mvan_4982 [Mycobacterium vanbaalenii PYR-1]MTADPKLHHVVFAVAPDRRAAAVQMFTDLGFAFNTAELAELGIHVHLDWD
RGIELISPIPGSEGSVAASVTEFLDRHGDGVYTVVIRVPDAAASETVAER
FGSATRFRQSFSGGDSYLDEIDLSVLGLPLTLLSTNVS
120405930YP_955759.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MSQRTYRVIQWMTGDVGRVGVRHFAENPVFDLVGVLVHSKDKVGRDAGEI
AGTGPIGVAATDDVDAVMALDADCVFYTPIIMDVDTVCRLLRTGKNVVTT
AGFFHPSRDFREAGEQIRAACGDGGASFHGGGIHPGYAGDLLPLTLARVM
SRIDSIHVYEVVDVVKDAPVDHIDWMGFGKDKDAFLAEPTILGLGLPFFA
QSMYMIADGLGLTIDEVTAADIEAATAVEAIPHAEGAIPKGTVAAQRHEW
TAWVDGRPLIVFHAIYVSAGPDLLDPPWDWGDTRYEIVIDGAPPTELTLK
GVRQPDGALSHPGYEWTAMAAINAIPAVCDAPPGWLNHLDLGLIRPRGLV
RP
120405929YP_955758.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MTYRVVQWTTGNVGRKSVHAVIANTGLELVGCYAWSPDKVGRDAGELCGV
GPIGITATDDVDALLALRPDCVVYNPMFADVDELIRILGAGVNVVTTSEF
INGHRLGADRDRIVDACLRGNATLFGSGINPGFIQLFAVVTAGISDRVDR
ISIVESFDTTIYNSPATEIPMGFGYPIDHPDLPAITEAGSGIFGEAVQLV
ADALGAELDDIRCETEYAQTTDTLHLPGDWTIGPGCVAGIDVRWIGSIDG
RDVIDIRGIWTKGQVLEPVWSTAFGYTVTVEGRPSIKSTLSFEPPPDFVA
ETLDDFVMLGLTITAMPAITAIPAVVAAPAGIATYTDLPLLLPRGVLAPR
120405928YP_955757.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTRTPERHAENWDLRHPDFNDNDFLYDVYAVMRAKSPFARTDNPFLSATP
AGAWVAVRYAECVQILQDWEHFSSNPTPEGAEQLAGDLVITLDPPRQQKF
RKVLNPYFSPARMKALRPEIGVETDRLIDDFIETGSGDLAAVAWRQPGIV
FFKYLLGMPVDDVPLCVELTDTALNGATEQDRMAAWGGLYQHLHDAVTAR
RGQPPRDDMIDVLLSAEIDGEKLAFADVVSNAMLLVQAGLETTASAMSFA
YHYLATNPAERDRLIDDPDLLTRAVEEFIRFAGSIHGIPRTVAREVELSG
CTFSPGESVIVNYAAANRDEQEFPDAHRCILDRRDNRHLGFGAGVHRCLG
SNLARLEFQVGLERVLTRMPDFALSPTSKAEFHGNSVTRGFRSVPVVFTP
GKRVTA
120405927YP_955756.1 hypothetical protein Mvan_4978 [Mycobacterium vanbaalenii PYR-1]MTTSVGNTEEKTEDLPPGTTPYYARMHKWIKRAVLVCLVALVIEGAFTLP
FMAVYYGYPTLSLTEICSELLKVRYSDDTLECQVPYPILGPPEGAEGKDT
AQDEWGIQPVPKYNRIGFRELVQIHQEREARVAREAAQQESP
120405926YP_955755.1 hypothetical protein Mvan_4977 [Mycobacterium vanbaalenii PYR-1]MNIPLLNRKPAPTVTASVPLTGSVNLEEHHDESRLAQRRADKWMIVGAAL
MGMWAPGLIGLPIFMRGVWLQRQALRAGLSVRPMIVTLIGYLVLIDGMLN
SLGWALDLVANHTLINRVLMVGWGAMFDAGYFWHYNEAWIGGAAAPGEKS
MVFGMILTVFAMRCAAAIGFLQMKRWGHQWMIITCWMGVLIWCLYVFNMT
MYADVRYAGVVFPVIGWWLYDIFYITPFLAIPYLHTVNREIFSD
120405925YP_955754.1 hypothetical protein Mvan_4976 [Mycobacterium vanbaalenii PYR-1]MVDQKEKNRKKALIILQVVVYGYLLAMFLIQLYMSFARGWWEL
120405924YP_955753.1 ATPase [Mycobacterium vanbaalenii PYR-1]MTEQTYLANGNEVRLFEQACRQRLPVMLTGPTGCGKTRLVEHMGLLLGRP
VVTISCHDDLTSSDLVGRFIVTGGDVVWTDGPLTRAVKAGAICYLDEVVE
ARHDSLAVLHSLTDHRRTLYLDRAGEVVRAPEEFMLVCSYNPAYRSSLKE
LKPSFRQRFVTLPMCYLPPDREAEVIVAEAGIGLPTAQRLVRCATAIRTA
DEAFHFEPPSTRVLVTAAHLIAAGASELEAAEACVLAPLSSDGGVSEGLR
EVAAASLADADSPNPNR
120405923YP_955752.1 MorD protein [Mycobacterium vanbaalenii PYR-1]MSELTDAHAMAVERSCALTAVALSGQRRTGAYLVSGRHRGFGMSSMLDVV
HVPYPVRTPDWTRRTLTCGIALQCSPSKDRITDYRLNELSARELSALHLV
EAGVALGWVAATWPGLVPEFRRVLPELAPADTDMDAEEMLNRAIALARTG
QPLTVDPLIGRLPRAYTLPQGLSDKLRRSFGRLPWTTNQKRVPQPHSVPA
GGDGGVRNPNLPPPSRPQDNDLDVTPEHRPGIPYPEWNAWTESFMSDHVA
VLERAHDGRSGEPGAVAVDVRKWFEKNTHRAMKNRLEDGSDLDVDQYVCH
YIDVTTGEAVEPRIFRELLPASRDVSTAVLLDGSSSLGVHGGTAFKLELA
CADALSRAMTAARERHGIFVFTGNTRHRVEVTCLKDFADRRFVPPGGLGL
ATGGYTRLGAPLRHMTSRLLAQPSERRLLIVIGDGLISDEGYEGRYAWAD
AAHAVEEARDAGVSMYYVGIGPVRVDPLPEVFGPNRSQRIRRVEDLPRVL
AHVHKELVAA
120405922YP_955751.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MMAPQVRQTARELRRLQTRERILGAAIAEFQASGMAGADIGAIVSAAGVA
HGTFFFHFPSKEHVLLELERREESRMATEFARYLDKKHDLASALAKVVEL
ISALERRFGPLLFKELLALHFSPTRPSTDEWSDHPVIVSLVGAIERARGD
GEIHPEVDAFYSAAFFLLGIYGVLTTVARGDIRDAMLANLITTARRGLET
R
120405921YP_955750.1 hypothetical protein Mvan_4972 [Mycobacterium vanbaalenii PYR-1]MDRPMPSTGRRGTASQASAGGLDEHMEASQRAQRQADKWLISGSLLIGTA
ALGIFGLPLFLRGVWLLRKAQREGLSVRPMLVTLIGYLVIIDAAINTVGW
ALDLVANHTILARILLNGWGAMFDAGYFWHYNELWLGGAAGPGEKAMEVG
MILTVFTMRIAAAIGFLQMKRWGHQWMIITCWMGILIWCLYVFNMTMYAD
VRYAGVVLPVVGWWLYDIFYITPFLAIPYLHSVNREIFSD
120405920YP_955749.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMALEQFNLDGQVAVVTGAGKGVGQGIARVLAEAGATVVGTARTESDIVAT
IAAIERAGGKGLALVADAMSRADGERVVATAVERFGRIDILVNNVGGSTY
ARFLDITDDDFRHTFDWCVTSAFIMSQLAAPHMLEAGRGSIINISSGSAR
FGIRALTAYCVAKGGLEALTRAMAQELAPKIRVNAIALGSFATEGLQGSL
DLLPGSLEKMKEATPLHRLGDVEDLGRLCVYLATRDCYATNSIFHVDGGI
DSNNSPLPIPDY
120405919YP_955748.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MRRVVQFSTGNVGRHSLAALIGRPDLELVGVHAASADKIGRDAAELCGLS
DPTGVLATDDLDALIALKPDCVVYTALGETRPMEAIEQMSRLLAAGINVV
GTSMVWLVTPRHADGWLREPLEQACATGNSSLYVNGIDPGYSGDTAVHAA
LSLVTRASSVTVQEIFDYGNYDDYEYTGTAMGFGNSPQDELPMAFQPGVV
ASLFGGLVRSLAAHLDVELDEVRERCEPWYTDQRIECTMTTVEPGRMAAV
RFAAEGMRGGEPVITVEHINRLTSAAAPQWEFPPEGHLGVHKVIVEGEPR
VEVSTHLSHPVLDVTDAGCVSTAARAVNAIDWVCRAPAGLVALENIPPTE
MIRGLMW
120405918YP_955747.1 hypothetical protein Mvan_4969 [Mycobacterium vanbaalenii PYR-1]MDRPYDVWKLSESWRIRFAYFETYGPVPWTLEARQGYRALSFWDRVRLSS
NVSAFLFGPMYFFAKGMWRKGLTLLGVVGAVVAAVLLADVGGVIERMAAL
TVPVVAATTANYAYYLHVAEGSRSWNPLEGVFGRR
120405917YP_955746.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MNLFALLDQTAARHGDRGAVYHGERLVHTWSSLRERALRLASSLREFGPG
ARIAVASENRPEIVELMFAIWAAECVFVPLNYKLHVREMEQILSDAGAAR
VFTSPKIGAELAPVASTGIEIIGAAEYESRCAAMPSPAPRDTDPASPAWL
FYTSGTTGRSKGAMLSHRNLMAMTVSHLADFDCPDENSSLIHGAPMSHGS
GLYVPPYVSRGARQVVPASGTFDPDEFLDLCESHPGCSAFLAPTMVARLV
QTGRACPANLRTIVYGGGPMYVDSLKKAMAAFGPVFVQLYGQGEAPMTIT
GLRRRDHLDAPDAVLGSVGYARSGVDVAVLGPDGAPVAVGEIGEIVCRGD
VVMSGYWQNPEATEAALQHGWLRTGDMGSFDAHGFLTLRDRSKDVVISGG
SNIYPREVEEVLLEHPGVVEAGVVGAPDEEWGEVVVAFIVGAASAADLDA
HLLERIARFKRPKRYEFVDELPKNSYGKVLKRELRARLG
120405916YP_955745.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMQVAIVTGASSGIGFGCATTLAEQGMAVLGTGRDPGRLAALEKSSDRIAT
LAVDLTDDDAPQRIVSAALERWGRIDFLVNNAGIGSPKPLHETDDETLDR
FLDIMLRAPFRLARDVIVHMQPGSAIINITSTFAVVGGLRGGAYSAAKGG
LTALTTHIACQYGAQGIRCNAVAPGVTLTPMVASRLEDERFRKINTEMTP
HQRLGRVEDVASTVAFLCSEGGSFINGQTIVVDGGWSTTKYLSDFALNAH
WVER
120405915YP_955744.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MTTLADALRDAARDTPDRILLRDDEASLSSAELLSAATNLAHALVRRMPV
GSVVSFAVPNWHEAAVIYLGATLAGMVVNPILPSLRERELSFILADAGSR
AIFIPQTFGGHDYAAMLDRVVAGLPSPPEVVVVRGEPRRPALTDLVSEPR
DGTLPDLDPAATRMILYTSGTTGRPKGVLHSHKSLGALIAQLGRYWRIDP
GDTFLVPSPIAHIGGSIYAFECPLLLGTQAVLMQRWDPDAAVALMLRHRC
THMAGATPFLDGLLAAAERAGTRLPDLKVFICGGASVPPSLIRRAADYFD
KAAVSRVYGSTEVPVTTVGSLDDVDRAADTDGRPGIADVTLVDGEIRARG
PQMLTGYLHPEDNSESFDAEGFFRTGDLGHLTDDGYLVVTGRAKDLIIRN
GENISPKEVEDILVTHPQIAEIAIVGIPDLRTGERACAVIVAADSAAPDV
AEIRDFLVARGVAKFKAPERVVVVDALPKNDAGKVLKHAIRAVLLEKPRE
GEP
120405914YP_955743.1 regulatory protein GntR [Mycobacterium vanbaalenii PYR-1]MTATAGDHRYLQVARALRKEIVDGIYPVGSQLPTEHELCERFAVSRYTIR
EALRRLRDDNLVESRPRAGTLVVPRPSTNSYAQDVVSIDDLLAFAQGAQF
SIETNGMVTVDDALAERTGLAPGSEWFAVSGYRRADDDTAPICRTEYFIN
RSFAAVGRLLQRHTGPIFPLIEDLFGVSIVEVHQEISAVVLDADLAAHLQ
AEVGAAALQMQRTYTTSDGEIAQVTVNTHPSSRFRHSMTMRRVRDTA
120405913YP_955742.1 SMP-30/gluconolaconase/LRE domain-containing protein [Mycobacterium vaMTARYAAPDPSAADGWQLRRLTAPSRLFGANGLRTGPDGRVYVAQVTGSQ
ISALDLASGELETVSARGGDIIAPDDVAFGDDGTLFATEVMDGRVSARDT
AGRTRVLRDDLPCANGITVHRGRLFVGECRDGGRLMELPLDGGAPRILLE
NLPSPNAMEVGPDGLLYYPLMTANEIWRVDPDGGEPQRVAADLGVPDAVK
FDPDGFIVSTQVASGQVLRIDPRSGEKTGLAQLNPGLDNLTFVGDRLFAS
NFTGEITEILAGGQTSTLLPGGLNWPLDLTVADGRLYVADGTYFYEVGPD
GVLQTVGMLFSPGYPGFLRGVTAVGAAEFVVTTSGGQVARYRPADGETDF
LATDFDQLYGVDVDGDGTIVFAELGTGRLLALRSGAVETLASGLREPVGV
AIDADGAPLVAESGAGRVVRVGPGGVDTVVDGLQRPQGLHVRGERLYIVD
AGAGELVEFDLATEPSRARTTIAAGLPVGPPPGVEPKPLKGMPPFSGPQG
PFAGVTSGPDGTLYVSADGDGSVLAVARI
120405912YP_955741.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMSGTGISIRLDRRIVVVSGAGGGGIGTTVTRLAAEAGATVVAVSRSKDNL
DEHVVPLARKGLSVVPVAADASTDDGIATVLDHVRRTDGDLYGLVNIAGG
AAPATWMPSTRVTREDWRALFAANLETSFFMSQAVGSELRTRGLRGSIVS
VSSISGMNTAPFHIAYGTAKAAIVAMTRTMAVELALDDIRVNAVAPGVTE
TAASRTYVDEDPERDRTAIAMGRRGTPEEQAGAILFLLSDLSSYITGQTL
LVDGGLNLKWSHLAADNTSLFLKDESFRESIRRI
120405911YP_955740.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMTDLDNQPEIDAAEELSESMTIPVEAYISEEYARAERDRLWRKVWQQVGR
VEEIPEVGSYLTYDILDDSIIVVRTGADTFAAHHNVCMHRGRRLVDTPEG
CKNAVGRARKSFVCGFHGWTYGLDGTCTHIREQDDWKGKLTPRNTHLAPV
RVDTWGGWLFVNMDPDCEPLADYLFPAAKILDPFGLENMRYKWRKWLYFD
CNWKVALEAFNETYHVFTTHPEFNRFGEFKGWAKAQGKHSNIGYDAPKGM
DETKSKIRLGTGDPRISTAEMQVYTMEETNATTTETLVNAAKRLVDELPE
GTPADQVLQHWLASARRDDEARGVIWPTIPPDILGQSGTAWQIFPNFQIG
QGLTSALCYSARPDPSYDPNKCIFEVAVFELYPKGGEPETEWVYTPKDSP
NWLSVLPQDFSNMAAVQQGMKSAGFPGTLPNPYRERSTVNLHHQLSKYMG
TGEPREL
120405910YP_955739.1 FAD dependent oxidoreductase [Mycobacterium vanbaalenii PYR-1]METPCGPTDTPTDIDIPALREKYAQERAKRLRPEGGSQYLELEGDFAEFY
EVDPYTTVTERDPIAEDVDVVILGGGFAGLLAGAYLKKAGVEGIRVIEMA
GDFGGVWYWNRFPGIQCDNDAYCYIPMLEELGFIPSKKFADGAEILQHCR
NIGKHFGLYDGALFSTQVRELQWDDDLRRWRISTDRGDDIRARFVVMAQG
SYNRPKLPGIPGIKDFAGHVFHSARWDYDYTGGDADGGLHKLADKRVALV
GTGATGVQLVPHLGRDAKQLFVFQRTPSSVDERVNTPTDPAWAASLRPGW
QEERKRNFHNWSPFVGVVFGEPDLVCDFWTELGRNLTARIAASPDPAAVT
IEQIMAFREEEDYKIMERLRRRVAAVVEDPATAEALKPYYRFMCKRPCSS
EQYLATFNRPNVTLVDVSESKGVERLTEKGIVANGVEYEVDCVIFASGFE
ISTEISRRYAIDRIVGRDGLSLFEHWRDDYKTLHGMTSRGFPNQFFMGFI
QGGVSANTTAMFEQQAEHIAYIIAEAQNRGATTVEPSQEGQDNWVSTVRE
LAIDNSAFELSCTPGYYNNEGRGGKEGNGAFLGDFYSPGFYAFDELIAEW
RARGALEGLELRG
120405909YP_955738.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMADLRFDGRVAVVTGAGRGLGRAYALMLAADGAKVVVNDSGGALDGEGAD
TGPAQAVVDEIASAGGEAVANTDSVATPEGGRAIIADAQQRFGGVDILIH
NAGIVRRAPLAEMTYDDFEAVLDVHLRGAFHVVRPAFPSMCDAGYGRIVL
TSSIGGLYGNHEVANYAVAKAGVIGLSHVAAMEGAAHDVKSNVIVPAAVT
RMAAGIDTSAYPPMGPELVAPVVGYLAHETCAVTGEMFVALAGRVATAAV
TETRGVYRPSWTIADVAENLDAIRDRSESLTFPVVPNGHGDHIRYSFAMA
SRAAAMSACAKSRSR
120405908YP_955737.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMAENGPLAGIRVVDLTAMVMGPYCTQIMADMGAEVIKVEPPEGDNTRFIS
VGPVPGMSGVFVNVNRGKRSVVLDLRSDEGRAAVRALVGRADVFIHSMRA
KAITKLGLGYDDVAAVNPSIVYTNCYGYGRRGPERDRPAYDDTIQAECGI
PAVQQQLTGEPDYVGTIMADKVAGLTALYATTMALFHRQRTGEGQEVEVA
MFETMASFMLVEHANGAMFDPPLGPAVYPRTVAPNRRPYRTKDGYIAVLI
YNDKHWNAFIDAVQPPWSSDLYSTLEARAHRIDTVYGLVAETLAERTTAD
WLDLFRELEIPAAPLNTPDALFDDPHLNAVGLFETVDTPHGPVRFPGVPT
WFSRTPGKVRGPAPELGADTAAVLDELGLGG
120405907YP_955736.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFDMGKRASDLRRELRDLVNERVPERFLGAFTDDPADLETAQAFCRTLA
ERNLLCLAWPEEFGGGGASVWEQTVVREEMWAHHEPRGAQYMGVNWVGPI
IMRHGTEAQQLRHLPPIAAGEVIWCQGFSEPEAGSDLASLRTYARRAEDG
DGWLVSGQKIWTSYATMAQWCFLLARTSRVGEGATQKKQQGLTIFLVPMD
DPAITVRPIRTMLGPHHLNEVFFDDLRVTEADVLGTVDAGWSIVQDVMAF
ERVGIARYARCERLLAAAPGVLGDRWDSLPAELRGRWIGMLTHCRRARLL
AYRVVALQSSGRITPGDASAYRIAVTKLDQDSAEVLMDIAAEVRRDDHRA
QWFLGEVEDHWRYSQASTVSSGSIEMQRILLSRAMLSAGAAK
120405906YP_955735.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMILDLSDDALEYGLQALHAFENAGGDRLVEQAEADPTARHGLVRPVLDGL
GAWDLDPRTDADGLEAAAALCRSAGYWALPYPLAERLAKPADLDVDGLVV
VGGPRPAAALGGLDLRWAAVDLDGRRALVTGQGVTGPGFVAELELSPVDS
DGSRDVALALVLPCWTLLGILDRAVALTVAHVSLRKQFGQTLSSFQGVQF
QLTDAEVERSGVDILAKHALWSIATDQSHVVDDALALRMAAIEAADVVFR
VCHQLHGAVGFCDETTLSWLSRYSLPLRRLPFGLSSTRDHLTRVAGRRGL
TGLFI
120405905YP_955734.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTAESEDQRDNPTDSQSQAQFRQQVRAWCRDHIPADWRDTQTGVGDEEFV
RFQKAWFAELHSAGYAVPHWPAEWGGGLPVDRQVVLYQELAAHDAPRLVL
AFVGIHHAASTLLVAGTDEQRRRHLPAILDGEIWVQGFSEPEAGSDLAAL
RTTARRAGDEFVVNGQKLWASGGMHADWCLLLARTDPDAPKRPGARKSAG
ISYFLMDMTTPGVDVRPIRNAIGDSHFCEIFLDDVRIPAANLIGAENNGW
QVAQATLGAERGLTMLELAERLGNAGFRWLVQSAPVDDPIVADRLAGFET
EITGLRGLCRQIVERGATGPADASVVKLYYSELLQRLTDFAVEIGGPEAH
TVLAKPMSSGWESGSWVLDFVGSWEWTIPGGASEIQRTIIAERGLGLPRE
PGAA
120405904YP_955733.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTHGFSEFHDELRSVAGDLLAKDRVVDWSVLVDAGWTGLEVPDGLGGSGA
TFVETAMILDQIGRAASANRYLGSAVLAVGVLNLLEPSEIRDELLTAVAS
GPGRLGVATDGFAVNGGRLAGRAGFVPDAVGADRLLVLVDGAVAVVDAAQ
MSVVPQPVVDETRQLATVTAEAAEIAELLTLAGDPASVRHRAEVAIACDS
LGLAEQMLAATVDYVLVRHQFGRPIGSFQAVKHACADMLVAIEVSRRLVS
DAVGVLAEGGDAATQAAMAKSHACSAAVDVAGKAMQLHGGIGYTWESGIH
VYLKRATLNRALFGSPAAQRKRLSQRYSKGI
120405903YP_955732.1 thiamine pyrophosphate binding domain-containing protein [MycobacteriuMTMGIPVYKRILDLFEAEGVNTLFGIPDPNFVHMFTEADARGWSVVAPHH
ELSAGFMAEAASRMTGNPGLCIGTLGPGVANIAGAMMCALVENSPVIFLG
GQRARITERRVRRGRIQFVQQEGLFAPSVKYSSSIEYADQTDEIVHEAIR
RAMSGTPGPAYIEFPSHVILDELNVGEAPEPSTYRLLNQGAGAREVAEAV
ELIRQAERPILLVGHGVHTSRTQEQVRELAELMACPVIQTSGGTSFIPGL
EDRTFPYLFSPAANEAVEQSDLCVALGTELGEPMHYGRTQHWAGNDANRK
WVYVEQDPTAIGVNRSFDVPLVGDLRGVVPQLVEALRDTTRAPSANLETL
VDADAAELARVAEEAPSGRTPVHPARFVVEATKAFNDYAQDGILVRDGGA
TVIFQWTYSQAKPRDVIWNQNFGHLGTGLPYAVGASVAEGRTRPVMLLTS
DSAFLFHIAELETAARENVPLVCVVGVDHQWGLEVGVYKRTFEQPSPQPG
VHWSKDVRMDKIAEGFGCHGEYVEKEDEIGPAIQRAYASGRTAVVHVCID
PKANSEEMPKYDRFRTWYAEGTQ
120405902YP_955731.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MREYLKHYIDGRWVDPVRPNALEVDNPTTEEISGRIALGSSADVDLAVTA
ARRAFATWSQTTREERLELLGAIMAEYQKRAGDLAEAVTEEMGAPAGLAS
GPQVNLGIGHLATTVDALKNFAFEEQHGSTLVVKEPIGVCGLITPWNWPI
NQIACKVFPALATGNTMVLKPSEVAPYSAQIFTEIIDAAGVPAGVYNLVY
GDGPGVGASISSHPDIDMVSFTGSTRAGIEIARNAAPTVKRVTQELGGKS
PNIVLDDDDFAKSVAAGTSVMMVNSGQSCNAPSRMLVPNSRMDEAIAVAR
ETAAAVKVGDPSDKTAIGPVASKAQFDKIQGLIQKGIDEGATLVIGGTGR
PDGIDKGYYVKPTVFANVTNDMTIAREEIFGPVLCILGYDDLDQAVEIGN
DTEYGLAGYVSGADLDKARAVARRIRAGSVAINHGFDMAAPFGGYKRSGN
GREWGPFAFDEFLEVKAALGYAPA
120405901YP_955730.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MYEYGIDFDAVAAIDIHTHVEVDSHGHRAYDDVLVEATGKYFKMPQGSKG
VVAGVDAVAEQYRQHNTAAVVFTIDARHGMRHAPNSIEDLVAGAARNNDV
LIPFGSVDPWQGRHAVHRVHELVRDHGVKGFKFHPSMQAFEPNDRAYYPI
YHAIAEAGVPALFHTGQTGMGAGLPGGHGIKLRYSDPMLLDDVAADFPEL
TIVMAHPAVPWVDAQISIATHKANVYIDLSGWSPKYFPAQLVHAMGRQLR
TKVLFGTDFPYIQIDRWRRDFDTLDIDPAVVPLIYKQNALRVLGVASHRP
120405900YP_955729.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMSFSRRGGLHGDRSPPLRRPEETAMPVATTAPLGAPIWIDLATSDLDRAQ
QFYGAVFGWTFESAGPEYGGYVTAFRDDHPVAGLMVNDPQWNAPDAWTVY
LHTADIEATVAKATAAGGTSCVAPMEIPAKGWMGMLTDPTGAFLGLWQPT
GHRGYGIVGEHGAPVYHQLTTRGYGAALDFYRTVFGWTTETVSDTDEFRY
STALFDGEALVGVMDGSNIPGEAPSNWCFFLGADDVDKTVALVTDHGGSV
VRGAEDTPYGRLAAVADPTGAGFNLSSIQS
120405899YP_955728.1 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium vanbaaleniMSRFPDVVVTGVAMTTALGTDVESTWQALLEGRSGIRRLEDSFIEEFDLP
VRIGGHLLETFDEQLTPEENWELSYVQRMAVVLGRRVWENAGSPDVDPNR
LTVSIGTGMGGIEELAFAYDHLREHHLELVNPTVVQQYAPSGPSSAVALE
RHARAGILAPVSACASGSEGIAQAWRHIIFGEADIAICGGVEARIEAVPI
AGFAQMRIVMSTNNDDPPGACRPFDRDRDGFVFGEGGALLVIETAEHARA
RGAKVLGRLMGASITSDGFHMVAPDPNGKRAGYAMSHAVELAGLSATDID
HVNAHATGTTVGDVAEGVAINYALGGHKPAVYAPKGALGHSVGAVGAVES
ILTLLALRDGVIPATRNLKNLDPEIDLDVVAGEPRHGDFKYAINNSFGFG
GHNVSLVFGRP
120405898YP_955727.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium vanbaalenMAKSSVNPPAAGKNMEPHFEEVQAHYDLSDDFFGLFQDPSRTYSCAFYER
DDVTLAEAQMAKIDLALGKLELKPGMTLLDIGCGWGSVLQRAVEKHDVNV
VGLTLSRNQCRFAQELLDGLDTERSRRILLRGWEQFDEPVDRIVSIEAIE
AFPQERYAPFFQMCSRALPRGGRMLLQAILGHPLKKWPEMGIPIVMSDLK
FMRFIAKEIFPGGSVPSEENIVELSADAGFTLERTQFLNQDYVRTLDTWA
QALEAHHDEAVAATSEEVYQRYMKYLTGCSDFFNRGISELGQFTLVKT
120405897YP_955726.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium vanbaalenMANSSTDQANKTAESAWLSKSAAQTRGSDKTEVQFHYDISNDFFKLWQDP
SQTYSCAYFERDDMTLEEAQLAKVDLSLGKLGLEPGMTLLDIGCGWGSTI
ARAVEKYDVNVIGLTLSENQKQHIEQNRFPQLKTDRKMEVRLQPWEEFDG
KVDRVVSIGAFEHFGFNKYDDYFKKTFSWMPDDGVMLLHTIIIPSDEEIK
AKKLPLTMSNVRFIKFIMDEIYPGGRLPLAAQVTDAATRNGYTVTREQHL
QPHYVKTLDTWASNLKDKKDEAIAITSEQIYERFYKYLTGCADLFRDGYT
DVVQFTCEKSGV
120405896YP_955725.1 hypothetical protein Mvan_4947 [Mycobacterium vanbaalenii PYR-1]MKRSASECTRPPPHIKRPTPNGDKMGDMVTAGVYLKACINGARTPDQHPR
LPVTPDQLAAEAVAAHRAGASAVHMHPKTADGVDSLLAREVDAAVAAVRH
TLPGLPLGVTTGYWALPDAEQRLRAVESWSVLPDFASLNWHEPGSPELAR
LLLSRGLGVEVGLFHADAARSWAASDVTQHCMRVMVELGADGDTTTADEL
LGIVATAGSPAPVLLHGLDESCWPLLEHARVRGVQTRIGMEDTLVLPDGS
TAEGNAALVAAAVELLSR
120405895YP_955724.1 hypothetical protein Mvan_4946 [Mycobacterium vanbaalenii PYR-1]MSDLPEWARRLDFSPHPEGGWFKETWRSDLTIPQSVLPPDYTGCRNAGTA
ILFLLMPGQQSAWHTVRSAELWLYHSGGPLQLEVGAHQESAIVHLLGADI
EAGETPQFVVPPGHWQRARPRDGQPCLVSCVVVPGFDFADFALGAATD
120405894YP_955723.1 hypothetical protein Mvan_4945 [Mycobacterium vanbaalenii PYR-1]MGRALPGWLVALCALLVAVTAWLPWLTSAEGGGRANAIGGVAGAMPVPPP
AFGVGQLVVLLSSTLVVAGAMAARGISGRMASTAALAVSVLLVVLIVWFY
RLYVYSPVSAGYGLYVAAALALVAVLLSVWTMLSVWTSSEPMR
120405893YP_955722.1 N-acetyltransferase GCN5 [Mycobacterium vanbaalenii PYR-1]MSGFVEPVTLTGDRWVSLEPLAREHLPEVEAAAADGELGRLWFTGTPKPG
AAGTWVEMRLGLQRPDTGLTFVVRGRDGALIGSSSYLNVDGPNRRLEIGN
TWFVETARRTGVNTETKLLMLGHAFDELGCVAVEFRTHYFNFASRAAIER
LGAKLDGVLRSHQLLPDGSRRDTVVYSILDIEWPAVRSNLRFRLDRNS
120405892YP_955721.1 heat shock protein Hsp20 [Mycobacterium vanbaalenii PYR-1]MLRFDPFSDLDALTRGLLTSQTGSSRSPRFMPMDLCKIDDHYVLTADLPG
VDPGSVDVNVDNGTLTISAHRTARSEESTQWLANERFFGSYRRQLSLGDG
VDTAAISATYENGVLTVTIPVAEKAKPRKIEISHTGNQKSIQPTTVEAG
120405891YP_955720.1 isochorismatase hydrolase [Mycobacterium vanbaalenii PYR-1]MAAMTTLDNRPDSALLVVDVQTAVVEGAYRRDEVVANIAALVRRARAKGV
AVVWVQHSDADLVRGSDGWQIVPEMSPDDGEPVIEKHYGDAFEDTDLEQV
LTDSGVGRLVVVGAETDACVRSTLHGAFTRGYDVALVGDAHTAGDKTQWG
APPVEAVIAHTNLYWSYQAAPGRTAAVATAAEIDLE
120405890YP_955719.1 HxlR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAGTPNAVARMLSLLGDEWTLLIVQRALLGARRYGDFAAALPVSNTVLSG
RLQSLTADGLLIRSQYQSNPPRSEYLPTSMGRSLWPMLTSIWEWERRWVP
EHAEPLPRMHHATCGRPFQPVVTCRACDGPASGKDVAAQWGPSGSWERSI
PSGTNRRRSSGRRSGAALLFPQTMSVVGDRWAFALLVAAFVGVGRFTDFQ
AQLGAPPATIADRLSVFTDENILGQSGGRYGLTEKGLAFFPVLVCALAWA
QRWLPSPEGPAVLLTHTACDRRFAPVLVCDQCGNRLRAEQVLPVS
120405889YP_955718.1 carotenoid oxygenase [Mycobacterium vanbaalenii PYR-1]MSLHSHPEIVGKFLSTLPEDDDHPYRTGPWRPQTTEWDDDDLKVVEGRIP
DDLDGVYLRNTENPLHPALKYYHPFDGDGMLHIVGFRDGKAFYRNRFVRT
DAFAEENEAGGPLWPGIAEPLELARRDYGWGARTLMKDASSTDVVVHRGV
ALTSHYQCGDLYRIDPRTGAALGKEDWHGTFPSDWGVSAHPKIDDHTGEL
LFFNYSKQAPYMRYGVVSPAGEVVHNVDVPLPGPRLPHDMAFTENYVILN
DFPLFWDTGLLEHNIHFPRFHRDMPSRFAVVPRRGDTSQIKWFETAPTYV
LHFPNAYEDGDEIVLDGFFQGDPEPTDGVDNGMSGKWRQIFRSLSLDGMQ
TRLHRWRFNLVTGEAREEQLSDSITEFGMINPAYSGRPYRYTYAATGKPG
WFLFDGLVRHDLHTGTEQRYGFGDGVYGSETAMAPRVGSAAADHIGGSAA
AHIGGSAAAHIGGSAAEDDGYLVTLTTDMAADASYCLVFDAARVGDGPVC
KLQLPERISSGTHSTWAPGADLPQWRESDSAAGAIGL
120405888YP_955717.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MSSTGVWILGGYQSDFARNYDREGLDFAGLTAEVVEATLEASGVDAADIG
VVHVANAFGGLFARQGHLGAMPATVNDGLWGTPAVRHEAACASGSVAALA
AIADLRSGAYTSALVVGVELEKTVPGDEATSILGSAAWTGHEGQQAKYMW
PYMFETVAAEYDRRYGLDESHLHAIASLNFANAKTNPRAQTRTWAVPERV
SADDTQNPVIEGRLRRLDCSQLTDGGAGVVLVSDDWLRDHPTARPLGRID
GWGHRTVGLGLQQKLDHSAGDPYVFPHVRAAVLDAFGRAEVTLDDVDGFE
VHDCFTPSEYLAIDHIGLTAPGESWKAIEHGEIALGGTLPINPSGGLIGG
GHPVGASGVRMLLDAARQVSDTAGDYQVDGAKTFGTLNFGGSTATTVSFV
VGRTP
120405887YP_955716.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMTETSSHALAQRMAELARTVASPRRVEDVLSDVTREVMGLIPGVDAAGVL
FVGAQGRFESVAGTSELPHRLDELQMKYRQGPCLEAALDSLIVRTDDFRT
EQRWPLYSAAAAELGVLSGLSFKLYTSARTAGALNLFALKPNAFDADAET
IGAVFAAHAAAAIMASRENEQLQSALSTRDRIGQAKGIIMERYDVDDVTA
FEMLRRLSQDSNTKLVEVAAKVIETRGT
120405886YP_955715.1 hypothetical protein Mvan_4936 [Mycobacterium vanbaalenii PYR-1]MSVLVRSAGAVMIAGAALLGSSALAASQPPPPPAPNCSIADQAGILSGVS
ASLSAYMFTHPEVNWFFTSLRGLPPDERRAKVQAYMDSSPQVTAELRGIR
QPMTDFRARCGLPPANMPDA
120405885YP_955714.1 MerR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVIVSSNPDCLESHGVSIAEAAQRTGLSRHTLRYYERAGLIESVERSTSG
RRQYAASDLDWFAFLVRLRQTGMPITQMQQFARLRADGAATLEQRRQLLD
EHRRHVEAAIAVQQGHLAALTDKIAHYEQLITGRQGDQT
120405884YP_955713.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MNDAPATGSTPETMLTEEVERARYERGAEMLARVDGEGGQRVVEALADIA
PALAHHIVAYGFGDVYARPGLAPAQRQLVTLGMLTALGGCEPQLDVHINA
SLNVGLTTSEIVEAIIHAAVYCGFPKALNAIFVAKRVFAERDLLPVASGQ
120405883YP_955712.1 hypothetical protein Mvan_4933 [Mycobacterium vanbaalenii PYR-1]MGAYPPAAARSQRRNPVVAKMTKHAEVAGSVPTVELTLQRIGAWSGSIMI
LLYGASFSGVAQLFPPLSPAAPADEIAAFFVDHKLWIRFGVSGALLSAVL
ALPFLAAIVLRIRRVEGRWGMLSMTQLMAATVFVPALLFPQFFLGVAAYR
PEQRSAELTQALNDVFWLWFIGIVGTIIVQNITLAIAAFMDKTDPPTFPR
WYGYLNLWVATLSLPGCVVVVFNDGPLAWNGVFAFYIPGLVLVVWLFSTT
AVMLKSIKAEQQAGTRAGVAAQPA
120405882YP_955711.1 cytochrome c oxidase subunit III [Mycobacterium vanbaalenii PYR-1]MTATAAPPHEKRVPGESGTWVFLFGDMLVFGAFFVTFLVERATAPEAFDA
ARTTLHVGVGVTNTLVLLTSSLLVVLALNAMRVGAAPIATRAVAAAIVCG
LAFIALKVFEYISLAAAGHGPGANDFYLYYFILTGLHLFHVCLGLGALSF
VLTQTRRTELSPTRTALVEGGACFWHLVDLLWIFLFALLYLVS
120405881YP_955710.1 hypothetical protein Mvan_4931 [Mycobacterium vanbaalenii PYR-1]MTVLSLLKNRAGASWLFLVAATVLSWAVGAEHGTGSLVPVLVLAIAAVKV
RLVGLDFMELRHAPVPLRAAFEVYCVGIWALLSALYLWL
120405880YP_955709.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MATEFRFGVGVTRARSRAELVDSARRAEDLGFDVLHVPDHLGGPAPFPVM
TTIAMATTTLRVGTFVINSAFYRPALLARDVAALHDLSEGRFELGLGTGY
VKEEFDAAGIPFPSARERVDHLKLTIEYMTEHLPDVPIMIAGNGDRVLRI
AARSADIIGFTGGDRAATADEDPLADRIAFVRDAAGERFGDLELNLAVTA
MPVDDSGRPDLTIPRISLPGLSDEELLRHPGVLSGSVDEIADRIRGYRDV
YGISYLIVQMRHAEAFGKVIELLR
120405879YP_955708.1 carboxylate-amine ligase [Mycobacterium vanbaalenii PYR-1]MTDIPTLGVEEEFLLVHPGSGAPVALNREVAARAADMDVELQLELTSCQV
ETATAVVDDTAHLREQLLHLRRTASAAAEHAGARLLAVGLPPTLPHEFPV
TDTPRYRDIGERYGMIAHEQGICGCHVHVAVPDRDAAIAVSNRLRPWLPL
LLALTANSAIYRNADTGHASWRSVLWARWPSAGPPPHFDSADEYDAAVQM
LSHTGVIRDDGMVYWDVRPSANFPTVEVRVADVPATVDETVLFAALVRGC
VMTALEDERHGDPVLPLAPYALKAAYWKAARNGVDGDGVDLENHVPAPVS
DLLGYLTERTRPALEAAGDHELVTAGLARVTDLGNGATRQRRAWRRNHDV
DDVLAEAAAATLEDG
120405878YP_955707.1 hypothetical protein Mvan_4928 [Mycobacterium vanbaalenii PYR-1]MTSPQNDLLSLATPYALHALSHAEAADIDRALNDAPPGVADAFLAEVRAV
RETMAALASATAVEPPARMRDAVLRQIAEDPVRTLPVRSSSRRRAAAVLS
AAAAVVIGLGTLAVGYALRPAPTPSTAEQVFAAPDVRTISGEIPGGGTAT
VVFSREQNSGVLVMNNVPPPQPGTVYQMWLVDADGSHSAGTMDAEAVAPS
TTAVLPDLGSSRALAFTVEPPGGSTRPTTPVFAELPLT
120405877YP_955706.1 RNA polymerase sigma factor SigK [Mycobacterium vanbaalenii PYR-1]MTASVLVGAAARLPLVTAELDALLRQVAQRDAEAFAAFYDQTRARVYGLI
TRVLRDPGYSEETTQDVYLQVWRNAAGYDPSVGSALSWLLTLAHRRAVDR
VRSEQAASTRESRYGAISVDPPSDHVADDVLLDDERRRVAGCLDSLTDVQ
RECIQLAYYDGLTYAQVADRLAANLATIKSRMRDGIRALRKCLGVA
120405876YP_955705.1 hypothetical protein Mvan_4926 [Mycobacterium vanbaalenii PYR-1]MRAAIYRTRITHLRRAPVHHYFEHRSYSWFVDLDALPRLPRWLRPFAGFE
ARDHLWEAPRDTLRGRVDAFLAGKGIDLGGGTVTALMQPRVLGHVFNPLT
LYWCHDSNGVLRCIIAEAHNTHGDRHAYLLPPSTDPPVMVDKKLYASPFN
GVDGHYLVRAPEPDERLDVTVSLHREQQPAFVVTLRGSRRPAGIRQVLAM
QIVAPLAPLMNALSTRVQGALLWLRRVPVVPRGSDERRAPVETVTRLDAG
RRCPAGPILTRDPQETRSP
120405875YP_955704.1 hypothetical protein Mvan_4925 [Mycobacterium vanbaalenii PYR-1]MGVRHFYFAYGSNLCVQQMARRCPDATDPRRATLADHDWLINERGVATIE
PFAGSEVHGVVWRVSDRDLATLDSAEGVPVRYRRDELTVLTDNGPSEAWV
YIDHRVEPGPPRPGYLERILDGARHHDLPRRWIQFLERWDPTRWPQRPDR
ADSVAPQSLSELVSDPAIAEDVTLQSRFGFLAIHGGGLEQMTDVIAERAA
DAAGASLYVVRHPDHYPHHLPSARYDPAQSPVLAEFLDHVDVAISLHGYG
RLGRSTHLLAGGRNRGLAEHVARHVVVPGYRVVTDLESIPKELRGLHPDN
PVNRVRGGGAQLELSARVRGISPRSGLPGDDGLSPATSALVQGLVRAART
WRLPSTQG
120405874YP_955703.1 hypothetical protein Mvan_4924 [Mycobacterium vanbaalenii PYR-1]MKSISRYGTGLFAALGVAAVLAAPTAAAAPECTDVGKTVTFCETNGSTQL
TTTPPPWNYGGWNGIGVWPLVGAYGLGPW
120405873YP_955702.1 hypothetical protein Mvan_4923 [Mycobacterium vanbaalenii PYR-1]MKARLSTLAALLVAGGASVAIAVAPAASAQPNCSTTSAGAGGRTEVCQSP
GNAQISSTPGQYAMPWYGGGMFPWEGYGPFIF
120405872YP_955701.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MAIKVAAIGTGNVGRHALTQLITDPRFELTAVWVSSESKAGKDAAELVGL
ADSTGIRATTDLDAVLATRPQCAVYTALADNRLPEALEDYRRILAAGVNV
VGSSAVFLQHPWKVLPDELIAPIEDAAKAGSSTIFVNGIDPGFANDLLPM
ALAGTCQSIQQIRCMEIINYDTYDSAPVMFDVMGFGGSLDETPMLLQPGV
LSLAWGSVVRQLAAGLGIELDEVTETHLRVPAPEAFDIAAGRIEKGTTAA
IRFEVRGMKDGEVAVVLEHVTRLRDDLCPDWPQPAQHGGSYRIEITGEPS
YALDLCLSSPNGDHNHAGLVATAARVVNAIPAVIDAAPGIVTARELPPIT
GEGLYAKP
120405871YP_955700.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTRGRQREANVILDRFRLDDQVAVVTGAGRGLGAAMALAFAEAGADVLIA
ARTRSQLEEVAEQIEGTGRRAHIVVADLAHAEDTAALAAGAVEAFGRLDI
VVNNVGGTMPNALLTTSTKDMRDAFAFNVATAHALTTAAVPLMLEHSGGG
SIINITSTMGRLAGRGFAAYGTAKAALAHYTRLSALDLAPRIRVNAIAPG
SILTSALEIVADNDELRGPMEKATPLRRLGDPLDIAAAAVYLASPAGSYL
TGKTLEVDGGITFPNLDLPIPDL
120405870YP_955699.1 hypothetical protein Mvan_4920 [Mycobacterium vanbaalenii PYR-1]MMSYSRRTRHRAIAGAVYIGALAGAAFFGGAPAATAQPPAPPPPAPPNCS
PADWAGVRAGVAAATSVYLFTHPPVNDFFATLEGQSREEMQPQVQEYLDA
NPQVRAELEGIKQPAVDFLNRCR
120405869YP_955698.1 hypothetical protein Mvan_4919 [Mycobacterium vanbaalenii PYR-1]MNPWLQRSALSAVVLAFLPLTELASPAVGRSQPPPCPPGMYWNFATLICE
FPPPPAVYVDPWLPVYVPDIVDIDLDIPVPRPPGPPGPPGPPGVGPPGIG
APGPGVGRPGPAPAPRPGGGRRGGRR
120405868YP_955697.1 hypothetical protein Mvan_4918 [Mycobacterium vanbaalenii PYR-1]MYCVSTALTVAALAAGAIAFAAPVSSQCQGGWTPWGGGEYCDGYIYEDGS
YDHCVSVTVLGFGGTQCNRVCPPDPANPAVPLPWQPGAFCPFRK
120405867YP_955696.1 Ku domain-containing protein [Mycobacterium vanbaalenii PYR-1]MRSIWKGSIAFGLVNVPVKVYSATEDHDIKFHQVHDKDNGRIRYKRVCEV
CGEVVEYRDIAKAYESDDGQTVIITDDDISTLPEERSREIEVLEFVPAGD
LDPLMYDRSYFLEPDGKSSKSYVLLAKTLMDTDRVAIVNFALRNKTRLAA
LRVKDFSKRDVMMIHTLLWPDEIRDPDFPVLDKKVDVKPAELKMASQVVD
SMTDDFNPDRYHDDYQEQLHELIQAKLEGGEAFTTEEQPQELDETEDVSD
LLAKLEASVKARKAQGTQKDEPAAEKPAAKKPAAKKSPAKKTAAKKAPAK
KAPAKK
120405866YP_955695.1 ribokinase-like domain-containing protein [Mycobacterium vanbaalenii PMRALVIGEALIDIVERDGGVTEHVGGSPLNVAVGLARLGRDVDFLTHIGT
DARGQRITDFVESSGAQLVPGSRSAARTATARAVLDATGSATYSFDIDWQ
LSGTPEVAPPLVVHTGSIAAVLEPGCLATTALVDTYHLSATFTFDPNVRP
ALITDPDAARSRIDRLLERADVVKASSEDLHWIDPTRNPEQVATAWLALG
PSIVVVTFGAEGSVAMCADGTVRVPAGNVDVVDTVGAGDAFMTGLIDALW
SMDLLGAGRRARLAGIGTDALTTAVRAATLTAALTVTRPGADLPDRVTRD
AATASDILG
120405865YP_955694.1 ATP-dependent DNA ligase [Mycobacterium vanbaalenii PYR-1]MVDRYERVKLTNPDKVLYPATGDRRRAVTKAEVFDYYVNVAAAMLPHIAG
RAVTRKRWPNGVTEESFFEKQLASSAPDWLGRGTIVHKSGTTTYPVIDTV
EGLAWIAQQAALEVHVPQWRFVDGSVGPATRIVFDLDPGEGVTFRQLCEV
ANEVRDLLADIGLRTFPLTSGSKGLHLYVPLDEPISSRGASVLAKRVAQQ
LEQAMPMQVTATMTKSLRTGKVFVDWSQNNANKTTIAPYSLRGREHPTVA
APRTWEEISDPDLRQLTFDEVLDRLDRDGDLLAGLDPPVPVPDRLTRYRS
MRDTAKTPEPIPGDAPTTGNNDKFVIQEHHARRLHYDFRLERDGVLVSWA
VPKNLPDTPSVNHLAVHTEDHPMEYLTFAGEIPRGEYGGGEVYIWDTGTY
ETEKFRDNPPDGPDRGGEVIVTLHGEKIDGRYALIQTDGKNWLAHRMKDQ
QRPTAADLAPMLTTHGSVQRLTKGQWAFEGKWDGYRLLVEADHGRLALRS
RNGRDVTAEYPQLQALAADLADHHVILDGEAVALDESGVPSFREMQNRAR
STRVEFWAFDILFLDGRSLLRAKYTDRRRVLEALADGGGLIVPPLIGADT
GAEALETARKRGWEGVVAKKRDSTYQPGRRSSSWIKDKLWNTQEVVIGGW
RQGEGGRTSGIGALMLGIPAGGVAGGLQFVGRVGTGFTEKELASLKETLA
PLHTDESPFATELPKQDAKGVTFVRPELVGEVRYSERTSDNRLRQPSWRG
LRTDKTPDEVVWE
120405864YP_955693.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MQLFVTGGSGFVGQHLIRRLVGAGHEVRALARTDSAAGLVGRVGAEPVLG
DLSDLVNSDPPPLWASALRGVDAVVHGAAYMAFWGPDDVFRRANLEPSVA
LHQVAASSGVTRFVLISAASVATGTQRAPVVDERTDEGRPNIAYSRVKLA
TERILLNAVTPTMTTVALRPPFIWGAGMSTLADFVAAVEAGRFSWIDNGK
HTVDFVHVDNLAKAVGLALTRGRAGRAYYITDGAPMPTRDFFTPLLATQG
VDVSAARSVPFALAAPLGALLEAGARLLRRPEPPMLTNWITTFMGRDRSY
DITAARSELDYTPSVNLADGLAEMADSLSR
120405863YP_955692.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MGGRAASGASAQRAGRLADAFGRAGKSVVRAFDDRLGEHGVSTPRSKLLA
EVARMQPVRLADLAREVGISQGTASTLVEALVRDGLVARGVDDNDRRAIR
LTTTPEGETQARNWLRDYVVVAGEIFSCLTAEEQRQLTRLLDRIAESLDS
PA
120405862YP_955691.1 hypothetical protein Mvan_4912 [Mycobacterium vanbaalenii PYR-1]MYVRAMSGSDVQAAVTALRTAFDDMAACDVDLLTRPDLVAALDELETLGC
RLPSVSHRLLARLQAEATPPQMGAKSWKEVLAVRWRISTSEAHRRLTEAA
VLAPRQAMTGESLPPALPATATAQAHGLINAEHVEVIRKAMAKLPGFVDT
ATRERIEVDLVRTAVGNGPKELKDSADRTLFLLDQDGPEPDERERARKRA
VTKHKQREDGMVDVSATLTPEAWAVWEAIFAKFAAPGMCNPDDPEPCTSG
TPSQAQIDHDQRSLAQRQHDALLAGGRIALMSGELGKLNGLPVSVIIRTT
LQDLESRAGVGVTGGGTVMPIAEVIRMAGHANHYLAVFDRATGSALDLFR
TKRVASAAQRIMLIARDGGCTKPGCTVGAYGCQGHHVEADFAKGGNTNVD
ELGLACGPDNRSVDNNGGWTTQMNERCEVEWIPPPPLDTGQARINNYHRP
ERLLRPPEEPDPHSDNDTAASAKPAEGNEIGDAQPGAPQPADNPSEPGGP
APPDNQAA
120405861YP_955690.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MRRHGWAGNIPVDDDEAVSRIVAAARASIDARGTVSVSEVATELGITRQT
VYRYFPTLDALLTGTALSAVGGFLDRLAQDLASITDPAEAVVEGIAYTLE
QLPHDRYLGLVMQPGKASAFAAGVTSDVAISFGRSILERLNVDWAGAGFS
GQSLDELVEFMLRTLQSFILDPGGPDRHRGELRAFLHRWVAPAVELHHRS
GFPEQA
120405860YP_955689.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMTAIADGPVSNQDEELTRRALRHAVDKTTDMADRELRVPLHYYRDPKITE
IEESQVLRRVPLAIVPSAQIPAVNDYVVRSVLGDSLLVTRDRDGVSHVFL
NYCRHRGAKPACGAGNTSRFTCPYHAWSYKNTGELFTVPGKAGFDSMDKA
DYGLVELPNQERHGFIWAVLTAGATIDVDAHLGAIGPELELMNYASYGYH
TEKEFQSQVSWKGALEAFAEGYHFPFVHGESVIGQNTLPNTGVYDEYGKH
HRIGFPFNWVTNLADDASGSWDPHQNMGVIYWIYPNLILANSPIGVEIID
ILPAGEPTRCSVRHSWMGRVPATTDEMREMYDQVYDSVHAAVVDEDFAML
PQCGEGVRHGQHDHMIIGRNEIGVQHMVKVFAQELGVALS
120405859YP_955688.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MNEAHRDAHAASTAPVSRLQRRKMRTRMALIHAAQGFIAEGKLAVPVLEI
TQAADVGMGSFYNHFDSKDELFEAAVTEALDGFGALLDSYTAAVADPAEA
FATSFRLSGRLFRIRPQEAKLLLANGSSLILSEHGLSPRALRDITAAIDK
GRFKITDPELGLAIAAGALYGLGTLLTQRPDRDGASATDEVTASVLRMFG
MTSQQARGLCRHPLPDLSSLQDTRAARPTPIPPAGVT
120405858YP_955687.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMVKLRNDGHKHLHSEQGARRGEHPGRSTNPLIRVADIAWLEFDKPDLVRA
EAFARAFGLGVASSDPRQLVLRGTDAGCPCLIVRPGTHSRFTGVAFRAAD
EVDVLRLADKVHAPVQPLPEALGGVAVQLTDPSGIAVKVVGGLHELPELP
TQSPLLLNTGRKTLRTNATQRPLRAPARVQRLGHVVLQSTTYLATLNWYL
DTLGMIVSDFLYFPGQRDRGPTMSFIRCDRGDSPADHHTLALALGPANRY
VHSAYQVSDLDALAAGGEYLRDRGYFRSWGIGRHIQGSQLFDYWRDPDGF
LVEHFTDGDMFDNTVEPGWAPFTATGLAQWGPPVSRDFLGTTPKHAPQEL
RSMVSALRDRNEFDLTRLIGLLKVASS
120405857YP_955686.1 fumarylacetoacetate (FAA) hydrolase [Mycobacterium vanbaalenii PYR-1]MTLSVLRTADAWWVHTPAGAARIDTKATTTAQLLADRAAVEEAASSTPTA
AVSELNLLSPVTAPCRVVAQMTNFESHVKDAGMDPKTVPLTFFRKSSASI
SGPFDDIVRPSHVRLLDYEVEIGLVIGRDIPVGTTLTDANLADYVAALAI
TNDVSARDIQLPQTQFYEAKSYPTFTPVGPALVLVNAEELARFGDLRLRL
RVNGDERQNALVEGDMLYRPLQALQSLARFQDLAAGDLVLTGTPVGTALS
APPKPIEIIGNLLPPAVKWKAFFARQAKNPKYLRHGDVVEASIATDDGAI
DLGTQRLTVRFA
120405856YP_955685.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium vanbaalenii PMPVVVVGGGPTGVTAATLLAQYGVDTLVLDRWSQVYPQPRAVHLDDEICR
ILARLGVAEEFARISRPARGLRLVDRNLAVLAEFRRDTAVTRSGYPAANM
FDQPELENLLRRNLTRFRRARFRGDVEVLDIAVDAAGVTRVAFSDRLSGR
RSVITADYVLGCDGANSMVRNAIGATMRNLKFDQRWLVVDVATTADLQQW
EGVHQICDPRRAGTYMRIGDTRYRWEFALSAGESADDFATLSALLPLLAP
WTRHVAEADLQLVRVAEYTFRAQIADHWRSGSIFLLGDAAHLTPPFIGQG
MGAGLRDAMNLAWKLAGVHHGSLPPTVLDSYEQERKPHARHMISLALNMG
RAMTAGGRLGAAVRRLIVPRLHLIPGMRGKVIDSETPALKASSLVRRTPA
SRRVAGRLCPNPVLADGRRLDEALGSGFGVVTTGALTPAQQALVERCGAR
ALCVAPATELASWLRRGRVTTAMIRPDRTVMSAGRDVDALCRQFLSGNLV
GVWNSVAATPD
120405855YP_955684.1 ribonuclease H [Mycobacterium vanbaalenii PYR-1]MTDDPVIIHTDGGCRPNPGPGGWGAVLRQRDHVREMFGGEAGATSNNRME
LMAPIMALEALTRPVVVHLHTDSTYVRNGITKWVFGWERNGWMTAAKQPV
KNVDLWQRLQIASAQHRVEWFWVKGHSGIADNELADALATRGLQEAIAAA
AIPT
120405854YP_955683.1 hypothetical protein Mvan_4904 [Mycobacterium vanbaalenii PYR-1]MPHALTVDEFAVADPVDAWTQAGFSVDADTVCRVGGVRIRLVGRDRGTGI
VGWSLRGLPERSAGDLDGVPTERSTAAAATPAAHANGVTAIDHVVMLSPD
LSRTVDALAVVDVHPRRERDTELGGRAVRQIFFRLGEVILEVIGSPGTAG
DGPSTLWGITYVVGDIDATAALFGDHTTPVKDAVQPGRRITTLRHQDFGM
SVRTAMISAPILGA
120405853YP_955682.1 hypothetical protein Mvan_4903 [Mycobacterium vanbaalenii PYR-1]MNRRGAISVAVIVPTPELLERMLEEKPACWTWAAFASTVFQRWAAVEQRK
VDQVLGSPVTPTHKLGTGSDVAQFVIGHMRDVDGIVAQVSAFLSGPAFRE
AFGAPDDEDSADAEGIIRAAHHLGDCYERLLELAEECRRCSVSAQYAELL
HDCVRFVNQHLQDFGGFVNDILENLEDLQKRVMLGERLIHCQRPALHTNT
DDRLIWSILDRVRTIE
120405852YP_955681.1 hypothetical protein Mvan_4902 [Mycobacterium vanbaalenii PYR-1]MDLSRRAFGSIAVAAAAGVAAARIGPRARAAPAGVPVAETQARSVVLVHG
LYADGSSWIDVVPHLQNAGLAVAVVQNPLTTLADAVAETRRVLALQPGPT
VLAGHSWSGTIVSEVGGDPTVSALVYIAARAPDAGEDFPALAKRFPAPPA
SKGVVVTPDGYAQLGEAAFLSDFAGGVPAERARALYAVQGRNLATLPAER
TTTAAWRDKPSWYQVSTQDRTIDPELERYLAHRMGAHTIELDTSHVSLLT
RPREVADLILAAAGRGAG
120405851YP_955680.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MFHSGTHKVKETAMKAMVYHGDGKASWDDVPDAVLVDPTDAVVRVDAVTI
CGTDLHILRGHVPTVDRGRILGHEAVGTVTAIGSGVRQLAVGDRVLISCI
SSCGSCRYCRRTSYGQCSGGGGWILGNRIDGTQAEFVRVPFADNSTHRVP
DGVSDENMITLADLLPTGYEVGAINGRVRPADTVVVVGAGPIGLAAIMTS
QLFSPSRIVAIDLADSRLDAARKFGADIVINPDRLDPVAAIADLTGGLGV
DAAMEAVGTAATFELAVQLVRPGGHVANIGVHGGPATLHLEDIWIRNLTI
TTGLVDTYSTPTLVDLVAAHRLDTSALVTHRYPLDEFERAYHEFSNAGET
GALKVLLTQN
120405850YP_955679.1 hypothetical protein Mvan_4900 [Mycobacterium vanbaalenii PYR-1]MSAKSLMAATPTGRRRPLLIDDADYSTAVVRQGTPIPWTDTALAAGHFDQ
VRALLDPDALWIDVRRLLTAHTDARPDLIASMGARTRIGYPLRTLLTDSD
VLAASREMLETVAKTTRRQLLLHLPSPGAWLGAAHEVAGTPLDEVDADRA
DNASIYVAEWLGRLGSLPIALILLDARDASFAETLTPYTAVANVASHFDW
TLAMWNDDGIHGAAGDPSIGVLGPEFWAGGAEFGHAVPETDLLVTSIPPS
ASPEHVLDQLAKLT
120405849YP_955678.1 hydantoinase B/oxoprolinase [Mycobacterium vanbaalenii PYR-1]MTTVNERPAGKLTATEQRWVDQFMDETTLFLGPDPEIMRSHRISERSLHE
EVAIAAGVDRLQVERIRKRIAGALDEGYEMCEAQGAAPGAKWGDLTTAIY
TGSGDVSYLSCHGVIAFSAILHHPIRYIMKYWKDEPTVGINPGDGFIHND
ARFGNVHNTDQSMIMPIIRDDEIIAWVAATIHEGENGACEPGGMPSGSET
AFDDGLRMSPFKIVERGELRRDLLTFLQHSVRDPKLQLADLKVKITAVRK
IMERIDKVIDEVGVDTFVAALRTTVEDVDAEVRRRIAELPDGTYRFDQFM
DSTLKENILIKFACKITVKGDHMTVDLRGTGPEILNRAINSPLCSVKSMM
MQAILAFWWPDLPRCTAAMSCIDIISDEGTWADASYDAPMGQSLQASFRG
FSCMQALYSRMSFSTPHKYSNVVANWFNQINTFLWGGITQHGDMVGNLCA
DLNGMPGGAKPFHDGEDAVSPLFCAMADTAEQEVMEEEVPFMQLVAKRLV
RDNMGFGKFTGGMGYEMIVAAEGTPQWGFMTVTSGAKFSSIYGMYGGYGC
GTYPLAMVKGTNVYEHFRRDNKKFDLSIEKVMNERPFPDGRYSTYHMGLQ
FDLAKDGELYMISQGAGGGYGDPLERLPESVVRDAELGRISQKVAEDIFG
VRYEPKTFRLDVAGTEAARAAARKNRLQRGKPFAAFCEEFVTPEPPKDLP
YYGSWGTWTDENQDITATVHSIDGPERVCAPLSALPIVMVPDRREVKIGK
LEARIAELEAKHGEKVTRLT
120405848YP_955677.1 5-oxoprolinase [Mycobacterium vanbaalenii PYR-1]MKRISVDIGGTFTDCFFVWDDIYVDAKALTTHHNLAIGFNDALDLACKRA
GLDRSTVLSEVDSVRYATTLGTNALIERNGPKVAAIVTHGFEDTIPLSRG
RGYGEGLDYGMQQNLPAAERPEPLVPRAMIRSVKERVNSAGKIVARLDAE
DVRTVVRELVDAGAEAIVVSLVNATENPEHELAIQEIILDEFPPHELGAI
PVLLGHQVSGRKGEYVRATSTIIDGYLHEIMFHALAQLSSNLRDFGYDKP
MLVIHNSGGMAQMNSTDALQTIHSGPIAGVGAAEHLSNETGIGHVIATDM
GGTSFDIGLVPEGGVKHYDFLPTIDRWLVSVPMVHLDTLGAGGGSIASYD
RIHNSVKIGPKSAGSNPGPACYDRGGLKPTVTDADLLLGYLDPDNYANGY
IKLNPKRSLFAIEEELCDHLDMDPIDVARVIKDGVDEQMAIGIGKELRVR
GYLPEDFTMLAYGGNGPLHACGVARHAGIKRVLAPPFSSVFSACGAGNMK
QLHFHERGVHVTMYNATTRALFEDYDEFNSVVSELEARGCEDLIRQGFSA
EDVKFRLELDMRYGNQLLTQAVALSDINRINGVGDVLEIIKTFGDVYSHR
FGASSAAPEAGIRCSTIRVASYVDGDVVNFEPLEHGGARTAPAPAGTRKA
YFIGIDDPIETPVYDEKALTPDSVIVGPAIVTTENTTFLVEPGWRLEPTA
QGAVWFLQD
120405847YP_955676.1 putative acetone carboxylase subunit gamma [Mycobacterium vanbaalenii MRVPMTEYLVIDLDTERWVCRVCTQDMGSAHDTYKSGTLVYDRDPREIHQ
PIIDPERYEYTFSPDPTYCRILEYYCPGCGTQIECEYLPPGHPPAVDMLI
DVAALRKQWADRGQDAEAVFNYGPGEDAQKYTAALKAAGHLH
120405846YP_955675.1 hydantoinase/oxoprolinase [Mycobacterium vanbaalenii PYR-1]MGTLINIDNGGTLTDICVWDGNAFTFTKTLTTPHDLSECLFTGIEKASDA
LYGEADITRLLHATEHIRYSTTQGTNALVERRGPMIGILTTIGGLDAGMK
RGAAEKKLFTGLVGDRFLTVDPEADLEFDAVQKINRLTTLGAARVVVAAA
TPEEERQLRHVLLRKFPRHLLGSVPLIYSWELAGDRDDARRAWSCVVNAF
LHPTMERFLYSAERRLQAYKVVNPLLVYRNDGASSRVAKSVALKTYSSGP
RGGLEGTAALARVYGLPHALMMDIGGTTTDVGVVEGGAVAVADRGGIEGV
HISYPMSDVTSSGVGGSSVIQVVDSEITVGPQSVGAAPGPACFGFGGKQA
TITDVNLLLGVLDPDTYLDGTFTLDPSRSQAVITETIARPLGISLEEALI
RMEHAYFQALSASFAPLVTEDTTLLAFGGAGPMSATGAARLAGVKQVLVP
RTAAVFSAFGISFSDIGKTYEVIVAEPTTEAATETHDALLVRAERDMFQE
GYALADCETSWQLLVENLEDGSVSRLPYQPGDEVDYPGSVVSLQLNAAAP
LSHPDLTADAVVTATAAPAAGTRQVRSAADHVDDVPVHVLDDLSPGDGGE
GPAIIEGPFFTARVLPGWSFRLTAAGDLLLNDKS
120405845YP_955674.1 Fis family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MPNSSARMLRVAAARADFLEYGGGGAAGVSEVVVASWERSQAAGVDIAHP
NAQFTDEIDAASLLVRCARPVLQQLQIDTADMPLVIALTDKKARVVQRID
SSSAVARLLDRVDLAPGFSYAESTMGTNGIGTVFEAGQPISVVGPEHFSE
NLHLFACTGAPVIDPVTGRVEGVLDISTLSSSWSPLMHTLVKSAAKDIGR
NFLLDRGQAQRAIFETYLKVTARSDRQAVFAFGESVFVANSAAQQMFDAD
EQRIMREHAMFLMAGKDRVSDTIALPGQRLVHVRGTRILAGVAVAGMVVI
ADLVTSSQPGTPDDFSEQQLPQVAIATPQTSQIVGGLWRSRDSLAGGSTP
AWIRACGDLRQALEQVQPALVVGEQGAGKFTLVAELFHSVYPGGRAISVD
AGQLESGCAPSDLGSLLGDSAEPTLHIIRDIDQASTDGVERLEAYLAAVA
EVTGPVWVVATGSDSAASADLPFRELLHHFEVSITIPPLRCRTDDLPTLT
AALLRGIAPERKVRLSPEAQRVIARYSWPRNISQLREALVHALRRRPVGE
IQESDLPGYCQTASRHALTPLEAAERDAIVAALRDTAGNRVAAAAHLGMS
RSSLYRKIKTYGIVA
120405844YP_955673.1 regulatory proteins IclR [Mycobacterium vanbaalenii PYR-1]MQDKGTQVLARAATLLRAIGGGDLTGMSTTEIARTADLPRPTAHRLLTAL
AEEGLVDRDTTTGRWTLGPELYLLGTGAAHRYDITDQSRDVIERLARETG
ESAFLSARRGDETVCILSREGSFPLRSHVLHEGIRFPLGVASAGLAILSH
LPDRDIDEYFTRSDLEPRWPASHSEAAIRERIAATRTTGYAVNPGLLVEG
SWGMGAAVFDRTGRPAWALSLTGVETRFRPERRGEMGALLLELAHELTVR
LRR
120405843YP_955672.1 3-oxoacid CoA-transferase subunit A [Mycobacterium vanbaalenii PYR-1]MSSKVYDSAAAAVSDIATGATLAVGGFGLCGIPDALIEAVAASSTTDLEV
FSNNCGVDDHGLGVLLSLGRIRRVTASYVGENKEFARQYLAGELEVELTP
QGTLAERLRAGGTGIPAFFTPAGVGTPVADGGMPWRYAADGSVAIASPPK
ETRVFGEKRYVLEEAIIADFALVHARLGDTDGNLVFEKTAMNFNPLAAMA
GRITIAQVEELVEPGAIEPGRVHLPGVFVQRVVHTGPQTKRIEKRTVRTA
QGAR
120405842YP_955671.1 3-oxoacid CoA-transferase subunit B [Mycobacterium vanbaalenii PYR-1]MTATFTTGWTRNQIAARAAAEMIDGQYVDLGIGLPTLIPGHLSPGVRVIL
HSENGILGTGGYPDEDSVDADLINAGKETVTVNRGAAFFDSATSFGMIRG
GHIDAAVLGAMQVSRNGDLANWMVPGKMVKGMGGAMDLVHGAARVIVVME
HTDRSGAPKIVDACTLPLTGQGVVDRIITNLCVIDVPGDGTLVLRELAPG
VTVDDVVAATGAELTVAL
120405841YP_955670.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MAADNSSVLVAGARTPIGKFMGSLAGLTGAELGGVAIAAALAKAGISGSQ
VQYVIMGQVLTAGAGQIPARQAAVAGGIPMTVPALTVNKVCLSGLDAIAL
ADQLIRAGAFDVVVAGGQESMSQAPHLLENLRAGTKFGDAALRDHVAVDG
LRDVFTDQAMGSLTDSVNALSRADQDEFAAASHRRAAAARKNGVFDGEVV
PVVIPQRKGDPVQVTVDEGIRADTTTASLARLRPAFVADGTVTAGNASTM
NDGAAAVVVMSKAKATEVGLTWIAEIGAHGVVAGPDSTLQMQPANAIAAA
CAIEGIDPAALDLVEINEAFAAVGIESTRALGLDPERVNVNGGAIAIGHP
LGMSGARIVLHLALELQRRGGGTGAAALCGGGGQGSALIVRC
120405840YP_955669.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMTDTLHRPSGPVSVAAPDPVVRRLAVVALALGGFGIGTTEFVAMGLLPDI
ATGMGVSEPTAGHVISAYALGVVVGAPVIAAVTARMARRKLLLALMALFT
IGNLASMLAPTYETLIAARFLAGLPHGAYFGVAALVAAHLMGPQNRAKAV
AHVLTGLTVATVLGVPIASWLGQSLGWRAAFGLVVGVGLVTLTALWCWLP
FQLKFMRATSPLTELGALRRPQVWLALLVGMIGFGGMFAVYTYITTTMTD
VAGMPRGLVPLALMMFGLGMVLGNLVGGRLADGSVVRALYLSLGALCGAL
ALFVVASHNPWTALLVLFLIGLTGSAVGPALQTRLMDVAHDAQTLAAALN
HSALNIGNATGAWVGGLVIAAGLGYTAPAAAGAVLALAGLAVLTVSVLLQ
KRG
120405839YP_955668.1 2-dehydro-3-deoxyphosphogluconate aldolase [Mycobacterium vanbaalenii MEDVKEPRSLLDVAPVMPVISVRRAADAVPVARAITAAGLPLVQVALDGP
TALEAIARIAEEAPDVIVGAGAVTEADQPERARAAGAEFLIATTGGAALC
AAMRDSELPHLPGVTTAAEAAGLLDAGYTDLVLHPAAAAGGLRHLKALAA
FAPAARFCASGGITAADLTGYLAAPNVGCVSADWLAPADAVRRRDWDRIR
RLADVALKLSTPTVTTVRAL
120405838YP_955667.1 ROK family protein [Mycobacterium vanbaalenii PYR-1]MALFRTSSASSVGDVFALIRHKRDLTRTEIGRLTGLSRTAVTARVSELTS
RDLVVEREQAPSTGGRPAALLSFNADAGVVLTAAVGGSRTRLAVCNLAGD
VLTAADIDQEPGLGPQDLMPQVVKGLEVLLAESGHSDAVYGVGLSLPGTV
DQERGSSIDTPVLSGWDGAPLIPYFRQLTEAPVVLGNDANVIALAEWRAG
AGRGFDDLLVVKASTGLGAGIIAGGAPQRGAIRAAGEFGHNKTPAAEGRP
CRCGDTGCLETVAGGWALVRTLAQEGRPVRNLRDLVELAHSGDALARRQI
RDSGRYIGEVLAGAVNLLNPAALVVAGDAAGAYDIFVAGLRETLYGNATA
LATRVLEIRPAQLGDRGGSIGSAMMVLDQVLGPRAVDALVAA
120405837YP_955666.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MTARNYDVPDAFDAGAPAYDGLVGANPGYHAHLRLSARRMRLPDQGRGLR
LLDIGCGTGASTAALLSAAPLADIVAVDGSAGMLEQARAKTWPPSVTFVH
SRAETLAAAGVTGPFDGILAAYLIRNVEDPDSVLGSLRSLLRPGGVLAVH
EYSVRDSRLATAVWNLVSTAIIIPAGRLRSGDAGLYRYLRRSVNNFDGAA
QFRDRLRRNGFVDVHSESMPGWQHNIVHTFLGRAPQ
120405836YP_955665.1 UDP-glucuronosyl/UDP-glucosyltransferase [Mycobacterium vanbaalenii PYMPMVNVGIGLQALGHDICVLTGAEFSDAVHAAGLQMIPLPDSVRIDPPAA
APALLRKLPVAVRRFWLGRAELASVFAEPLAAEAQSLRAVLRNGSVDAIV
ADVAFTGVLPVLLQDSPRPPVVVCGVGPLTISSRDTPPFGVAWQPERGLD
YRRMTTAAHRVIMRSSQRRFNHALRQAGSDACPLFVSDWPRLADGLLQLS
VQALEYPRGDLPATVEFVGPVLPAGPEDFDPPHWWGDVMNAGAVVHVTQG
TFDNADLDQLIAPTLEALGDRADLLVVATTGGRQGQRIHGRIPANARIAD
WIPYSALLPHVDVMITNGGYGGVQHALAHGVPLVVAGETSDKAEVAARVD
YSGVGIDLKTATPTPEAIRAAVDHVRRDGRYRSAAERLRSAIEASTPVDA
IANAIKRLCNA
120405835YP_955664.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRFTYAEAMTDPTFYIPLAQAAEAAGYHAMTIADSVAYPFESDSKYPYTA
DGNREFLDGKAFIESFVLTAALCAVTTKLHFNHFVLKLPIRPPALVAKQA
GSLAALFDNRLGLGVGTSPWPEDYELMNVPFAKRGKRMDECIDIIRGLTS
GDYFEYHGEFYDIPKTKMTPAPTKPIPILIGGHADAALRRAARNDGWMHG
GGDPEELDALLGKLNRFREEAGTADNADYQIHVISIDAYTADGIKRLEDK
GVTDVIVGFRIPYIQGQDTEPLDAKIRNLEMFAENVIAKL
120405834YP_955663.1 hypothetical protein Mvan_4884 [Mycobacterium vanbaalenii PYR-1]MGLFLLRAALTGLALWVVTLIVPGVQFVGGDSTAARVGIIFVVAVIFGLV
NAVIKPVVQIISIPLYILTLGLIHIVINAFMLWITSWITEHTTHWGLSID
DFWWTAIWAAIVLSIVSWLLSLIVKAD
120405833YP_955662.1 DNA-formamidopyrimidine glycosylase [Mycobacterium vanbaalenii PYR-1]MPELPEVEALADHLRRHAVGLTVGRVDVAALSVLKTFDPPISALYGQEVT
GANRWGKYLGLQAGELHLITHLSRAGWLRWSDKLAAAPLKPGKGPIALRV
HLGPPGESPGPNVAAGAAPGFDLTEAGTQKRLAVWLVTDPMAVPQIASLG
PDALSLTGQALAEVLGGQSGRIKTVITDQKVIAGIGNAYSDEILHVAKLS
PFATANKLTPSQLVTLHDAMISVLTDAVTRSVGQQAATLKGEKRSGLRVH
ARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKVLADRRMSRLLK
120405832YP_955661.1 transposase IS116/IS110/IS902 family protein [Mycobacterium vanbaaleniMLVESEDSEQIIARVAALDIGKAELVCCVRVPGRGTRRLQEVSTHSTMAR
SLTELANHLVESGVQRVVMEATSDYWKPVFYLLEAHGLDPWLVNARDVKH
LPGRPKTDVLDAVWLAKLAERQMLRPSFVPPPPIRQLRDLTRYRIDLVAT
RTAERNRVEKLLEDACIKLSVVASDIFGVSGRAMMAALIAGERDPKVLAQ
LARSRMRTKIGRLEEAFNGHFNAHHGFLLTRMLARLDGIDADIAVLDEQI
EVYLAPFAAAAARLDEIPGIGAVAAAIILAEIGTDMSVFPTAGHLCSWAK
FSPGIQSSAGKTKGTASTGHGNRYLAQILGEAAIAASRTDTFLGQRYRRI
ARRRGNKRALVAVGRSILVIIWHLLTDPDATFIDLGPDHYTKHLNPETKR
RNHIRQLEALGYTVTLTPAA
120405831YP_955660.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTRQKILITGASSGLGAGMARQFAAKGRDLALCARRLDNLDELKAELLER
YPDIKIAVAALDVNDHEQVPKVFNELSEELGGIDCVIVNAGIGKGYPLGG
GKLWANKATIETNLVAALVQIESALEIFKAAGKGHLVLVASVLGNVGVPG
TKAAYSASKAGVISLGESLRSEYASGPIKITVLEPGYIESEMTAKANKTM
LMVDNETGVKAMVDAIEKEKGRAVVPGWPWWPLVEVMKVLPPRFAKYFA
120405830YP_955659.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MADQLDRRREARSFHFDRHTPQYRDRFQEITAQMQARCPLAWTDTYGGHW
VAAGNREVFELARCPHVSNDNDIDGTRRGYTGINIPRGDYSVAFRGGMLE
MDDPEHREYRSPLNGYLSPAAVRRWVPVVDELVKACLDEKIEDGRIDFVD
DLANIVPAVLTLGLLGVPLKDWEIYCEPAHASVYTPADSPDFPRVADLAI
ASAMGMMHHVAEIRQTPRPGLIDALVRTRIDGQPAPDTEIMGMLMLLIGG
GFDTTTALTAHALEWLSQHPDERERLSRDRDTLLDPATEEFLRYFTPAPG
DGRTVAEDIEVDGVVLKEGERLWLSWAMANRDPALFQNPDEVVLDRKGNR
HFSFGLGVHRCIGSNVARTVFKSMLTAVLDRMPDFQCDAAGAVHYETIGV
IQGMQHLPAAFTPGPRLGPGLEATLEKLQRVCDEQQLAAPITVHKAAAVI
120405829YP_955658.1 XRE family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MSPVRRGETFPIHNRIGVLRAERRMSRAQLAEQIDVNPQTVGALERGDHY
PSLDLAFRICEVFDLPVEAVFSRKPFPPLSTELYRKDGRPQGGKAHA
120405828YP_955657.1 hypothetical protein Mvan_4878 [Mycobacterium vanbaalenii PYR-1]MPDATLIDRYQDFRTRRFLKHERTYSNALPGWRPQRRRRIIVAGLASTFV
VMAVVSVLCAFGIDWAPLIWLPAAAAFFPLWLLLQIVSGRQGDAPDAALD
EYELAQRNNARSIGLTVTQNLMLIPIFYLIFGSVMTRGTDTDMAYAGGLM
ALTVLLIGGCAPAMILGWTRPDPDA
120405827YP_955656.1 glucose-6-phosphate isomerase [Mycobacterium vanbaalenii PYR-1]MGSDITATPAWQALSRHHDEIRAKDLRGLFADDPTRGTGFALTVGDLYID
YSKHRVTRETLDLLLDLARTAGLPAKRDAMFSGAHINTSEDRAVLHTALR
LPRDASLTVDGQDVVADVHEVLDRMGDFTDRLRSGEWRGATGERITTVVN
IGIGGSDLGPVMVDQALRHYADAGISARFVSNVDPADLVAKLNGLDPATT
LFIIASKTFSTLETLTNATAARRWLVDGLGGSAGQDAVSKHFVAVSTNAK
LVDDFGIDTANMFGFWDWVGGRYSVDSAIGLSVMAVIGRERFAEFLAGFH
LVDEHFRSAPLEANAPVLLGLIGLWYSNFFGAETRAVLPYSNDLARFAAY
LQQLTMESNGKSVRADGTPVSTGTGEIFWGEPGTNGQHAFYQLLHQGTRL
VPADFIGFSEPTDDLPTADGTGSMHDLLMSNFFAQTQVLAFGKTAEEITG
EGTPPNVVPHKVMPGNRPSTSILATKLTPSVVGQLIALYEHQVFVEGVIW
GIDSFDQWGVELGKTQAKALLPVLTGADSPAAQSDSSTDALVRRYRTERG
RTA
120405826YP_955655.1 succinate-semialdehyde dehydrogenase (NAD(P)(+)) [Mycobacterium vanbaaMDTSALLKSVPTGLWIGGEERQGTSTFSVLDPSDDEVLATVADATADDAR
DALDAACAVQGEWAATPARKRGEILRSVFETITARADDIAALMTLEMGKV
FAESKGEVTYGAEFFRWFAEEAVRIEGRYTPAPAGTGRILVTKQAVGPCY
AITPWNFPLAMGTRKMGPAFAAGCTMIVKPAQETPLTMLLLAKLMAEAGL
PKGVLSVLPTSNPGAVTEALINDGRLRKLTFTGSTGVGKALVKQSADKLL
RTSMELGGNAPFIVFDDADVDAAVDGAILAKMRNGGEACTAANRIHVANA
VREEFTEKFVKRMSEFTLGKGLDEKSTLGPLINAKQVATVTELVSDAVSR
GATVAVGGVAPGGPGNFYPATVLTDVPADARILKEEVFGPVAPIAGFDTE
EEGIAAANDTEYGLAAYVYTQSLDRALRVAENIESGMVGVNRGVISDAAA
PFGGIKESGFGREGGTEGIEEYLDTKYIALTR
120405825YP_955654.1 acyltransferase 3 [Mycobacterium vanbaalenii PYR-1]MTAVSAAPIRVGPRRYVGPGQAIPALDGVRAIAVALVLADHGGVPGLSGG
FLGVDVFFVLSGFLITSLLLDEVGRTGRIGLKGFWIRRARRLLPALLVMV
LAVVALRELFSEESTANLREDAVAAFFWMSNWVFVAQHTDYFSQGAPPSP
LQHTWSLAVEEQFYVLWPLLIAAVLAGLAALAYRRGVPLSQRVVRTAVFV
LAAGGVVASATATFFLSSDATLNRVYFGTDTRVQALLVGAAAAALVVRDW
RGLTAGLVIFRSRWARWVAWSLPAVGLVVLFSAARMATGSAAEFRSGLLI
VVALAAVLVIAPVALAQDGPVARLLSAGPLVGLGAISYGVYLWHWPIFLV
LNGERTGIEGWELFALRCAATVAVAAVSWWLIEQPIREWRPAFVPMLPLA
AATAATAAVVTMTVLPVRMVPATPEPGPEVDIAALVGAEVPVEVTRAPRP
SAPGDLRVAVFGDSIAWTLMRYLPETPGLDFADYTTIGCGIARGGPYEYV
GQELPQKPECDEWPARWAQRVGHEKPDVVLLMVGRWEVVDRMMEGQWTHI
GEAGYDAYLRGELNRALDILGSTGARVVVTTEPYNRRAEKPDGSLYPEDQ
PKRVETWNALLRSVVDKRPNATVLDLNKKLSPNGYYQTRVDGIRVRSDGV
HPTPEAVEWLTPWLVDALKPE
120405824YP_955653.1 chorismate mutase [Mycobacterium vanbaalenii PYR-1]MTTMETTGSSGSSEANDIDELREEIDRLDAAILEAVQRRTEVSQLIGKAR
MASGGTRLVHSREMKVIERYSVLGDEGKNLAMLLLRLGRGRLGK
120405823YP_955652.1 ATP-dependent DNA helicase PcrA [Mycobacterium vanbaalenii PYR-1]MTSLSVSAGPTGTDELLDGLNPQQRQAVLHQGTPLLIVAGAGSGKTAVLT
RRIAYLLAARDVGVGQVLAITFTNKAAAEMRERVVSLVGPRARNMWVSTF
HSTCVRILRNQASLLPGLNSNFSIYDADDSRRLLLMIGKDMGLDTKRHSP
RLLANGISNLKNELIGPEQAAAEASEAEDDLARIIASVYAEYQRRLRAAN
ALDFDDLIGETVAVLQAFPQIAQYYRRRFRHILVDEYQDTNHAQYVLVRE
LVGTETVDGVPPAELCVVGDADQSIYAFRGATIRNIEDFERDFPNATTIL
LEQNYRSTQTILNAANSVIARNVGRRDKRLWTDAGEGELIVGYVADNEHD
EARFVAQEIDALSDAVADFSYNDVAVFYRTNNSSRAIEEVFIRAGIPYKV
VGGVRFYERREIRDIVAYLRVLDNPGDSVSMRRILNTPRRGIGDRAEACV
AVYAETTGANFNDALAAAAEGKVPMLNTRSEKAIKGFVELLDELRGGLDG
ELGDLVETVLDRTGYRAELEASSDPQDLARLDNLNELVSVAHEFSIDLAN
AKALASEEGAEPQDEDVPDTGVLAAFLERVSLVADADDIPEHGAGVVTMM
TLHTAKGLEFPVVFVTGWEDGMFPHMRALGDPGELSEERRLAYVGITRAR
QRLYLSRAKVRSSWGQPMLNPESRFLREIPQELIDWRRTEQPSSFSAPVG
NAGRYGAPRPSPTRPAAGKRPLIVLEPGDRVTHDKYGLGRVEEVSGAGES
AMSLIDFGSAGRVKLMHNHAPVSKL
120405822YP_955651.1 hypothetical protein Mvan_4872 [Mycobacterium vanbaalenii PYR-1]MADESSDSTEETRILRRAPLNTGAAPSAPTSEPVTQIVPRAQPVAVGPPR
AARADPKSAIATAVTSILSGWATTVIATDLITGWWATDPLFCVAMGFLAA
VSAAASISGLIALLLRRRTARLLVVVGAVIALLIFASLFVAGANLPALVY
AMPLLPAASIVLAALPATARWSRSA
120405821YP_955650.1 peptidase M23B [Mycobacterium vanbaalenii PYR-1]MPQHRLPRSIEVLAAPGPTEVTDIIPFNEFGDLSDLEFLPHAAFDRDTQV
IHAPELDDLHDTDDLTPLQLAVPSEFRAAPRADRRPSGRAYRDSHTDVSD
GTAKTDIIDMRGRTGLHRKAEVPVKGRLVVAAMAVGATAAGAYTMTNGTA
KAPAETVLASDHTTLGDSTVIAGSTDGMQIVTVAPAANSTVHAEEITKAA
AFAQERAEREARLTKPQFAMPTTGVWTSGFGYRWGVLHAGIDIANAIGTP
ILAAADGVVIAAGPEGGYGNLVKLRHADGTVTLYGHNSSVLVNVGERVMA
GDQIAKMGNTGNSTGPHCHFEVHLNGTDRVDPVGWLAKRGLTPGGYVG
120405820YP_955649.1 succinyl-CoA synthetase subunit beta [Mycobacterium vanbaalenii PYR-1]MDLFEYQAKELFAKHNVPTTPGRVTESAEDAKAIAEEIGKPVMVKAQVKV
GGRGKAGGVKYAATPEDALTHAQNILGLDIKGHIVKKLLVAEASDIAEEY
YISFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVPVDAVKGVDEA
FAREIAEKGHLPAEVLDAAAVTIAKLWEVFVKEDATLVEVNPLVRTPDDQ
ILALDGKVTLDANADFRQPGHAEFEDKDATDPLELKAKENDLNYVKLDGA
VGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDG
NNVEEGRRILSEANHPLVIQADTMDSGADKAAELANK
120405819YP_955648.1 succinyl-CoA synthetase subunit alpha [Mycobacterium vanbaalenii PYR-1MSIFLNKDSKVIVQGITGGEGTKHTKLMLKAGTQIVGGVNARKAGTTVKH
EDKDGNEVELPVFASVAEAMKETGADVSIAFVPPAFSKDAIIEAIDAEIP
LLVVITEGIPVQDTAYAWAYNVDKGQKTRIIGPNCPGIITPGESLVGITP
NNITGKGPIGLVSKSGTLTYQMMYELRDLGFSTAIGIGGDPVIGTTHIDA
IEAFEKDPETKIIVMIGEIGGDAEERAADYIKANVSKPVVGYVAGFTAPE
GKTMGHAGAIVSGSSGTAAAKKEALEAAGVKVGKTPSETAKLAREILAGL
120405818YP_955647.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTRPALFTPSASDTAALEALTVGRTDLLDTLTQRIRSSARDGSRPHTLLV
APRGAGKTHTLRVVLGRTLSDAATARHVLPVMVSEDSLAIGSYADLLVEA
ARAIGPQVAEQARQLRRARDPVGIEAAIIEAAAGRMILLAIENLDRVFDA
IGATGQGSLRAWVETSTTVLVLGTSPELFPGVSSREYPWYGSFMIETLPE
LTAQDAGELLRGAARRRGDTDFHRFLQSPDGRARVAAVHKIIGSTPRMWH
LLAECADAPSLDAVTPAVNALLDRLAPQYQQRLWQLPAGEQRLVVELARG
SEPRSVSELAEAVGVSNQSASAALGRLAAEGWVTSSKAAGDRRTSWYDLT
DPLLRSYLQYRGG
120405817YP_955646.1 hypothetical protein Mvan_4867 [Mycobacterium vanbaalenii PYR-1]MSLVVGGVVPVEDVVGRVRESNEVLASLPNSGAVLVGDRRHGKTSLARLV
QRMAADSGAVVVSVSAERETYAEFVAALISELARLDPAWAQELARIRLTL
TAGPVRLERDSRAAATLDDLLDRAVRRAGSRILALFIDEVSVLARNLERA
SPGSGDTFLHLLRRVRQENPGRVATVLSGSIGFHHVSADAPSTVNDIPKI
AVGPIRSDHATYLAECLLLGSGVPTTDRHEVAAAIAAAAENVPYYIQHLV
AAARKSWQDTQVAPYPELIDLLVLDAIESPYDPWDLRHYRDRLPHYYGAD
APAIAGLLDIYAHAAGQVGVDTVLMRLRSEGSPIGDRAQLVSFIERLTLD
HYLVRTGDTDGFASPLLQRAWKAMRR
120405816YP_955645.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MAVDPRTPVIVGVGQFTERIDDPAYRGMSAVELATAAVQAALVDTGADAA
VVAAAIDTVFGLRQFEISGPMPATLGKSNNYPRSVMKRVGGDPARVVLEP
VGGQGPQKLVTEAGNLIVAGDADVVMIMGSEPGSTAKYFAGRDDKPDFTE
HVDGQLEDRGHQIYNYIDEYTVTHGLTGAPVQYGLLDNARRSRLGLGVGP
YRHLMAELFAPMSKVAAKNPFSASLVERSVEEVETVTGENRMICDPYPRF
LVARDTVNQGAAAVLTSVEAARKLGVPEEKWVYLHGHSDLVEQALLERVD
LGASPAAVAAAHEALRVAGLGVDDIATFDLYSCFPFPVFVICEALGLSAD
DPRGLTLTGGLPYFGGPGNSYSLHGIAETVAQMRDRPGQFGFVGANGGIM
SKYSVGIYSTEPVGWRTSRSAELTAEVAERPRVAVTKSPEGAATIETYSV
RHDWPVRTGIIVGRLDADGSRFMATSEDADLVALMTEADPLGANITVTPT
DNGNRAVLR
120405815YP_955644.1 hypothetical protein Mvan_4865 [Mycobacterium vanbaalenii PYR-1]MRVTIPLIALATAALVAGCSMEKQPAPASVSTETAPPTDTPPADPPPGVD
FPDLSGYTESFDQFEQTDVPRVQGFSFSTPSGLICSSNAYPEPQFESVSC
RGPIAAQGPGLWEVTTLFGQAATVVAVVDDGLPRDTPPVLPPFHKVTASK
GAAECGVDDEGTVACRIGQDGFVLTPSSVELF
120405814YP_955643.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MNYGLVLFTSDRGITPAAAAKLADEHGFETFYVPEHTHIPIKRQAAHPTT
GDESLPDDRYMRTLDPWVSLGTAAAVTSRVRLSTAVALPVEHDPITLAKS
IATLDHLSGGRVSLGVGFGWNTDELADHNVPPGRRRTMLREYLEAMRALW
TQEEAEFDGEFVKFGPSWAWPKPVQAHIPVLVGAAGTEKNFKWIAKSADG
WITTPRDFTIDEPVKLLQDTWAAAGRDGAPQIVALDFKPDPEKLAHWREI
GVTEVLFGLPDKSEADVAAYVERLAGKLGALT
120405813YP_955642.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MGSSGGALPQADGVQSATGAPAQASPAPPPRPDDAAGWPQWLLYIVMTVI
SLLLFIVAATTLWWMLHAWRSPESLHSTGFRRRSAGRPKGFSLLLPARHE
QDVLGDTIDALARLDHPLYEVIVIIGHDDPETEHVARAAAARHPRIVRVV
IDTNIPKNKPKALNTALPTCRGEIVGVFDAEDEVHPRLLRLVEARFEEAR
ADVVQSGVQLMNIQTSWWSLRNCLEYYFWFRSRLHFHADQRFIPLGGNTV
FARTALLRSVGGWDRDCLAEDCEIGVRLSTRGARVAVAYDPKVVTREETP
GSLRALVKQRTRWDQGFMQVYRKGEWRKLPSRRQRMLARYTLAMPFLQAA
TGALVPIAIACMFVLKVPVPLTLLSFLPLAPTLVTVAVEAAALGEFGKEF
GIRIRLWDQVRLVLGAFPYQLLLAAAAVRSVWRELRGQGGWEKTEHVNAH
RAGGREEAIAA
120405812YP_955641.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MNTLKRINPSIPVLLALMALTAVLRLINIAGSPIRLDDEGTYVAQAFAMI
QWGELAHYTYWYDHPPAGWLQLAGWMLLTGPGFGGNAVTAGRYLMVVVAV
VGTGLLWLLARRIGMTRPAAAAAVTVLAVSPLAISLSRAVYLDNLAVAWM
LAGLVLVCSPRHRLSAMLGAAACFGIAVLTKETMLLFLPMVAWLVWTKTA
PATRRYALTVFGTVFALVVSIYALMALVRGELIPGPGHVSLWEGVKFQLW
QREASGSIGDPQSLKRHTIDEWLRLDPVLPLLAAPIALSALLIQRLRPYA
LGLLILVVTVLRPGYLPVPFVIAALPLIALLAAGLGEEGVRRLRRGGQIA
PRFGSRIRVTAALATAFAAAMLVALWVPSHDTVLSADDDAAMRQAQSWVA
ANVPEEDRLIVDDAMWVDLVRDGRDRHNVIWSYKVDTDEQVQNLAPDGWA
DYGWVVSTPSMRANMPDSGVLTDAMWHARPAATFGSGGERVDVLRVDSGG
APAARPAVPDFGVQVAARLHPDSDPDALADLQSGVVDQRTVATLSMLVSR
QPVVLQSISGVAAEEVAGTARREFRLGGPRDQLQAAAGFIERQRSPFGAE
TVQLSDNGLTVRFPARATDVGLGSRPDPVPAGPPAAVRIVDMRRGQAADR
LEFVHVDGTPVGSVRPGTGSPSDYRALPGGTYVMSTVADRGGVPVMRQAF
TVAPGATYTLALFSAGETGEIAAQLAPDGPVSGSSVRLLQAAAAAGPVKL
ALAAPGADPTVLADNASYGLITGYGAEPAGAYDAVVTAGGREWRQPVELT
DGTPTTLVVTDGRDGPAVHQTRDVAAAAAPLDPPAPGAPAVAPIPDKNPS
KTVAAGGDPRQKVLPLAACATVIAALAWALTRYQRRQGQWRGHGESVA
120405811YP_955640.1 glycoside hydrolase family protein [Mycobacterium vanbaalenii PYR-1]MVSRLRKAMLLLVALLLVVGAGWAAAQAVDPRMSDDDVRGMREQAARQAG
EDFLSRYVESDGRVVRRDEGGDVVSEGQAYGMLIAAALGDEPRFRAIWDW
TRTHLRRPDGLLSWRWADGRVTDPSSATDADLDAARSLLLAARRFAAPEL
AEDGKRLGADVLRGETVTVGAAPSPAMARPGLITVAGNWATAPPHAVDPG
YFSRRAERELLDASADRRWLDVSRTQRVLVWQLIGTASLPPDWASVDPAG
RAVPTGPPDGGPTRFGLDAARLPIRFAESCDPADRAVAVSLRRVVAASRD
IPATRNLDGSAAGEWQHPVALVSAAATDHAAGDREAGAARLDQASALQQR
YPTYFGAAWVALGRIMLDTSLLGECA
120405810YP_955639.1 alkanesulfonate monooxygenase [Mycobacterium vanbaalenii PYR-1]MAVAWLTMTTERIADHVKFAYWVPNVSGGLVTSDIEQRTDWNYEYNRKLA
RTAENNGFEYALSQVRYEASYGAEYQHESTSFSLALLLATERLKVIAAVH
PGLWQPAVLAKLGATADQLSGGRFAVNVVSGWFKDEFTHLGEPWLEHDER
YRRSAEFLQVLRKIWTEDDVDFRGDFYRIHDFTLKPKPANTAERPNPELF
QGGNSTAARRNGGYYADWYFSNGKDFDGVTEQVVEVRDHARAAGREVRFG
LNGFIIARDTEKEAKEVLREIIAKANTPAVEGFRGAVQQAGNSTSDRKGM
WADSTFEDLVQYNDGFRTQLIGTPEQIAERIAAYRERGVDLILGGFLHFQ
EEIEYFGARVLPLVREIENSGRVSADSPVLVPA
120405809YP_955638.1 hypothetical protein Mvan_4859 [Mycobacterium vanbaalenii PYR-1]MSYPQGAPGGQGFPPGQQPTTQFSAPTQQFNRVPDADPVAEGPSKLPVYL
SAAVVALGLLVYMSSFGPHFTASDFSAFGELTGSSFGVILAVISAITAGL
FAAVGLLPRQNNFTAVAAVAAVLALLLVVAEIINKPAEASIGWGLYLVIA
FILLQAAVSVVVLLFDAGIITPPVPRPKYEQPQSYGQYPGYYGQPPTQGG
SGQHQQGPQQQQRPGYPTPYGGYPGSGPGTGGFPAGAQSGPPTPPTGFPT
YGQPPASNTPTSQAPAPHQSPSSSQPGQSSS
120405808YP_955637.1 hypothetical protein Mvan_4858 [Mycobacterium vanbaalenii PYR-1]MSTRPVGTRQARDLLRVAFGPSLVALVIIAAVVLLQLLIANSDMTGAFGA
IASMWLGVHLVPVSIGGSALGVMPLLPVLVMIYGTARTTAAATSSSWFVT
RWVVASALGGPVLIAAICLAVIHDAASVLTQLQTPDALHAFGYVFTVHAI
GAVLGVGSRVGRRLLSASPLPGWLPDAFRAAAAGVLALMGLSGAVVAGSL
VVHWSTMHDLFSITDSMFGQLSLTVLSVLYLPNVMVGASAVAVGSSAHIG
LATFSSFTVFGGDIPALPVLAAVPTPPLGPVWVALMIIAAVSAVALGQQC
ARHPLPMPAALAKVLTAAAAAAGAMALLGHAGGGPLGNFGNVGVDQATFA
PAVFLWFFGIGALTVAMSGGITPRVRKPKPVPEPAAVVDDAVIETADAEP
HTEEIALEAPPRDRPDPDPRIEPAGEPAPPVPDGPIDADLDPEDHFVVDE
QTSPFVEDEENGHFVEDEENGPFVEDEENGHFVEDEENGLSVVDDDSGGK
REQGDH
120405807YP_955636.1 phosphoribosylglycinamide formyltransferase [Mycobacterium vanbaaleniiMQPEAGGREERCVLRVPPSAPARLVVLASGTGSLLASLLKSAVGDYPARV
VAVGTDRVCAALDIASGAAIPTFTVPLSEYPDRAAWDAALADATAAHRPD
LVVSAGFMKILGPQFLSTFPGRVLNTHPALLPAFPGAHAVRDALAYGVRV
TGCTVHLVDAGTDTGPIVAQQAVTVLDGDDESSLHERIKVIERQLLVDVV
AAMATRGMTWTGRKVNLG
120405806YP_955635.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferaseMSDNDDLFRRPIRRALISVYDKTGLVPLAQGLHAAGVDIVSTGSTAKTIA
GAGIPVTPVEDVTGFPEVLDGRVKTLHPHVHAGLLADQRKAEHVAALAEL
GVTAFELVVVNLYPFTQTVNSGADEDECVEQIDIGGPSMVRAAAKNHPSV
AVVVDPLGYDGVLAAVRAGGFTYSERKKLAALAFRHTAEYDVAVASWMES
VLAPEAEATSGDLPPWLGATFRRAAVLRYGENPHQQAALYRDDGGWPGLA
QAEQLHGKEMSYNNYTDADAAWRAAFDHEDICVAIIKHANPCGIAISPVS
VADAHRKAHECDPLSAFGGVIAANTEVTVEMAETVAGIFTEVIIAPAYEP
GAVEVLSGKKNIRVLVASEPQRGGTEFRQVSGGLLLQQRDALDAAGDNPN
TWTLAAGPAADPDTLADLAFAWRTCRAVKSNAIVLARDGATVGVGMGQVN
RVDAARLAVERAGGRSSGAVGASDAFFPFPDGLETLIRAGVKAVVHPGGS
VRDDEVTAAAEADGITLYLTGARHFAH
120405805YP_955634.1 hypothetical protein Mvan_4855 [Mycobacterium vanbaalenii PYR-1]MDSRTVRRRVLAATAVLAATLVPSCTRVVDDARAVAAVPGAPFGSYASAD
ACTPVDSELADVPPPRGAAADIEPVLRIPRPEGWKRVTALDSGAIRYVMR
NEGLATGGITPTAVVTLESHRGELSPREFFADQRRQVMQLGVTDLTLTDT
TLCGLPAVRGHYMSPLLGTAAPRRADLLSAVMVSEGTTYGVAVTVQSADE
RDPEYQRDSAQILDGFQMLPPGSR
120405804YP_955633.1 putative magnesium chelatase [Mycobacterium vanbaalenii PYR-1]MTSPNDLPRTVGELRASGHQERSIKAEIRENLLSALASGAGADAVWPGIL
GFEDTVIPQLERALIAGHDVVLLGERGQGKTRLLRALTNLLDEWTPVIAG
AELGEHPYSPITPESIRRAADSGDDLPITWRHRSERYTEKLATPDTSVAD
LVGDIDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDLAERIQVA
MLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPLKDRFGA
EIRTHYPPELDAEVGVITQEAHLAAEVPDYLLQILARFARSLRESSSIDQ
RSGVSARFAIAAAETVAASARHRAALLGEQDPVARVVDLQNVIDVLRGKL
EFESGEEGREQAVLEHLLRRATAETAQRLLGGIDVGPIVTAVENGSPVTT
GERVSAREVLAAVPEVSAVAEIQQRLGATSEGQRAAAMELALEALYLAKR
IDKVSDEGETVYG
120405803YP_955632.1 von Willebrand factor- type A [Mycobacterium vanbaalenii PYR-1]MAKHVRLSRYSRYTGGPDPLAPPVDLREALEAIGQDVMEGTSPRRALSEM
LRRGTQNMPGADKLAAEANRRRRELLQRNNLDGTLADIKKLLDEAVLAER
KELARALDDDARFGELQLNSLSPSPAKAVQELSDYDWRSPEAREKYDQIK
DLLGREMLDQRFAGMKEALENATDEDRQRVNDMLDDLNDLLDKHAKGQDS
PQDFQDFMAKHGQFFPENPKNIDELLDSLAKRAAAAQRFRNSLSEQQRAE
LDALAQQAFGSPSLMNALDRLDAHLQSARPGEDWTGSQRFSGDDPLGMGE
GAQALADIAELEQLAEQLSQSYSGATMDDVDLDMLARQLGDEAAVNARTL
AELERALMNQGFLDRGSDGQWRLSPKAMRQLGQAALRDVAQQLSGRHGER
DTRRAGAAGELTGATRPWQFGDTEPWNVTRTVTNAVLRTAGTNAVLREAG
TGETAGPIRITVDDVEISETETRTQAAVALLVDTSFSMVMENRWLPMKRT
ALALNHLVSTRFRSDALQIVAFGRYARTVTAAELTGLEGVYEQGTNLHHA
LALATRHLRRHPNAQPVVLVVTDGEPTAHLEDFDGDGRSAVFFDYPPHPR
TIAHTVKGFDEVARMGAQVTIFRLGSDPGLARFIDQVARRVGGRVVVPDL
DGLGAAVVGDYLSAKRRR
120405802YP_955631.1 hypothetical protein Mvan_4852 [Mycobacterium vanbaalenii PYR-1]MSTPASRSGAMRAGDTDRIQVAQLLTDAAASGTLGLSEYESRLSRAYAAQ
TYDELDRLSADLPGAVTRGRGGPCRPAPSTLLLAILTGYERRGRWNVPRR
LTTFALWGGGVVDLRYADFTSPEVDIRSYSIMGGQTILVPPEVNVDSRGV
AVMGSFDHGVDGEGSAGAPLVRIRGFALWGSVGVKRKRRKAPADTAEG
120405801YP_955630.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MGVPPACGGRSREEATVLMSTLVTYERDGAVARLTLDSPHNRNALSTALV
EQLHDGLTRASSEPRVRTVVLGHTGRTFCAGADLSEAAGRDPSDLAVDRA
REMTRLLRRILELPLPVIAAVDGHVRAGGLGLVGACDIAVAGDSSTFALT
EARIGVAPSIISLTLLPKMTARAAGRYFVTGEKFGAAEAAAMGLVTVATD
DVPGTVADLTSAIAQGSPQGLAASKALTTAALIDDFERRAEKLTQESARL
FVSEEAREGMLAFLEKRPPRWVG
120405800YP_955629.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMSFIETDEQQALRKAVAAMAANYGQDYYLEKARAGQHTDELWSEAGKLGF
IGVNLPEEYGGGGAGMYELSLVMEEMAAAGSSLLMMVVSPAINGTIISKF
GTEEQKKRWIPGIADGSLTMAFAITEPDAGSNSHKITTTARRDGSDWVLS
GQKVYISGVDQAQAVLVVGRTEDHKTGSLKPALFVVPTDTPGFTYTKIPM
EIVSPEFQFQVFLDEVRLPADALVGSEDAAIAQLFAGLNPERIMGAASAV
GMGRFAIGRAVEYVKTRQVWKTPIGAHQGLSHPLAQNHIEVELAKLMMQK
AASLYDAGDDAGAAEAANMAKYAAGEASVRAVDQAVQSLGGNGLTQEYGI
ASALTASRLARIAPVSREMILNFVAQTSLGLPRSY
120405799YP_955628.1 carbamoyl-phosphate synthase ATP-binding subunit L [Mycobacterium vanbMITRVLVANRGEIARRVFATCRRLGIGTVAVYTDADAGAPHVAEADARVR
LTGTRGYLDAAQLIAAARSSGADAIHPGYGFLSENPDFAAAVQDAGLRWI
GPPVAAVAAMGSKIEAKKLMAAAGVPVLDELDPDTVTADMLPVLVKASAG
GGGRGMRVVRDLAELPAQVEAARREAQSAFGDPTVFCERYLDAGHHVEVQ
VMADVHGTVWAVGERECSIQRRHQKIIEEAPSPLVERVAGMRDKLFEAAR
LAATAIGYSGAGTVEFMADDQGAFFFLEMNTRLQVEHPVTELTSGVDLVE
LQLAVADGATLDPSPPAPRGASIEARLYAEDPANNWQPQPGAVHHFDVPT
AGVEFGPLDRTGVRLDSGITDGAVISVFYDPMIAKVISYAPTRRQAAALL
ADALTRARIHGVRTNRDLLVNVLRHPAFGDGATDTAFFDTHGLAELAAPV
ADDRTVALSAVAAALADAAHNRSTATVFEDIPSGWRNLPAGFQHKSYQDH
AGRAHDVRYRFTRDGVMIDGHDDVSVVSAGQRQVVLTVSGVDRPFDVTRY
GDSVFVDSPCGCTHFVALPRFPDPAAALAHGSLLAPMPGSVLRVGAAPGD
TVTAGQPLLWLEAMKMEHTITAPTDGVLVELNVEPGRQVEVGAVLARVES
QEGDPR
120405798YP_955627.1 propionyl-CoA carboxylase [Mycobacterium vanbaalenii PYR-1]MTTATSDGGTSRSRGTDRASILQTAIDTASPAFLEAAEVMTAKLAELEAE
HTKALAGGGEKYVARHHARGKMTARERIEALLDPDSPFLELSPLAAWGTD
FTVGASIVVGIGAVSGVECLLVANDPTVKGGTSNPWTLRKILRANQIALQ
NRLPVISLVESGGADLPTQKEIFIPGGQMFRDLTRLSAAGIPTIALVFGN
STAGGAYIPGMSDHVVMIRERSKVFLAGPPLVKMATGEESDDESLGGAEM
HARTSGLADYFAVDELDALRIGRRIVARLNWRKQGPAPRPVVVPRYDENE
LIGVVPPDLRIPFDPREVIARIVDGSEFDEFKPLYGGSLVTGWATLHGYP
LGILANARGVLFSAESQKATQFIQLANRSNTPLLFLHNTTGYMVGKDYEE
GGMIKHGAMMINAVSNSTVPHISLLIGASYGAGHYGMCGRAYDPRFLFAW
PSAKSAVMGGTQLAGVLSIVNRAATEARGGQVDEAADAALRAAVEAQIEA
ESLPMFLSGRLYDDGVIDPRDTRTVLGMCLSAIANGPIEGTSNFGVFRM
120405797YP_955626.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMSIWTTPERDDLRKTVRAFVEREVLPHAGEWERIGELPRELHRKAAEVGL
LGAGFPESVGGGGGDGADAVVICEEMHRAGAPGGVFASLFTSGIAVPHMI
ASGDEHLIDTYVRPTLRGEKIGALAITEPGGGSDVGHLTTRAVKDGDCYI
LNGAKTFITSGVRADYVVTAVRTGGPGAGGISLIVVDKDGPGCSPGLQVT
RKLDKMGWRSSDTAELSYTDARVPAGNLVGAENTGFLQIAAAFVSERVGL
AAQAYSSAQRCLDLTVEWCRSRETFGKPLITRQSVQNTLAEMARRIDVAR
VYTHHVVERELAGETNLIAEVCFAKNTAVDAGEWVAHQAVQLFGGMGYMA
ESEVERQYRDMRILGIGGGTSEILTALAAKTLGYQS
120405796YP_955625.1 hypothetical protein Mvan_4846 [Mycobacterium vanbaalenii PYR-1]MTTAPFRTPVRIGNCSGFYGDRLAAMREMLTGGELDYLTGDYLAELTMLI
LGRDRMKNPDRGYARTFLRQLEECLGLAKDRGVRIVANAGGLNPAGLAAA
VRALADKLGVAITVAHVEGDDLLARAEQLRLGNPLTANAYLGAWGIVDCL
DSGADVVVTGRVTDASVIVGPAASHFGWQPTDHDLIAGAVAAGHVIECGT
QASGGNFSFFTELADLSHPGFPIAEIHADGTSVITKHPGTGGAVTVDTVT
AQLLYEIGGARYANPDATLRVDSIELTSQGPDRVRISGVKGEPPPPTLKV
SLNSLGGFRNEVTFVLTGLEIEAKADLVRRQLETSLPVRPAELEWTLART
DHPDATTEQEASALLRCVVRDPDPATVGRQFSSAAVELALASYPGFTSTA
PPGDGQVYGVFTAAYVPAHDVAHVAVHSDGVRIDIPAATDTEELTDPPQP
QLPPQREFGVTRRVPLGLIAGARSGDKGGSANVGVWVRTDDQWTWLVHTL
TVEKVRELLPEAADLPVTRHVLPNLRAVNFVIDGILGRGVAYQARFDPQA
KGLGEWLRSRCIEIPEELLP
120405795YP_955624.1 50S ribosomal protein L32 [Mycobacterium vanbaalenii PYR-1]MAVPKRRMSRANTRSRRAQWKATATNLVGVTVAGQQRKVPRRLLKAARLG
LIDLDRR
120405794YP_955623.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAV
VLDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTTPDDGAGESAAMTFSDLSLDPVTREVTRG
DRPISLTRTEFSLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYV
GYLRRKTEAEGEPRLIHTVRGVGYVLRETPP
120405793YP_955622.1 integral membrane sensor signal transduction histidine kinase [MycobacMAADNAGRWPGQPPGPPAPTHPASSVSLRWRVMLLAMSMVVISVVLMAVA
VFAVTSRALYDDIDNQLRSRAQMLIESRSLDIDPGKAIEGTAYSDMNAMF
YIPGRSKYTANQQGQTLPVGQPEQDVMDGTLLLSLRTVEHQRVLAIRLAS
GNTLLLSKSLAPTGKVLKRLGTVLLIVGGLGVAVAAIAGGMVASAGLRPV
GRLTQAAERVARTDDLRPIPVIGNDELARLTETFNMMLRALAESRERQAR
LVTDAGHELRTPLTSLRTNVELLMESMKPGAPRIPEEDMAELRTDVIAQI
EEMSTLVGDLVDLTRDDAGNAVHETVEITEVIDRSLERVRRRRNDIQFDV
AVTPWQVYGDAAGLGRAVLNLLDNAAKWSPPGGRVGVGLTQIDALHAELV
VSDRGPGIPPQERALVFERFFRSTSARSMPGSGLGLAIVKQVVLKHGGTL
RIEDTVPGGTPPGTAMHVVLPGRPSPAGSDEAER
120405792YP_955621.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium vanbaalenii PYR-1MTNQPSYSPTPQPGRQSGYPGQVPPGHAGPRTGSYEQQGSGGWDWRYATE
QQRQAFRAPYDPYAGAPMPSGPGHHPRPGMPVTPPRQPRKGSRATALAAG
AVAVALVSGGIGGGVAMLVHPDHGVPGISASGAAPGMPAASVPAGSVEAV
AAAVVPSVVKLEVSQGRASEEGSGVILSTDGLILTNNHVVATAAGAAGEP
GGPAKTKVTFADGKTAPFTVIGADPSSDIAVVRAQNVSGLTPITVGSSAD
LRVGQDVVAIGSPLGLEGTVTTGIISALNRPVAAGGDARNQNTVLDAIQT
DAAINPGNSGGALVNMNGELVGINSAIATMGADAGAQQGGSIGLGFAIPV
DQAKRIADEIIQTGSASRASLGVQVGNEAGVDGAKIVEVTAGGAASAAGL
PSGVIVTKVDDRLINSADALVAAVRSKAPGDKVTLTYLDPAGKSQSLDVT
LGKAGQ
120405791YP_955620.1 molybdenum cofactor synthesis domain-containing protein [MycobacteriumMTAPRYTVELMEQPQALVGRALVVVVDDRTAHGDEEDHSGPLVTELLGEA
GFVVDGVVVVSSDEVEIRNALNTAVIGGVDLVVSVGGTGVTPRDVTPEST
RELLDRELLGIAEALRASGLSAGIIDAGVSRGLAGISGSTLVVNLAGSRA
AVRDGMATLGPLAGQVIAQLSSLEI
120405790YP_955619.1 hypothetical protein Mvan_4840 [Mycobacterium vanbaalenii PYR-1]MKAISRVLIAVVASIAALFVSTGTSHAGLDNELSLVDGQGRTLTVQQWDT
FLNGVFPLDRNRLTREWFHSGKATYIVAGEGADDFEGTLELGYQVGFPWS
LGVGINFSYTTPNIAFDGWGLDDNLADSIVTPPLFPGVSISADLGNGPGI
QEVATFSVDVAGPGGSVAVSNAHGTVTGAAGGVLLRPFARLISSTGDSVT
TYGAPWNMN
120405789YP_955618.1 hypothetical protein Mvan_4839 [Mycobacterium vanbaalenii PYR-1]MKVISRVLIAMVASIAALFASTGTSHAGLDNELSLVDGQGRTLTIQQWDT
FLNGVFPLDRNRLTREWFHSGKATYIVAGEGADDFEGTLELGYQVGFPWS
LGVGINFSYTTPNIAFDGWGLDDNLADSIVTPPLFPGVSISADLGNGPGI
QEVATFSVDVAGPGGSVAVSNAHGTVTGAAGGVLLRPFARLISSTGDSVT
TYGAPWNMN
120405788YP_955617.1 large-conductance mechanosensitive channel [Mycobacterium vanbaalenii MLKGFKEFISRGNVIDLAVAVVIGAAFTGLVTAFTENVIQPLIDRIGAGP
DAEYGILRIPLGGDQFVDLNAVLSAAVNFLIVAAVIYFVIVVPFKKLKER
DKKVESTETELTLLTEIRDLLRDNAADAATGRHGGTGPQSHADE
120405787YP_955616.1 hypothetical protein Mvan_4837 [Mycobacterium vanbaalenii PYR-1]MAKHAKAPTRSSKKLGVLGLGSFAVATAFAGLGSGTAGADVEEIGPGPTV
TSRQATEFSVVRINDFGVARGISESRVADAGIINAFGEVRDGVKAVVGTT
SSAFEGEWPVGPGIGDW
120405786YP_955615.1 SAF domain-containing protein [Mycobacterium vanbaalenii PYR-1]MGHSLDPTALDRLGRVLRPDWTRTPTARRVVAGALVVLAGVAAWRGDPQA
EQSDVVVTLHDLSPGAEITAADVRVETRSASTVPEGAHSDVDAVVGATLA
GPTRRGEIVTDVRLLSSRLAESAAGPDARIVPIPLADAALTDLVRAGDVV
DIVAGPADEAGAARLIATDAVVVLVSAEQNGVGSRSGGRIVLVALAATAA
KAVAGATLVEPVTLTLH
120405785YP_955614.1 FmdB family regulatory protein [Mycobacterium vanbaalenii PYR-1]MPTYSYACTDCSNKFDVVQAFTDDSLTDCPQCDGRLRKVFGKVGVVFKGS
GFYRTDSRESGKSSIPSGGSGASDSSGSSGSSGASGSSGSSDKSSSSDKS
STSSSAAAPATAASS
120405784YP_955613.1 5-formyltetrahydrofolate cyclo-ligase [Mycobacterium vanbaalenii PYR-1MALTKAQVRAEILTARRSLTQQQHDREAAQLAAHLKALIAPGTVVCAFIP
VGSEPGSIAMVDDLVHRGVEVLLPVAREDIDGTPLPIRWGPHTPGAVAKA
PFGLREPHPPWLPPEAVGRASVVLVPALAVDRSGARLGRGAGFYDRTLPL
ADADAWLVAVVRDDEVVDHLPSEPHDVRMTHALTPQKGLVALGPEAGPSG
RE
120405783YP_955612.1 nucleotidyl transferase [Mycobacterium vanbaalenii PYR-1]MNRAEVPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEA
AEAGAERLIIVTSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPA
LIKVESVVQAEPLGLGHAISCVEASLAPDEDAIAVLLPDDLVLPTGVLET
MSKVRAKRGGSVLCAIEVDREDISAYGVIDVEPLPDANNPNVLKVKGMVE
KPKPEDAPSLYAAAGRYVLDRAIFDALRRIPRGAGGELQLTDAIALLIQE
GHPVHVVIHRGSRHDLGNPGGYLKAAVDFALERDDYGPELRRWLVERLGL
APATSGQ
120405782YP_955611.1 molybdenum cofactor synthesis domain-containing protein [MycobacteriumMRSVEDQQARVAAAAVAPRPVRVAIAEAQGLMCAEEVVTERPMPGFDQAA
IDGYAVRSVDVLGIGGSDEDAGLDGESDRDESRPREISLPVMGLIEAGAR
TPSRLQPRQAARVQTGAPMPTLADAVLPLRWTDGGDSRVTVLRGVRSGAY
VRRTGDDVQPGDVAVRAGTIIGAAQVGLLAAVGRERVLVHPRPRLSVMCV
GGELVDISRTPGNGQVYDVNSYALAAAGRDAGAEVNRVGIVSTDPKQLRE
VVEGQLSRAEVVVIAGAVGGAAAEAVRSVLAGLGDMEVARIAMHPGSVQG
FGQLGPDGVPVFLLPANPVSALVVFEVMVRPLIRLSLGKRQATRRIVPAR
ALSPISSVAGRKGYLRGQLMRDQDTGEYLVQALGGAPGASSHLLATLAEA
NCLVIVPSEAEQIRTGEIVDVAFLAQRG
120405781YP_955610.1 N-acetyltransferase GCN5 [Mycobacterium vanbaalenii PYR-1]MAAVMNLLSSRSQHPGWPLAVGPLRVPAGVVRLRPVRLRDAAQWSRIRLA
DRGHLEPWEPSTDMDWELRHSVSAWPSVCSGLRSEARKGRMLPYVIELDG
QFAGQLTIGNVTHGALRSAWIGYWVASGSTGGGVATAALALGLDHCFGPV
MLHRVEATVRPENGPSRAVLAKAGFREEGLLKRYLDVDGAWRDHLLVAIT
IEELNGTAASALVRAGRASWA
120405780YP_955609.1 hypothetical protein Mvan_4830 [Mycobacterium vanbaalenii PYR-1]MPSIPQSLLWISLVVLWLFVLVPMLINKRDAVRRTSDVALATRVLNSGAG
ARLRRRGGPAAGHRSDPDWRPSASDLDEDLDDVEEKAPSRAVVMVAGAAG
GADAEPDYLDVDVVEDSGAQPVAELAADAQQAESVAAESNELTLDFAEAD
ELDDAPEDRDEAVAEGAERDTAEDTGVYSVIDDEYENVEDEYEDAEGEYE
DVDDASEQGDSSEADLRMAESISDARRRRRESTTAAAVSARKYRFRARTI
AVMAVLLLASAVAAFTWSPSMWYICGAVGTVTALYLAYLRRQTRIEEQVR
RRRAQRMARSRLGVENTSDRDFDVTPSRLRRPGAAVLEIDDEDPAFEHLD
YVPFSRHYDLPRAAGQ
120405779YP_955608.1 hypothetical protein Mvan_4829 [Mycobacterium vanbaalenii PYR-1]MRYFIRNIDHSGPILEHMSEVKMYVQEFLDRIAAAERLVREAPHVESEAD
LLEGLQYLAGCIAACTRLAFDYDRDHPFLHSGTGPFTKMALDNPDTLYFG
TWLQGGHEYVLTGRRGTTTDLSFQLLGGEYTEDNVPDNQFAFDDRELDLA
VDGSFEWRFTPNSDAQLVVREVYNDWSAQRGTIAIARTDSTGTAPRTLTP
ELIAIRYAAAGKHLTRRIRTWLSFPQWFYLNVPVNTLTAPRITPGGLATQ
YSSVGHFDLGPGRAMVITLPASDAPYLGFQLGSMWYISLDYINHQTSLNG
TQAQVDPDGMIRIVVAHESPGIANWVETLGHRRGYLQFRWQRTSRKLTAA
EGPIAEVVDFDAIPSRLPYFGHNTISNDDFRTRIALRQNQIANRMVA
120405778YP_955607.1 hypothetical protein Mvan_4828 [Mycobacterium vanbaalenii PYR-1]MPLSHADRARAFALPGVAHVGDRTGLSRTLIGEGDQFQRSAHAQRCSEPQ
SPPSRRSNRVSEKWSQGQNCRTQTLPTGYSA
120405777YP_955606.1 hypothetical protein Mvan_4827 [Mycobacterium vanbaalenii PYR-1]MYVRAMSGSDVQAAVTALRTAFDDMAACDVDLLTRPDLVAALDELETVGC
RLPALSYRLLARLQAETTPPQMGAKSWKEVLAVRWRISTSEAHRRLTEAA
VLAPRQAMTGEALPPVLPATAAAQAHGLINAEHVEVIRKAMAKLPGFVDT
ATRERIEVDLVRTAVGNGPKELKDSADRTLFLLDQDGPEPDERERARKRA
VTKHKQREDGMVDVSATLTPEAWAVWEAIFAKFAAPGMCNPDDPEPCTSG
TPSQAQIDNDHRSLAQRQHDALLAGGRIALMSGQLGQLNGLPVSVIIRTT
LQDLESRAGVGVTGGGTVMPIAEVIRMAGHAHHYLAVFDRATGSALDLFR
TRRIASPAQRIMLIARDGGCTKPGCPVGAYGCQGHHVEADFAQGGNTNVD
ELGLACGPDNRDVNDHGGWTTQMNERCEVEWTPPPPLDTGQARINNYHRP
ERLLRPPEEPEPHSDNDIAATAKPAEGNEIGDAQPGAPHPADNPGEPGGP
APPDNQAA
120405776YP_955605.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMSRVQLALNVDNLDEAISFYSKLFNTPPAKVKEGYANFAVAEPPLKLVLL
QNPGKGGTINHLGVEVDSSDTVHSEIARLAGEGLFTEEEMNTTCCFATQD
KVWVTGPAGEKWEVYTVLADSETFGVSPGHADGGTAESGVCCGGAATDAA
KPATLNACC
120405775YP_955604.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MSTDWHNRVMPKALPSIDISAPVCCAPVAAGPMSDEDALQVALRLKALAD
PARVKIMSHLYSSAAGEENSGSLAKVLGLTESTVSHHLSQLRRAGLVESD
RRGMNVYHRPHRDAIGALCVVLDPNCCA
120405774YP_955603.1 hypothetical protein Mvan_4824 [Mycobacterium vanbaalenii PYR-1]MPLDEPQGTDKPTMWQYLTYCYGRRLPASMNRWVAEDLAGDGAVRRHMIR
YAIPPLLILAPLWLIPAPIYMRLEMTAPIYIWALLMALALNKVWRRHRLA
KHGMDPNLVDVIKRKRDAQMHEDYVRRFGPRPDDAQAHSNSSPF
120405773YP_955602.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MATPAAQELDPLALERQVCFALAATNRAVLAIYRPLLEPLGLTHPQYLVM
LSLWDQQKRSSGRPSPMSVKQIARTLQIDSATLSPMLKRLEAIGLITRAR
NTADERSTDVQLTDAGAELRRRALDIPAAVIERLGVDVAELEHLHEVLTR
INSAAVAAGALQS
120405772YP_955601.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MNTELGFVGLGNMGFPIMTRLVEAGHRVLVFDTRADVVAQAVRAGAEART
SARDVADRAETVLASLPTPQVSNSVASEVAEGSRVRRFVDLSTVGQQAAQ
RNREVLSARGIAALDSPVSGGVHGARAGTLAVMVSGPRPEFEALASVFAV
LGRAIFVSEQPGAAQTMKLINNLMAATALAATAEVMVMGVKAGLDPQVVI
DVLNAGSGGTHASRDKFPRAVLPRTFDYGFATGLMTKDVLLYLDEARALG
TPVALAESVMRLWEQTQDEEGPSSDFTSVVKPLERIAGVTIGPT
120405771YP_955600.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MDPQTYELGRQIRTTVLGADYVQRAASDADDFSQPLQDLVTEYCWGAVWG
RDGLPLKTRSMLNLAMIAVLNRPQELATHIRGALNNGVTRDEIREIFLQV
GIYAGIPAAVDSFRVAKTAFAELEAE
120405770YP_955599.1 hypothetical protein Mvan_4820 [Mycobacterium vanbaalenii PYR-1]MRTLITGVDADGRSCVVSADELALDQLAPGFATGIPFATTASPPPARPDG
AAPLIDQGIAPGLARWMIVELGPDSETPMHHTDTLDLETVLSGSVDLVLD
DGAHRLEQGDLVVLAGVDHAWRAGPDGCRLSAVLIGTPPPA
120405769YP_955598.1 diguanylate cyclase [Mycobacterium vanbaalenii PYR-1]MQWDQRRVDHYEWFSGFLDARGAKPAVRLLIASIALLMAGSVLLLIFSAG
GPEGQPQRAMMWLSVAGGVAGVMLWLWHWPSRLQSAAFATVTAFSVALAG
LAYPDPLAALLGCIAFTTNGAYLAFFHTTRLLLGNIVIAIGVATVEAIQL
AAQGRIALAAVDLFLVVQINIAVPLAIRILLHALRGDLHYADHDPLTGLL
NRRAFRRQILSLLARSHGEGRYLVVALMDLDHFKALNDARGHIAGDQALI
AVADALRTTATSTAVVARSGGEEFLIADVTGSPSAAAHYQQVCDAITALP
VGLTASIGTAVAALRDVPVEAFESTIDRLVSAADMAMYRAKRNGGNQCHH
LDAWPPPGPA
120405768YP_955597.1 cyclic nucleotide-binding protein [Mycobacterium vanbaalenii PYR-1]MSGLTAVRADDLAALTVFDGISVEALVPLAAQLRPLTAAAGQVLMQQGEL
AVSFLLIGSGRAEVVHGGDDGHDTVAELTAGLIVGEIALLRDAPRTATVV
ATEPLTGWVGGREAFATMLDVPGMMDRLVRTARQRVAAFVTPVPVEMRDG
TVLYLRPVLPGDVERTVGGPVEFSSETLYRRFQSVRSPSKSLLAYLFEVD
YLDHFVFVLTEGPDGPVVADVRFVREEHRSEQAEIAFIVADAYQGRGIGT
FLMGAISVAAGYDGVQRFTARVLSENYAMRSILDRFGAVWHRDDLGVVTT
EIPVPEVGELGLSHELVTQIRGLARQVIRAAG
120405767YP_955596.1 shikimate 5-dehydrogenase [Mycobacterium vanbaalenii PYR-1]MTRPPLTKDTRLCISLAGRPSNIGTRFHNHLYEVLGLDFIYKAFTTTDIV
AAIGGVRALGIRGCSVSMPFKEDVLHLVDHVEASAQAIESVNTIVNDDGR
LTASNTDYLAVQQLIGEHGLDPEDTVMIRGSGGMAKAVGAAFAGAGFRTG
FVVARNPESGHALADRLGYTYVADVGTVTAPIIVNVTPIGMAGAPEQREL
AFGAAAIAAADTVFDVVALPSETPLIKAARAAGAQVITGAQVIALQAAEQ
FERYTGVRPTPEQIAEASALSRA
120405766YP_955595.1 LpqN [Mycobacterium vanbaalenii PYR-1]MTIATRAGVAAIAAVALGIGLSACGSDSTDEKPSAASSSATSETAASPAS
PTPAAGPGITLAQYIEENGIAETPVLRGDPGAPTINLPFPQGWEAAGPRA
PQGAYDAIIYTAGPPGAQPATIVAFVTKLTGNVDSAKIIEYAPNETRNLP
GFEGADKGEPSNLGGFDATQIGGFYTKDGVNHLVAQKTVVIPAQDGLFVL
KLIADGTEEVAYPLMEATSAIDEQTTITP
120405765YP_955594.1 hypothetical protein Mvan_4815 [Mycobacterium vanbaalenii PYR-1]MRLIIRPLAALFLVLASVAALPLSWTLSGVVVALTSNTTALIMGGSFHPL
AEPADAPPFVTAYLDNAVTGHLDPAFADASGPVTNAVAVYTPEQFFPIGQ
LTFARSVAEGLVNLHRCLGAETDCVFNDDPAIRPHAVAPRAGDAMMAFGY
SQSAVIASLAKLDLIQRYQPGDPSVSFMLVANPMRPNGGILMRLHGWPTI
PILEIPFPGASPTDSAVLPDGRHVYPTVDVARQYDGLGGDFPVRPLNLVA
TVNALLGYALLHGSAVDIPLAQARFQGRQGDTGYYLVETDLVPLLQPFAF
FVPRPILKAIDAPLRVVIEDAYDRDVGPGVATRASWRPIKDIVGLAARLV
ASIPVAVDNLTEGLGLGRVLGTTEPGAFGVGGPDLPAEPEPAVPDESVEP
AVPEQDPESVEYDGGRAAGEGSAGEGSAGAESVDRVEPDAAPVESDPAPV
EADPAPVEADPAPEKSDPAPVEADPAPEKSDPGSDASADDGEAGAATTPT
ETDEADEPPDEDTAEAA
120405764YP_955593.1 hypothetical protein Mvan_4814 [Mycobacterium vanbaalenii PYR-1]MRLIAVCALALAGVGCAQSSGPAPAPASQTTARLTIDPTRIDRARDALPD
GYEVAAYTGPPAPFAVWGFRGSPVTDPAPCAALAAPAVDPGTARGWSASG
PGGIVYAVVAGAAGPPITAVRADCARWTAVSGHTTGVVTGVPGPDVASAQ
TVGMSGTATTVVEGGTETRSHSETFVAYLDGYVCFVAVVTDPGSPDPALA
PGFASDLLAETVSTLRG
120405763YP_955592.1 hypothetical protein Mvan_4813 [Mycobacterium vanbaalenii PYR-1]MSNPPKHRAVAAVVCAGLVAACSAGQSADLSNADIARVSELKSSFPAPYT
VNSVGPAGIDPRYLTAQKLPPGLTFDPADCGKSAGQQAIPEGVKGNMAAT
TAEGDGVRYIVLAVETSEPVPVNEPTDQCGKVTFAGPGLRGLVEVVEAPQ
IDGVRTVGTHRVLQTTSEQGPRTGELYNYVAHFGTFIVIVTANPLVVDGK
PAARVDTQRARALVAQTVGLVKGA
120405762YP_955591.1 hypothetical protein Mvan_4812 [Mycobacterium vanbaalenii PYR-1]MEPALQSALFDHSERRDLGDGAWLEVRSGWLSQDGAADDALFGELRDQIP
WRAERRQMYDRVLNVPRLVSFHNLVDAAAPHPRLKQLRRRLNDAYAGELG
EPFVTAGLCLYRDGDDSVAWHGDNIGRSSTEDTMVAIVSLGATRVFALRP
RGGGPSLRIRHCHGDLLVMGGSCQRTWEHAVPKTARPVGPRISIQFRPHD
VR
120405761YP_955590.1 MerR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MESAHELTPGEMAVRSGVAVSALHFYEREGLISSRRTSGNQRRYARDTLR
RVAFIRMSQRLGIPLARIREALATLPTDRVPTSKDWARLSAGWREDLDQR
IVHLQRLRDNLAGCIGCGCLSLKVCALANPGDVLSEEGPGPVRL
120405760YP_955589.1 arginine deiminase [Mycobacterium vanbaalenii PYR-1]MTDATLGCNSEVGRLRVVILHRPGPELQRLTPRNNDTLLFDGLPWVARAQ
QEHDAFAELLRSRGVEVLLLGVLLTEALSNSGAARMHGISAAVDSRRLGV
PLAQELSAYLRTLDAAALARILMAGMTFDELPFGENELSLVRRMHHGADF
VIDPLPNLLFTRDSSFWIGPRVAITSLSMHARVRETSLTDLIYAHHPRFL
GVRRAYESRSAPIEGGDVLLLAPGVVAVGVGERTTPAGAEALARSLFDDD
LAHTVLAVPIAQERAQMHLDTVCTMVDTDAVVMYPNIQDSLTAFTIRRES
GGVKIDRAAPFVDAAADAMGIAKLRVIDTGLDPVTAEREQWDDGNNTLAV
APGVVVAYERNTETNARLADSGIEVLPISASELGTGRGGPRCMSCPAGRD
PL
120405759YP_955588.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MTAPTDQLERSGRTVPVISPGPVAPVADFGPVDRLQGWAMTAVITALAAV
TRFLNLGSPTDAGTPIFDEKHYAPQAWQMVHNGGVEDNPGYGLVVHPPVG
KQLIAIGEAIFGYNGLGWRFSGAVCGVVLVLLVVRIARRISRSTLVGGIA
GLLLIADGVSFVTARTALLDGFLTVFVVAAFGALIVDRDQIRERMHIAFV
EGRIAETPWGPRLGVRWWRFGAGVLLGLACATKWSGLYFVMFFGVMTVAF
DIAARRQYRVPRPWLGTFRRDVGPSLYALVLIPFGVYLASYAPWFASETA
VDRYQVGRSIGPDSVLPIPDALRSLWHYTYAAYRFHSGLTNADGNHHPWE
SKPWTWPMSLRPVLYAIDTENVSGCGAQSCVKAVMLVGTPAMWFLAVPVL
AWAVWRAFVKRDWRYAVLLVGYSAGFLPWFADIDRQMYFFYAATMAPFLV
MIIAMILGDILYKPGQNTADVRSSLSTERRTLGLLVVCFYVAMVITNFAW
LYPILTGLPISQHTWNMQIWLPSWR
120405758YP_955587.1 uroporphyrin-III C/tetrapyrrole methyltransferase [Mycobacterium vanbaMTAGRLLVGATPLGQPSDASARLVRALRSADVIAAEDTRRVRTLAQALEV
KPVGRIVSLYDQNEASRVPALLDDIKGGATVLLVSDAGMPLISDPGYRLV
AACVEHDLPVQCLPGPSAVTTALAVAGLPAERFCFEGFAPRRQAARRTWL
RSLSAEPRTCVFFESPRRLAELLGDAVEVLGPDRRAVVCRELTKTHEEIV
RGRLGELAEWAADGVLGEITVVLEGATPTADPDALVAEVNRLVDDGMRVK
DACAQVVAATPGSPSKRELYDAVLRARG
120405757YP_955586.1 aminodeoxychorismate synthase component I [Mycobacterium vanbaalenii PMRIERLGDLGSAPTVLRTLAAAASASGIAPPAALLGDWFSSRAVIAPSLI
AGEVAPRDAFAVTPGSRCDGPVGGGWFGYLSYPDGGADGLGPRIPQAAGG
WADTVLRCDRDGVWWHESLSGAALPGWVTEAVQSVPDPRDAVVTWGEPDR
HAHRRGVLACLEAIAAGEVYQACVCTQFAGVLAGAPVDFFAEAAARTVPA
RAAFVAGDWGAVASLSPELFLRRCGEAVTSSPIKGTLPDFADPATLRASV
KDVAENIMIVDLVRNDLGRVARTGSVSVPELLAVRPAPGVWHLVSTVSAR
VPEDTPTAVLLDATFPPASVTGTPKSRARGLLTGWEPHRRGIYCGTVGLA
SPVAGCELNVAIRTVEFGADGSAVLGVGGGITADSDPDLEWEECLHKAAP
IVNAVPVAVPVQPRARSTAS
120405756YP_955585.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMSEHADRFTHLRPLLFTIAYEILGSATESDDVLQESYLRWAEVDLAAVTD
TKAYLARLVTRQALNALRAQSRRREDYVGPWLPEPLLTEADPSADVVLAE
SVSMAMLVVLETLSPDERAVFVLREVFGFGHDEIAATLGKSTEAVRQTAH
RARAHVQSRRKRFEPVDPKVSTEITTRFFTAAATGDLDGLMAMLAPDVVW
TADSDGKVSAARRPVAGADRVARLIMGFVRQAGADGRVEPAVYNSAPALV
LYLGDNLEGVVTFEVVDGRITNFYAMRNPEKLAGVKVPRQISR
120405755YP_955584.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTAQRTHVVVIGGGYAGVMAANRLMSRDGLRVTLVNPRPEFVERIRLHQF
VTGSDDAVVDYADVVGEGIALIVDSVTRIDAPTRRVELASGGSIDYDYLI
YAVGSTGAAPTVPGAAEFAHPISEYEHGAPLRTAVTAAAADAPIVVVGAG
PTGLETAAELAEEGRRVTLVCGSVLGPYLSTRGRRAAAKRMTKLGVDVID
GPGATVTEVLADAVVLADGRRVASAVTIWTAGFGVPDLAVRSGLSTDAIG
RLLTDETLASVDDPRIVAAGDAAAPSDLPLRMSCQAAIPLGAQAANTVLS
RIAGTTPKPINQAFTGQCISLGRSAGLIQIAHLDDRVMPLYIGGRTAASV
KEAVCKGTISFLSREARKPGSYFWLKGGKRQQKLAAQPVSS
120405754YP_955583.1 glutamate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MDGLNTKLHDIYDEVARRNPGEAEFHQAVYEVLDSLGPVVDKHPDYVDTA
VIRRLCEPERQIIFRVPWLDDGGVVQINRGFRVEFNSALGPFKGGLRFHP
SVYLGIVKFLGFEQIFKNSLTGMPIGGGKGGSDFDPKGRSDGEVMRFCQS
FMTELYRHLGEYTDVPAGDIGVGMREIGYLFGQYKRITNRYESGVFTGKG
LTWGGSQVRTEATGYGTVFFVDEILRSRGQSFDGRQVVVSGSGNVAIYAI
EKVHALGGTVVACSDSSGYVHDENGIDLGLLKEIKELRRGRMTDYAEARR
GAAHHVAGRGVWEVPCDIALPCATQNEVSGADAAQLIDSGCRIVAEGANM
PCTPEAVKRFEEAGVTFAPGKAVNAGGVATSALEMQQNASRDSWTFEDTE
ARLAEIMGRIHDRCLSTADEYGQPGNYAAGANIAGFIRVADAMLALGLV
120405753YP_955582.1 methionyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MTEPYYITTAIAYPNGDPHVGHAYEYIATDAVARFKRLDGFDVRFLTGTD
VHGLKMAETAAKLGVPTAELARSNSDVFQRLQEKLHISFDRFIRTSDPDH
YEASKAIWRRMVDAGDVYLGKYSGWYSVRDERFFTEAETSVDAAGVRIAT
ETGTPVTWTEEETYFFRLSAYADRLLALYADHPEFIEPEVRRNEVVSFVS
GGLRDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVGFPDTDSEL
FTRYWPADLHMVGKDIIRFHTVYWPAFLMSAGIELPKKVFVHGFLLNRGE
KMSKSVGNVVDPVNLVDTFGLDQVRYFFLREVPFGQDGSYSEDAIIGRIN
ADLANEFGNLAQRSLSMVAKNLDGVVPQPGAFTAEDSEMLAAADALLERV
RRHFEATAMHLALEAIWSVLGAANRYFSAQEPWVLRKTDPARFATVLYTT
LEVVRIAALLSQPVMPDAAAKLLDLLGQPADRRAFTAIGTRLAPGTALPS
PTGVFPRYQAD
120405752YP_955581.1 TatD family hydrolase [Mycobacterium vanbaalenii PYR-1]MSATKQRREPPPIPQPLAPLIDAHTHLDACGARNADDVRAILDRAASAGV
QAVVTIADDLEAARWAAEAADWDPRVYAAVALHPTRANALTPEARSVIER
LAAHPRVVAVGETGMDLYWPGRLEGCAEPADQREAFAWHIDLAKRTGKPL
MIHNRDADAAVLDVLRAEGAPETVIFHCFSSGAAMARACIDEGWLLSLSG
TVSFKNARDLREAVPLIPADQMLVETDAPFLTPHPFRGAPNEPYCLPYTV
RALAEVLSRPAETIAEQTSATAKRVYGLASCWN
120405751YP_955580.1 transglycosylase domain-containing protein [Mycobacterium vanbaalenii MNALIKLHQTRSPLLRVLVAATLLALIVAGGTAVAAHKTVTLTVDDVSMA
VPTMKSRVIDVVEENGFEVGERDDLYPAADTPVHHSDTIVLRRSRPLEIS
TDGGGTEQVWTTASTVDQALAQLQMTDKAPVAASRGSRLPLDGMALPVVS
PKNVQIDDGGAVRAVRLAAPNVASLLDAAGVPLQQSDTVIPAASSPVVEG
MRITVTRVRVAKVTERLPLMPNNQRIDDVTLNMSRQIVEDPGNPGVQDVT
FAVATVNGVETGRLPVANVVIAPARDGVLRVGAKPGTEVPPVSNGGTWDA
LARCEAGGNWAINTGNGYFGGVQFDQNTWERNGGLRYAQRADLATREEQI
AIAEVTRARQGWGAWPTCSGRIGAS
120405750YP_955579.1 dimethyladenosine transferase [Mycobacterium vanbaalenii PYR-1]MTIRLLGRTEIRHLAKSIDFRPRKSFGQNFVHDANTVRRIVSASSINRSD
HVLEVGPGLGSLTLALLDRGAKVTAVEIDPVLANQLPTTIAAHSHSEVNR
LTVLNRDILTFKQSDMTEMPTALVANLPYNVAVPALLHLLAEFPSIRTVM
VMVQAEVAERLAAEPGGKDYGVPSAKVRFFGNVRRYGMVSPTVFWPIPRV
YSGLVRIDRYETSPWPTDPEFRQQVFELIDVAFAQRRKTSRNAFAEWAGS
GNESASRLLAASIDPSRRGETLSINDFVRLLQRSADWHVVPKPESAATAV
ATDEDAQVPTL
120405749YP_955578.1 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Mycobacterium vanbaMSARDGNTASEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAV
SLLDEVTVRTADILSLEMTGEGAESLPTDERNLAWRAAELMADHVGRSPD
VAISIEKTIPVAGGMAGGSADAAAVLVAMNSLWELGVPRRDLHALAAQLG
SDVPFALHGGTALGTGRGEELATVLTRNTFHWVLAFSPGGLSTAKVFAEI
DRLRAEEDRTLPPRLESPEPVLAALASGDPAQLAPLLGNDLQPAALSLDS
TLRRTLRAGVDAGALAGVVSGSGPTCAFLCGSAGAAVDVGTELAGAGVCR
TVRVASGPVQGARVVPSPSNAG
120405748YP_955577.1 long-chain-fatty-acid--CoA ligase [Mycobacterium vanbaalenii PYR-1]MSRFTEKMYRSAHTTGRGMVTGEPYEPVRHTWGEVHERAKRIAGGLAAAG
VGLGDAVGVLAGFPVEIAPTAQGLWMRGASLTMLHQPTPRTDLVVWAEDT
MNVIGMIEAKAVIVSEPFLVAIPVLEEKGIKVLTVTDLLAADPIEPIEVG
EDDLALMQLTSGSTGSPKAVQITHRNIYSNAEAMFIGAQYDVEKDVMVSW
LPCFHDMGMVGFLTIPMYFGAELVKVTPLDFLRDTLLWAKLIDKYKGTMT
AAPNFAYALFAKRLRRQAKPGEFDLSTLRFALSGAEPVEPADVEDLLDAG
KPFGLDPGAILPAYGMAETTLAVSFSPCGAGLTVDEVDADLLAALRRAVP
ATKGHTKRLAELGPLLTDLEARVIDDHGNVMPPRGVGVIELRGECVTPGY
MTMGGFIPAQDEHGWYDTGDLGYITEEGNVVVCGRVKDVIIMAGRNIYPT
DIERAAGRVEGVRPGCAVAVRLDAGHSRETFAVAVESNNWQDPAEVRRIE
HQVAHEVVAEVDMRPRNVVVLGPGSIPKTSSGKLRRSNSVSLVT
120405747YP_955576.1 hypothetical protein Mvan_4797 [Mycobacterium vanbaalenii PYR-1]MYADWFDAPGYWLAREVLQRGVAAIYLIAFVAAARQFRALIGEHGMLPVP
RFVAQVPFRVAPSVFHLHYSDRFFSAVCWSGAVLATAVAAGGDDLVPLWA
ATLAWLALWVLYLSIVNVGQRWYGFGWESLLLEAGFLAMLLGNDDTAPPL
LALWLARWLLFRVEFGAGLIKMRGDPCWRDLSCLDYHHETQPMPGPLSWF
FHHLPKPLHRVEVAGNHVAQLVVPFALFAPQPVASVAAGIVIVTQLWLVL
SGNFAWLNWLTILLAFSAVDQSVFAVVLPMSAPPARAGPPPWFAALVIAG
TALTVVLSYWPVRNMLGRRQQMNASFNPFHLVNTYGAFGSIGRVRYEVVI
EGTAEPEPTAQTVWKEYGFKGKPGDLRRMPRQWAPYHLRLDWMMWFAALS
PAYARDWFRPLVVRLLRNDAATLRLLGHNPFPDEPPRCIRARLYEYRFTT
WRELRDERRWWHRTLVGEYLPAVALGAGDSPAAR
120405746YP_955575.1 daunorubicin resistance ABC transporter ATPase subunit [Mycobacterium MADKSVGPMSVCAYTVDAMESAIEAIDLVKRFGDTLDNPAVDGVSFAVPP
GTVLGLLGPNGAGKTTTVRMMTTLTEPTSGTARVAGYDVRAQPDDVRRHM
GLTGQVATVDELLTGRENIRMIGGLYGIRRKDLDRLGDQLLHQFSLTDAA
DRVVRSYSGGMRRRLDLAVSLLASPPVLFLDEPTTGLDPRSRSELWDVLR
GLVAQGTTLLLTTQYLEEADQLADNIVVIDRGHIIAEGSPLELKQQAGRA
SLVVTVGDAADLEGARTLLGQTGAEVFVDAGARRLTASADGLDDMIRVAE
WLRDSGIAVDDIGLSRPSLDDVFLTLTGHRTEDSEEIGA
120405745YP_955574.1 ABC-2 type transporter [Mycobacterium vanbaalenii PYR-1]MTALDTEAHAAVRPQPVPIRPTNLAQQSWIMVKRNMIHTKRMPEMLSDVT
AQPIMFVLLFAFVFGASITNTGGASYREFLLPGIQAQTIVFSAFVVASGI
TADVEKGIIDRFRSLPISRSSVLIGRSIASVIHSSLGVLVMALTGLAIGW
RIRNGVAEAVLAFALLLLFGFGMIWFGILIGSLLRTVEAVNGVMFTALFP
VTFLANTFVPTEPMPRWLRVIAEWNPVSSLAQAMRELWGNGGPAPAGAQL
PLHHPVLATVLWSLALTAVFAPFALYAYKRRTGG
120405744YP_955573.1 hypothetical protein Mvan_4794 [Mycobacterium vanbaalenii PYR-1]MPILRAVSAVLVAAAGVVTATVCSAPVWAGGPGGMVETGVVSRAVGSGVR
DGMLVGFSASGPTNEAASAAVIAVCQNAGAEQCSSDEVTNDVFCVVSVGA
DNGSGIVSGGAGPTVEAARDDAFRNVGRANLTLDPNARVLASSCP
120405743YP_955572.1 hypothetical protein Mvan_4793 [Mycobacterium vanbaalenii PYR-1]MSRFALGGVPAGKVTMTSRANYPTLVLMTSVVAVLLVSAPPASAQANCQE
AGNLVRCETNGSVSIKAVPGTRAPNVADTIPRNNRTGIILSW
120405742YP_955571.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPAEDPRQRAIDAAVELFHREGFGAVGIDRLTTSIGMSKRTLYKYFDSKD
DLLLAVLDSCEGMALRDLPDEDDDSSPRDRILAVFDAQAKYCTDPDFAGC
FFVNIATEFRDPDHRAVRIAADHKAKLTQFLVRQARLAGVAAPDDLAEQL
TVLHTGAADYALLYGHYPDSTRTAVAALLTAAGL
120405741YP_955570.1 OsmC family protein [Mycobacterium vanbaalenii PYR-1]MTTTTTLNGIDREALSATLDAVRATPALAQVSFTLGSAWLSGCHQRSQTG
EMRQNGEAVADRRSRYVLESDEPAALLGTDTAANPAEYVLQALAGCYAVT
YATNAALRGIELSSLKLELEVDFDLHGFLGLDDSVRPGAQQIRVNVHAES
PNASGEQLQKLTEAVQDHSPIRDTLANPVEVVTTLVR
120405740YP_955569.1 NADH:flavin oxidoreductase [Mycobacterium vanbaalenii PYR-1]MTKLISKPLELPAFVTPNRVFMAPMTRMRAAQPGDVPTDLMVDYYTQRAG
AGLIVTEGSQISPEGKGYADTPGIHSDAQVAGWRKVTDAVHAAGGRISLQ
LWHVGRLTHETLQGGQPGVSASAIDFDGTVTLKHADGERYTAQSPTPRAL
EVSEIPRLIEDYRRATRNAREAGFDMVEIHAANGYLLQQFMSVSSNHRDD
RYGGSLQNRARLPLEVVDALTDEWDAAHVGIRLSPMIKFGGLDDADGMEM
GLYMAAALHERGVGYLHLCEPDWAEGPALDSAFRSGLRNAFSGIIIGAGN
YTVAKADEMIAEGFIDAAAFGRPFIANPDLPRRLFEELPLAEVDFDTVYG
SDVAGYPQGYTDYPTAD
120405739YP_955568.1 4Fe-4S ferredoxin [Mycobacterium vanbaalenii PYR-1]MLEKLPVRLAEHPTVRAVRSRPAQAPGVIDADWLRKVCLDAGADDVGFAS
VGDPALSSELAHVEAALPGAVSYISLVVKMNRDNVRSSARSVANQEFHRS
GEVMNEAAHRIARVLQDAGHRVVNPSATFPMEMDRFPGRIWVVAHKPVAV
AAGLGAMGIHRNVIHPRFGNFILLGTVLVASEISSYGTPLDYSPCLECKL
CVAACPVGAIKKNGDFDFVACSVHNYREFMGGFTDWAQTIADSADAAEFR
SRVSDSENASMWQSLSFKANYKAAYCLAVCPAGEDVIEPYLDDRKGFMDL
VLKPLQDKVETLYVLPNSDAEAHAVRRYPHKPVKRVDSGIRGV
120405738YP_955567.1 peptidyl-tRNA hydrolase [Mycobacterium vanbaalenii PYR-1]MAEPVLVVGLGNPGPQYATTRHNAGFMVVDILADRMGEKFKVHKKSGAEV
ATGRLAGRPVVLAKPRVYMNESGRQVGPLAKFYSVAPADVVIVHDELDID
FGRIRLKAGGGVAGHNGLRSVASALGGNDFQRVRVGIGRPPGHKSGASFV
LENFNSVERKEVPTILEQAADATELLVAQGLEPAQNTVHAWG
120405737YP_955566.1 50S ribosomal protein L25/general stress protein Ctc [Mycobacterium vaMAKNAPNNLPAQVRTATGKGASRRARREGKVPVVLYGHGTEPQHLELNGR
DFAAVLRHAGTNAVLTLDIDGTEQLALTKAIEVHPIRRNIQHADLLVVRR
GEKVTVEVNIVIEGDATPGTLVAQDANAVEIEADVQSIPEQFVVSVEGAE
EGTQILAGQIELPSGVTLISDPETLVVNIVAAPTAADLESEGGGERAEQA
AEAPEAGEAEAASESESE
120405736YP_955565.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMSDWTAADLPSFAGRTVIVTGANSGLGLITARELARVGARTILAVRNLDK
GNTAAATMTGDVEVRSLDLQNLASVRAFADGVDSVDVLVNNAGIMAVPYA
QTVDGFESQIGTNHLGHFALTNLLLPKISDRVVTVSSMMHLMGRVNLKDL
NWKSRPYLAWPAYGQSKLANLLFTGELQRRLAAAGSPVRAVAAHPGYSAT
NLQGHSGNPLGEKIARAGNRIATDADFGARQTLYAVAADIPGDSFIGPRF
SMFGPTVATWRSPLARDRGKAAGLWTLSEQLTGTEFPL
120405735YP_955564.1 putative lipoprotein [Mycobacterium vanbaalenii PYR-1]MTVRLRPALAAAAILAVPALSGCAAETPDYQSVWSTASTTSAAPTSTDPD
APPMSIATFLEQSGVTGQPVAPDKLTDLTVSMQTPPGWHPYQNSNLAPGT
RVIAKGDTYPTAMLMVFELDGDFDVAEALTHANVDAQASENFRELNASTA
DFNGFPSSMIEGSYDLNGTRMHSYNRIVIATGAPPDRQRYLVQFTVTGFA
DKAAEDGPDVESVIRGLTVALPR
120405734YP_955563.1 arsenate reductase [Mycobacterium vanbaalenii PYR-1]MAGRIYHNPKCSTSRKTLDLLRDNGIEPEIVLYLKTPPTRAELAAMIADA
GIDVRTAVRKRESLYTELDLASASDDELLDAMAEHPILIERPFVVTDKGT
RLARPLDNVREIL
120405733YP_955562.1 ribose-phosphate pyrophosphokinase [Mycobacterium vanbaalenii PYR-1]MSHDWTDNRKNLMLFSGRAHPELAEQVAKELDVPVTAQTARDFANGEIFV
RFDESVRGCDAFVLQSHPAPLNTWLMEQLIMIDALKRGSAKRITAILPFY
PYARQDKKHRGREPISARLVADLYKTAGADRIVTVDLHTDQIQGFFDGPV
DHMRAQKLLTGYIAENYADHDMVVVSPDSGRVRVAEKWADALGGVPLAFI
HKTRDPLVPNQVKSNRVVGDVKGRTCILTDDMIDTGGTIAGAVRLLKQDG
AADVVIAATHGVLSDPARERLAESGAREVIVTNTLPIGEDKMFPQLTVLS
IAPLLANTIRAVFDNGSVTSLFDGSA
120405732YP_955561.1 bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosaMRDAAVVILAAGAGTRMKSDTPKVLHTLAGRSMLSHALHAVAGLEARHLV
VVVGKDRERVAPAALEIGQTLGRDVDIAIQDQQRGTGHAVECGLTALPAD
FTGTVVVTAGDVPLLDTHTLSDLIAAHDAESAAATLLTTTLADPTGYGRI
LRTQDGGVIGIVEQADATPSQRAITEVNAAVYAFDAGALRSALSRLQADN
AQGELYLTDVIAIARSDGGVVRARHIDDAALVAGVNDRVQLADLAAVLNR
RIVEGHQRAGVTIIDPASTWIDVDVTIGRDTVVRPGTQLLGATTIGGRAE
IGPDTTLADVTVGDGAAVIRTHGTSAVIGDDSVVGPFTYLRPGTELGAAG
KLGAFVETKNATIGTGTKVPHLTYVGDADIGEHSNIGASSVFVNYDGETK
SRTTIGSHVRTGSDTMFVAPVTVGDGAYTGAGTVVREDVPPGALAVSAGP
QRNIEGWVTRKRPGSAAAEAAAAAGAGAGAAAEDQGPEATGE
120405731YP_955560.1 GreA/GreB family elongation factor [Mycobacterium vanbaalenii PYR-1]MYTADYVWMTPQAREDLEKELADLMAVPNPAGTDETERTDQVVDAWLARK
ERIRQIHELLSRADHSTSPADDGIAEPGMVLTVRFDDTGDTETFLLGTRG
TADPELEVYTVASPLGSALLGAVPGEQRSFRLPNGSIQQVTVLAAKPFGA
HDPRELAKR
120405730YP_955559.1 D-amino-acid dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSGGSGMDGGPRSVIVVGAGIVGLSTAWFLQERGVDVTVVDRSGVAAGAS
WGNAGWVSPALTAPLNSPSVLREGLRALADPAAPLHIPVRADTALARFLL
RFAANCRPSAWERAVRANAILNDEAIETFDVLVSNGVDAPVTDTSLAVAF
RDAGHAELFLTELNHLRSTGQQLHVETLTGAALHEQVPLASSNVAAVVNV
SGQRFVDPGRFTHALGFAVAERGATMLSGEVCRVSGSRDGALLELRDREL
LRGDAVVLATGAWLPALTGRRIRVGLQAGRGYSFTVPVDRALPGPVYLPE
ARVACTPYRGGLRVAGTMEFRRPSEPLAQRRIDAIIASATPLLDGVRWTE
RTDAWVGPRPVTDDGKPLIGQLASAMYVAGGHGMWGLAHGPATGRLLAEQ
IVTGKQPEAVRPFDPLRGRGRATPTEVLTLPL
120405729YP_955558.1 putative DNA-binding protein [Mycobacterium vanbaalenii PYR-1]MITLDRLINVLGGYGARWHSGSADRQTELRSVVLPEVVDGRTVSGDVLLA
VGAASPAEALQWARAARAVVVLTRGEHADPELDGAGVAVVVIDSAMPWSD
FAAIVYGLVMEGRETESGRGPTDLFALADSLAGAVGGAVVIEDRSSQVLA
FSRGQQDADPGRIATILARQAPPELRAVYEAHGVFAHLAVSDDPVFVPGD
APDGMLDDAAGRTGRMVVAARAGRELLGSVWVACASPLVGDRRRALADGA
HTVALHLLRSRASADLERQVESELVIRLLESPADAATVASRLGLPPATLR
VIALRASDEGGRHAALLQMFERATAGFGWSRPSRSALADTTVYTVLAAEA
AAVARDWVSALVAALPEQLTVQAGISAPAAATELAVARTEADECLALQEG
TGADAPPAYDESWDDLLLRRLRAAARSGRTPPRGAVAELRAHDSTHGTAY
VPTLRAWLQERGDPGRTGTRLGVHENTVRYRMRRMAELTDLRLDDADKRF
AMMIELAVLD
120405728YP_955557.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAVSDKRGGPDTHVRAPRARMTGTERRQQLVEIAKSLFAERGFDGTSIEE
IALRANVSKPVVYEHFGGKEGLYAVVVDREMSALLDGITSSLADNRSRVR
VERVALALLTYVEEHTDGFRILIRDSPASITSGTYSTLLNDAVSQVASIL
AGDFSRRGLDPDLAPLYAQALVGSVSMAAQWWLDVREPKKEVVAAHLVNL
CWNGLTHLESDPVLHEE
120405727YP_955556.1 transcription-repair coupling factor [Mycobacterium vanbaalenii PYR-1]MTVSGTLHVHTPIAGLVDLALRDPALQEIARRAGDRPADLNLVGPASARV
FVASALAQPGLLLVVTATGREADDLTAELRGVFGDAVALFPSWETLPHER
LSPGVDTVGARMMLLRRLTHPDDARLGPPLRIVVTTARSLLQPMAPDLAE
VDPVTLTVGGEADFDAVVARLVDLAYSRVDMVGKRGEFAVRGGILDVFPP
TAEHPVRVEFWGDEVSEMRMFSVADQRSIPEIEIDTLIAVPCRELLLTAE
VRDRAAALASEHPVLENSVTGSVPDMLAKLAEGIPVDGMEALLPLLRPSD
FATLPDHLPEGTPLLVCDPEKVRTRAADLIKTGREFLEASWSTAAVGGDV
PIDIEALGVSGYVGYGDARDAARAGGHPWWTLSQLDSGAGESTALDIRPA
PSARGQQHNLDEIFAMLRAHVATGGFGVVVTPGSGTAMRVVEQLSESDIP
ATVLEPGAVPGEGVVGVIKGPLHDGVVIPGANLVVITETDLTGNRAAATE
GKKLAAKRRNVVDPLALTAGDLVVHDQHGIGRFVEMTERVIGGARREYLV
LEYASAKRGGGSDRLYVPMDSLDQLSRYVGGEAPTLSRLGGSDWANTKTK
ARKAVREIAAELVALYAKRQASAGHAFAPDTPWQREMEDAFGFTETVDQL
TAITEVKSDMEKPVPMDRVICGDVGYGKTEIAVRAAFKAVQDGKQVAVLV
PTTLLADQHLQTFTNRMTGFPVTVKGLSRFTDPAESRATIEGMKDGSVDI
VIGTHRLLQTGVTWKDLGLVIVDEEQRFGVEHKEHIKSMRTHVDVLTMSA
TPIPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPHDDKQVAAALRREM
LRDGQAFYIHNRVRTIDSAAAKVRQLVPEARVVVAHGQMPEEQLEKTVEG
FWNREYDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQLRGRVGRS
RERGYAYFLYPPEVPLTETAYDRLATIAQNNELGAGMAVAMKDLEIRGAG
NVLGAEQSGHVAGVGFDLYVRLVGEAVEAYRAAADGKTVAAPEEPKDVRI
DLPVDAHLPPDYIGSDRLRLEAYRRLAAAPDDAAVDAVIEELVDRYGPLP
EPAQRLVAVARLRLLARAHGVTEIGAPSATTLRISPMTLPDSAQLRLKRL
YSGANYRATTSTVQVPVPRAGSGVGSPRIRDLELVAFVAGLLLAIDGKPG
EEVDITKFGGGA
120405726YP_955555.1 nucleoside triphosphate pyrophosphohydrolase [Mycobacterium vanbaaleniMTVVLVDPRRPSLIPIEAIELLTGDVQYTEEMPIKVPWSLPSARPCLAGS
DDEPAAVLLSSDPGHPSVAARIAAGERVICAPAPQPGERLVDAVAMMDKL
RTAGPWESQQTHDSLRRYLLEETYELFDAVHGGDLTELRDELGDVLLQVL
FHARIAEEAPHNSFDVDDVADALVRKLGNRVPAVLAGESISLEDQLAQWE
QRKALERSTRESIMDDIPTAQPALALAQKVLARAETGGVPHDLIPAAITS
VAVSADIDAENALRSAVLEFMADVRDAERAATAARRGADVAEELDDAPHG
VISADEWRAHWPGADEPVAEEPDAAEG
120405725YP_955554.1 Dyp-type peroxidase family protein [Mycobacterium vanbaalenii PYR-1]MSSHPNNENAEPAQPERSGLSRRKLFGAAGVTAAVVGAAGVGALAGRASA
AQPPNHLDTAVPFRGQHQAGIVTEAQDRMHFATFDVTTKSRDDVIKMLAD
WTEMAERMTQGEEAFPNGSIGQNPYSPPSDTGEALGLPPSQLTLTIGFGP
SFFVKDGVDRFGIADKKPAELVDLPKFPNEKIDPARSGGDIVVQACANDP
QVAVHAIRNLARIGFGTVAVRYSQLGFGRTSSTTRDQTTPRNLFGFKDGT
ANMRSDETDRLNKSVWVADGDGPAWLTGGTYLVARRIRMLIEQWDRTTLL
EQERVIGRQKGSGAPMGLDDEFQELNFDLTNDKDEPLIDPVAHVRLASSK
NLGGIEILRRGYNFTDGSDGFGHLDAGLFFIAFVRNPVTQFVPMQNAISR
NDAMNEYVRPTSSAVFACPPGIPEGDKSTFWGSTLFD
120405724YP_955553.1 hypothetical protein Mvan_4774 [Mycobacterium vanbaalenii PYR-1]MKVHPSVAVLAAATAAFALAGCQAKEEAPAASEEGGSTAPAQVTVEASDD
ACELSGTEGKTGANTFVITNNGTKVTEFYVYGEGERVMGEVENISPGLQR
KLIVQLTQPGTYQTACKPGMVGDGIRSDFTVTGDAVQVDTEGKFKEAADS
YKRYVNSQVEALVPAVEAFVAAIKSGDIEAAKAQYPTSRVYYERIEPVAE
SFPDDLDPRIDLREADLEPGQKWTGFHRLEKDLWVTGPQADTNAIADQLV
ADVKELQAGVSAPDFSVDSTQIAGGAQGLLDEIATSKISGEEDIFSHTDL
WDFNANLQGSQTAVASVRPILDERNPDLGTRVDQRFEEVEALLERYREGD
GFVSYDKVTEPERQELSRAIDALSKEVSQVQGVIAPQ
120405723YP_955552.1 iron permease FTR1 [Mycobacterium vanbaalenii PYR-1]MLSATDLSVITYYAAPNISSQLFGSGLIGLREGLEAAIVVSILVAFLVKS
DRRDALKWVWLGVGAAIALTLTVFLAIQFGENTITGLAAEAIAGVASLIA
VAIVTTMVLWMKKASASMSGELRDEMARALETGPLAVALLAFLAVGREGV
ETALFMVGYAEAQTSWPLIGLITGVLIAGAIAFGIYRGALSIDLGKFFTY
TGVFLILVAAGILSYGVGALQTVGWLPGLANKAFDISTWFHWSSWYGEVI
QGIFNVTPTPTVLQLTGYLAYLAVVLALFLRPAQAPKSKTPTPPNPSPER
STT
120405722YP_955551.1 putative lipoprotein LpqU [Mycobacterium vanbaalenii PYR-1]MTRVRWLQAIAVIGATALLMASSCSWQIGIPVPDGVPPPPGDAVPQIDTY
AKGRPADQLHEWAAERAPALGIPVTALEAYAYAARVAEVENPDCNLKWTT
LAGIGQVESHHGTYRGSTVAADGEVTPPIRGVLLDGTAGNLVILDDDSVS
HDPAIENKGDEPFARAMGPMQFIPETWRLYGVDANNDGDVSADNIDDAAL
SAAGYLCWRGKDLSKPRGWMEALRAYNHSDQYARTVRDWATAYAQGHPL
120405721YP_955550.1 phosphopyruvate hydratase [Mycobacterium vanbaalenii PYR-1]MPIIEQVGAREILDSRGNPTVEVEVGLLDGTVSRAAVPSGASTGEHEAVE
LRDGGSRYLGKGVEKAVEAVLDEIAPAVIGLGADEQRLVDQALVDLDGTP
DKSRLGANAILGVSLAVAKAAAQSAELPLFRYVGGPNAHILPVPMMNIIN
GGAHADTGVDVQEFMIAPIGAPSFKEALRWGAEVYHSLKSVLKKQGLATG
LGDEGGFAPDLPGTRAALDLIGTAIEAAGLKVGSDVALALDVAATEFYTE
GTGYAFEKETRTAEQMAAFYAQLLEAYPLVSIEDPLSEDDWDGWVALTAA
IGDKVQLVGDDLFVTNPERLEDGIERGAANALLVKVNQIGTLTETLDAVS
LAHNAGYKTMMSHRSGETEDTTIADLAVAVGSGQIKTGAPARSERVAKYN
QLLRIEEELGDAARYAGDLAFPRFSVETK
120405720YP_955549.1 septum formation initiator [Mycobacterium vanbaalenii PYR-1]MPEANRPDPRRRSSAGDARSRKAPASRPGKPGKSGDAARGKPRGAARRET
RSADPRSPKELTGAAADPGFVDDTGDEPGADSIRQSIIASAEQAAEQRFG
SAARRAAILAAVICVLTLTIAGPVRTYFAQRTEMKQLQASEAQLRDQISE
LEQQKAKLADPVFIAAQARERLGFVMPGEIPYQVQLPPGAAQPAAPPDEL
AEAKTNDPWYTSLWHTIADAPHGVSPMAPPAPPGVPGAPEPVAPGAPPSG
G
120405719YP_955548.1 hypothetical protein Mvan_4769 [Mycobacterium vanbaalenii PYR-1]MVDPTDLEAVARQLGREPRGVLEIAYRCPNGEPGVVKTAPKLPDGTPFPT
LFYLTHPALTAAASRLESSGMMRDMTERLAEDPELAAAYRRAHETYLAER
DAIEPLGTTFTGGGMPDRVKCLHVVIAHSLAKGPGVNPFGDEALAVLAEE
PGMAGILDPKVWT
120405718YP_955547.1 Ppx/GppA phosphatase [Mycobacterium vanbaalenii PYR-1]MRVAAVDCGTNSIRLLVADAAGDGLHDVHREMRIVRLGQGVDATGEFAPD
ALARTRAALTGYAEVMRRHGVDAVRMVATSAARDVANRDEFFAMTSEVLG
TVVPGAVAEVITGTEEAELSFRGAVGELDAAAAPFVVVDLGGGSTEVVLG
SDRDVRAVVAGYSADIGCVRLTERCLRSDPPTDDEIAAARAVVREALADV
LAAVPVERAHTWVGVAGTMTTLAALARKLTTYDADAIHLSRIPFDDLLPV
CADLLAMTRQQRAVLGPMHEGRVDVIGGGALIVQELAAVLGERAGITELV
VSEHDILDGIALSII
120405717YP_955546.1 hypothetical protein Mvan_4767 [Mycobacterium vanbaalenii PYR-1]MYARTTTVWGRPSSIDDGIANMRGSVMPELQRMHGFVGFSLLADRESGRC
IAASAWQTEDAMRASAPLVVEVRDRAAQILGGTVDVADWEIAVMHRHHES
AEGACVRVSWVKVDPSHVESGIDLFKHSVLPALEELEGHCSTSLLVNRAT
GAAVISTAYDSAEALQHHRPQLDRLRDATVEQAGAQMLEECDFELAIAHL
RVPELV
120405716YP_955545.1 hypothetical protein Mvan_4766 [Mycobacterium vanbaalenii PYR-1]MSAAPKYMAVQGAAMIVAAALAVIGVLGFIPGVTSGLDQLTWFGQHSGAR
LFGVFAVSAVLNITHLVVGAAGFFFARSYAGARAYLLVGGLLYLGLWLYG
VLVEFGSDAHVIPLNAASNWLHVGLGAVMTLLAVTLAGQHDPTKRRARIR
RPATR
120405715YP_955544.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MPGYRDLFDSSITDPVAFWGAAADAVTWTRPPGRILDDSNPPFYRWFPDA
ELNTCANTLDRHVDAGRGDQPALVYDSAVTDTKRTYTYAELLEATARFAG
ALRKLGVGKGDRVVIYMPMIPEAVIAMLACARLGAVHSVVFGGFAPHELA
VRIDDVRPTVIVSASCGIEPGRVVEYKPMLDAAVGMVEHPPRHCVVVQRD
RHRCDLVEGRDLDWADVMAGAEPVDPVPVAATDPLYVLYTSGTTGKPKGI
VRDNGGHAVALLWSMRHIYDIEPGDVFWAASDVGWVVGHSYIVYAPLLLG
ATTVLYEGKPVGTPDPGAFWRVASEHGVKALFTAPTAIRAIRKEDPEGKY
VGDYDLSGLKYLFLAGERLDPDTYHWASEKLGIPVIDHWWQTETGWAIAA
NPMGTEALPLKAGSPTVPMPGYDVRILHDHGHECETGQEGAICIRLPLPP
GTLPTLWNADDRYQASYLTEHPGYYLTGDGGRFDEDGYLFVMGRIDDVIN
VAGHRLSTGAIEEVLATHPAVAECAVIGVADEIKGQAPRGLVVVKAGAST
DGLADELVKLVRDEIGAVASFKLVDVVPALPKTRSGKILRKTMRGIAAGR
DEPIPSTIEDPAVLDALSPILRG
120405714YP_955543.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MTDQPPPIDGVRRHFVTARGVNFHVTEAGPEDGRPVLALHGWPQHHWVYR
SLLADPPTSAGASSRLPEPGLRIIAPDLPGYGWSGPAPHKWAKEDVVSDL
VALMDAMGLDRVLLIGHDWGGYIGHLLAMRVPERIDGYLALNIAHPWVPP
KVMAPHLWRFLQYQPLVAFAGVPLQRHTSFLKRAYKLAAPKLDPQTVRVY
SERFRDPVVARTARDTYRTFLLREAPAAIRNGERRRSKVPTRALFGRDDA
AIHPSLAAAETARADDYTIDVVDGGHFILDEQPELVRAKLIALAEEFPAR
120405713YP_955542.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMTSVKTRVLVIDDEPQILRALRINLSVRGYEVHTAASGAEALRMAADHKP
DVVVLDLGLPDMTGIEVLAGLRGWLSAPVIVLSARSDSADKVEALDAGAD
DYVTKPFGMDEFLARLRAAVRRGATAAETDEPVIETSSFTVDLAAKKVTK
GGVEVHLTPTEWGMLEMLVRHRGKLVGREELLKEVWGPAYAKETHYLRVY
LAQLRRKLEDDPSHPVHLLTEAGMGYRFQQ
120405712YP_955541.1 osmosensitive K+ channel signal transduction histidine kinase [MycobacMDDESVAASPHKAKRGELRIYLGAAPGVGKTYAMLGEAHRRLERGTDVVA
AVVETHGRKKTAELFEGIEIVPPKLIAYRGSDFAELDVEAVLRRNPQVVL
VDELAHTNTPGSKNTKRWQDIEELLDAGITVITTVNVQHLESLNDVVTQI
TGIEQQEKVPDEVVRAADQVELVDITPEALRRRLAHGNVYAPERVDAALS
NYFRRGNLTALRELALLWLADQVDSALEKYRADNKITDTWEARERVVVAV
TGGPESETLVRRASRIASKSSAELMVVHVVQGDGLSGVSGPQMGKVRELA
ASIGATLHTVVGDGAGGVPAALLDFAREMNATQLVLGTSRRSRWARIFDE
GIGATVVQKSGRIDVHMVTHEQAGGESLWARVSPRQRHAVSWLAALAVPG
AICAATVLLLDRFLGIGGESAMFFIGVLVVALLGGVAPAALSAVLSGVLL
NFFLVEPRHTFTISEPDSAITIVVLLVVAVAVAALVDGAANRTRESRRAA
REAELLALFAGAVLRGADLNTLLERVREAYSQQSVTLVRGEAHGGGVVGC
AGSEPCVTVETADTAIEVGSKDDPEEFWLLLAGRRLDARDRRVLGAVANQ
AAGLARQRELAEEAGRAEAIARADELRRSLLSAVSHDLRTPLAAAKAAVS
SLRSEDVGFSPEDTAELLATVEESIDQLSGLVGNLLDSSRLAAGVVRPEL
QPVYLEEAVPRALLGISRGSTGLRAGLDRVKVEVGDTVVMADSGLLERVL
ANVIDNALRYAPDGPVRVTAGRVADRVLIAVADEGPGVARGAETELFAPF
QRLGDQDTSSGVGLGLSVARGFVEAMGGTISATDTPGGGMTVEIDLAAPR
120405711YP_955540.1 K+ transporting ATPase- KdpC subunit [Mycobacterium vanbaalenii PYR-1]MTRVVRQHWAALRALLFFTVVLGLAYPLLIWLIAQAPFLSDKADGSVVEV
DGTPVGSSLIGQLYTDADGNPLPQYFQGRPSAAGDGYDPLATSASNLGPE
SIVDQPDKPSLLTLVCSRSVAIGELDGVDGTRPYCTGDGVGAVLSVIGPR
DAGGNVVHPTKVVSVNEPCATTPTPFVDTYEGVRVECAATGEDYRLGQLV
PLRGSASAVPAVPADAVTASGSGLDPHISPAYADLQVDRVARARGMNPDE
VRALVAEHTEGRTLGFLGEPRVNVLELNLALDRRG
120405710YP_955539.1 potassium-transporting ATPase subunit B [Mycobacterium vanbaalenii PYRMSVTTAGAAARKHAEPKSSNKIQGGLLDPNMLWKSLPSALRKLDPRTMWR
NPVMFIVEIGAVWSTILAFLEPSWFAWLIVVWLWLTVLFANLAEAVAEGR
GKAQAESLRKTKTATPARRLTGWAPGTPGREEAVAAALLQPGDIVVVEAG
QVIPGDGDVVEGIASVDESAITGESAPVIRESGGDRSAVTGGTTVLSDRI
VVKITQKPGESFIDRMIALVEGANRQKTPNEIALNILLASLTIIFVFAVT
TLQPLAIYSKMNNPGVPDSLALNGNGITGIVMVSLLVCLIPTTIGALLSA
IGIAGMDRLVQRNVLAMSGRAVEAAGDVNTLLLDKTGTITLGNRQASEFV
PLTGVTPEALADAAQLSSLADETPEGRSIVVFAKQEYGLRARTPGELAHA
AWIEFSATTRMSGVDVDGHRLRKGATSAVAEWVRSEGGTVPTELGDIVDG
ISAAGGTPLAVGEVREGKAAVLGVIHLKDVVKQGMRERFDEMRRMGIRTV
MITGDNPMTAKAIADEAGVDDFLAEATPEDKMALIKKEQAGGRLVAMTGD
GTNDAPALAQADVGVAMNSGTSAAKEAGNMVDLDSDPTKLIEIVEIGKQL
LITRGALTTFSIANDIAKYFAIIPALFVGLFPGLDLLNVMRLHSPQSAIL
SAVIFNAVVIIALIPLSLRGVRYTPSSASKLLSRNLYIFGLGGIIAPFVG
IKAIDLIIQLFPGM
120405709YP_955538.1 potassium-transporting ATPase subunit A [Mycobacterium vanbaalenii PYRMSTGLAGILFLASLVIALVAVHVPLGDYMYRVYNTAKDSRAENVVYRLIG
ADPKAEQTWGAYARSVLAFSAVSLLFLFILQLVQGRLPSALTDPGTPMTP
ALAWNTAVSFVTNTNWQAYSGESTHGHLVQMAGLAVQNFVSAAVGMAVAI
ALVRGFARKRTGELGNFWVDLVRGTIRILLPISVIAAILLITGGAIQNFH
NYDQVVNTLAGAQQTIPGGPVASQEAIKDLGTNGGGFYNVNSAHPFENPT
TWTNWIEIFLLLVIAFSLPRTFGRMVGNKKQGYAIVGVQAVLAVISWSAT
LFFQLQAHGTVPTAVGAAMEGVEQRFGVANSAVFAASTTLTSTGSVDSFH
DSYTSLGGLVLLFNMQLGEVAPGGVGAGLYGILILAVITVFVAGLMVGRT
PEYLGKKITPREIKLAATYFLVTPLIVLTGTAVAMAMPGQRAGMLNTGPH
GLSEVLYAFTSAANNNGSAFAGITVNTEWYNTALGLAMVFGRFLPIILAL
ALAGSLAQQGKTPPSIGTLPTHRPQFVGMVAGVTLILVALTFLPMLALGP
LAEGIH
120405708YP_955537.1 hypothetical protein Mvan_4758 [Mycobacterium vanbaalenii PYR-1]MAGPSRNRQRAGHSPLPGRTLACAHRHRGGCVNERRRTDNRDLRGDLHRA
DGGDLRRPRRRPEVGGESVTQNLIGLALAALIAVFLFAALLFPERF
120405707YP_955536.1 hypothetical protein Mvan_4757 [Mycobacterium vanbaalenii PYR-1]MTLVDVPPARHLLPASMNSVRRILSIAGCGLPAAALGDPAVAACVRAQGV
AVAVCGGEELDLARAAGIRPIHVVLRCDRVSDTIRRAAALGVVRFVASTD
RHIDVLTECPQPTKHVYLDDRGPAVLGEHRLDVVGIHCDIDDSAGAAEWG
AATERVLCRVALLRSCGSNPTRISLAGGAASRWLGGRTGELRAIASAVDD
ALDEGCARWRMPRPAVMLAPLRP
120405706YP_955535.1 hypothetical protein Mvan_4756 [Mycobacterium vanbaalenii PYR-1]MAGIIDYPLATDHAARETRLTWLTAVFAVVASFAMLLSATPGTVSPVAYW
TVTSIALATVLIVFVAGECAWDRMVDRARAAGVVGR
120405705YP_955534.1 hypothetical protein Mvan_4755 [Mycobacterium vanbaalenii PYR-1]MMSRLARSLYTPLSVATGVGGGLLAGAIFGQIWKRIGENDAEPPDPKDLS
HSTATVMTAAAIQGLIVGIVRATVQRAGAHGYRAVTHETPPA
120405704YP_955533.1 hypothetical protein Mvan_4754 [Mycobacterium vanbaalenii PYR-1]MDEDGGADDASRDTRRRNETATERLDRNWASLLQELRVVQTGVQLLTGFL
LTLPFQQRFDILDDSMQMVYLATVSAAVASTALLVAPVGMHRLLFRRHRL
DALVRAAHRCAYAGLVLLAVAVTGMTVIIFDAVAGLFPALVAGGCALILF
MMFWLVLPLSMRDGAPKPPTP
120405703YP_955532.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMSDDVTPEGVIPYPGQTADMTPQPRDEMRDYTGTGLLSGKRALITGGDSG
IGRAVAIAFAKEGADVAIAYLEEQADAAHTVSLIEAAGQRGIQLPGDLAD
PSHCRGVVAETVKQLGGLDIVVNNVAFQSPVSDLAEISDEQWRRTFAVNI
DSFFHVTKAALQHLPDGSAIINTGSINGLRGNKTLIDYSATKGAVIALTY
SLAQSLADRNIRVNCVAPGPVWTPLIPATMDAEKTASFGEHVPMGRAAQP
DEIAPSYVFFAASRMSSYYSGEVLAPIGGETLPV
120405702YP_955531.1 hypothetical protein Mvan_4752 [Mycobacterium vanbaalenii PYR-1]MRRLAEGAAVEDHGYRPAPAGLRANMIFSADGAAGFAGRAGPLSCPADHT
LLLALRAYADVVLVGAGTARAENYGPVRLRAEHLAQRRELGLGEQPPAIA
VVSRSGRLPESMFGSVPPILVTSARGRQPRPSGVEKSCEVMVCGDEQVDV
AEAVRRLRAQGSHRILCEGGPTLLNELVEADLVDELCVTLAPRLAGSQPL
GAGRPARLTSPPGLRLAHILAGTDDYVYLKYVRP
120405701YP_955530.1 flavin reductase domain-containing protein [Mycobacterium vanbaalenii MDEHNDGGAEAFEKLTSLLDYPMFVVMTAAGDHRSGCLVGFTSQTSIHPA
RFLVGLSRKNHTFGVAADADHLAVHLLPRTELDLVRLFGEKTGDTTDKFT
QCAWHPGPRGMPILDAAAGWFVGRVLRRFDVGDHVGHLLEPVAGSAPENL
GDLITFSDVRDLEPGHEA
120405700YP_955529.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMSTPTIGSARDVVDYLKTQHETIKALFIETLDAADASTRREAFTRLRTML
AVHETAEEMVVHPRVRRKVEGGEQIVDDRLVEEHDAKVLLRDIEKLPIDS
AEFSKALIHLQAAVLEHARHEEELEFTALEAAVGDDELAKLADAVEIAER
IAPTHPHPGVESAAANFAAGPFASVLDRARDALGAVFAKR
120405699YP_955528.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MRAVTWHGRRDVRVDSVPDPKIEEPTDAIIEVTSTNICGSDLHLYEVLGA
FMNEGDILGHEPMGVVREVGSAVSNLAVGDRVVIPFQISCGHCFMCDRKL
YTQCETTQVRDQGMGAALFGYSELYGSVPGGQAEYLRVPQAQFTHIKVPD
GPPDSRFVYLSDVLPTAWQAVAYADVPDGGTVTVLGLGPIGDMAARIAQH
LGYQVFAVDLVPERLDRAIARGIHTIDASIVDGSVGDEVRRLTGGRGSDS
VIDAVGMEAHGSPVAKFAQQATALLPDAVAKPMMQKAGVDRLDALYTAID
CVRRGGTLSLIGVYGGMADPMPMLTLFDKQIQVRMGQANVKKWVDDIMPL
LTDSDPLGVDTFATHVLPMEEAPHAYKIFQQKQDGAVKVILQP
120405698YP_955527.1 hypothetical protein Mvan_4748 [Mycobacterium vanbaalenii PYR-1]MRLTRSNLNAPGVVRKRRGKGFAYYTPGGEPLDDPDTAQRIKELVIPPAW
KDVWISPKPSGHIQAVGTDAAGRRQYLYHEKWHQERAEEKFDRVLELSVL
LPQWRAQIAGDLTRRGLRRERVLALALQLLDRGYFRAGGEQYAEEHEHYG
LATLLREHVSLRNGAVVFDYPAKSGVRRSVEIDDAEVVRAVRALMRREDS
SKRLLVCRNGSGDGWADVRADDLNARFKELVGDEYSVKDLRTWHGTVLAA
AAFADAKEPTSKSAIKRAAAAVMKEVAEELGNTPAVARASYVDPRLVDGY
AQGMTIGAAVRRAADTSSPEERQEVLEKATRTLIRRVARS
120405697YP_955526.1 hypothetical protein Mvan_4747 [Mycobacterium vanbaalenii PYR-1]MPNTSIKNEKMYEELRREGNSKEKAARISNAAAARGKSSVGRKGGKSGSY
DDWTVGDLKSRAKELGISGYSHLSKDKLISKLRNH
120405696YP_955525.1 hypothetical protein Mvan_4746 [Mycobacterium vanbaalenii PYR-1]MSVTAFQDLPLADRDREWDGGAAEKRVRRWADATDDPNPKYRDAHVWYDQ
DKKSNFTAYKLLIADVIDGELRAVPRGVMAAGAIMQGSRGGIDLPPSDID
RVKSHLAKYYAKMGDEPPWEKD
120405695YP_955524.1 hypothetical protein Mvan_4745 [Mycobacterium vanbaalenii PYR-1]MAENAIPVRALGLICSLKPSPAPSSSALIAEHVFETLREQGAECEAVRCV
DFNIAPGVEADMGDSDQWPQIRQKVLAADILLISTPVWLGHPSSVTQRVL
ERLDAELSNTDDQGRPAMAGKVAIVSVVGNEDGAHKVVADVFQGLNDVGY
SIPAQGCTYWNGPAMESTDYKDLDEVPEQVASTTAAAARNAVRLARVLKQ
AQYPPY
120405694YP_955523.1 hypothetical protein Mvan_4744 [Mycobacterium vanbaalenii PYR-1]MPDTSRDPVDHARTYRQHAGETMKAGVNAPGLIAVGIGVLSLVIGLFSFA
NGSRSAGVAAVVVAVLLVGGGLAWLARAHHKVQKKQQDWHREHPEAPYEP
PTS
120405693YP_955522.1 amidohydrolase [Mycobacterium vanbaalenii PYR-1]MAPSSQATTVLDGLPGIRSWQEDFYRDLHRHPELSHQEHRTAGKVVDTLT
AAGYRVHDGIGGTGVIGILENGPGPTVLLRADMDALPVLEDTGLPYASTE
RATDPTGHEVPVTHACGHDLHVTALLGATRLLADGRGSWGGTLVGLFQPA
EETGDGARGMVADGLANLLSHVDVCLGQHVMPFPAGTIGMHAGPFMASAD
SMRVTVYGRGSHGSMPQASVDPVVLAAMIVVRLQTVVSREVSPVEPVVLT
VGSITSGSKSNVIPDRAVLQLNIRTFNDDTRTAVLEAVRRIVTAECAASR
SPRDPEFELSDRFPVTDNDIATTERVTHAFSEMFGERCVELPQGVGSEDF
SEIPRALGVPYTYWGVGCVDPDAYRSAAEAGSVNQDIAVNHSPRFAPVIQ
PTLDTATQALVAAAMTWLAPT
120405692YP_955521.1 transposase- mutator type [Mycobacterium vanbaalenii PYR-1]MLTVVHDAAEANESAGGAGRSLLDEIVRDGARQMLAAALQAEVAAYVAQF
ADQLDEDGHRLVVRNGYHQAREVLTAAGAVEVTAPRVNDRRVDPDTGVRQ
RFSSAILPAWARKSPQISEVLPLLYLHGLSSGDFGPALEQFLGSGAGLSA
STITRLTAQWQDEAATFGRRDLSGTDYVYLWVDGIHLKVRLEQTKLCLLV
MIGVRADGRKELVAITDGYRESTESWADLLRDCKRRGMTAPVLAVGDGAL
GFWRAVREVFPATREQRCWFHKQANVLAALPKSAHPSALAALKDIYNAED
TDKAQLAVKAFEVDFGAKYPKAVAKIVDDLDVLLEFYKYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRTAGIAMAYKLIDAAQARWRAVNAPHLV
ALVRAGAVFHKGKLLERPTDITPPTPPSNGDESTGTEVA
120405691YP_955520.1 hypothetical protein Mvan_4740 [Mycobacterium vanbaalenii PYR-1]MNGAMLRRAAAGAVLSGVGAVATLGLGVFGYAIGVAQADIRCDPVCHGTW
CPGEPVLWQIRYLAETWDPNVCHEYHQISGTENGGYAEGPLPPGTFVCPP
FAFMCP
120405690YP_955519.1 hypothetical protein Mvan_4739 [Mycobacterium vanbaalenii PYR-1]MDSVGHIAWVGSLAVALGVAGAAASPPAISWAESSDSASQDTSAPDPGEA
SGDDTADSEPDHESAPSAGESDSADDDSADDDGPVDLPTGDAGSIDIPDT
AESDRGNHGDDTMTAAPSEETADDLSHTQSDPDLSALESVADHEAPPAEP
DTAPATTRAVQPITAPAEREVIESAYTPTSAAQTTSTAVFAPPLTPAPPS
TPVPPVASLAAFASMRRDNEPALRERTTEQSNAAHATVAAAGGPTPNPVA
MASPPAGSIMAAVESMLTAARNWFERTFFAATPVYPPQTVMVTVGPGSAS
DPFTLTAADADGRALTYSVHGSTGGTGTAAGTLTISGDKATYTPPADWNG
ETAYTDTFSVTASDQRDGFHIHGLSGLIYNLTFGLLGRAGHSATTTVTVG
VRAASTPPGPDPEPPDGPGVPGSFPVSFANNSGYADDEVYVMVIGQVTPG
QWSWVDRDGVAHHIDHAAADAPGHLEKDGVNYADMTFTLAEADDLRIPPE
LLGGRIYVSLEQPLYIAISADDSGWASPDGANPADPNYETVFDWYEMSYD
NGSVPFGGNTTQVDQFGFPFSFTVSQDATGFSATRGIALSRREVFSAFED
TVPEAYQALIIRDEDGNPIRILAPRSHQPGSLATWFDEPVDDFWHTYRTT
EFVYHGTGYTVTGRVGDDDRFAYAVTAAGGASTAHSMTKPSTADVFRADG
PFVGTGLQGAFLAELDAAFNRGVATSPDDWNDVSAYYPAGGRWNDWARFF
HAHSLNGFAYGFPYDDVNSQSSVVILNNAEPLTDLRLTLTS
120405689YP_955518.1 putative lipoprotein LppH [Mycobacterium vanbaalenii PYR-1]MREHTAALTVAATCVLVAACGGGGNEGATSTTPSTLLSPTTSAPAPPTTS
TPPPPVAESALDGLLLSPAEIDTVVGATGMAVAGTSTSLAEDITVPPDAP
EEKKACVGIAGTAEAQAYAGSGSTAVRDQALRAPNDSGATLSAGQAVVLF
PTADEAATFFAESAQKWPLCRGYNAGGSPVTVGDVSSDNGMLVTSITIQS
EDEPTLCERALTMKNNIVIDVSTCGGSSDSAVRIADQIAARVPGE
120405688YP_955517.1 hypothetical protein Mvan_4737 [Mycobacterium vanbaalenii PYR-1]MRSVTGSRIRSRMLAVLATGLTVAGCAGNSQTPGNGTPEIAESSTVRNSS
IAQSDPPPVDGSTGGTMIPAYGDAQSPEAMYGRTLLQGDQLLEDLADNIN
RRLKLPYDIWLRGSQCDEANAIWNGSANTITICYEGVTLDQRIFTEAGDP
DPRRSALNSEYAKFYHEVAHMAISLYRLPITGPEEDAADQLAAYILLTPG
DDGHVDPESVQAMKDLARTLGATESRPGQLGEEDSTDVHSLDQVRMYNLQ
CWIYGSNPEANADLVTDGQLPEGRASGCRKEWEQLEQAWSALLEPHFK
120405687YP_955516.1 putative outer membrane adhesin-like protein [Mycobacterium vanbaaleniMAAASPRKPRRTTGRHRKPVTARASMCARWLRVGAAGVGMAAAIAGGQGV
ASATPDDASAGSSPSASADDNSSGTSDTSGADSSSQAGAGTDNEPDSDAD
ADSSPVTDSETESLTETVDADDGVTGEEDAVTGEESESEEPQSGPALDAG
GEAAPTAQTASQNQDPGDNAESAAVSEQSVTPDESVTPPNDELPSAQTED
DAAPSVTPTSASQPEGAAALIDDSEATAAASTTQNAQVGTTSAAATGIVT
DLLNWLGLGTGGAIPLPGGAVESLWLAIRQSRGPQAEQPVVVSPAAALWS
GDSALKELLREVIQADFSRKYGWIPVVGTVAHAFSLMGNVGELGAAILRG
DRADVADELRDVTRDVIGTVPIVGAPIAADLYFKEAGASVEDIFSVTARL
ATAQAMAPQSLTPEEEHALETLAQVLNQLAGWPEPPHNFVTPANYTLDQA
LDAHDDVLDLLFANPTPTTQWIPDAMALINLFFKSALPGYSFSDGLNTFG
DLLNRLVPPYTIEPGPDYVMTKAQVAAASVGALVSILNELLGGNFDPESL
RDAAIAGGTSGFLTPSSVLNMTFTTGAEPNPYSLMAYIALVGVYERFQWV
ALNHLPEVTGQTQNGQFLLSITGQVNATDPDGDPLTYSISQQPANGIVTV
GLNGSWLYTRTSNWTHSGPDTFTMTIDDTLGQIGDLGLDHPYSPLGHSIT
VEVTVDYTGVANNQPTIIALPGLPDSMGIVRGSAPGNDIDGDTLTYSLVD
PGTPGATSNSIYTSEGGIVALDTATGEFVYIPKVSTDLIPAFDTDSFQVQ
VSDGRGGTATTTVVVISNLKPGTSTTGTSAYVEHGKVDIPTADVGLLTYS
VGSQGAKGTVVVNADGTYTYTRSLTATGSTSDTFTIIGTDANGKTVTLPA
VSVAPPLISVTPTTTATGGTFTPRGMINGTAITPATQTTTGTMSGIDEDG
NPVDISGGIYSTEKGGTVTITSGGGFLYTNTTYSDLFHKAAATDAPGSDK
VDTVKITVTDSLGRTGEVTFSIVLRTENSNPSSSSSVGSADALGVVRGSV
SGDDNDGDSFTYSLAGVGNPAGATANSTYTANGGIVSLNWDGTFTYIPNK
SAATADSFKVLVSDGHGGATTETVSVPLGTPSPLANVVTSTPNVVTGQLN
IPPADNGLMTYSVGIGPSKGTVTVDPGGTFTYNRTSPGHTTTPPDSFTII
GTEVATGKTVTIATVNVTPVVPNAAPVGGAVTVTSSSLSTGLTRNQTATG
TIGATDADGDPLTFTAGTIETTNGGEIVLAADGSFTYTISKLLTSSYYHE
AAKIGASGSAVRDTFTVTVSDTFGASTSFVASVPIYATNTPPNTPTSGVF
WGLGANDWTSVFATDPNGDSLTYTITKQPEHGSASYSSGSQILSTTGAQS
GDTIILTVTDGYYVVVDGVVTGTPASSSRTYTV
120405686YP_955515.1 hypothetical protein Mvan_4735 [Mycobacterium vanbaalenii PYR-1]MAVDANVTNVNPTADAPAEQPPVARTMADHDAVQQPVQPPVAPAPSTKQR
VWTMPKSPVTRKHADEVGRIALTVIRSIAGFVAGAARYGAGVAGQMWRGI
EAVPPAAKLFFVSALLMLLGLVGGLTLDSSLGLMCTVVVVPVCAGILGAL
GYRWYSGLGVETARRTDSHATEPTQSDLQRSVQYVDRKLTLALTSFGTEH
HQQAVIALFQAKTAVELTLGTEQDLASYGDIALRADDYGLRPRIRAGSGT
TPAPREGNSLAAS
120405685YP_955514.1 LysR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MELRQLEAFVAVAGELHFGRAAEKLHIGQPTLSELIRRLEREVGTPLLTR
TTRRVALTQAGVELFGRAKVILDDVEGAAAAVRRLADGEAGTVRLGITPP
VAPVLAPHLSQALHSAAPDVQLVVQRMWLPDLQRAIGDGELDVAITCGPV
ADPPGILSEVFCAEPVMVGLRADHHLAGRDAVELRNLSTETIGVHSEALF
PAWSLALRQVLDDTGIRPPAVEFTDTDLAAYRWPIQSEVDWVLTTAAVAG
DSAGVVLRPTSPAHFVPYTLQWCPIRATTVAVGRFVRLALSVDVPPGWVS
QPDHLRHGAGSLLED
120405684YP_955513.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MAETCTHYRTASIDGLDVFYREAGDRSNPTLLLLHGFPSSSHMFRNLITA
LADDYHLVAPDHIGFGQSSMPSVNQFTYSFDRLTDITEKLIDRLGLGRFA
IYIHDYGAPIGLRIASSRPERITGIITQSGNAYTEGFTPFWDRLFAHAKD
RGANEDAVRDYFTPETTKWQYTHGVPADRLDRIAPETWLLDQAGLDRKGN
DAIQLQLFWDYQFNLDGYPKFQEYFRVHQPPLLVTWGRNDEIFGAAGAEA
FKRDLPDGEFHLLDTGHFALETHGDEIAGHIRDFLGRQEGLIRE
120405683YP_955512.1 hypothetical protein Mvan_4732 [Mycobacterium vanbaalenii PYR-1]MSESRPPFPPFDLTTALQKVQAAEDAWNTCDPHRVSLAYTPDSEWRNRDR
FITGRAQIVAFLTAKWQRELDYALRKSLWDFRDNRIAVRFQYECRDATGQ
WWRSYGNELWEFDDGGLMRRREASINDVAIDESDRRYFGPRPDDERGHDF
ALH
120405682YP_955511.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMSKHYGSIAFTGDVRAVQSEHGSEAFYGRKLAAGKASSGRDPLTGEEKEY
LSERDGLFLASVGETGWPYVQFRGGPRGFVRVLDDHTIGWADFRGNLQYI
STGNVNGDDRVAIIAVDYAQRRRLKIFGHARIVTAEQDAALIQSLSDSTY
DAVVERAVVVGVDAYDWNCPQHITPRFTLEELEPALAPLRSELSSLQAEN
ARLREQLERAGA
120405681YP_955510.1 hypothetical protein Mvan_4730 [Mycobacterium vanbaalenii PYR-1]MSAPVTTTDRSRRTRSFARVLGPFIAVVPAIVAIRAGSIGSQLSSFSADP
MWSWSLGALLFLCGVFIIAFHQYWRSVAAVIISLFGWFLLLRGLALLTVP
QLIVEGAESATQTSDTAVDVVRVGFGLLAVCGLYLAYVGWVKKPD
120405680YP_955509.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPRVVKPKDVRRAEVLDRALALFLERGYENVSLNDLLAVSGTSKGAFYHY
FPSKEALVVALAQRSAGEAFEVLRPVFDQPGKNALERLNAGLAASYQVKL
GMGVPEPIAAMRSLLMPENQALFRKIVTIWEDLFRPVLTEVITQGVREGV
FDTFDPEGVGDMIQGFAASIQDYLVRMFDAADAKSRRKTIDDCVKRLKLY
GIATDRILGLPDGATVVLERKQVEAMMTLFMPSRPAGSLP
120405679YP_955508.1 hypothetical protein Mvan_4728 [Mycobacterium vanbaalenii PYR-1]MTGFPGFLGSALLPRILQRTGGEAVCLVQRRFLAAANRRLAELDSDDPSL
RQRIRIIEGDITQPGLGIDRDVLAEVTEAWHLAAVYDLTIDRETALRVNV
TGTTNMLNALERCTSLSRLHYFSTCYVSGRYAGPFSEEELEVGAPFNNFY
EETKHLAEAEVRQRMSAGMPATIYRPSIVVGDSRTGETQKFDGPYFVMQW
LLRQPRKAVLPVVGDPAMARVNLVPRDFVVDAVAYLSGQSSSAGRTYHVA
DPHPLTVAELISVLAEATGRDVVSIPLPRRLAKASIRHVPGIYRLLRMPA
EAVDYFAHPTYYLTEHIREDLAGSGIEAPPFPSYVDRLVAFMRAHPDLGS
AAMY
120405678YP_955507.1 hypothetical protein Mvan_4727 [Mycobacterium vanbaalenii PYR-1]MSDVATNEAESSTTADLLDEVQDSAKMGQHAATEALRIFRHTVNEAVPEA
MQPLRTKLVDAAIELADKLVTAQYQFNRSLIRTADRALSKSDEEQK
120405677YP_955506.1 hypothetical protein Mvan_4726 [Mycobacterium vanbaalenii PYR-1]MRRRLRSAAWGLLSLVIAVLFAWGSVVTSTSAGAGTALVMGGNGHPLSVP
QDTPDYINKYVTAADDAFIAPSGLCGPQCSLVATYTPAQIRFVNGIFDMT
YDESVAVGQANLNDCIQGSDCTATLAPYSETGPHTVADSTYVIYAYSQSA
TVAANQKLQLIAHPVASTVSFLLVANPNRPDGGILERFVGAYIPLLGITF
NGSTPTFSPQPRPLTTVDVARQYDGWADFPTNPLNLLADLNAIMGTILLH
PNYSDAGTPQLQGQYQDSTYYLIPAPITPVLVPLTWVPIVGKPLAIALDP
AVRVLVEMGYDRTVNPGQPTPARYLYVPNLIKAALNFAMAIPTGWDDAIS
YLTGDPDCRPFHTTVPASPFGVGGPPVYTGAIDPYGEPTPYLAPPVETHG
EAAPGSGSPAAHPAGTEPPETVTFSPTTESTPSTLLPETPAESEDMPPDF
VENDTPDSDEVSPTEDDALKDTETINESQDGPTESASGVSGEDAADADSR
SADADSLSADAGDSAPADAAAADTAA
120405676YP_955505.1 hypothetical protein Mvan_4725 [Mycobacterium vanbaalenii PYR-1]MFESMFDVDETASQAELRAAVERLERLKSQAAAAQARATALWAAKRQLAE
ESAGVRAHHRGKGLASEVALARRDAPVKGNQHLGFAKALVNEMPHTLAAL
ESGVLSEWRANLIVRESACLSVEHRRQLDAELCADASGLEGWGNRRIEAE
AKKIAARLDAAALVERARKAPEQRCVSCRPAPDNMLYVTVLLPMTHGVAV
YAACNRAADTTFDGRTRDQVMADTIYERVTGRSAAEPVSVALNLVMADTT
LFGDDEAPGWAQGYGPVPAAVVRDLVSDAVTDAKAKATLRRLYRHPKSGQ
LVAMESRSWLFPKGLATFIGLRDQSCRTPYCDAPIRHHDHAVPDREGGPT
SALNGLGECQACNYAKEAPGWHVTTTDTDGEHTATFCTPTGAKYFSIAPP
APGTPVSRRSIVEGELSIDIVTFLAA
120405675YP_955504.1 peptidase M15D- vanX D-ala-D-ala dipeptidase [Mycobacterium vanbaaleniMTNTLLPAVLACAVVAAAATAGPASAEPGPTAPADFVSLSDIDPSILLDI
RYSAPHNFTGDPVDGYQAPMCLLTRPAAYALRDAQQEFLEQGYSLKVYDC
YRPQRAVNDFVEWAKNLTDQRMKAEFYPRVDKTRLFADGYIAEKSGHSRG
STVDLTLVALPASQEPAYVPGQPLVDCAAPVNQRFPDVSVDMGTGYDCFD
TLAHTLDPRIQGEQLKNRLLLKEGLERHGLQNYELEWWHYTFKPETHPET
YFDFPVAPSSLTE
120405674YP_955503.1 hypothetical protein Mvan_4723 [Mycobacterium vanbaalenii PYR-1]MRRTLMVLLLALVATMPGAAHSATALIVGGAGKYAVLTEEQMAAALGGRF
KDYTRVNVPFPGLPDDLRYSLDVGTENLHAAVYATPGPKTIGGVSEGAPV
VDEVLRRLMNDPNPPPAGELNAVMLGTMSPIWYLFTGVDYRAVADTRYDV
MVVKAEYDGIADWPDNWINVLAVANAVLGALQLHVSSAFYDISLVPPEYV
ARKTNSEGGTTTTVLIPTPLLPLLKPLADAGASQETIDCLDGVIRPIIDS
GYWRFWFKDRSSGWPLPPPEPAGTAPMDIAVPEPGSPGDVERDLGAGLPP
VVDPESDQSGTAAADDATAQPTDDATVQPTDDATVQPTDVPAPSDEAVGN
REQEDDRNAATGNGEVAPAGDDAAAAEPEENESVAPAPDEAMADDGADSA
GPSSSTSDDAPDAIGK
120405673YP_955502.1 hypothetical protein Mvan_4722 [Mycobacterium vanbaalenii PYR-1]MSEFMRSSDAFTWSMESDPRLRSTVVTVLMLDRTPDWGEVRDRIERLSHE
LPMLRQVVVESPPPAPPRWQDCTDFDLDFHMRRVAAPEGGSFDDVLELAR
LAQMEDFDRARPLWKITLIEGLPEGEAAVLCTFHHALSDGVGGIQIAMTL
FGLTPELAPTDETPEVSRPSLLGDYRDAARYGAGLVTDAVTGVLTGVPRL
VYDGVRSPLRTLNSVAEMATSVYRTVRPVNATGSPLMTERTLIRRLGVLE
VPRPQLREAAHRSGGALNDAFVAGVAGGLRRYHEKHGVGVGALHLTMPIS
LRASSDAPGGNRITLMRFDIPVDEADPAERIRQIHERTERVRNEKSLPHT
QLIAGFLNRMPRWYIGSILRHVDFLASDVPGIPVPVSLGGANVRVQYAFG
PTIGSAVNVTLLTYVDTCALGIDVDSGAIPDVEVFTDCLRDGFDEVLALA
DDD
120405672YP_955501.1 hypothetical protein Mvan_4721 [Mycobacterium vanbaalenii PYR-1]MTSETPPDRTGAHTAVTRQSGRFVIEVEGRPVGLADYHDHDGRRVFPHTE
VLPQFQGRGLATILVAEALRVTQAEGLRIVPTCWMVAEYIDRHPEYADIT
DRT
120405671YP_955500.1 hypothetical protein Mvan_4720 [Mycobacterium vanbaalenii PYR-1]MSSTPEAADYPRTAADRGRVEPVPRRVRGYVGAELVFDTNAARYVWEVPY
YPQYYIPLRDVRPGLLRDDGRPQKVQFGPSRVFSVVAGSRTAVSAARVFD
DGDGPVAGLVKFEWDALTWFEEDEPIYGHPRNPYARVDALRSHRHVAVEL
DGVSLADTHSPVMLFETGLPTRYYIDRTDIAFEHLEPSGTQTLCPYKGVT
SGYWSVRTDHGVHADLAWTYQTPLPAVAAIANMVAFYNEKVDITVDGVQL
SRPKTHFS
120405670YP_955499.1 Cl- channel voltage-gated family protein [Mycobacterium vanbaalenii PYMDPGVGDARPSLHRSAVLSAAAIVAGVVIGLVGGAFRWCLQAAESLRVDV
VEWAQRLPGPGWLVPMGVVAACATAAALLVRWEPLAVGSGIPHVEAVFLG
EAAPPPLRLVFARFVGGVLAIGGGLVLGREGPTVHIGAAVGAEAARRTRL
PSSEAATMQAALGGAGLAVAFNAPLAGVLFTLEEVTKSWRLQAVLVSVFA
AAAAVGTSRLLLGDHPDFGVPTVPAPELVWLPLFLVFGVLTGFLGAGYNL
VVLWALDHVAAIRRIPTLVQAGAIGAAVGLLLCVAPLTVGDGDTLTQMLL
GGHQFVLLATAGLLAARFLTGPLCYSAAVPGGLFAPLLAIGALWGTLFVG
CFGAVWPDDPTFLAIPMALAGMAAFFGATVRAPLTGLLIVIEMTATTSVA
VPMMIATAAAVVSANALGSAPIYDSLRERMPVSSGPDRS
120405669YP_955498.1 hypothetical protein Mvan_4718 [Mycobacterium vanbaalenii PYR-1]MRETTMTQPPPPGNYPPPPPAGSPGYPPPQQPQGPQPSSNLVWGILTTLF
CCLPFGIVSIVKASQVNGLWAQGRFAEAQAASDAAKKWAIWAALGAVAVW
IIYAILYAVGAINMDFDTSSTY
120405668YP_955497.1 hypothetical protein Mvan_4717 [Mycobacterium vanbaalenii PYR-1]MPARQPAPARLGGPLLVGALAAGACAVVWVADPTTPGGLLPQCPTKALLG
VDCPGCGALRMIYSLLHGDVLAAIRFNALAVVALGFLVVAFAAWTYGRIV
DRRMVSWQHHKWAAPVTLAVVVVWFVLRIMPFAPFTALRV
120405667YP_955496.1 hypothetical protein Mvan_4716 [Mycobacterium vanbaalenii PYR-1]MRGKLIVSAAVAAAGLATALAAPAFADETDDIFISALQNQGIPFSTAENA
IELASAVCDYAAAGQDPTQIALEIMEPAGWTAEQSGFFVGAATQSYCPS
120405666YP_955495.1 hypothetical protein Mvan_4715 [Mycobacterium vanbaalenii PYR-1]MTVPAAAGVTHLQFRRFAGCPICHLHLRSFATRHEEISAAGITEVVFFHS
AASALQGYQALLPFAVVADPDRKVYREFGVDAHLRAVAHPRALLAAFRGY
AKIVGRHDDPDNAGVGGGDGSTHLSLPADVLIVPDGAVVTVHYGRHADDQ
WTVDDLLDLNRGVAGKDSP
120405665YP_955494.1 hypothetical protein Mvan_4714 [Mycobacterium vanbaalenii PYR-1]MATTGSPRSGVSTTPRHLAQSLIVGAGAGVVASLAMAMFAMLAGATFQHS
GFFTPLHHIASTFIAPDAMMKSMRAAMAGHMFTFIPGPALIGAVVHMMVG
AGYGAVFGLISGRTRLHGLALVGAAMAWGLAVFAASTWAVLPAAAALFGG
GDPVRDMAAMVGHGPFVVEHLIYGAALGLLLLTKPESR
120405664YP_955493.1 glutaredoxin-like protein [Mycobacterium vanbaalenii PYR-1]MADSQASTSPQSSDRQAIEVYWRPGCPFCRRLMRALRGSGLTLREVNIWE
DAEAAARVRSVADGNETVPTVFIGDRALVNPSSRQVFAAIGHQPPPRLWD
RLRGR
120405663YP_955492.1 hypothetical protein Mvan_4711 [Mycobacterium vanbaalenii PYR-1]MQPAVRRPSPGSFLLASRAFAIATLGVVIALFCTAGAMIQSQQLKDIHGV
AAIALHVVTAGLTLALGGLAFSRERGWWAAGLAGALFVFTFAQAYLGEGT
TLAIHIPGALAVVASAVWLTAWVFTAAPAAIPATP
120405662YP_955491.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium vanbaaleniMTLDSFAQSAVHSAFLEGRPRLLSLAHRLLGSAHDAEDAVQTAWLRVAAT
PGPRDIANPSAWLTTVVTRVCLDQLRDRSRRDVLSRRVQPVQTVAYAADE
EFLHREDVARALMVLLGRLTPAQRAAYVLHDLFAVPFDRVADILGVTPAG
AKKHASRARARLRPVEPPSTGAPGDAVDREVVDAFLRAAGGGDIVRMVAL
MAPDAVRIVDPELLPTGTAAVVTGATAIAEETRHFADRIRASVRMRVSGR
EAHIIAPGGHPLGIIDIRCSGGLITGITITPVCAADVLEPAAQPA
120405661YP_955490.1 integral membrane protein [Mycobacterium vanbaalenii PYR-1]MNGLVSTALAAVTLTCAVANAAVAAADLARAPFVLANSAEVGVAPRWIPY
LAGLKLAGAAGLLLGFVTTPWLGLAAATGLVGFFVGAVAVHVRTRVFHNL
AFPAAYLLMAVGAATYFAAAVG
120405660YP_955489.1 hypothetical protein Mvan_4708 [Mycobacterium vanbaalenii PYR-1]MLAALLLSFAVIFVAELGDKTQLVAMMFALRYRWWVVLSAITAATAVVHV
LSVAIGYYLGAALPTHLLGFIAGAMFIFFGLWTLRGDSLTDEETSRAAKA
TAPAFFVVTSAFVLAELGDKTMLATVTLAADRDWLGVWIGSTLGMVAADG
LAILVGAVAGKHLPERLIQISAAALFLLFGFYMVFDNLLPTAPTAAVAGA
ALTLVLILGGVMRALPDRLRPAVLRPSAPSAVDIAERDECSPDAAIGSGA
GRSAAPSDGRD
120405659YP_955488.1 hypothetical protein Mvan_4707 [Mycobacterium vanbaalenii PYR-1]MTTLLEPSLAELDFDPEILCTCRRFCGPLAHPAQWWVTLSCGCPYPMCQR
ALRIANLRLKVRSLACRLCATDEIAIRSVAPI
120405658YP_955487.1 hypothetical protein Mvan_4706 [Mycobacterium vanbaalenii PYR-1]MAMRLHDVLTTTNGATMKLTRVLGTSAIAGGIAAASLISTGIGTALAEPG
NPCGQPGAAACQPGPSTQNNDWQHRDINRGRQDHQPFTYEGQRVQPLPAG
NGDGWGFWFLGRWIRL
120405657YP_955486.1 hypothetical protein Mvan_4705 [Mycobacterium vanbaalenii PYR-1]MKKFPKFLAASLLPLGAALAVAAPAQADTAASTINQLRSQGYDVRISRVG
NAPLDQCTVASVRSLPVVAQPFPVDDDDTNVFTVQPKQKVNVTLDCSA
120405656YP_955485.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MNQLVTEAAAAEPVGTVKIRIEGLKKSFGDHVVLDGISTTISKGEVVCVI
GPSGSGKSTFLRCLNKLEDISGGKVVVDEFDLTDPKIDLDKVRQRIGMVF
QHFNLFPHMTVIENITLAPLLTKKMDKAAAEKKAMELLGQVGLAEKAHVK
PATLSGGQKQRVAIARALAMNPSIMLFDEATSALDPEMVGDVLQVLRDLA
EGGMTMVVVTHEMGFAREVASRVVFMADGDIVEDAPPAELFDNPKHPRLQ
DFLAKVL
120405655YP_955484.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMRATRSGHVEAGGTPSIRCRVAAVLTVILATVLGAGLLGAATASAQEQNY
VIATDTTFAPFEFQDAGGELVGIDMDLIREIAKDQGFTVDIRPLGFDAAL
QAVQANQAAGVIAGMSITDERKAVFDFSDPYFESGVQMAVLDSNDTIASY
EDLRGQRVAVKNGTEGAEFAESIKDKYGFQIVSFADSASMFEEVKTGNSV
AVFEDYPVLLYGIQQGNGFKTVTPKEQGSNYGFAVNKGRNAELLTKFNEG
LKNLKESGRYDAIIESYLGEEAAETDNSFFGLLKSTFPILMEGLRLTLIL
TVVSIAIALVLGVMFGLFRVSRSIWLRAIGTTYVDIFRGTPLLVQAFFIY
FGVPSALDFRMTALTAGIITLSLNAGAYMTEIVRGGIQSVDKGQMEAARS
LGIGYLPTMRKVILPQAIRTMIPSYVNQFVITLKDTSILSVIGIAELTQT
GRLIIARNYQSFTMWLIIGVIYFIVIMALTKLSDRLERRLVK
120405654YP_955483.1 anti-sigma-factor antagonist [Mycobacterium vanbaalenii PYR-1]MQQFTEHQIDGVLVVAAVGAVDMLTAPQLQEAINAALDRQPTGVVVDLTA
VDFLGSAGMQVLMTTRRQLEGTVKFAVVADGPATSRPLKITGIADYVDLF
STLDVALRNLAG
120405653YP_955482.1 CsbD family protein [Mycobacterium vanbaalenii PYR-1]MSDNNSGPEEAVKGVVEGVKGKAKEVVGVVTGRDDLQREGEAQQDKADAQ
REAAKKEAEAESARAAAKANEERQRAEQS
120405652YP_955481.1 anti-sigma-factor antagonist [Mycobacterium vanbaalenii PYR-1]MTVTSIRSRSADCRRFSIASTSLTFACRTEGAGSATRATVSVWGEVDAAN
AKHFAHTVREVAEGNAALILDLSEVNFMAFDGASALYAISAQLAREGVTW
CVIASPAVSRVLELCDPEGLIPATTIPSVRGAKPA
120405651YP_955480.1 hypothetical protein Mvan_4699 [Mycobacterium vanbaalenii PYR-1]MANFSVPKGRLMLNGGAGSKAASHVADEPLTEAATSDVVLERRITLGRGP
VGDIAAGQGFVVMANAGDDSVSVIDPMTLAVVDTIAVDGQPVAVTASDDR
AYVCVAAESHDAVCAIDLEAGTVVSTHPLASGVTALAVSPDGKRVYAGRD
AQDRVDVAVIDVTAERVGTIGIGSGPAANVDALSVDPSGKRLYVAVTDAV
GSRLVIVDTETSLVHRVLPIGAPIRDIAYAGGAVYVLTSDRAVGGTVHVV
DLNAMRVTDRVVVGGAPTQLTMSADQTRAYIVDYDRVAVLCTLGLDVVDS
LAVDARPSCVTHPADSSRLYIADYTGAVSVFSVESSIETLYSQFLATDSI
ALGVSRALQPTPA
120405650YP_955479.1 response regulator receiver/unknown domain-containing protein [MycobacMIDVLIVEDEHLIADAHQAYLQRLQGFSVAAVAHTARDAMRAAAEAAAAG
SPIDLVLLDLGLPDASGIALASALSGLSPAPDIIAITSERDLEMVRAAVG
HGALAYLLKPFTFAAFRDRLERYRRYREALPAGTDAASQAEVDRALAELR
VGPDRTAAPKGASPGTNDEIARAVRDSADGATADQVAKQVGVSRVTAWRY
LERLADEGTVRRHTDYGRAGRPKTRYQWR
120405649YP_955478.1 signal transduction histidine kinase regulating citrate/malate metabolMRRIRSPSRSPWPRSLAGQAVALQILVITLIVLAGSALAVLDARRDGDAA
AEAQVLGIATSLADSPSTAQAIESGRATEILQPVTEQVRTHTDIAFITIM
APDRTRFTHTDPSQIGGDYLGTIEPALRGETFTEVYTGTLGPSIRAVAPV
RDSSGRIVGLVAAGILQQSLADRWQAQWPAIAAVGLGALAVSLLGGWGIR
RRLMRQTRGLRPEELRVMYDHHDAILHSVSEGLIVLDRSGVAVVNDEARR
LLSLPAGEVARSDLPEFLRTYNPGARDEVHVTDDRVLVVNRSPVRDGSDA
GGSEVVTIRDRTELQGALGELNSLKVLTDSLRAQAHEAANKLHTVVTMVE
MGRAEEAITFATAGLELSQQLVDRLSSAVGEPALVALLLGKTAQADERGI
ELTVTEESALPADTDDLLLTGQEMVTVAGNLIDNAMDACDPQDPWVEVTV
NQNSERLLIRVADSGEGMDAGTFEKAMRRGYSTKSGAEADQHGLGLALVA
QVVKRHHGQLSADVTYGSVVTVTVARP
120405648YP_955477.1 sodium:dicarboxylate symporter [Mycobacterium vanbaalenii PYR-1]MTTRMDSPTPPEAPRRKRDRTHWLYIAVIVAVVAGVAVGILAPEVGKSVG
VLGTMFVALIKMMIAPVIFCTIVLGIGSVRKAATVGKVGGLAFLYFLVMS
TFALAIGLVVGNLLHPGSGLQVSDTAAGKGAELADKAHEAGGLLDFVQGI
IPTTMFSSLTEGSVLQALFIALLVGFALQGLGTAGEPILRGIEHLQKLVF
KVLVMILWLAPIGAFGAIANVVGQTGWAAVGQLMALMLGFYLTCAIFVFG
VLGALLRVVSGVSIFKLVRYLAREYLLIVSTSSSESALPRLIAKMEHLGV
DRSTVGVVVPTGYSFNLDGTAIYLTMASLFIAGALGDPLSLGEQIGLLVF
MIVASKGAAGVTGAGLATLAGGLQAHRPDLLDGVGLIVGIDRFMSEARAL
TNFSGNAVATLLVGSWTRTIDRDKVNSVLAGDDPFDELTMLDSDHGSRAQ
EPAQEKIPAPV
120405647YP_955476.1 hypothetical protein Mvan_4695 [Mycobacterium vanbaalenii PYR-1]MRKAWISAVALLGVMLGPAGVAAAQQQNPWVVIEQWESAGYQVNIDRIGN
APIGECVVTGVRNPQQVVEEVLVVDRDRHHRRDFDVIDVVVHQSISVSLD
CTG
120405646YP_955475.1 lipid-transfer protein [Mycobacterium vanbaalenii PYR-1]MKRVFVVGVGMTKFEKPGGRAARGADHEPGREGWDYPDMARESGTKALED
AGVAYTEIQQGYVGYCTGDSTSGQRALYELGMTGIPIANVNNNCSTGSTA
LYLAAQAIRGGLADCTLALGFEKMQPGSLGAGAEDRESPLKRHILALNEI
DAMQFPVAPWMFGAAGREHMKKYGTTAEHFAKIGYKNHKHSVNNPYAQFQ
DEYSLEDILAAKMISDPLTKLQCSPTSDGSAAVVLASEDYVARHDLAGRA
VEIVGQAMTTDFASTFDGSAANIIGHDMNVKAAQQVYDQSGLGPQDFQVI
ELHDCFSANELLLYEALGLCGPGEAPALIDADDTTYGGRWVVNPSGGLIS
KGHPLGATGLAQCSELTWQLRGTADKRQVDDVSAALQHNIGLGGAAVVTA
YQRAER
120405645YP_955474.1 protein kinase [Mycobacterium vanbaalenii PYR-1]MTDPQRGSRVGSQVGPYRLRRLLGKGGMGEVYEAEDTVKDRVVALKLLPE
AVSHDPVFRKRLQREAHAAGRLQEPHVVPIHDYGEVDGLLFVDMRLIDGT
DLRKLLKEQGPMTPARATAIVAQVASALDAAHQNGIMHRDVKPENILINR
DDFAYLVDFGIANAVTDEALTELGTAVGTYAYMAPERFTNGEVTHRADVY
ALTCVLHECLTGAQPFQGDSVSVVITAHLNDPAPRPSQSRPGIPAGLDDV
ISRGMAKRPEDRYASAGEMARAATAALTGAQQDQADSILQRSQAATMMAP
LPPPPPPPPPSTPGGPLPYGGSPVPPPPPPPGQPTQASGFHTPPPPGGPP
PGWPPQPPQSSGGGGGSKGPMIALLAGAAVIILVLAGLGIWLVVKPDSTS
DPVASRTSTSAAPTTTSRGSTTRTRTSTSTPPPTESYDQQLMALLSGGHD
SSNCEPVDPPAPTILATVDCTQALTPGGPAFTRYSLFEDRGALDAAFEEA
IRVNSELVQCPGSGVDSPTTWHYTETPDQVVGQIACGTYDGNPDLVWTKD
DDLLLADAQGPNLEELHNWWLEFG
120405644YP_955473.1 dihydrodipicolinate reductase [Mycobacterium vanbaalenii PYR-1]MTLRVVQWATGGVGVAAIKGVLEHPELELVGCWVHSPGKAGRDVGEIVGL
DPLGVTATDSIDDILALEADAVIYSPLIANPDEVAALLRSGKNVVTPVGW
LYPSERSGASMREAALAGNATLHGTGIAPGGISEKFPLMLSAMSTGVTFV
RAEEFSDLRTYEAPDVLRHVMGFGETPDKALTGPMQKMLDTGFIQAVRMC
VDQLGFAADPKVLATQEIAVATARIDSPMGPIEPGQVAGRKFHWEALVDG
EPVVRVTVNWLMGEENLDPAWSFGPEGQRYEMEVRGNPDFTVSVKGFQSE
VGGEGPEYGVVGTAAHCVNSVPAVCAAPPGIATYLDLPLISGKAAPAKAR
AGI
120405643YP_955472.1 MerR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MIDISAVARRSGLPTSTLRFYEEKGLIASVGRRSRRRLFGPDVFDRLALI
TLGRAAGFSLDEIATMLTLGGPRQIDRKALTTRAAEIDSTIERLTAISTA
LKHAAACPAPDHMECPTFRGYLDLAAAGLFSESPPRKSPPKPTIKKQVRL
GAGQPIRGE
120405642YP_955471.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MVDRANVAQVQAWNGDSGRAWVTLQHVLDRTLKPFEDLIVDSVAAAAGPR
EQILDLGCGTGATTLALAERLGAHGGCTGIDISEPMIHAARTRARDRNLP
VEFVVGDAQSFPFQPNTFDVMVSRFGVMFFDDPTTAFRNLRRATRPGGRL
TFVCWRDPTDNPFMSTAERAAAQLLSDLKPGIAGSPGPFAFADAHRTHSI
LRAGGWTAVDIRPVDVTCTMQESDLLPYLTQMGPVGRTLRAVDARTRAQV
ITSLREAYTEFIVDGEVRYPAACWMVDARG
120405641YP_955470.1 hypothetical protein Mvan_4689 [Mycobacterium vanbaalenii PYR-1]MPKAHLMEQSRAIPVDVETAYRRTVPMPLPTLFSRWYGPIAPVKAVRDQT
GDWNSVGQSRTVVQVGGGTMREELTAVDAPHAFGYTLSGITGALAPLVDH
IEGQWLFAPAGTGTEVTWRWTVYPRSAAAGLVMPAFARLWRGFARQSLEQ
LSRELLGQGSVG
120405640YP_955469.1 patatin [Mycobacterium vanbaalenii PYR-1]MTDVNRALVLAGGGLAGIAWETGVLLGICDESPDAGQKLLAADVLLGTSA
GSAVAAQVGSGVPLEELFARQLSEEHGAHEIHPGVSIDAITDLFLDAMLT
QGATKAQKLAKIGCVAAETDTVPEAVRRTVIEHRLPAHEWPQRALRVTAI
DIATGELVVFDAASGVGLVDAVAASCAVPGVWPPVTIGGRRFMDGGVGST
VNMSAVQDCGAAVVLVPSGANSPSPWGTGTVAEIEGFPGATLAVFADDES
LAAFGANPLDPACRAPAAQAGRAQGRREARKVAEFLSV
120405639YP_955468.1 patatin [Mycobacterium vanbaalenii PYR-1]MRVALALGSGGARGYAHIGVLNELTERGHEVVGIAGSSMGALVGGLQAAG
KLDEYTAWASSLTQRAVLRLLDPSITSAGVLRAEKILDAVRAIVGDVTIE
ELPIPYTAVATDLITGKSVWMQRGPLDDAIRASIAIPGVITPYVLDGRLL
ADGGILDPLPMAPIAAVAADMTIAVSISGDDPEASGRGRESRAPSTDWLN
RMWRSSSSLLDTKAARSLLDTPTGRAVLGRFAAGDDEPLPEPDDKVTEEP
GNAGIPKLGAFEVMNRVIDIAQAALARHTLAAYPPDLLIEVPRTVCRSLD
FHRATEVIEIGQELASAALDTLEQKVPETASDT
120405638YP_955467.1 regulatory protein ArsR [Mycobacterium vanbaalenii PYR-1]MDEVFRALADPSRRRLLDSLNARNGQSLRELCAGLDMARQSVSKHLKVLE
DANLVSTVWRGREKLHYLNAEPINAIADRWINHYDRLRAQTLADLKTALE
QDTMEHDNDFVYTTYIRTTPERLWQAVTDPAFSERYMGHGLVTDWKVGST
FDWRDGDLNISNPEQVVLEADPYRRLAFTFHTFTRQLTTVGLSEDVIDRA
AAEPRSKVSFDIEQVDGGRVKLTVIHTGFPSGSIVRELVSGGWPSKLSDL
KSNLELASVTADA
120405637YP_955466.1 LpqV [Mycobacterium vanbaalenii PYR-1]MRRYPVRGSGAVVCVLALLSGCSSGTDTPPASSATSVTTTAAEPPAAAAP
VPPGEVAISPGGVTTAVGAPAESTEDDYFQACLAARTWMEQRGGVARSQI
EPYLASVQSAPSAGPGTFDRPWPELTPGEQAAVIVAVEAAADALCG
120405636YP_955465.1 cysteine dioxygenase type I [Mycobacterium vanbaalenii PYR-1]MTLAPTRLRPADLLHVTDRFADDVLGGDYDHVLPAAGLPTAERWFTRLHG
TDELDVWLISWVSNRSTELHDHGGSLGALTVVSGTLRETRWDGEALRERR
LVAGDQAAFPLGWVHDVVWARESIRGGGTPGPTLSVHAYSPPLTAMSYYE
VTTQNTLRRNRTELTDKPESD
120405635YP_955464.1 rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]MPSRIDVVLDEARAKLTRLAADEVPAALARGAVLVDIRPAAQRAAEGEVP
QALVIERNVLEWRCDPTSDARLRHAVDDDVEWVVLCSQGYTSSLAAASLK
DLGLRRATDVIGGYHALKSVLV
120405634YP_955463.1 hypothetical protein Mvan_4682 [Mycobacterium vanbaalenii PYR-1]MTDTGEAPAALIEQTPAGTKTTAPRRAWWVRHYTFTGTAVGFVFLWLSLT
PSLLPRGPLFQGLVSGGAGAIGYSLGVFAVWLVRFMRSKDTSPPAPRRAW
PVLGVIGVIGMVIMVIQFHNWQDDVRDLMGVPRLTFWDYPLAAAISVVTL
FVLVEIGQLVGRFVRFLDRQVKRVAPPRVSAVVVVTLLLALTIALLNGVV
VRFAMSTINKTFAAVNDETDPDFAAPDSDLRSGGPQSLVSWESLGHQGRV
FISGGPSVEDLTEFNGDPATEPIRAYAGLNSADGIKETAALAAQELQRTG
GLERAVVAVATTTGTGWINEAEASALEYMYNGDTAIVSMQYSFLPSWLSF
LVDKENARQAGQALFEAVDALIREMPEAQRPKLVVFGESLGSFGGEAPFL
ALNNLIARTDGALFSGPTFNNTIWTDLTRNRDAGSPEWLPVFDKGENVRF
VAEPRDLQRPHDPWEQPRVVYLQHASDPIAWWNPDLLFARPDWLHEPRGY
DVSPGMEWIPVVTFLQVSADMAVAVNVPDGHGHVYVRNVADAWASIMLPP
GWTQDKTEKLRGLLRSDENS
120405633YP_955462.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MGSQNFETIIVERDDRVATITLNRPKALNALNSQVMDEVTTAAAELDADA
GVGAIILTGSEKAFAAGADIKEMAGLSFADVFSSDFFAGWGKFAATRTPT
IAAVAGYALGGGCELAMMCDILIAADTAKFGQPEIKLGVLPGMGGSQRLT
RAIGKAKAMDLILTGRNMGAEEAERAGLVSRVVPADTLLEEARSVAKTIA
GMSLSASRMAKEAVDRAFETTLTEGLLYERRLFHSAFATDDQTEGMNAFT
EKRSPNFTHR
120405632YP_955461.1 3-hydroxyisobutyryl-CoA hydrolase [Mycobacterium vanbaalenii PYR-1]MDENKDVLVTVRNGIGRITLNRPKAINSLTHPMVTDIAQALKAWETDDAV
TAVIVSGAGDRGLCAGGDVVAIYHDARAGGSESRRFWHDEYLLNAYIGRY
PKPYVAIMNGITMGGGVGISAHGSVRVVTETTKMAMPEVGIGFIPDVGGT
FILSRTPGLLGVHAALTGAAFSGADAIAMGFADHFVPQDRLAAFADAIEA
DGVDAAVAAFAQEPPPSALLAQRDWIDHCYAGETVADIVVALRGHDAEPA
IDAAELIESRSPVAASVTLEAVRRAAKLDTLEDVLRQEFRTSVASLRSHD
LVEGIRALLIDKDKNPQWSPASLSTVTPADIEAYFAPADPDLTFDEE
120405631YP_955460.1 hypothetical protein Mvan_4679 [Mycobacterium vanbaalenii PYR-1]MRESSNPVFRSLPKGQQGGYAQFGTGAAGYGAQAVHADPYVTQYPEQQQA
GVSRALTIDDVVTKTGMTLAVLTAVAVVSYYLVSQNLGLAMPFTLVGALG
GLALVLIATFGRKQDNPAIVLSYAALEGLFLGAVSFVIANIASVGGVGMI
AQAIVGTLGVFFGMLVVYKTGAIRVTPKFTRMIVAGLFGVVALMLLNLVL
GLFGVGGGAGLGLRDGGAIAIGFSLLCIALAAFSFLIDFDAADQMVRAGA
PEKAAWGIALGLTVTLVWLYLEILRLLSYFNND
120405630YP_955459.1 phosphoribosylglycinamide formyltransferase 2 [Mycobacterium vanbaalenMTTIGTPLSPRATKVMLLGSGELGREVLIALQRLGVETIAVDRYDNAPGQ
QVAHHARTIAMTDPDQLRALIEAERPDLVVPEIEAIATPALEALEAEGVT
TVIPTARAARLTMDREGIRRLAAETLGLPTSPYRFCDSLEELTAAIEGGI
GYPCVVKPVMSSSGKGQSKIDGPEGVAAAWEYAMSGSRVSNTRIIVEGFV
DFDYEITLLTVRARGADGEIETRFCEPIGHRQVSGDYVESWQPHPMPGTA
LERARQIAGAVTRDLGGQGIFGVELFVKGDQVWFSEVSPRPHDTGMVTMV
TQWQNEFELHARAILGLPVDTTLKSPGASAVIYGGVDAEGVVFDGVDLAL
RVPHTDIRLFGKPESFVNRRMGVALAFADDVDTARRNAAEAAGRVTPRAV
120405629YP_955458.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MPEAVIVATARSPIGRAGKGSLVSMRPDDLAAQMVRAALDKVPSLDPRDI
DDLMMGCAQPAGEAGYNIGRAVAIELGYDFLPGTTVNRYCSSSLQTTRMA
FHAIKAGEGSAFISAGVETVSRFGKGAADGAPDSKNPMFDEAQARTEQGA
AGATEWHDPREDGLLPDVYIAMGQTAENVANFTGISREDQDHWGVRSQNR
AEEAINSGFFAREISPVTLPDGTVVSTDDGPRAGTTYDKISQLKPVFRPN
GTITAGNACPLNDGAAAVVIMSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKKALANAKMSIGDIDLYEINEAFAVQVLGSARELGMDEDKLN
VSGGAIALGHPFGMTGARITATLLNNLTTHDKTFGIETMCVGGGQGMAMV
LERLS
120405628YP_955457.1 GDSL family lipase [Mycobacterium vanbaalenii PYR-1]MGIRASRRSVALAAAATLASTGTAYVGARNLLSGQADQARRVIPKSWDIP
PRADGVYAPGGGPVERWHRGVPFDLHLMIFGDSTATGYGCAAADEVPGVL
IARGLAEESGLRIRLSTKAIVGATSKGLSGQIDAMFVAGAPPDAAVIMIG
ANDITKPNGIGPSARRLGRAVRRLRGSDAVVVVGTCPDFGVITAIPQPLR
WVARSRGLRLARAQAAAVRAAGGVPVPFSDLLAPHFYKTPELLFSPDMFH
PSAAGYELAAKQLLPALGNALGAFVTEDSAEAALESRTGEDGSLLGRLGG
LSRLWRRSTGVPAPIVVAAG
120405627YP_955456.1 alpha/beta hydrolase domain-containing protein [Mycobacterium vanbaaleMTAPSKVPATPHAAIAAARAGKIRRFPVSDGAPVEVVEDGPSIAGRLMGL
AAVATVKPFLTVGSYAPKLPWPWGLLDFAARVLKPAPGTVRATIGLPHCN
AQLVRAAGVLPADGHRSVILYLHGGAFLTCGVNTHGRLVTALSKCADAPV
LVVNYRMIPKHSVGTALDDCFDGYKWLRELGYEPDQIVLAGDSAGGYLAL
SLAERLQAEGINGFVGETPAAIVTMSPLFEIDNEARADHPNVRTDAMFPP
KAFHALVELIEAAAERRMVDGKPEEVYEPLDHIEPGLPRTLIHVSGSEVL
LSDARKAARLLAAAGVPVEVRVWPGQMHVFQLGAPAVSEANRSIKQIGEY
IREATW
120405626YP_955455.1 cystathionine beta-synthase [Mycobacterium vanbaalenii PYR-1]MRIARHISELIGNTPLVQLNSVVPPGAGTVAAKIEYLNPGGSSKDRIAIK
MIDAAEASGELKPGGTIVEPTSGNTGVGLAIVAQQRGYKCIFVCPDKVSE
DKQNVLRAYGADVVVCPTAVAPEDPASYYSVSNRLVEEIDGAWKPDQYSN
PMGPESHYETTGPEIWADTDGKVTHFVAGVGTGGTITGAGRYLKEVSGGR
VKVIGVDPEGSVYSGGTGRPYLVEGVGEDFWPAAYDPSVPDEIIAVSDAD
SFDMTRRLAREEALLVGGSCGMAAVAAIKVAEREGPDALVVVLLPDGGRG
YLSKIFNDAWMSSYGFLRSRLDGSVEESTVGDVLRGKSGALPDLVHTHPS
ETVRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRA
KLADAVADHMGPPLPLIGVGELVSTAAKALRESDAVMVVEEGKPVGVLTR
HDLLGYLSEGNARR
120405625YP_955454.1 hypothetical protein Mvan_4673 [Mycobacterium vanbaalenii PYR-1]MTENPPPGGYPPPPPGGYPPPPPPGGYQPPPPPPSGGGYPPPPSGGFPPP
QEGGYPPPQGPGGYPPPAGYGPPQGGFPPPAQGYPPVGGPPAYSVGDAFN
WAWNKFSKNAMPLIVATLVFGIVVIALQAIINIVQALVSPGDTSYIADDS
GFSFSYATTGVAGTIVAIVGWFLSLIVTAAIQSAFLGGIFDIANGQQVAV
GSFFRPRNVGNVIIAGLIVGVITTVGLFLCIVPGVIASFLLMFTTIAVLD
RNLAPMDAIKSSFETSKNNVGPVLLTWLASVAVVFVGALLCGVGLLVAAP
LAALILVYAYRTLNGGFVAPAVP
120405624YP_955453.1 RDD domain-containing protein [Mycobacterium vanbaalenii PYR-1]MTGNLSGQPPAMPRRVYTSWSARVAAFFVDMVPLGLAWGIWEVVALRSAT
LDCVTFDNGGVSCSSGISSVGYLAFALTVAVSVAYLVWNYGHRQGVSGSS
VGKSVLRFQVLDEKTWRPVGFGASVLRQAVHLLDAAVCFIGFLCPLWDRR
RQTLADKLTGTVCVPKRY
120405623YP_955452.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMPAHQPLPTTTTIENLLDLDSLLSAEDRDLRTMVRGFGEQRLRPQIAEWF
EAGQVPVRELAAEIGKLGLLGMHLQGYGCSGSTATAYGLVCQELEAVDSG
LRSLVSVQGSLAMFAIHRWGSEEQRTRWLPGMAAGELIGCFGLTEPDFGS
NPGGMRTTARRDGSDWILNGSKMWITNASVADVAIIWARSKEGVLGFAVP
TSTPGFHATEMTRKLSLRASVTSEIHLDDVRVPEDARLPEAQGLKAPLSC
LSEARFGIVFGAVGAARDCLQTTLDYVGTRAVFDRPLAGYQLTQAKIADM
AVELGKAQLLALHLGRLKDEGRIRPEQVSVGKLNNVREAIKIARQCRTLL
GANGITLEYPVLRHANNLESVLTYEGTSEVHQLVIGEALTGVGAFR
120405622YP_955451.1 cystathionine gamma-synthase [Mycobacterium vanbaalenii PYR-1]MSEQRSASDHYRAFGPATRAIHAGYRPDPATGVVNPPIYASSTFAQDGVG
GLRGGFEYSRTGNPTRSVLEGALAAMEGASHGRAFSSGMAATDCVLRAVL
RPGDHLVIPDDAYGGTFRLIDKVFSLWGISYTAVALGDLDRVRAAVTDRT
KLIWIETPTNPLLSIADIAAIAEVGAATGAKVLVDNTFASPALQQPLALG
ADIVLHSTTKYIGGHSDVVGGALLTNDEALDDAFAFLQNGAGAVPGPFDA
YLTIRGLKTLPLRMQRHSENAAAIAEFLDGHPAVTTVLYPGLPSHPNHDV
AARQMSGFGGMVSVRLRGGPQAARDFCARTEIFILAESLGGVESLIEYPG
AMTHASTAGSQLEVPDDLVRLSVGIEDVADLLGDVEQALGAPG
120405621YP_955450.1 hypothetical protein Mvan_4669 [Mycobacterium vanbaalenii PYR-1]MAQIAEDLFLLLVDNASAQPALDGSRREHVLAAAILLDLAHACRVRPAVT
GEPVPEGRLVALDAPGPLDPVSARAFALLRAKPLRPDAAIKKLGRDSQKL
LVTSLTQAGQIRPTARPGKLFGRSRSFPLTNRDRVGAARAALMAALFDRT
PPAPATAAIITVLHAVDGLGALLSLNDRGWRWVHARAGEIASGSWVDESP
TALPEVNLAVTASAVRQALVQLA
120405620YP_955449.1 transcription elongation factor GreA [Mycobacterium vanbaalenii PYR-1]MTDTQVTWLTEESYDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGY
HAAREQQGQEEARIRQLQELLNNAKVGEAPKQSGIALPGSVVKVYYDDDE
KDTETFLIGTREQGVSDGKLEVYSPNSPLGGALIDAKVGESRSYTVPSGN
TVKVTLVSAEPYHG
120405619YP_955448.1 LmbE family protein [Mycobacterium vanbaalenii PYR-1]MSELRLMAVHAHPDDESSKGAATMARYVDEGVRVMVVTLTGGERGDILNP
AMDLPEVHGRMAEIRRDEMARAAEILGVEHHWLGFVDSGLPEGDPPPPLP
EGCFALEPLEVPTHALVRVIRDFKPHVITTYDENGGYPHPDHIKCHQVSV
AAYEAAADHRLFPEAGDPWTPLKLYYNHGFLRQRMQVLQDEFAKHGKEGP
FATWLEKWDPDEDLLAKRVTTRIECAKYFAQRDEALLAHATQIDPNSFFF
STPMEWQQRLWPTEEFELARSRVPVTLPETHLFAGIEGYE
120405618YP_955447.1 hypothetical protein Mvan_4666 [Mycobacterium vanbaalenii PYR-1]MSDAVMLGLDLMTLAQDSPRQTGPDFGKASPFGLIIVVLLLIAVFGLVWS
MNKHLRRLPKSFDEDETAAAAPADGGSVAAEPDPTNDNRTDGTERESG
120405617YP_955446.1 Fis family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]MSRADGSTNSLARATSPYLRQHADNPVHWQQWAPDALALAAERDVPILLS
IGYAACHWCHVMAHECFEDDEVAAAMNAGFVCIKVDREERPDLDAVYMNA
TVALTGQGGWPMTCFLTPDGRPFFCGTYYPKASFLQLLAAVVDTWRTRRA
DVEETSDKIAAELRSMASGLPRGGPPVAAEVCDDASAAVLRDEDTVDGGF
GAAPKFPPSALLEALLRNHERTGSPAPLAAVSRACEAMARGGIYDQLGGG
FARYSVDAAWVVPHFEKMLYDNAQLLRVYAHWARRTGNPLAHRVVDETVR
FLIEDLRVGGMFVSSLDADTAGVEGLTYVWTPGQLCEVLGEGDGRWAAEL
FGVTAAGTFEGGASVLQMRADPDDADRFVRVRDALRAARLTRPQPTRDDK
VVTAWNGLAITALVEASVLDRPEYLSAAIQCARTLLDAHLVDGRLRRSSL
GGVVGDSMAVLEDHAALATGLLALHQATGERVWLQEATGLLDLALDHFSD
SAEVGRWFDVADDAEQLMLRPSDPLDGATPSGASLIAEALQLAAHLAPEA
AAQRYAAAAEATMAGATVLLARVPRSAGHWLAVAEAAVRGPIQIAVAGGA
DSALLAAARRLAPGGAVVVGGEVNSSELLRDRPRVDGADAAYVCRGRVCD
LPVTTVEDLATALGASV
120405616YP_955445.1 nuclear transport factor 2 [Mycobacterium vanbaalenii PYR-1]MSFEPDVLQGFVQRYLDTVVSGSADDVAALYAEDATLEDPVGGGEVHIGR
QAIAGFYKAIQGGEIKTELLSFRAGGHEAAFLFAITVGGAMRIEPIEVMT
FNGEGQITSMKAYWGPQNITQLS
120405615YP_955444.1 hemolysin III family channel protein [Mycobacterium vanbaalenii PYR-1]MPTTLEPWYTADSPGEPEDLPEAVAEGVAQFLGKPRLRGWIHVYSAVIAV
ICGVTLVAVSWSLESTRAGIATLIYTLTIVAMFTVSGVYHRVNWTSVTAR
KWMKRADHSMIFLFIAGSYTPFALLALPERDGMVLLWIVWAGALAGVALK
MLWPSSPRWLGVPLYILLGWVAVWFIGPIAHGAGVAAVVLLIVGGALYSI
GGVLYALKWPNPWPTTFGHHEFFHACTAVAAICHYIAMWFAVF
120405614YP_955443.1 undecaprenyl diphosphate synthase [Mycobacterium vanbaalenii PYR-1]MIVDLIPRRLKEPMYRLYELRLRQGLTASRSELPRHIAVLCDGNRRWARE
SGHDDVSYGYRAGARKIAEMLRWCQEAGIEMATVYLLSTENLQRDTEELS
ALIEIITEVVEEICAPANQWSVRTVGDLELIGEESARRLRDAVSSTDGNG
GTFHVNVAVGYGGRQEIVDAVRALLSKELANGLTGEQLIESVTAEAISEN
LYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAYWPEFRRVDFL
RALRDYSARHRRYGR
120405613YP_955442.1 hypothetical protein Mvan_4661 [Mycobacterium vanbaalenii PYR-1]MLALSALVFALSWWLGLYLLARDPRKAVLVLAATGLTSFALVVALDAVRV
VSASATLSRVEIYLVAVPGIAWFAVLLELSRPRDTWRSRAGEVGLVAGVA
AVAFLGATMVGDVDGPLRLGHWVMFAAVSLPSVGAMIHAVVRRSQPGQVI
GFVIVATLFFALGNAILVIPLGLVPSWLALASTGFDVALLGVAVAIGDAF
DEGHALRKDMLRSFVGTTVVAVLFGGQLLIGLAVTGQSTTLAVLLFTSLG
IAIAINVLADPLAGLLDRVAFSRSPDLRADRATLRGTEAALPLRSAGPLD
GMDEDTFVRVTRRALGHYGDLSKLVASPLTALPVIDERLSRRGAPDQPLE
RANELRALLAERIAALKPRDGGDFGTTEQWRHYNALYFPYVVGVRAYAQN
ATAAGLDPPARQAWQWLVTEVPQRSLHNWQNAAARVIATDLRSNLVAAH
120405612YP_955441.1 hypothetical protein Mvan_4660 [Mycobacterium vanbaalenii PYR-1]MTAITSRHRQATRPDPQLLRFAIRADATLCAGVGLFVAMAADPLARMSGL
TPTAEWIVGAALVGYGALLYSAARMRDVRRVGVAVLVGNVGFTLAVAVVL
AAGWLPLTTFGVAATVAFTASTVGLAWLQYLGVRRTPA
120405611YP_955440.1 hypothetical protein Mvan_4659 [Mycobacterium vanbaalenii PYR-1]MATTISARLNESTDTLLRVAMRADAVLSGLTGIGLLIFAPQVAEISGTTP
SVEYTIGASFVVFSAVVLALAARPAVRGSGLVLALGNALFTVATIAVVVI
GVWPLTTVGIALTLGTGVYTLVMAELQYQGVRRIPK
120405610YP_955439.1 pantothenate kinase [Mycobacterium vanbaalenii PYR-1]MARLSEPSPYVEFDRTQWRALRMSTPLKLTEDELVRLRGLGEKIDLLEVE
EVYLPLARLIHLQVAARQALFATTAQFLGEPQQNPDRPVPFIIGVAGSVA
VGKSTTARVLQALLARWEHHPRVDLVTTDGFLYSNSELSRRNLMHRKGFP
ESYDRRGLMRFVTAIKSGADAACAPVYSHLLYDIVAGEKQIIEHPDILIL
EGLNVLQTGPALMVSDLFDFSVYVDARIEDIENWYISRFLSMRAGAFADP
ASHFHHYSTLTDEQAVFAARDIWHSINRPNLIENILPTRPRATLVLRKDS
DHSINRLRLRKL
120405609YP_955438.1 hypothetical protein Mvan_4657 [Mycobacterium vanbaalenii PYR-1]MEPGTLIREYLLLGLRFDRVEEGYVDSFTGDPALRRVVESEPRPDPADLV
RQAERLLTELPAGLEERRAMFIGSHLRALACAGRKFAGEQVGFVDEVEAY
FDVRITKGDPDRYRQAHAKLDDALGGDGPLAERIQAYRAAEEIPPARLEE
AIHAFSSALRDRVRATFPLPARETITYEVVTDKPWSGFNYYKGDYQSTVA
VNADLKQQMSNLPRLVAHESYPGHHTEHCRKEAGLVEGKGQIEQTIFLVN
TPQCLMAEGLADLALYAAVGPGWGSWASEIYADLGLRFDGERAETIAEAT
AALADVRQDAALMLHDEHRDADDVANFLKRWLLVNDERARQMLRFLSSPL
WRAYTSTYVEGYRLLRGWLDARPDGVSLAERFGTLLDEPLIPSSLRAA
120405608YP_955437.1 serine hydroxymethyltransferase [Mycobacterium vanbaalenii PYR-1]MTSSSPSGQGADYAATASEAYRAALRVIESVEPRVAEATRKELADQRGSL
KLIASENYASPAVLLTMGTWFSDKYAEGTVGHRFYAACQNVDTVEALAAE
HARELFGAPYAYAQPHSGIDANLVAYWAILATRVEAPGLAELGAKHVNDL
SEGDWEKLRAKLGNQRLLGMSLDTGGHLTHGFRPNISGKMFHQRQYGTDP
ATGFIDYDAVAAAAREFKPLVLVAGYSAYPRRVNFAKMREIADEVGATLM
VDMAHFAGLVAGKVFTGDEDPVPHAHITTTTTHKSLRGPRGGLVLATEEY
APAVDKGCPMVLGGPLSHVMAAKAVALAEARRPEFRAYAQAVADNAQALA
DGFIKRDGSLVTGGTDNHLVLLDVTSFGLTGRQAESALLDSGIVTNRNAV
PADPNGAWYTSGIRFGSPALTTRGFGADDFDRVAELVVEVLSNTQPAAGP
NGPSKAKYTLADGTAERVRAAAAELLDANPLYPGLTL
120405607YP_955436.1 transposase IS116/IS110/IS902 family protein [Mycobacterium vanbaaleniMLVESEDSEQIIARVAALDIGKAELVCCVRVPGRGTRRLQEVSTHSTMAR
SLTELANHLVESGVQRVVMEATSDYWKPVFYLLEAHGLDPWLVNARDVKH
LPGRPKTDVLDAVWLAKLAERQMLRPSFVPPPPIRQLRDLTRYRIDLVAT
RTAERNRVEKLLEDACIKLSVVASDIFGVSGRAMMAALIAGERDPKVLAQ
LARSRMRTKIGRLEEAFNGHFNAHHGFLLTRMLARLDGIDADIAVLDEQI
EVYLAPFAAAAARLDEIPGIGAVAAAIILAEIGTDMSVFPTAGHLCSWAK
FSPGIQSSAGKTKGTASTGHGNRYLAQILGEAAIAASRTDTFLGQRYRRI
ARRRGNKRALVAVGRSILVIIWHLLTDPDATFIDLGPDHYTKHLNPETKR
RNHIRQLEALGYTVTLTPAA
120405606YP_955435.1 integrase catalytic subunit [Mycobacterium vanbaalenii PYR-1]MPSGVPVPLSVKRVFFDLVCGGMTTTEASVQVGVSRRTGWSWWRHARGMK
LRKGGDGLGGLAQVGDLTRTGGRGHRLSFTERYEIDRALQAGLSYAAIGD
QLGRDRSVIWREVQRNRLPDGTYHALMAHARATENARRPKAFKLDDPGLC
ADIEAWMDQGWSPKLISQVLARDAGSAKVKRVSHETIYQSLYVQTRGQLR
ADLHKCLSTSRTQRKPRGQTERRGRFGDVMRISARPAEAADRAVPGHWEG
DLIIGARGGSAIGTLVERSTRFTILLHLPGDHTAETVAAAMLKAMGDLPD
HLRRSITWDRGSEMAGWQDISLQLQSPVYFCDPHSPWQRGTNENTNRLLR
FWFEKGTDLSGYTPDDLKAVADKLNTRPRPTLDLDTPAQRMAQLLSQAA
120405605YP_955434.1 fatty acid desaturase- type 2 [Mycobacterium vanbaalenii PYR-1]MAQKPVANALTLELEPVVLQELRRHLDTEDVWYAHDYVPFEEGENFAFLG
GRDWDPSQVTLPKAVTDACEILLITKDNLAGYHRELVEHFILERKWGRWM
GRWTAEEHLHAIALRNYLVVTREVDPAANEDVRVEHVMKGYRADTYTQVE
TLAFMALWERAHAVYCRNLEAQITEPVLKALVGRIAKDEERHEEFFANLV
AHCLTYTREETVAAIARRAAGLDVVGGDIDAYQDKVATVAEAGIFDRDQL
RKVVSDRIAAWGLADEPELKQFISS
120405604YP_955433.1 PhoH family protein [Mycobacterium vanbaalenii PYR-1]MSTEKFVWGRRNSRSLEERYVTQSQSRQPDLRTYVLDTSVLLSDPWAITR
FAEHEVVVPLVVISELEAKRHHHELGWFARQALRMFDDLRLEHGRLDQPI
PVGAQGGTLHVELNHSDPTVLPAGFRTDSNDARILTVAANLAAEGKHVTL
VSKDIPLRVKAGAVGLLADEYHAQDVVTSGWTGMAELEVPGADVDALFAD
GEIDLEAARDLPCHTGIRMLGSNSHALGRVNADKRVQLVRGDREVFGLRG
RSAEQRVALDLLLDESVGIVSLGGKAGTGKSALALCAGLEAVLERRTQRK
VVVFRPLYAVGGQDLGYLPGSESEKMGPWAQAVFDTLEGLASPAVLEEVL
SRGMLEVLPLTHIRGRSLHDSFVIVDEAQSLERNVLLTVLSRLGAGSRVV
LTHDVAQRDNLRVGRHDGVAAVIEKLKGHPLFAHITLLRSERSPIAALVT
EMLEEISPGALP
120405603YP_955432.1 polysaccharide deacetylase [Mycobacterium vanbaalenii PYR-1]MTSGSGAQYDTRGARARRIRSAAILLGLVGGFIAAVPAPAAADSVDCARV
KCVALTFDDGPGPFTDRLLQTLRANNAEATFFLIGDKVAADPAAARRIVD
AGMEIGNHTWSHPDLTAIPPQELPAQLSRATEVLERATGERPTLMRPPFG
AVDDAVLAAAGSQGLAVVNWDVIPLDWENDTDIAATRAALTEQIRPNSVV
LLHDTFASTVDLMAEFVPVLRANGYHLVTVSQMIGPRPPGSLYGTPP
120405602YP_955431.1 hypothetical protein Mvan_4650 [Mycobacterium vanbaalenii PYR-1]MTATLDPTTASTPTALVTTAASQPALRTGAVLLGLASLVDLSKAKRGRGA
DRVLAVSGAAAAGWLLTPRFRRGFRR
120405601YP_955430.1 fumarate hydratase [Mycobacterium vanbaalenii PYR-1]MTDSAVDNTEYRIEHDTMGEVRVPKNALWRAQTQRAVENFPISFRPLERT
QIRALGLLKGACAQVNKDLGLLAPEKADAIIAAAAEIADGRHDDQFPIDV
FQTGSGTSSNMNTNEVIASIAAANGVTVHPNDDVNMSQSSNDTFPTATHI
AATEAAVRHLIPALEVLHESLDAKARQWRTTVKSGRTHLMDAVPVTLGQE
FGGYARQIQAGIERVKASLPRLGELAIGGTAVGTGLNAPDGFGAKVVDVL
VDQTGIAELRTAVDSFEAQAARDGLVEASGALKTIAVSLTKIANDIRWMG
SGPLTGLGELQLPDLQPGSSIMPGKVNPVIPEAVTQVAAQVIGNDAAVTV
GGLSGAFELNVYIPMMARNLLESFTLLANVSKLFAAKCIDGLVANDDHLR
ELAESSPSIVTPLNSAIGYEEAAKVAKQALKEKKTIRQTVIDRGLIGDKL
SEEELDRRLDVLAMAKVRDGS
120405600YP_955429.1 fructose 1-6-bisphosphatase II [Mycobacterium vanbaalenii PYR-1]MSSSRREAPDRNLALELVRVTEAGAMAAGRWVGRGDKEGGDGAAVDAMRE
LVNSVSMRGVVVIGEGEKDNAPMLYNGEEVGNGDGPDCDFAVDPVDGTTL
MSKGMPNAISVLAVAERGAMFDPSAVFYMHKIAVGPDAADVIDITAPIAE
NIRQVAKVKNSSVRDLTVCILDRPRHQQLMADVREAGARIRLISDGDVAG
AISACRPNSGTDMLVGIGGTPEGIIAAAAIRCMGGAIQAKLAPTDDAERQ
KALDRGHDLDRVLTTEDLVSGENVFFCATGVTDGDLLKGVQYYGGGCTTQ
SIVMRSKSGTVRMIEAYHRLSKLNEYSAVDFTGDKTAAYPLP
120405599YP_955428.1 hypothetical protein Mvan_4647 [Mycobacterium vanbaalenii PYR-1]MTTPPEPGPEVSADPGRESDAAGHRPAEYVMTPVAAPAKSRLLQDGRDMF
WSMAPLVVACVVLAGLLGMCSFAPTGPGPGPAPDYDAPAALQADAAALKI
PIRVPKLPDGWQANSGSRKGIEGGRTDPVTGQPVRAVGAVVGYLTPSGMY
LSITQSNADEDKLVASFSPELVPTGTQDVDGVRWVVYEGGEVDGKPTEPV
WTAQVRGPTGPAQLAVTGAGGTDEYRTLAAATQSQAPLPVT
120405598YP_955427.1 hypothetical protein Mvan_4646 [Mycobacterium vanbaalenii PYR-1]MSGPEADLRGWTAEPFTAAGLTYDVYRKGEGPGVVLIPEMPGLHPGVLAL
GNHLVDNGFTVWAPSLFGTPGAPALGPGALPVLMKGCIAKEFAAFATNAD
RPVAHYLRALARELNDDTPGKGVGVIGQCFTGGFALAAAVDDSVLAPVMS
QPSLPLPLTPKQRRDPGLSEAELAVIERRAADEGLCALGLRFSEDPMAPA
ARFTTLKARLGDAFEVIEISSKRGNPHGIGRAAHSVLTDQVVERDGHPAY
EARKRVVEFLTERLT
120405597YP_955426.1 hypothetical protein Mvan_4645 [Mycobacterium vanbaalenii PYR-1]MRDDFTLTQKRALAVLTVIALAFAAYFLRTYLLLIAISAVLAYLFTPLNN
RLLTRMGSGAAATVTLLAAIATVALPLSGVAFLAFLQISQMVTGISQWVE
RTDFTALGQRLLDSANQLLARIPFIDTTLTPESVRDALATIGQKAGEFAL
GFARDSVGGIVAMVTALILFIYVFLALLTNGTKVLDLFRDLNPLGQQVSD
IYLAKVGAMVSATVKGQFIIAVCQGVAGAVSVYIGGIHDGFFMFVIFLTV
LSFIPLGGGIVTIPLGVGMAVFGNPVGGIFVIVFHIIVVTNIDNLLRPFL
VPKSAHLHPALMLLAVFAGLQMFGFIGIVLGPVLMIVIVTTISVYLVVYK
DAPMESITGTGGDPADDDAVREIPWWRRLLPGKPKPAPEPAKSAAP
120405596YP_955425.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMRFTGKHAIITGGGSGIGAALCRALDRAGAQVVCTDIDEAAAGAVVSTLS
PRARAARLDVTDAAAVQGVVDDVVARTGRLDLIFNNAGIVWGGDTELLTL
DQWNAIIDINLRGVVHGVAAAYPQMLRQGHGHIVNTASMAGLTAAGQVTS
YVATKHAVVGLSMALRSEAVPRGVGVLVVCPAAVETPILDKGAVGGFVGR
DYFLQTQGGRAYDADRLARDTLRAVERNKAILVKPTVAQAQWWFARLAPG
LMNRMAMRFVTGQRTRQVDRYPSSAADTG
120405595YP_955424.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMERVPHHRRKANRMSDSSDRAGREAVVVGGASGIGWATATALAAEGCRVT
IADLNVEGARERAAGLGAEHAAAHVDVTDEDSVQRLFEDAGPIDIAVNCA
GFSNVGLITDMTAADFRAVIDVCLTGAFIVTKHAGRHLREGGSLVQISSL
NGRQPAAGMSAYCAAKAGLSMLTQVAALELGPRGIRVNAVAPGFVHTPLT
AAAASVPGVVEDYVDNTVLGRAGTAEDIANAVVYLCAPGSSWLTGEVLDI
NGGAHLKRYPDVMGHVMRLVEQSS
120405594YP_955423.1 hypothetical protein Mvan_4642 [Mycobacterium vanbaalenii PYR-1]MSESISVAVSPEQLYALVADVTRMGEWSPVCRACWWDDGAGPQVGAWFTG
RNVTPERTWEARCQVVAAEPGRRFAWEVNHGWAYWGYEMAAEDGGTRLTE
SWELLPEGVAGLRERYGETGDAEIAKRSEAARSGIPATLEAIKRTAESG
120405593YP_955422.1 deaminase-reductase domain-containing protein [Mycobacterium vanbaalenMRKLTAGLFIALDGVVEAPDQWHFPYFDDAMGEAVNAQLGSADTLLLGRV
TYDSFAGAWPLREAEGGEDAEFAKALGDARKIVVSRQDLRFSWRNSEQLT
GDLVEAVTALKNGPGDGDIAMSGSPSVVRQLLQAGLVDELHLLVHPIAVR
KGARLFDEGTPIPLKLLTSNTFDTGVVHLVYTRDDQTRSGGYEDAKSHL
120405592YP_955421.1 diguanylate cyclase/phosphodiesterase [Mycobacterium vanbaalenii PYR-1MSGGRPRLLGSCIAVPVGLTVALAVVLAVGGDGAWVPVLDDVIIVALSSC
ATVCAVLAAKSAEGRQRRAWATMAAAMGAWAVADLIWLVCEYVLRVEPFP
SPADFFYLAFSVLVVPAVLGMAQFDAWSRRQATLRIALDGVTVALCSFLL
AWIFALDRVYEAYRDDKLALGLAFFYPVADMVILAVAVAVLARVDAAHRA
VPALLVFGFAVMTLTDSAFAYGVAVDSYRTGSFIDLGWAVALVAICAAAQ
LSRENPQFRMPIVLVPSNTALWAPYVPLLLAGTIGPPLVMSGLEQLVVPV
IVVAVCLRQVVAAWENRQLLRAAAEQALRDPLTELANQRLFYDRLAHALT
LSSREGHSVAVVSLDLDDFKLVNDSVGHPEADSLLVRVGQRIADCVRAGD
TVARIQGDEFALLLEGEHDDSKLIAERVVDAFDEPFVLHGEHILLRPSVG
VAAASPGEAEVAPETMVMRAETAMNVAKRSRSSRVHVFDATLESAAPDVV
APERGSPQNWPDGAAKVRLLGELRRAIDNGEFHMVYQPIVDLRSGFIVGV
EALLRWPHPRLGMLSPDAFLPLVRQHGLMRPVTEVVLDNVLDDAARWMAD
GVPMPVAVNLFAPFLRDAQLPSALCQALERRGLPTDLLTVEITEDLVLHD
FDVVTGVLGQLREQGIRVAIDDFGSGFSALSYLRELRIDEIKLDRHFIAT
VASDPRAAAVVRAVIDLTHDLGSVVVAEGVEEPATAAWLRDRGCDMAQGY
YFGKPIEAADVPGLVRMAKDPA
120405591YP_955420.1 hypothetical protein Mvan_4639 [Mycobacterium vanbaalenii PYR-1]MTEHGAAMVWIPGQTAILGSDSHYPEEAPAHPVTVDGFWMQPTQVTNLEF
AEFVAATGYVTAAERPVNPADHPGAPRENLQPGSMVFTRTGGPVDLRHLN
LWWTWTPGASWRHPVGPASSIDKRLDHPVVHVGYEDAESYAAWAGLELPT
EAEWETAARGGLTAATYTWGDVPEQPGRQLANYWHGDFPWRPDRGYGRTR
PVGSFPPNRYGLFDMAGNVWEWTTDWYGDRRDYQPCCAAESYDAKQPQFE
VPRRVVKGGSFLCADSYCQRYRPAARRPQPVDTGMSHIGFRCVKR
120405590YP_955419.1 putative nonspecific acid phosphatase [Mycobacterium vanbaalenii PYR-1MLDSWNDGPTKAAIIAFAEGAAKDVAPEDRVAVFDNDGTLWCEKPAYIQL
DFLVRRMAEQVGADPSLADRQPYMAAAAGDLGWFGDAVTKHYLGDDSGIK
LLAAGILSAYSGLTVEEHAERVKAFFAAGEHPSLKRPYTACGYAPMAELL
RYLEGHGFTNYIASGGGRDFMRPVTYQMYGIPPERVIGSSVGLDFADGHL
RTTATPEFLDDGPVKPVRIWDRTGRRPIFAAGNSNGDIEMLQFTAAGTGP
SMSLVVRHDDAEREFDYTVGAEKALQIAGTHGWAVASMREDWIRIFD
120405589YP_955418.1 hypothetical protein Mvan_4637 [Mycobacterium vanbaalenii PYR-1]MTEPQENPAAPTVTSQPETAAGPPLGPPPPTGREDRSGRVTHVAAWVGIV
AGALFIVFLVFLAGVLLGRQSAGDDGFGRWRYHDGFHHGGQQWAPGMGQG
YGPGMCGPGGPGMYGPGMQGGMPPMMPGMQGMMPGMQGPAAPSTPSTTPP
APARP
120405588YP_955417.1 hypothetical protein Mvan_4636 [Mycobacterium vanbaalenii PYR-1]MPRFCSVAHDGAHIRYLDSGGDDLGAPIVFVPGFTDVADDYIETLPAFGR
RAAVVELRGHGHSRAVAGPYDSDTLGRDVGAVIDAVTDGPVHLITFSRGT
AYALTWALAHQARVRSLSIGDYVPEEIVLTDEVMLGLLDGRWRGSPVRDR
VDPAAAIATVRAARAQSFWEPLARWQPPLLVVRSPNATVVDDAAWARYRK
LFPHASFHEFTDSPHDIFRPDRGRYPALVRSHVDAVDCLPV
120405587YP_955416.1 3-beta hydroxysteroid dehydrogenase/isomerase [Mycobacterium vanbaalenMGDATTPTTELGRVLVTGGSGFVGANLVTELLDRGLQVRSFDRVPSPLPD
HPGLEVVQGDITDVDDVARAVGTGADKADTVFHTAAIIDLMGGASVTEEY
RQRSFAVNVTGTKNLVHAAQKAGVQRFVYTASNSVVMGGQRIAGGDETLP
YTERFNDLYTETKVVAEKFVLSQNGVSGMLTCSIRPSGIWGRGDQTMFRK
VFESVLAGHVKVLVGNKNVKLDNSYVHNLVHGFILAAQHLVDGGTAPGQA
YFINDGEPINMFEFARPVMEACGEPWPTFRVSGRLVWFAMTIWQFLHFRF
GLPKPLLEPLAVERLYLDNYFSIAKAERDLGYRPLYTTEQALEHCIPYYV
DLFGRMKAEAAQPAVQAAAPVPPAG
120405586YP_955415.1 exodeoxyribonuclease VII small subunit [Mycobacterium vanbaalenii PYR-MKPISELGYEQARDELIEVVERLEHGGLDLDTSLKLWERGEQLAKRCEEH
LAGARSRVEKALAANDEAED
120405585YP_955414.1 exodeoxyribonuclease VII large subunit [Mycobacterium vanbaalenii PYR-MTSAQGHSPENPFPVRGVAIRVAGWIDKLGAVWVEGQIAQLTLRPNSSTA
FITLRDPAADMSLSLTCPRDLVVNAPVKMTDGTQVIVYGKPNFYTGRGTF
SLRVSEIRAVGIGELLARIERLRRLLDTEGLFDPRLKRPIPFLPGTIGLI
TGRASAAEHDIVAVATGRWPAVRFAVRNTVVQGPNAVPQIVDALRDLDAD
PDVDVIVLARGGGSVEDLLPFSDETLCREIAACTTPVVSAIGHEPDNPLC
DLVADLRAATPTDAAKRIVPDTAAEQALVTDLRRRSARALRNWVNREAHT
VAQLRSRPVLARPLAAIDARAEEIHRARAAARRDVKRLLATEADRVGHLT
ARLTTLGPAATLARGYAVVQTIATSGEPHVLHSVSDAPAGARLRIRVTDG
AVTAISEGSE
120405584YP_955413.1 hypothetical protein Mvan_4632 [Mycobacterium vanbaalenii PYR-1]MSTAPYGVRLLVGAAVTAIEETRKLPQTILMYPMTIASQLAQLVMKMQQD
VAVLVIKGDETLESIFPPKDEQPEWATFDEDLPGDDGEVGAAAARDGERL
TEGRFALFSGEADAARASASDDTSAPSTAASPDAPEIVAEIEYESLTLAQ
LRARLTSLRLADLEALLSYEESTKARAPYQTLLANRITRASAK
120405583YP_955412.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium vanbMPPTVNMGIPGASRTALGSVAGDVTGKRVLLAEPRGYCAGVDRAVETVER
ALEKHGAPIYVRHEIVHNRYVVDTLAKAGAIFVEQTDEVPEGAIVVFSAH
GVAPTVHEEAAARHLRTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGH
EEVVGTAGEAPDHVQVVDNPDAVDKVTVRDPNKVIWLSQTTLSVDETMET
VRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSN
SVRLVEVALGAGASAAHLVDYADDIDPAWFDGVTTVGVTSGASVPEILVR
GVLDRLAEHGYDVVQPVTTANETLVFALPREIRPARQ
120405582YP_955411.1 penicillin-binding transpeptidase [Mycobacterium vanbaalenii PYR-1]MIVRTSRRSAAALLAVMLLLAGCSDAEDRLESTLRSFVDALSRGDAPAAA
ALTGDEAAASDTLGRLFASLGTDVGFEVTATRREEDSATFTLAATWKFGP
EKRNEWSYTTDGTATAAGDDWTIGWNAATVAPGLDQGPLSYSTLVPQPAA
RVLDRTGAELLTQHVVTLVDVAPGINANDVNTVAALLNPIAPGVTPASLS
ADLAAASGKPVTAITLREEDLAPIEEQLAATPHVTLRPQTRLLATDRALT
SPTLAGLSDLWQQRTDAAAGWAIIAETAAGAQRVGGQDAKPVGDIAATLD
IGMQLAAEAALAPLTTPAAIVAIQPSTGDLLVVAQNAPADAQGPIALTGL
YPPGSTFKTVTVSAALQAGQVTPDSIVACPGTENIEGRQIPNDDNFDLGD
VPLHTAFARSCNTTMGRLAVNLPPDGLTKAAAQLGLGIDYVARGMTTVTG
SVPVADTSALRVEEGIGQGKVTASPFGMALVAATLAHGSVPAPTIVAGEP
GVPDRTPEPLPSSVDEQVQAMMRETITDGTATQLQDIPGLLGKTGTAEYI
DDQHAHGWFVGIRGDLALAVFVSDAGSSGPAVDAAGRFLRAIP
120405581YP_955410.1 sulfatase [Mycobacterium vanbaalenii PYR-1]MGDKPNILIIWGDDIGQSNLSCYSDGLMGYRTANIDRIAAEGARFTDYYG
EQSCTAGRAAFITGQNPYRTGLTKVGMPGAPIGLQAEDPTIATALKAQGY
ATGQFGKNHLGDRDEFLPTMHGFDEFFGNLYHLNAEEEPENVDYPKDPEF
RKKFGPRGVIRAWANGDGTQRIEDTGPLTRKRMETCDEEFRDAAIDFIKR
QHEADTPFFVWFNSTHMHFRTHPKPESIGRSGRWQSEYHDTMLDHDDIVG
DLLNTLDELGIADGTIVMYSTDNGPHMNSWPDAGMTPFRNEKNSNWEGAY
RVPAVVRWPGRIPAGTVLNGIVSHNDWFVTLLAAAGDPDIAERLRAGTDL
NGTTYKVHLDGHNQLDYLTGATDESPRQYFFYVSDDGDLTALRYDNWKIV
FLEQRAAGTLQVWLEPYTELRAPKLFNLRTDPYERADITSNTYFDWVLDR
VFVFTPAQAFVAQMLQTLVEFPQRQASASFNLEQVMAKLQAGIPDS
120405580YP_955409.1 hypothetical protein Mvan_4628 [Mycobacterium vanbaalenii PYR-1]MPMTSPKLDPNTRLAAERTRLALERTLMAWIRTATALIAFGFTIYQIFRY
LSTAERLRAPFVSPQIVGVAMIVIGLTALILAWVQHRRAMKALQADFGPM
PGSLAGIFAALIAGLGVIALLGVMLRL
120405579YP_955408.1 hypothetical protein Mvan_4627 [Mycobacterium vanbaalenii PYR-1]MDYAEGEPQFRRLTTPRSAAVAGVLFAVLFAASLVLLRSAIPDDPFAQIA
WVNGGRTRIGAALVLAPMAAIAFLWFIGVMRDVLGDFEDRFFASVFFGSG
LLFVAMTAVSMGIAGAILTITEIPGVASNGLIYFGRSLMLQISNVWGVRL
AAVFMISLATIWIRTGLMPRWTAVITYLVAALLIVVVSLSLWVTLVFPAW
VGAVSLMVLFTRPGPHRGAVGHRGP
120405578YP_955407.1 hypothetical protein Mvan_4626 [Mycobacterium vanbaalenii PYR-1]MSEQRARPAVAPEHSSAHPNIAGIPWWGAILTAVIASAIGFAFDAGSGGG
QLTAAFAALYVVGCLVAVLAVQQSNLFTAVIQPPLVLFVTVPAAYFLMHS
SDIQGLKDILINCGYPLIERFPLMFFTSAAVLMIGLARWYFAKSGHQFGA
QARGKGAPAGAGLSAKLSSLLGGSATAVDGDAVADEPPRRRATDRRRAAP
KPAARKSSRGDRPVKRSAPRARQAPAPETEIIDPVADRPRRRRPRPEEQP
PTPEPRRRPRTSSAREPRNARSRDPLPPRERRSPYDGDDRHDHRPQRDRG
PREQPRRRSRFDDHEPFDPYSSAGTSSHHPISRVRYRGADDVDDRAEHRS
RRHSPRDADADRWEFDI
120405577YP_955406.1 GTP-dependent nucleic acid-binding protein EngD [Mycobacterium vanbaalMVPVGLNLGIVGLPNVGKSTLFNALTRNDVLAANYPFATIEPNEGVVALP
DPRLTELARIFGSEKILPAPVTFVDIAGIVKGASEGAGLGNKFLANIREC
DAICQVVRVFADDDVVHVDGRVDPKSDIEVIETELILADMQTLERALPRL
EKEARTHKDRRPVYDAAVAAGKILDTGKTLFSAGFDVSELRELNLLTAKP
FLYVFNADEAVLTDTERVAALRELVAPADAVFLDAKIEAELQELDEESAA
ELLESIGQTERGLDALARAGFHTLKLQTYLTAGPKEARAWTIHQGDTAPK
AAGVIHSDFEKGFIKAEVVSFDDLVEAGSMAAAKAAGKVRIEGKDYVMAD
GDVVEFRFNV
120405576YP_955405.1 alkylphosphonate utilization operon protein PhnA [Mycobacterium vanbaaMSDQLPPCPACGEAFTYEQGALLVCPMCGHEWSADEVSDVDSAHAGAAVK
DSVGNVLADGDTVIVVTTVKVKGGGGGVIKAGTKVRGIRLISDGVGDHDI
DANVPGLGRMQLKSSVVKKVV
120405575YP_955404.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMELRGKRVLITGASRGIGESLAHNFAGAGARVALVARSRDSLESLAVELG
GTVHPADLSDSTQVSGLIRRVEDDGGPIDVLVNNAGIESTACFTDAPEDE
LRRVTDVNYLAPAELCRQAIPGMLRRGGGHIVNVSSLSGIVLFPGLVSYS
ASKAALSHFTAGLRTDFRGLPIGTTLVELGPIPTDLLAKIDNYEPTAKSF
QRAYRWGVAVDTPRERVAEEVVKAVLKGRRHVRLPKRSAPLAMLAEAPRR
IAEIILTGVPHQAKS
120405574YP_955403.1 hypothetical protein Mvan_4622 [Mycobacterium vanbaalenii PYR-1]MTKDWRVDRVEEIRSLIKEAEPDVVEEIKWRKPSNPDGVPAFSLDGLICT
LEMYKGKVKVNFAKGSSISDPDSLFNASLQAPVGRSIDLHEGDELDSEAF
KTLIREAVKVNRK
120405573YP_955402.1 hypothetical protein Mvan_4621 [Mycobacterium vanbaalenii PYR-1]MGQSDRLDVFFEELAELAGQRNAIDGRIAQIAAEIDDAGLWGFTGVRSME
GLIAWKLGTSFRNAETIVAVARRLEEFPRCSRDLCEGRLSLDQVGVIAER
AGAGSDDHYAELAAHSTVAQLRTAVKQEPRPEPEPDRDPGRDCDPEAESE
AECGSESESGADCDPESESEAKPRRDPVPRASITKTSDEQYTYWRIALPH
EEAATFDTALNCHLEGLVAQWKRDHNITDHTDDHNHDINSDPGRGDGHDT
VDRGYDTDDGGGGGGGGEGVGRAPLPDTVAAFWALVKAGWDVEVARRPHG
AHTTVVMHVDVKDRIAALHLGPALSAAERRYLSCDATCEVWFERHGQVIG
SGRTTRAISRRLRRALEHRDRTCVVPGCGATRGLHAHHIRHWEDGGLTEL
DNLVLVCPHHHRLHHRGVITITGPADQLTVTDSVGRHLEPGSLARPPTTP
PPAVAPYQGPPGERAQWKWYTPFQPPPPTTN
120405572YP_955401.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MSFVVASEAYGRFMGRYAEPLAEAFVAFAGVGVGDKVLDVGCGPGALTAR
LRSVGADIAAIDPSPPFIDAIRRSFPDVDVRQGPAEELPYDSAAFDAALA
QLVVHFMTDPVAGLRQMSRVTRPGGVVAACVWDGPTGALAPFWDAVHVVD
PEAEDEALLSGARSGHLTELFEAAGLRDVVEDSIAVDVVHPTFEQWWEPY
TYGVGPAGDYVQQLDDEGRARLESAARERLGKGPFTVTAVAWAARGTA
120405571YP_955400.1 type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]MPEVDVGQRYTEVADLYIRMFGAVDRVAPQDLSFLERNLGDSDGTVLDAG
CGPGHLAAYLTGLGLTVQGVDLVPEFIGNARANWPGVDFAVGSVHTLDMP
DRSLGAILAWFSLIHCEPAELTDVLTEFRRVVRRGGMLVVGFFEGACVER
FDHKVAPAYRWPVDEMSRMLSAAGFAETERCRRSGTAQTRPYAALAARAA
120405570YP_955399.1 hypothetical protein Mvan_4618 [Mycobacterium vanbaalenii PYR-1]MPLRYVDPHRRRGSRYQQGVRFGRSRVGQFIARHIARRTDPMLFRLTGGR
VNMGPIVNAPLRTVGAKSGKPREVQLTYFHDGHDVILVASNFGGSTHPQW
YYNLKAHPECDFGREPFTAEQVTDPGEYSRLYQLAERVYEGYADYRDKTA
DSGRQIPIFRLKPR
120405569YP_955398.1 hypothetical protein Mvan_4617 [Mycobacterium vanbaalenii PYR-1]MLEPMSALAVVAALVAALCVGYQLGRRVDRRSPTWKQRTSSAALGRQAVG
LIALLAAGRLERSVRRRLPRRRASWLSRR
120405568YP_955397.1 hypothetical protein Mvan_4616 [Mycobacterium vanbaalenii PYR-1]MTEVVGGADDSESVGEDYSEVRYLHPKPTAPKTYGFNELLSRLVGYRLQS
VQFIGSYVQLGFDLAASPDAPVLTCEVMPVVDRPAGPVSDREPGYADALR
SLIGEQVAATSEAAGQGIRIDFGAAALMMRPGVADLRGPVIAMLSDFSDG
SSESWRPGSGAFDYLV
120405567YP_955396.1 hypothetical protein Mvan_4615 [Mycobacterium vanbaalenii PYR-1]MPTSTDHDAPAHDVPGRALFSARASAISIVVAAIATLGVVFVMLNAGDKE
APQVQSIPAQPNTVSQWVTAPARDKPIPVAPRPQAPALAMDGRGFVNTAA
RCDAAARAVAIARTARSAVVVCQGPDGSYEYQGIRLRDGAALQLDDVRPM
AVGFEARNEGTTYRLSPTELVVISGESLQSRDAVVEYRAG
120405566YP_955395.1 hypothetical protein Mvan_4614 [Mycobacterium vanbaalenii PYR-1]MSLERALEETRTGDIWLFRGRSGPDRAIQSMTNSPVNHVGMTVAVDDLPP
LIWHAELGDKLLDLWTGTHHRGVQLNDLRQAVERWMHTYDQRCWLRQLTP
YATRDQEDRMLRVIARMDGTPFPSTARLTGRWMRGRLPGVSDFTRGIPFV
HKRVRESVERRKSERVKVGLETAYCAETVAITYEEMGLLQTEKHANWFDP
GKFWSGDTLPLAAGHRLGEELSVVP
120405565YP_955394.1 putative adenylate/guanylate cyclase [Mycobacterium vanbaalenii PYR-1]MALLVLAAVVVGLAVALAVQSRRLRTARQEADELRRRLDTRQMLVTGSTK
AVKTVWQTANILRRDGFGAAVRSSIEELADWAEVERPDLARLAPNGRVAI
MFSDIEESTALNERIGDRAFVRLLGRHDKPVRRHVDAHDGYVVKSQGDGF
MVAFARPEQAVRCGLAIQHSLDKRPNGIRVRIGIHVGKSVLRGDDLFGRN
VAMAARVAAEADGGEVLVSSAVRDALTDADDIVVDGERDAHLKGFSGSHT
LYSVRSASASR
120405564YP_955393.1 hypothetical protein Mvan_4612 [Mycobacterium vanbaalenii PYR-1]MAKAPYYESRFIRANDPDTARAVWLRETLLLPTVGEPVADVWVMVFDPSG
HRAVKQQFTIAEAAFGYDDWTARIASTVLDDTAAFGALADARWDLAITAS
GQEPVRVLSDRAYQARFPTAKTSVRDPLARFDGHLEISGHGVDIDGWTGS
VNHNWGTRHTPAYAYGQVCGFDNAPEATLEIVTARAALGPVLLPGVTLFV
FRHEGQQFAVRSIRGSLQSHGRYAPFRWTFGARVGEQMIEGEITTVPSDV
IGLTYSDTHGGVKYCYNSAIANCRIQVAGKAFERSELVSRRAMFEILTDD
RLDSVPLLA
120405563YP_955392.1 limonene-1-2-epoxide hydrolase [Mycobacterium vanbaalenii PYR-1]MTRTPDAVVTEFCAKWTTPDPQELATYFTEDGVYHNIPMTPVVGRDAIAA
FITEFTSMVDGIDFRVHRQISSGNLVFNERTDVMRFKDGRELPLPVAGVF
EITEGRIAAWRDYFDMATVTAAWS
120405562YP_955391.1 hypothetical protein Mvan_4610 [Mycobacterium vanbaalenii PYR-1]MSTRSTAGFNFLEQQELPAPQVSEAQAQDILATHYGLAAHVSALGSQQDK
NFTVRDDGGAVVGVLKIANPAFTAEELAAQDAAARRIAEAEPGLRVAVPL
ANAAGETRTAVDGVLEGTALVRLLQFLPGGTVSESGYLTPDSVAGLGDVA
GRVSRALADFTHPGLDRILQWDLRFGMHVVDELSAHVGEPALRRRLQTAA
RDAWARIAPLDDALPRQAAHIDLTDANVVVSPADGRPDGVIDFGDLSHTW
AVSELAITASSVLGHVGAQVTSVLPAIRAFHAVRPLSVAEADALWPMLVL
RTAVLIVSGAQQSVLDPDNEYLTEQSDAEQQMFDLATSVPIDVMTAVIKA
GLGMAQPSPPVRVQAQLIGADRTSTVTLDLSTTSEVYDDAFDAAGVMRSD
IEDESARAAMHQGATVVVTRFGEARLDRAPRLSQDSPEVVATGISMWTAA
DTDIAAPWDGEVVTDATGSITLRGNDFEVTVVGAAPAGGAAVCAGEVLAS
ARAGERIEVSVRPVGVPVAPPFIRADLAPGWLAQVRDPRPLLGLAPLEQD
GAADLLSRRDASFAPVQEFYYRTPPQIERGRRHYLMSTAGRSYLDMVNNV
TVLGHAHPRIADTAARQLRRLNTNSRFNYEAVVEFSERLAALLPDPLDTV
FLVNSGSEASDLAIRLATAATGRRDVVAVREAYHGWTYGTDAVSTSTADN
PNALATRPDWVHTVESPNSFRGKYRGSEAFRYAEDAVAQIEALVMSGRPP
AAFICESVYGNAGGMALPDGYLKQVYAAVRAGGGLAISDEVQVGYGRLGE
WFWGFQQQDAVPDIVSVAKSVGNGYPVGAVITTRAVAEAFSSQGYFFSST
GGSPLSCAIGMTVLDVLRDEGLQDNARRVGTHLKTRLEGLKERHPLVGTV
HGFGLYLGVEMIRDPQTLTPATAETSAICDRMLDLGVIIQPTGDHQNILK
TKPPLCIDVEAADFYVDTLDRVLTEGW
120405561YP_955390.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MSTVSSEPTTVTFRGAEDLALVADEWNNPAEAASSGRDFDASRPSVLMLH
GGGQNRFSWKKTGQTLASQGLHVVALDSRGHGDSDRSPDANYTVEALCAD
TLAVLRQIGRPTVLIGASMGGLTGILASRQAGPELVTRLILVDVVPRYEK
DGSARIREFMFSHVHGFESLEQAAEAVAAYLPHRTKPRSPEGLKKNLRHR
HGRWYWHWDPAFLTKPNEDPFVRVEQLEQAAIELTIPILLIRGKLSDVVS
EEAVQDFLTKVPNAEFVELPGAGHTAAGDDNDAFSEVVAQFVLR
120405560YP_955389.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MQPGPDHDGDRRRIIEAAYRCLAQPHAGPIPMTSILRSAGLSSRAFYRHF
LSKDDLFLALLRQECEAVIAQVDRIADAAVGSPADQLADWIAAMFDIIVD
PQQRLQLTVIDSDEVRAAKGYREMRERLHAERERSLAEILRRGRRDGSFP
LAEPEIDAVAVNALVSRLLVRQTTDDPQARKQAEVAVLDFALRAVGAVPG
GQDTRR
120405559YP_955388.1 3-demethylubiquinone-9 3-methyltransferase [Mycobacterium vanbaalenii MPTITPSLWFDNDLEEAIAYYSSIFPDSAIETIERYNEAGPGTPGEVVAA
TFTLGGQRFIGINGGPQFPFTEAVSFTVACRDQAEVDYYWDRLVAGGQES
QCGWLKDRYGLSWQIVPDRLTELTSDPDPARAAAATKAMLGMRKILIAQL
EDAVQGV
120405558YP_955387.1 hypothetical protein Mvan_4606 [Mycobacterium vanbaalenii PYR-1]MVASDVISKPVRAFGGFYSMALDTFVAMFQPPFAWREFISQAWFVARVSI
LPTLLLTIPYTVLLTFIETILLTEIGASDFSGTGAALGTVRQIGPIVTVL
VVAGAGATAMCADLGARTIREELDALRVMGINPIQALVVPRVLAAMVVSL
ALSATVILVGLSGAYFFVVYIQDVSPGAFAAGLTLIIGATDVVIALVKAA
LFGLSAGLIACYKGISVRGGPAGVGNAVNETVVFTFMALFAINIVATAVA
IKITL
120405557YP_955386.1 hypothetical protein Mvan_4605 [Mycobacterium vanbaalenii PYR-1]MTVSRPHSQFPWLKSQFARVADPWNHIGTQTKFYGRTLRSVGYVFTHYGV
ELIRIIAQMGLGAGALIVIGGTVAIVGFLTVTTGALVAVQGYSDFSELGV
EALTGFVSAYFNVRLIAPATTAIALSATIGAGATAQLGAMRINEEIDALE
VMGIRSIAFLASSRVIAGFLVVIPLYCVGVLMAFWAARFGTTVIYGQSTG
VYDHYFKTFLNPTDLMWSFGQCIALSVIIMLVHTYYGYTARGGPAGVGEA
VGRAVRTSLIVSAFVLVMLSLAVYGQSGNFNLAG
120405556YP_955385.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MEGHEEGLHPAWWTLILVILTVVALWLTYSLFFGTFRAHETVTLTSERSG
LVMETGAKVKLRGVQVGRVSAIQGGSQPVALKLEIDKDKIKFIPANIEGQ
IRATTVFGAKFVDLVYPEDPKGQLQAGQVIESRNVTVEANTVFQNVVDII
KRIDVAKLNSTLSALADGVRGQGERIGQATTDANQVLLELNPRNETIAEN
WRALRDFNDTYSVAAQDILTTLDALSTTSTTITNRATQLDALLMATTGLS
NSGISLLAPNQANLIKAINVLEPTTNLLHKYSPSYTCLLTGAKTLLDTGG
YDAPGGNGRTLVLDVGLTLGDDPYHYPDNLPVIGAKGGPGGKPSCGSLPD
VAKNWPVRNLVTNTGFGTGIDWRPNPGIGFPAWANYLPTTRAVPEPPSIR
NLFGGPAIGPIPYPGAPAYGADLYAPDGTPLWPGLPPAPPPMAPRDPGPT
PGSEPFIVQHPAQMQPTPLPPVPLPREAAPSP
120405555YP_955384.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MPGLTTRVRHDALRLGVFLTVCLVGVFGLFAVFGQMRFGEKTHSYKAAFS
NVTGLENGDFVRIAGVEVGQVKKVAIQPDTTALVEFTADQSVVLTEGSRA
VIRYDDLIGGRYLALQEGAGATTTLKPGETIPLARTAPALDLDALIGGFR
PLFRALDPEQVNALSGQLISALQGQGGTINSFLAQTATLTSTLADRDQLI
GEVITNLNVVLGSLGDQNDQFAKAIDSLADLVQTLRDRKEDVSNGLAYTN
AAAASIADLLAQARPPLAKTIKETDRSAAIVVADHEYFDNFLNTLPDAYQ
ALARQGIYGDFFSFYLCDIVLKLNGKGGQPVYVKVAGQSTGRCAPR
120405554YP_955383.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MKSFSERNQFVVGIVGLALTIGIVLVSLNYDRLPFLQGKEYKAYFAEAGG
LKTGEDVQVSGFTVGDVKSIELDGSLALVTFTVARDIRLGERTEAAIKTR
GLLGTKMLEITSRGEGQLDGPIPLERTTSPYQLPDALGDLAMTISGLNTD
QLSESLRVLSATFADTPPQLRVAVEGVARFSETLNERDAELRSLLGNADK
ATTVLAERSNQVVSLIANSNALLIELENQSAALDQISGNISALSDQLVGF
IAENRETLKPALDKLNGVLTIIDNRKERLQKSIHLLQQYSMSLGESVASG
PFFKTYVANLLPGQFLQPFIDSAFSDLGVDPSVLLPSELTDPPVGQPGTP
AMPGQYPRTGQGGEPRLTVPDAITGNPGDQACGLPGLPLPGPGCYPYREP
LPAPPPGGPPPGPPAEAQPGQQSIPGPTPAPVLVPAPGETPHLGSAEAGQ
120405553YP_955382.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MTRTLRILLIASLSVILVGGVVVLLRTTEAINRTHAVAYFENSNGIYAGD
AVSIVGVPVGKIESIEPQPESVKVSFWYDSKYKVPADAKAVILSPTLVTA
RTIQLTPAYTGGPVMENDAVIPRERTAVPVEWDEVRQQLAKLADTLQPTE
PGGVSPLGSVINTTADNLRGEGANIRDTVIKLSQAISALGDNSTNIFSTV
KNLATLVSALQDSTNLMRQLNQNLASVTGLLANDPDEVANAVRDLDKAVG
EVQTFVADNRESLGTTSDKLAGVTQALTDSLADVKQFLHVAPNTLQNYVN
IWQPAQGAVSSVPMINNFADPVSFLCGAVQAASRLGAEESAKLCVQYMAP
IIKNRQYNFLPLAQNVFVGATTRPNELTYSEDWLRPDYIPPQPGSAAPPP
PAGAPQPAAGAPQPPAGAPLPPALGPLLPAEAVPTAPNPADGLQGLMVPA
GAGS
120405552YP_955381.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MRARAFRAIVVAAVLAGLLSGCAGWRGLNSLPLPGVQGTGPGAFQIQAQM
PEVDNIEPNSRVRVGDVNVGHVRKIERQGWHALVTIELNGDVELPANATA
TLGQTSLLGSLHIALAPPTDEAPQGRLKEGSLIPLSSSRAYPSTEQALAA
VALLLNGGGIGDIQDITEALSTAFTGRENDLRSLIEQLDKAIGYLDDQKD
DIIAAAESLNNLMGQLAEQKPVVDKALRTIPDALAVLKDQRNNLAEALTQ
LGRFSALAADSVNQTKEALVAELEDLGPVLEELADAGPALTRALSFLPTF
PFPKETLTNWMRGDYANLTLILDLTLSRIDSGFFTGSRWECDLTWLELQW
GRTIGQFPNPCNAGGPGTAGNPLIAPYRWDQGP
120405551YP_955380.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MRLTRQILIQMAIFAVIATTALVIMVFAYMRLPAFLGIGQYRVTLELPET
GGLYPRGNVTYRGVEVGEVKSVQLTDTGVEAVLSLNDNVEIPANLEAEVH
SVSSVGEQFVQLLPRSADGPVLKDGDVIPINRTTVPTDINGVLDATNAGL
EAIPQENLQTVIDEAYTAVGGLGPELRRLVTGSTALAIDARKNLESLTTL
IDQSKPVLDSQTETGDSIQAWAANLASISGQLQSQDPAVAGILDKGPGGA
EEVRALFDRLQPTLPIVLANLVSIGEVAVTYQPSLEQLLVLLPQGTAVTQ
AVGVHKRNTKQDYMGDALVFNLNLAIPLLPAPIPLPPQQLPPPCTTGFLP
AQQRRVPTFEDYPDRPVGNLYCRVPQDAPFNVRGARNLPCISVPGKRAPT
WQDCESNEVYVPLNDGYNWKGDPNATLSGEPIPDVPPDVPVAVTPPPPGT
PPLPVAAAEYDPASGEYVGPDGKVYTQSNLADGASGERPWQSMLVPPGG
120405550YP_955379.1 hypothetical protein Mvan_4598 [Mycobacterium vanbaalenii PYR-1]MADEKRPAEESTTEVDAPAGSPDATPAPVADPAEMESDTAEDSEVIEEYD
LEAEDSEADEAEASEADEAEASEADEAEAAPRSPMSHVKVALIAGLVGVL
ALAGLTAWMGYRTYEANRDEHRRELFLQVGRQGALNLTTIDWQNAEADVQ
RILDSATGTFYDDFQQRAQPFVEVVKQAQSKSVGTVAEAGLESAGANEAQ
VLVAVTVKTSNAGAPEQEPRAWRMRISVEKIGDDAKVSNVEFVP
120405549YP_955378.1 hypothetical protein Mvan_4597 [Mycobacterium vanbaalenii PYR-1]MSNEKTGTADITEDTTAAADEPATDTEQPAKGTDDAESAADKTGAEETDT
VDEDAEVTEDADEDAEVTEDDDEDAEVTEDAGEDAEATDDAAVTPKRDGK
WARLTAFVLLPALALVLALGAGYLKWQDTTFRSGAIEASPSGRLSLAEKT
VQIARDSTIALLSYKPDTVEQQLGAARDLLTGEFRDSYTSLTNDVVIPGA
KEKQISAVASVPAAASVSATPTEAVVLLFVNQTVSVGADVPTDTASSVRV
TLEKVGDRWLISKFDPV
120405548YP_955377.1 hypothetical protein Mvan_4596 [Mycobacterium vanbaalenii PYR-1]MTVRRLSAVDAQTYWMSASVPSDQFLLYAFDGPVADLDRALRVVRDRAQQ
CADLGVCIEDTEFWRYPVWAPREAGADQIVVHQLADATWQGCLSAVAGLV
GEQVDPRVQTWRLHVFPAVEGLPEAGAGSVAVLQICHALGDGIRASALAA
HLFGRAGDVPALTAHRGRAAALPLRAFGAGRAYRRLVRDTDAGMVPPQAV
PRPALRSNARPAGACHLRSVVCARERFGGATVTVGALAAISAALAGHLRE
FGEDPAQLGAEVPMAKAGPRLSYNHFGNVGVGLYPDRELSSRVRSIAADL
HQRRRRATHPAMAAEAAALAAVPAPLLRWGVGKFNPEARSSTVTGNTVVS
SVNRGAKDLSFGDARVVLTTGFPGLSPMMGVTHGVHGIGDTVAVSVHAAD
SAIGDIDAYLERLERELR
120405547YP_955376.1 carotenoid oxygenase [Mycobacterium vanbaalenii PYR-1]MGNQYLEGAFAPVANEYTLTGLDVVGDIPAYLDGRYLRNGPNPVAEVDPE
LYHWFTGDGMVHGIRIRDGKAEWYRNRWVRSPRVAEALGETPPRGDYGLT
PIGANTNVIGHAGKTLALIEAGVAQYELTDDLDAVDVCDFDGTLAGGYTA
HPKRDPGTGELHAVSYCLLNGNTVQYSVVGVDGRARRTVDVEVTGSPMMH
DFSLTERHVVFYDLPVTFDSRQAATIGVPRWLQLPARLVLSALIGRVRIP
DPLAARRPGRDSSDAAFPYSWNPRYPARVGVMPREGGNGDVRWFEVEPCY
VFHPMNAFDDGDTVVLDVVRHEKMFATDHLGPNEGIPTLERWTVDLADGK
VRESRIDDRGQEFPRVDERVVGRRHRYGYAPTVTGGGSCADTLLKHDFVG
TGSVARSFGAGKTLGEFVFHPSSPDAAEDDGVLMGYIYDRPTDRSQLAIL
DAATLDDVAAVNLPHRVPAGFHGNWVPTA
120405546YP_955375.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MDSQVHKLTVKGRATRDRIVEGAAAEIRERGVAATTLDDIRARTQTSKSQ
LFHYFPDGKDQLLLAVAEHEAHMVLEDQQPHLGELTSWAAWRRWRDAVVD
RYRRQGQHCPLAVLMSEIGRTTPGAEAVSAALVTKWHGEIATGIRDMQAQ
GKIADRVDADRTAAALLAGIQGGVGIMLSTGDLGFLEAALDVGIAALRD
120405545YP_955374.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMSPNSTRLTGRTALVTGSTGGLGVTIAHALAADGAVVVVTGRDVARGESV
VAGIRADGASAHFVAADLGGADEQAIDGLAQRAAEAASAGIDILVNNAAK
LLLPEPTATLSAGEVAEAFTVNVVAPMLLTGRLASAMAARGSGSVVNIGS
ITGLRGTAGSAVYDATKASVHSLTRSWAAEYGPSGVRVNAVAPGPIATER
AAEFAEHIAPALARVPSRRMSTPQEVAAAVVFLASDDAANIQGAVLSVDG
GWAAT
120405544YP_955373.1 DoxX family protein [Mycobacterium vanbaalenii PYR-1]MTAYDVGVLILRVVLGLTMAAHGYNKFFGKGGLKGTAGWFDSMGMRPGMF
HARIAATTEMAAGIGLAVGLLTPIPAAGFVALMLVAAWTVHKPNGFFIVK
EGWEYNLVLAASAVGIATIGAGRLSLDYALFSGTGIYDLLHGWWGLLIAV
VLGLAGGIGQLVIFYRPPAPQSAS
120405543YP_955372.1 hypothetical protein Mvan_4591 [Mycobacterium vanbaalenii PYR-1]MGFLKQDAPVVDYAEWSKGTRAERIVPMARHWAEVGFGTPVVLHLFYVVK
ILLYILVAWLIVLTTSGIDGFTNVAAWYHEPIVYQKVVFYTMLFEVVGLG
CGFGPLNNRFFPPMGSILYWLRPRTIRLPPWPNRVPLTAGDSRTPFDVLL
YAALLVMLLFALFSDGTGPIPELGSEVGVLPVWQTATIIGLLVVAGLRDK
VIFLAARGEVYGSLAVCFLFSGADIIIAAKLVCLVIWLGAATSKLNKHFP
FVISTMMSNNPVMRPRWIKRKFFEHFPDDLRPGRASRFLAHFSTAIEGLV
PLVLFFSHGGWATAIAAFVMLVFHFGILSAIPMGVPLEWNVFMMFSVLAL
FVGNAGIGLADLQSPWPILLFAAVAGTVVIGNLFPRKVSFLPGMRYYAGN
WDTTLWCVKPSAAEKIANGIVAIASMPAAQMEKFYGSKETAEVYQYMGYA
FRSFNTHGRAMFTLAHRAMADGSEDDYVLTDGERICSTAIGWNFGDGHMH
NEQLIAALQKRCQFEPGEVRVLLLDAQPIHRQRQEYRLVDAATGEFERGY
VMVADMVTRQPWDDTVPVHVTWRR
120405542YP_955371.1 GntR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTRNTPLAPMIGPDAVASRAAVRSPKTAELVAGTLRRMVVEGQLKDGDFL
PNEAELMAHFGVSRPTLREAVRVLESERLVEVRRGSRTGARVRVPGPEIV
ARPAGLLLELSGATIADLLTAKSGIEPMAARLLAESGSPEAFDELERMLE
ELAADSHKSSRLAEATGLFHLRVVQLSGNATLSIVAGMLHEITVRHTAFV
FNERRPVSKADYDTLLRSYRKLMQFLRAGDAVGAEAHWRKHLDTTRELLL
TGLESVPVRDVMG
120405541YP_955370.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MAEAVIVEAVRAPVGKRNGALSGVHPAELSAQVLNGLVERAGVDPALVDD
VIWGCVMQAGEQALDIARTAALSAGWPETVAGVTVDRQCGSSQQTLNFAV
AGVIAGHYDVVVAGGVESMSRTPMGSSLANGGNPYGESFKARYAQTPNQG
VGAEMIAEQWGFSRTQLDEFSLRSHEKAAAAQDSGAFKDQIVGIKTKDAD
GNDTVVLEDGGIRRGGTVESMAKIKPAFKEDGVIHAGNSSQISDGSAALL
IMSAEKAKELGCKPLAKVHTAVLAGADPVIMLTAPIPATQKALKKSGLSV
DQIGAFEVNEAFAPVPMAWLKDIGADEKKLNPNGGAIALGHPLGGSGARI
LTTLLYHMRDNNIQYGLQTMCEGGGQANATILELL
120405540YP_955369.1 enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]MTDTVTDTAPGALTERRGNVLIITINRPEARNAVNASVSIGVGNALQAAQ
DDPEIRAVILTGAGDKSFCAGADLKAISRGENLFHPEHTEWGFAGYVRHF
IDKPTIAAVNGTALGGGTELALASDLVVAEERAKFGLPEVKRGLIAGAGG
VFRIVEQLPRKVALELIYTGEPISSADALRWGLINQVVPDGTVVDAALAL
AERITCNAPLAVQASKRVSYGAVDGVVGSEEPFWKQTFGEFSTLLKTEDA
MEGPLAFAQKREPVWKAK
120405539YP_955368.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMKRTIYDAEHEAFRETVKEYIERELVPNSEKWETERIVDRSAYTAAGKYG
LIGFNMPEEYGGGGSEDFRFNAIIDEEMAKSGVHGPALSLHNDVVGPYFK
DLTNDEQKKRWLPGIASGETIIAVAMTEPGAGSDLAGIRTSAVRDGDDWI
INGSKTFISSGINCDLCVVVARTDPEAGHKGFSLFVVERGMEGFTRGRKL
DKMGLHSQDTSELHFENVRVPNANLLGKEGRGFYHLMTNLPSERLSIAIS
AIAGARAVFQETLQYAKDRKAFGQPIGSFQHNRFLLAEMETELEVTENYI
DRCLQGVVDGELTAVEAAKAKWWATETAKKVVDQCVQLHGGYGYMLEYRV
ARAYVDGRIQTIFGGTTEIMKEIIGRELGV
120405538YP_955367.1 beta-Ig-H3/fasciclin [Mycobacterium vanbaalenii PYR-1]MRVLDLAVTNSCTYHARRLDKRKEHTVKTRTSKAIGVAVSAAAIALSVPL
AINAHAEPSTPVAEIPDPQGPDCGAFKEALPNWKGLANLPVSTALSSIPD
ISSFNSAISGQLNPAVNITGVLDNGPYVVFAPTNEAFAALPPEQLEVLRT
DPAALTSLVYYHVFLGLLGPDDVKGQRPTQQGTEIEVTGSGGDIAVNETT
KVVCGGIQAQNARIYIVDQVLNPAEAPAPITPTSTSETSSTETTTPTTPT
STETPPPAPAEAPTVPAAEAPIG
120405537YP_955366.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSSSAKVIYLRSYGDRDREDHHVVGAVLDATAALLCEFTFDDLTTRRIAE
AAGVTHGDLCVYFRSTEAIVAEIYLGLLRDAPLTVDIEQSAQARVAALFN
QLVMLPADHPGLAAACSRALISQEMSAHAIRRRIHAELHRRVCAVLRSEA
WPEVTETLEFGLVGAMVQASAGITTFEATAGELACVVARLLPAGS
120405536YP_955365.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMGVIVGPGEHDPAAACDPHVVTATSAPTALDIVEGVDLSGKTCVITGASS
GLGRESARALAKAGAHVILAARNAAAMSETEAWLRAQLPDALLSVVDLDL
TSLASIAAAAAEISELTPVVHVLMNNAGVMFTPFGRTVDGFEIQFGTNHL
GHFELTRLLFPALVAADGARVVNLSSEGHRMGDVDFDDPNWEHRDYDKFA
AYGASKTANVLHAVELDRRLRDSGVRAFAVHPGIVATSLARHMTNDDFAS
LNAASSTRNSDKPATDFRKQFTTPEYGAATQVWAAVSTDLDDAGGVYLSD
CEVRRAAAYAVDEARALALWDLSERLCTRSSPSLGSGA
120405535YP_955364.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MKPVRTLVAGATGYIGSRLVTALLHDGHQVVAASRDPARLTEFGWYKDVS
TVTLDAHDEISARQAFTDAGPVDVVYYLVHGIGQPGFREADNRAAANVAS
AAKAAGVRRIVYLGGFVPDDDSLSEHLTSRAEVAAALTVDGGPDVVWLGA
AIVIGAGSTSFEMLRYVGDRFLLLPMPEWSANPIDPIAISDALHYLVAAA
DADTVPPGAYDISGPETTTYGDLLRTYARVAGVWRAPVAVYGVDIATVSK
LTGVVLPVPAGLASDLVESLDYPMMASAEGLRGRVPDPPGGLVGVEDAIR
RAAASPARRPVDELTDPHHLADTDPDWAGGDALRLRQLAGAVTPPVARPF
LGLIGFVPGPVAAAVRTGLDAVIGLVPKVIPA
120405534YP_955363.1 abortive infection protein [Mycobacterium vanbaalenii PYR-1]MSAPTSWAGELRRIARGKARPYNEPPSVVNRRKLIVGVVLLVGAALLGYS
LSRPAGDETFIWLTLALAGVWAAGAFASGPLHMGHVCFRGRNQRPVITGT
AIGLALGAIFVVGALIVREVPGLNDYITRVLEYSNTGPLWLIVFITVING
VAEEMFFRGAVYTALLKFHPVIFSTVLYVIATAATTGNPMLGFAAIILGT
VCAFERRATGGVLAPMLTHFFWGLVMVLALPPIFGV
120405533YP_955362.1 transposase IS116/IS110/IS902 family protein [Mycobacterium vanbaaleniMSVQCAPVTSSTIVVAVDVGKTAALFSVTDAARHLLVSPTEFTMNRSGLG
GAAASVMAAVPVSGQVKVAVEAAGHYHRPVLDHLWPDGWEVLELNPAHVA
EQRRVQGRRRVKTDVIDLEAITELALSGHGRAIADRDVVIGELSAWAGHR
SRRITTRTATKNQLLGQLDRAFPGLTLALPDVLGTKIGRLVAAEFSDPSR
LAALGVNRLIRFAAVRDLQLRRPVAERLVAAARDALPTRDAAIARQILAA
DLNLLAGLDAQIQVAEAALAVLLPRSPFSTLTTVPGWGVVRAANYAAALG
DPYRWPGPRQIYRASGLSPMQYESAHKRRDGGISREGSVALRRALIDLGL
GLWLTEPAAKAYAGGLKARGKRGGVIACALAHRATRIAHALVRDHAAYDP
ARWI
120405532YP_955361.1 H+ antiporter protein [Mycobacterium vanbaalenii PYR-1]MVGNHRSVSTQYETGRSSARSDSEQPVAPAGWRVLAPFRYREYRLLIAAV
SLSIFAEGMWAVVMALQVIELSNDPAALSLVATCLGAGLVGFVLVGGLAA
DRLSQRGIIIVVEAVNTVAVTAVAVLGFVDALRIWHMAVAAAALGIAAAF
FFPAYSAILPRILPPEQLLAANGIEGVVRPVFQRAVGPAIAGLVVGALFP
SAGALVVAVLFATGLALLVATRPPKAKDTGAQHEPRPHLLRDLRDGWVFM
LRTPWLLWTLLFASLFVLVVLGPIEVLLPFVVAERFTHGAQTYGFILAFF
GLGSALGALGVSSRRLPRRYLTVMMAMWSVGSVPLVIVGVTSSFPLMALA
TFVIGVTDGTAMVIWGTLLQRRVPPELLGRVSSLDFFVSLAFMPVSFAIV
GPLSKIVSMEAIFLAAGLLPVLLAAVAVWAAKMHRDEVAHPLR
120405531YP_955360.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MKGTFMTTTDPTTDAYEGIADLAVGLDDGVLTVTLNRPNSLNSLTAPMLQ
AFAATLERAAGDPRVRVVRIGGAGRGFCSGAGISEEDHANPGAAGPPTDV
LDGANRCIRAIANLPQPSVAVVQGAAAGVGVSLALACDVVIASEKAFFML
AFTKIGLMPDGGASALIAAAVGRIRAMRMALLAERISAREAYDWGLVSSV
HPAEEFDAEVDKVIATLVAGPAVALRKTKDAINAATLTELEAALERETAG
QLVLLKSADFREGTHAFQQRRVAKFTDS
120405530YP_955359.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMAGPLQGLRVVELAGIGPGPHAAMILGDLGADVVRIERPGKGPGPATKPG
GDYLLRNRRSVAANLKSEEDRDMVLRLIAKADVLIEGFRPGVTERLGLGP
HDCAKVNEKLIYARMTGWGQDGPRAQQAGHDINYISLNGALHAIGRAGER
PVPPLNLVGDFGGGSMFLLVGVLSALYERERSGKGQVVDAAMVDGSSVLS
MMMWAFRGMGMWSDERGTNMLDTGAPYYDTYETADGKYVAVGAIEPQFYA
EMLKGIGLDGADLPDQNDMSRWPELREAFTKAFAAHDRDHWAKVFAGTDA
CVTPVLSFAEVESEPHNTERDTFYSENGSLYPAPAPRFSRSAPSAPKPPG
VPGADTEAVLREWV
120405529YP_955358.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMEIKDAVAVVTGGASGLGLATTKRLLDRGASVVVMDLRGEEAVKELDARA
KFVETNVTDPEQVAAALDAAEEMGPLRIDVNCAGIGNAAKTLSKDGPFPL
DAFKKVVEVNLIGTFNVIRLAAERIAKQEPINGERGVIINTASVAAFEGQ
IGQAAYSASKGGVVGMTLPIARDLSRELIRVCTIAPGLFKTPLLGSLPEE
AQASLGKQVPHPARLGDPDEYGALAVHIVENPMLNGETIRLDGAIRMAPR
120405528YP_955357.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MTIRTKFTETFGVEHPIAQGGMQWVGRAELVAAVANAGALGFITALTQPT
PADLANEIAKTRDLTDKPFGVNLTILPAINPPPYDEYRQVIVDAGIKIVE
TAGSNPAPHLPMFHDNGIKVLHKCTSVRHAVKAQSLGVDGISIDGFECAG
HPGEDDVPGLVLIPAAADKIEIPMIASGGFADARGLVAALALGADGINMG
SRFMCTVESCIHQNVKEAIVAGDERGTELIFRSLHNTARVASNEVSREVV
QILKDGGQFEDVKDLVAGVRGRKVFDDGDIDAGIWTVGTAMGLINDIPTV
GELVSRIVGEAEQLITGRLGEMVTPTAARV
120405527YP_955356.1 hypothetical protein Mvan_4575 [Mycobacterium vanbaalenii PYR-1]MVTVQYMWIDDTSADVIKVDFDALYHGDVLVEGLTSEQLDDEQALPTAV
120405526YP_955355.1 DoxX family protein [Mycobacterium vanbaalenii PYR-1]MNDTPSREAAHALALAEMAETDADGSTAGTRDIGLLILRLGVGAALVQAG
LIKVADFSMTVQFMTEAGWRLPAFAAFMVTATETLSGVALLLGVLTPLAG
SAALGAMLCAWAVNVSAAAFWSEPFNVPFLIGLGAAALIFTGAGGYSVDA
RLVTRLPWSTRVRVALLVLAFAVAVLTWVALYGVNPIHFTAPPAPPTP
120405525YP_955354.1 MMPL domain-containing protein [Mycobacterium vanbaalenii PYR-1]MLHRIALLAIAAPRRVLVVALLIMVGCGIFGAPVAKHLSAGGFQDPTSES
ARATQLLVDKFDQGDMELLISITDDNSADGANSPAARAVGTDLADRLAAS
PHVGAVTSAWTAPPSAAPALVSEDGRTGLIIAGITGGESEAQKHAKTLTD
ELVRDRDGVTVRAGGVAMTYVQINTQSEKDLLMMESIAIPLSFVVLVWVF
GGLLAAALPLAVGAFAILGSMAVLRAVTLVTDVSIFALNLSIAMGLALAI
DYTLLIISRYRDELAEGHDRDSALVRTMMTAGRTVLFSALTVALSMVAMV
LFPMYFLKSFAYAGIAVVGFAAVAAIVVAPAAIVLAGARLDSMDVRRLVR
RVLGRPEPVAKPVEQMFWYRSTKFVMRRSIPIGVVVVTLLLLLGAPFLGA
NWGFPDDRVLPQSASARQVGDELRTDFAVDSSANVVVVLPDAEGLGPDAL
DGYAAELSRVQDVSSVSAPGGTFVDGAKAGPPSAATGIAEGSAFLTIGST
APLFTDASETQLDRLHDVAPPEGRDVLLTGLAQINRDSADAITSRLPTVL
AVIAAITFVLLFLLTGSVVLPLKALVLNVLSLTAAFGALVWIFQDGHLGA
LGTTPTGTLVANMPVLLFCIAFGLSMDYEVFLVSRIREYWLASGGAGADS
STAHQRSDDLAPHVRSDESVALGLARTGRVVTAAALLMSISFAALIAAKV
AFMRMFGVGLTLAILADATLVRMLLVPAFMHVLGRWNWWAPKPLARLHER
IGFSETLDDSSDSPPRSRQHVATGNEHG
120405524YP_955353.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MADVSAPRQRRHRAPRGAGEQLRAEILDAATDLLLETGDEKAVSIRSVAQ
RVGVTPPSIYLHFVDKTALLDAVCGRYFEKLDEEMQEVAGAAATALDVLR
AQGMAYVRFALKNPVLYRIAMMGPGSPGSDVDVALNSSAFGHLLMSVQAL
IAEGVYPQADPTMLALELWTAVHGIAAMLISRPYLPWGGAEEFADRLMRA
VCCGQALSVAIRPDESPREIMTWLKEVVDERQRG
120405523YP_955352.1 type 12 methyltransferase [Mycobacterium vanbaalenii PYR-1]MNDSVDNPFFARLWTLMSSREPESLRRLRRENLAGLTGRVLEVGAGTGTN
FEFYPATVTEVVAVEPEHRLATLAQDAAARAAVPITVTTDTVEEFTDAEP
FDAVVCSLVLCSVDKPEDVVAELLSMLKPGGQLRYLEHIAAEGGRARLQR
FADATVWPRLLGNCHTHRHTEETIVGAGFRVRDARREWTFPRWVPLPVAE
FAIGVAVKP
120405522YP_955351.1 NAD-dependent deacetylase [Mycobacterium vanbaalenii PYR-1]MTVFSGAGMSAESGVPTFRDVETGLWAKVDPYEISSADGWRAHPDRVWAW
YLWRHHMMSAVAPNNAHRAVAAWEDYADVHVVTQNVDNLHERAGSSRVYH
VHGSLFEFHCDRCRSTFPDKVPDMPEPAESVAPPSCGECGGLIRPNVVWF
GEPLPDDAWQRSVDAVVNADLVVVVGTSSVVYPAAGLPELAIAHGTPVIE
VNPEPTPLTASATVSLRETAATALPGLLQRLPALLG
120405521YP_955350.1 regulatory protein GntR [Mycobacterium vanbaalenii PYR-1]MAELGDWVRVDPHAARPLFDQLRTQIIAGIRDGELTPGTRLPTVRELAGQ
INLAVNTVARAYRELEAAGILETRGRFGTYVARSDPADAAMATAAHTYVA
TARALGVGKGEALRYVETAFG
120405520YP_955349.1 O-methyltransferase domain-containing protein [Mycobacterium vanbaalenMNHTGKHTATDVTGVSETALLTLLVRATEARRPDSLIDDPMAIHLVDSID
FDFAKFGYVRRQDMSLRALAFDKQTRRYLRDHPKATVVALAEGLQTSFYR
LDAQGPDVGHDFRWLTVDLPPMIELRRKLLPASDRVQMLAQSALDFSWMD
RVPTDDGDVNQAGDDGDVNQAGDDGDVDQAGADGVFITAEGLLMYLQPEE
SMALITECAARFPGGRMMFDLPPSAFAPLVRRGFRASLRYRVPPMPFTLS
PAEAADLVNTVPGVRAVHDVPAEHARGRILNALLWTAQRVPLLDPVRPMF
TLLEFG
120405519YP_955348.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMTRDVFDDKLLALIGGNSLGVLATLKRDGRPQLSNVSYHFDARTLTISVS
IAEPRAKTRNLRRDPRAAIHVSSDDGWAYAVAEGDAVLSAPAADPGDDTV
TGLIELYRNISGEHPDWDDYRRAMVDERRVLMRLPISHVYGMPPGKR
120405518YP_955347.1 hypothetical protein Mvan_4566 [Mycobacterium vanbaalenii PYR-1]MASTEPAESGEDDNKRKFREALERKNAKAGGGSSHKDAGAKQPRAHGPVE
NRREFRRKSG
120405517YP_955346.1 hypothetical protein Mvan_4565 [Mycobacterium vanbaalenii PYR-1]MSAAALFPRPAEVEAATPPDRDRAIDVIRIVALVGVVVGHTVMATSIIRD
DVFIWTNLLTASPVFQALTWLFQIMPLFFFAGVAASVQSWRPGASWGNWL
MRRCTRLYRPVFYYLAFWAVALVVLRLLLPVHVYEPVAGISVQLLWFLGA
YVLVLAAVPALAHISTTGRLVGAVAATYGVVAIVDVIRINTDVWPVFGYL
NLTMWLIPGMFGVAYRRGLLSSGAALAPGAALFTVNVALVTLGPYELSLV
GIESQQLKNMSPPSLLLAGHAIMMCALAIAAAPGISRWARRPRVWWLTAI
GNSGAMTLYLWHIPLLLGMHLTFDYLGHPRFDPAAPDFVALSVLQLVLMA
LAVAAAFTVLRPLENDPLPLWDGGFVAHPGPRSAAVGALLCVAGAATLAS
VGWGLKEQGLYCVAATVTALVAARALANDGQL
120405516YP_955345.1 SSS family solute/sodium (Na+) symporter [Mycobacterium vanbaalenii PYMTTLLAQTETIGNPVANIGIFSLFVVVTMIVVIRASKRNATADEFFTGGR
GFSGPQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVAL
LLVAELLRNTGRFTMADVLSFRLKQRPVRLAAATNTLTVSLFYLLAQMAG
AGGLVALLLDINSRTGQSVVIAVVGVLMIVYVLVGGMKGTTWVQIIKAVL
LIAGAGFMTVMVLAKFGMNFSEILGSAQSAISGSTTTGVAGRDVLAPGAQ
YGGSLTSQINFISLAIALVLGTAGLPHVLMRFYTVPTAKEARRSVVWAIA
LIGAFYLFTLVLGYGAAALVGPDRILGAAGGVNSAAPLLAFELGGVVLLG
VISAVAFATILAVVAGLTITASASFAHDIYASVMKSHKVTEAEQVRVSRI
TAVVLGVLAIGLGILANGQNIAFLVALAFAVAAAANLPTIIYSLYWRRFN
TRGALWSMYGGLISTIVLIVFSPAVSGSKTAMIPGADFAWFPLANPGIVS
IPLAFILGIVGTLTSPDDEDPKVAAEMEVRSLTGIGAEKAVAH
120405515YP_955344.1 hypothetical protein Mvan_4563 [Mycobacterium vanbaalenii PYR-1]MSETDLPIRPEAISGERYLEVQASPEFQELRTRLRRFVFPMTAVFLVWYA
VYVLLGAFATGFMGTKVWGDINVGLIIGLGQFLSTFLITGLYVRFANREL
DPRAAAIRTQLESEIR
120405514YP_955343.1 Na+/solute symporter [Mycobacterium vanbaalenii PYR-1]MTGSPLTAAALLAAAVATIAIGAYGVRFSRTTSDFLVASRTVGSRWNAAA
ISGEYLSAASFLGVAGLIAKYGADALWYPVGFTAGYLGLLLFVAAPLRRS
GAYTVPDFAEFRLGSPRLRKVAMLVVVVICIFYLVPQYQGAGLALKTLLG
VPVWLGPLAVGAIVIMNVVAGGMRSITFVQAFQYWLKLTAVAIPALALAG
LFLTDRGGELGGPLPPTVQQITTVEIETDVVVQVAEPAGITVTGTLDDRQ
VDGAKIGPAGDHTLGAGSTLTLSAGAATPVVAGTPSAGRDWISSGGGLGG
RHPLYQVLSIMVATFLGTMGLPHVLVRFYTNPDGRAARRTALAVIALLSL
FYLFPTLLGVFSRLYVPQLLITGTADAAVLLAPGSVIAGVAGQLLAALVA
AGAIAAFLATSSGLLVSFAGALATDVLPGRVRDFRVAAVIGGLIPIPLAL
AASGELELSRSVGLAFAVAASTLCPLLVLGIWWRGLTATGAMAGLAVGGV
LSGGAVTVAVAGGIDENVLGGWPTVLVGYPAAVSVPLAFATMLAVSRLTR
ATAPPDVAQTFARMHLPEHLGMGIERMPRA
120405513YP_955342.1 hypothetical protein Mvan_4561 [Mycobacterium vanbaalenii PYR-1]MTSSERPQRQRVVLAHRRGARMVRTRVEVQEQTQVGDALVRGLVRAQLGL
ALRLGAVVVALIGAIPLLNALVPGLGAITVVGIRLNWLVLAGLAYPLMYG
IGWLYVRLAEQGERDFVGVVDAEP
120405512YP_955341.1 response regulator receiver protein [Mycobacterium vanbaalenii PYR-1]MTRPLTVLAVDDEAPALDELAYLLGKHPCVAEVFRAGDATSALRELNRRT
IDAVFLDINMPGLSGIELAGVLTNYTQRPAIVFVTAHDDKAVAAFDVGAV
DYLLKPIREDRLDEAVRRAATAHPATPAAASRTETGAAAPDSDVIPAELG
GVTHLIPRDSIGWVEAEGDYARLHSASGSHLVRIPLSTLETRWRDHGFQR
VHRSYLVALRLVTGLRTTDGAVLVRLRANGSSPAVELPVSRRQARELRDR
VVRNPMRSLRPAGSTDDQQ
120405511YP_955340.1 signal transduction histidine kinase- LytS [Mycobacterium vanbaalenii MSGELAIALTAALILLAVAAVVLAVRTRRVVATPTERAVHAALHTASLAA
RALRQGLNTDSAQTAAPFLRDLTGADGLALFDGDGAVLAEDALDDALWDD
DVRDACDDAAHESISGQRRVMAHAGTSAVVAQPLLAESGDLLGVLVVVTT
RSPGPGMLGAVGEVARYAASQIELAELDASRARLDRAEVLALRAQISPHF
IYNALNTIASFVRTDPDRARELILEFADFTRYSFRAAGQFTTLAEELRNI
DRYLTLERARFGTALKVTLQVAPEVLNVVVPFLALQPLVENAVRHGFAGR
GSGSIELVARDEGSDCVITVEDDGVGMDPDALRSGPGDALSDGAPASEGA
GAHVGLTNVDHRLRAAFGNDYGLVVETAIGAGTKVIMRVPKFRSGVRASG
GGFVVGRNE
120405510YP_955339.1 hypothetical protein Mvan_4558 [Mycobacterium vanbaalenii PYR-1]MRQSDRLEVCFEELAELAGQRNAIDGRIAQIAAEIDGAGLWAITGVKSME
GLIAWKLGTSFRNAETIVAVARRLEQFPRCSRDLREGRLSLDQVGVIAER
AGAGSDDHYADLAAHSTVAQLRIAVKQEPRPEPEPDRDPGRDCDPEAESG
AECGSESESGADCDPESESEAKPRRDPVPRASITKTSDEQYTYWRIALPH
EEAATFDTALRSHHEALVAQWKRDHDITDHTDGHDITDRTDGHDTDGHDD
NVGDHTDTDGRDITNPGPYYDGDGGEGVGRAPLPDTVAAFWALVKAGWDV
EVARRPHGQHTTVVMHVDVKERIAALHLGPALSAAERRYLSCDATCEVWF
ERHGQVIGSGRTTRAISRRLRRALEHRDRTCVVPGCGATRGLHAHHIRHW
EDGGLTELDNLVLVCPHHHRLHHRGVITITGPAERLTVTDSVGRHLEPGS
LARPPTQSPPAVAPYQGPPGERAQWKWYTPFQPPPPTTN
120405509YP_955338.1 hypothetical protein Mvan_4557 [Mycobacterium vanbaalenii PYR-1]MRRVIAPLVAAVIAAVASAGIAQAIPDQGTPEFDSYLQGLQRNGYNLHPD
TAWRVAHQACVGGIPGYIGLELAAQGVVGPGAQQRVMEVATKYACPVQ
120405508YP_955337.1 HhH-GPD family protein [Mycobacterium vanbaalenii PYR-1]MAKLKLVQEPAADALLEGNPFALLVGMLLDQQIPMEVAFGGPKKIADRMG
SFDAHVIADHDPEAFAALCAQTPAVHRFPGSMAKRVQALAQVIVDEYGGD
ATALWSDGADGAEVLRRLKALPGFGEQKAKIFLALLGKQYGVTPKGWRAA
AGDYGKAGSHMSVADVTDPGSLQKVRTYKKEAKARNKEAKAAKA
120405507YP_955336.1 resolvase domain-containing protein [Mycobacterium vanbaalenii PYR-1]MTVTLGYATAVKGCADLDGQLAELAAAGVDPRRIFTDRTAGSADKMRAGL
LALLSYARSGDVVVVVALDRLGRSVAEVTKTVADLTRRGITLRCLRNGLD
TATSTGRIVADVLTDLAGLDAVSTTEVRP
120405506YP_955335.1 nitroreductase [Mycobacterium vanbaalenii PYR-1]MDLYDVMRTTGAVRQFTGDPLPDEVLVRILDNARFAPSGGNRQGVHVIAV
RDRATREALGALSVTGARRYIAQQRNGEGPWNPLRPMQISAEQLAATEVP
AELSAPLLTSAVVLVVCVDLAVVAAFDQDLDRVGLIAGASAYPFVWNVLL
AARNEGFGGVLTTMAVAEEPGVKALLGIPDDHAVAAVLPLGRPQRQVTKL
TRRPVSQFATRERFDGESL
120405505YP_955334.1 hypothetical protein Mvan_4553 [Mycobacterium vanbaalenii PYR-1]MKTHLNCPCGEAITGKDEDELVEKAQAHLTEVHPGRDYDRDAILFMAY
120405504YP_955333.1 hypothetical protein Mvan_4552 [Mycobacterium vanbaalenii PYR-1]MSTRTTLTTTLAVCSSVALLTVGVTGVAHADPTAPLPIDGMQAPGLPAVQ
SLGPVIQQAASDPTNAASMLMAAAAVFAGDMAAPQPSRDVASAVNQFVAQ
PVAHVPATGAVPGAEAHLPAGVNPEHVLGPAPEALPQALPQALPEVAHAP
AAAAAPGPAPAPGPAPAPGAEVATPVAAPAAPGGLGPNAPVTQDFLYPSI
SNGCLSDGGNVLATAISVAGPATIPLPGPGPGQTAYVFTAIGTPGPAAEQ
KLPLNATWVNLTTGKSGSVTLKPRPDMNPNGPTTLTAIADTGSGSIMSTI
FGQVTTTEKQCQFMPTIGSTVVP
120405503YP_955332.1 hypothetical protein Mvan_4551 [Mycobacterium vanbaalenii PYR-1]MPSVSFADTDATDGNGRTFMHRTRKLFASTIIAAAGAVSAAVAFSATATA
QPAPAPAPAPEIPGLPFLQQLAANPAAATQLMQGFANIMGNASAPAATAT
ATPATPVTGPGATASISLPQPADVLPGANVLPGATALPGGNMTTVPVGNT
TTVPQTAPAAAPASPLSGLTESLGVPGGLASLLPGGSPLGGLLPTGPTAP
VTAAPAGAPAPAPAPLFTPLSALP
120405502YP_955331.1 mannosyltransferase [Mycobacterium vanbaalenii PYR-1]MPARRAARLVAHLSAAAPALLILSIAARLAWTYLVPNGANFVDLHVYVGG
AAELDGPGTLYEYVYADQTPDFPLPFTYPPFAAVVFYPLHLLPFGFVAFA
WQVGIIAALYGVVRLSQRLLSPTAVGSRRVAMLWTAVGIWTEPLRSTFDY
GQVNVLLVLGVLYAVYTSKWWLSGLVVGLAAGVKLTPAVAGLYFVGARRW
ATVLFSAAVFALTIGVSALIVGDQTRMYFTELLGDADRVGPVGTSFNQSW
RGGISRILGHDAGYGALVLVGVAVTAVLALLAWRAIGGADDRLGAIVIVE
LFGLLLSPISWTHHWVWLIPLMIWLLHGPLRAQLGARVLGWGWLALTLVG
VPWLLSFAQPTIWVIPRPWYLAWAGLVYIVATLATLAWVATRGSRRYRAP
SAHPCL
120405501YP_955330.1 pterin-4-alpha-carbinolamine dehydratase [Mycobacterium vanbaalenii PYMAVLTDEQVDAALPDLNGWERADGALRRSVKFSAFLDGIDAVRRVAEHAE
AKDHHPDIDIRWRTVTFALVTHSEGGITDKDVQMARDIDGILG
120405500YP_955329.1 NUDIX hydrolase [Mycobacterium vanbaalenii PYR-1]MSKLIVVAGALIEGGALLVAQRDRPPELAGLWELPGGKVAPGESDEAALV
RELNEELGVDVTVGARVGADIALSAAMCLRAYAVTRTRGVVAPHDHRALR
WIRTEEIETLPWVPADRAWLPDLTRLLAGADHARASGAAARRGNQPPA
120405499YP_955328.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMALATWVSAINFWAWNMIGPLSTTYAGDMSLSSSEASILVATPILVGALG
RIVVGPLTDRYGGRVMFMAVTLASIVPVLAVGIAGSSGSYPLLVVFGFFL
GVAGTVFAVGIPFANHWYEASRRGFATGVFGMGMVGTALSAFFTPRFVKW
FGLFTTHVIIAAALAVTAALCLFIMRDSPNFTPNHDAVVPKLKAAARLPV
TWEMSFLYAVVFGGFVAFSNYLPTYIKTIYGFSAVDAGARTAGFALAAVL
ARPVGGALADRFAPKYVVLASFAGTAAMAFVAIFQPPPDIWSAATFITLA
LFLGIGTGGVFAWVARRAPAKSVGSVTGIVAAAGGLGGYFPPLVMGASYD
SIENDYTIGLTLLVATALLAFLYTALRLHAREPQQKEAAT
120405498YP_955327.1 nitrate reductase subunit alpha [Mycobacterium vanbaalenii PYR-1]MTSPPRTGGVVEELLQRSGRFFTPGDFSEDLRTVTRRGGRDGDVFYRDRW
SHDKVVRSTHGVNCTGSCSWKVYVKDGIITWETQETDYPSVGPDRPEYEP
RGCPRGAAFSWYTYSPTRVRYPYARGVLVEMYREAKARLGDPVLAWADIQ
ADPQRRRRYQQARGKGGLVRVTWAEATEMIAAAHVHTIKTYGPDRVAGFS
PIPAMSMVSHAAGSRFVELVGGAMTSFYDWYADLPVASPQVFGDQTDVPE
SGDWWDASYLMMWGSNVPVTRTPDAHWMAEVRYRGTKVVSVSPDYADNTK
FADEWMPCAAGTDGALAMAMGHVILTENFVRRRVPFFVDYVRTYTDLPFL
VKLEERDGVLVPGKMLTAADLGPGYDGQENAAFKPVLLDGATDSVVVPPG
SLGFRYGDEGVGKWNLDLGDVVPALTVAPPDGQSGETTSISLTRFDTVDG
RGATLQRGVPVRRVGEHRVCTVFDLMLAQYGVARPGLPGDWPAGYDDPDQ
PYTPAWQESITGVSASQAIRVAREFARNAEESGGRSMIIMGAGICQWFHG
DTTYRAVLAMLLLTGSMGRNGGGWAHYVGQEKCRPVTGWATMAMATDWTR
PPRQMPGTSYWYAHTGQWRYDGYRADALASPTARGRFAGKHTMDVVAAAA
AMGWMPFYPQFDRNSLDVADEARAAGQDIGKYVCEKLASGELKMAVTDPD
NPANWPRVLNVWRANLLGSSSKGNEYFLRHLLGADSNLQATPTEEALRPK
DVTWPDDIPEGKLDLLMSVDFRMTSTTLLSDVVLPAATWYEKADLSSTDM
HPYVHAFSPAIDPPWETRSDFEAFGAIARTFSTLARSHLGTRTDVVLGAL
QHDTPGAMAYPAGTQRDWRETGETPVPGKTIGPITVVERDYAAIADKWST
LGPLVERLGVTTKGVTTWPVQETAELAQKFGVLDSGPAAGQPAITTAERM
ADVILALSGTSNGRLAVEGFRELERRTGRPLAHLAEGSEERRITYADTQA
RPVPVITSPEWSGSETGGRRYAPFTVNIEALKPFHTLTGRMHFYLDHDWL
EELGEQLPVYRPPLDMARLFGEPAIGARGELGLTVRYLTPHSKWSIHSEY
QDNLFMLSLSRGGPTMWMSPADAAKIQVRDNDWVEAVNRNGVLVCRAIVS
HRMPEGVVYVYHAQERTIDVPLTETTGRRGGIHNSLTRLLVKPSHLAGGY
AQTAFAFNYLGPTGNQRDEVTIVRRRSQEVVYQ
120405497YP_955326.1 nitrate reductase subunit beta [Mycobacterium vanbaalenii PYR-1]MKVMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRPGTEYVWFNNVETRPGQ
GYPRTYQDQERWRGGWIRDKRGRLRLRGGGRLNKLLNIFSNPKLPSINDY
YEPWTYDYENLTNAPLGEHMPVAPPRSLISGKPMKVEWSANWDDDLGGSP
EIVPGDPVLAKVSEEIRLELEQTFMFYLPRICEHCLNPSCVASCPSGAMY
KRTEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRIE
VGLPTVCSETCVGRLRYLGLVLYDVDRVTAAASVENDTDLYEAQKSILLD
PSDPEVIAGARAEGISDEWIEAAQRSPIYALIHEYQVALPLHPEYRTMPM
VWYIPPLSPVVDAVSRDGHDGEDAGNLFGALEALRIPIEYLAGLFTAGDT
AVVEGVLRRLAAMRSYMRDVNLGRETQPHIPESVGMTEEQIYEMYRLLAL
AKYDERYVIPTAYAAVEPWSLEEPGCSLSFEGGPGMYESGPFGEASGQPI
PVAVETFHALRQRQTSEHMAADEARPSRVNLLNWDGRGAPSGLFPQDGDR
120405496YP_955325.1 nitrate reductase molybdenum cofactor assembly chaperone [MycobacteriuMKLLKRSRTPALADRLVWQCASLLLSYPDGAQLAAAEELLDHVEGAAAEQ
LSATLAAVRALGPMQAAQDYVATFDMRRRATMYLTYWTAGDTRNRGQAML
AFAQAYRDAGAPAPADEAPDFLPVVLEFAATVDAGVGRRLLTEHRVPLGV
LHGVLRDVGSPYASAVAAVLATLPVATDEELRRAQRLAADGPPAEAVGLQ
PFTLTVPPKRAGEAGVGMNRAGEGGR
120405495YP_955324.1 respiratory nitrate reductase subunit gamma [Mycobacterium vanbaaleniiMSGWEIFWDVVPYVTLAIVVVGTWWRYRYDKFGWTTRSSQLYESRLLRVA
SPMFHFGILVVIVGHIIGLVIPESWTDAIGLSDHAYHIQALVLGAIAGVC
TLVGISLLVYRRRTTGPVFMATTVNDKVMYLVLVMAIVAGLACTLIGATP
VGAEHNYRETVSPWFRSIWVLQPRGDLMVDAPLWFHIHVMLGLTLFCLWP
FTRLVHAFSAPIGYLFRPYIVYRSREAAGKGELVGSAPRRRGW
120405494YP_955323.1 hypothetical protein Mvan_4542 [Mycobacterium vanbaalenii PYR-1]MGALRSLWRGVLAFDRIGSRIPQLVQMWLIELFFALPLTFFIAKVIDIRG
AFGVPGTGESMPGVFWGALAVSAAAGFLYFRGLVRPRVVQGSWTPMVKAD
VGDVTVFAGNPRWTAHYVYLTSHPSYVLLLLLTAPIPAVMVLATANNGDS
TFYFRVAGIVGLIVLALMALVRLSAWYVFRFGRRRLDEQIADTGMSQRRL
SWEIAWKPVLVLIVLIYAIVAIPLGWMFWQDKRTIAALPVVTVADADQPG
QYRRVEGLLASEPVYWAPDGTGRGGNNYAGAGVLVDLSSGGQALLLAESL
SVPDFVGAMKDAHGGTVHTQGKVIEQITEDQVEYYGFDVDDFPEPPQDGR
VMVLLSYP
120405493YP_955322.1 hypothetical protein Mvan_4541 [Mycobacterium vanbaalenii PYR-1]MAVYSVLTIVLITVLATLTTLAIFLGLANWIGAFYIVRCSECRHLTFSSA
NRNQASCPHCRHPVLTHPIHAIAHRDSRADVRVPGDRLRY
120405492YP_955321.1 GTP-binding protein TypA [Mycobacterium vanbaalenii PYR-1]MNARPDFRNVAIVAHVDHGKTTLVDAMLRQSGALSHRGDDAIERLMDSGD
LEKEKGITILAKNTAVHRHHADGSMTVINVIDTPGHADFGGEVERGLSMV
DGVVLLVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVE
ESHDLLLDVASDLDEEAQTAAEKALDLPTLYASGRAGIASTVQPANGENP
DGENLDPLFDVLLEHIPPPQGDPEAPLQALVTNLDASAFLGRLALIRIYK
GRIKKGQQVAWMREVDGHPVITTAKITELLVTEGVERTATDEAFAGDIVA
VAGIPEIMIGDTLADPDHAHALPRITVDEPAISVTIGTNTSPLAGKVSGH
KLTARMVKNRLDSELVGNVSIKVVDIGRPDAWEVQGRGELALAVLVEQMR
REGFELTVGKPQVVTRTVDGKLHEPFEAMTIDCPEEFVGAITQLMAARKG
RMEEMTNHAAGWVRMDFIVPSRGLIGFRTDFLTLTRGTGIANAVFDGYRP
WAGEIRARHTGSLVSDRSGQITPFAMIQLADRGQFFVEPGQETYEGQVVG
INPRAEDLDINVTREKKLTNMRSSTADVMETLARPLELDLEKAMEFCAAD
ECVEVTPEIVRVRKVELTASLRARAKSRAKQANN
120405491YP_955320.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MSPPPAPQSTDTTEVTPPPPMKATQIIVAIDSIGPGFNSHLLSDQSPVNA
AISSLVLPSSFRPIPDSRTPTGSRWELDTSLLESAEVTGEDPFTVTYKIR
PEAQWTDNAPIGADDYWYLWRQMVSQPGAADPAGYDLITGVQSVEGGKTA
VVTFAQPYPAWREMFNDILPAHIVKDVPGGFGAGLAQALPVTGGQFRVDT
IDPQRDEILLARNDRYWGTPATPDLILFRRGGAPAALADSIRNGDTQVAQ
VHGGSAVFAQLSAIPDVRTARIVTPRVMHLTLRAQQPMLADALVRKAVLG
LLDVDLLAAVGAGDDNTVTLAQAQVRSPSDPGYVPTAPPAMTREDAMTLL
AEAGYQVDPVQVPTSPPPAPGAPESNRGRLTKDGEPLTLVLGVAANDPTA
VAVANTAADQLRSVGIAATVAALDPVVLYGDAMVNNQIDAVIGWHPAGGD
LATSLASRYGCPALEATAVETTTGAPAPTSDPPRPSGTSGPRGPSDPPTT
STTPTTATQTSPAPEPDSDQLVQAPSNITGICDPHIQPRIDAALHGTADI
AEVIDEVEPRLWEMSTVLPILQDTTIVAAGPSVQHVSLTGAVPVGIVGDA
GSWVKLPQ
120405490YP_955319.1 Cl- channel- voltage-gated family protein [Mycobacterium vanbaalenii PMQFGCAIAVIGLIAGVAGAATTLLLHAIEHLTFHYSFGTLLSGIEGSNPV
RRAVGPLLGGALAGWGWWALRRRQDRPPLTGTADAGLQVLLVGSGASLGR
EGAPRQLAAAWGDIGVSRLALTAADRRILLACAAGAGLGAVYSVPLGGAL
FATRILLRTWHPRALGTALITSSIAVMVAAPVTHLEHPLSWPDSRLSYLF
VFLALALAPVATAVGLVFDRMMHGAPRLTLRSWMVIPGIAAAGLLTGVCS
IWLPELPGNGRSILQVSMGSGLTLTSAALILLLKPLLTMLFLRAGAAGGL
LTPALATGAAAGSLAALALNHWAGTQLHVAAVSLSCAAGLLAITQRSPLF
AALFVWELARPPLWLLLVFAVGAYAAYGLAALRRRHQKEAGREITAAA
120405489YP_955318.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MKATSTQWSQAMGLAAPIVNAPMGGVAGGALAAAVSRAGGLGMIGIGSAG
SADRLHTELRHVSDLVDRPFGIGLISWAVAEQPRLLEAALAARPALLSVS
FGDDWAWVRRAHDAGCVTATQVADVDGAQRAADAGVDVLVTRGAEAGGHG
QPRVGTLPLLVEVLDRVAVPVLAAGGIASGRGLAAALAAGASGGWLGTAF
AACPESTLPDAAAEVMLAARNTDTVTTRVFDIALGYPWPPTIPERVLRNA
FTDSWHGRESELAADTEAVTELRAAIAADDYRLAPVNVGQGVSELTAIEP
AARVIQRLCDEAREVGQQ
120405488YP_955317.1 hypothetical protein Mvan_4536 [Mycobacterium vanbaalenii PYR-1]MHVTVRSYLTAGVALAGASAIALAPVVVPPSSTVSSSPAMSSVAVELSAA
VNPITAWVDVFAGAATNLGGIGNAILEDPFPLLRQALENVLGYGGTLVSA
TTGAITGALNYFSFDNPAGAWPLIEDAFTQLSEGNISGAITTAGEALLLG
PILNIGLPIFTSGALEIPGKIAQNFANVVKSLTSLDTVFPIVLGALGTVM
APMQALGGSLQAAFDALGEGNLIDAVVELINIPASVTGALLNGYTNDMGT
TYPGLFTFSENPGEGGLIQALFVTLPKALAAAIAPEEAVATAAAEGPADP
DAGSGTMITVAEVAETDAAAETEAAAETEAAVVADGDTVVEEAPAVVVDE
ATAPVDGGEEATTPADDVVTAPVDDVVTAPVDEAGDDVEAAPDETDTADD
TAGEDDGDSAGGAGGESGGAGGESGGDD
120405487YP_955316.1 LmbE family protein [Mycobacterium vanbaalenii PYR-1]METARLLFVHAHPDDETLTTGATIAHYVARGAQVHVITCTLGEEGEVIGD
EWAQLAVDRADQLGGYRIGELTAALAELGVDRPRFLGGAGRWRDSGMDGT
PARQQQRFVDGDFAEQTATLAAAIDELRPHVVVTYDPNGGYGHPDHIHAH
RVTTAAVAASTWQVPKLYWTVTSSSALAAALASMGAVPEEWIRVSADDLP
LFGYSDEAIDAALDLTAHESARVAALRAHRTQVSVSPDGRSFALSNNVAL
PVDPTEYYVLAAGSAGARDERGWETDLLSGLSVG
120405486YP_955315.1 hypothetical protein Mvan_4534 [Mycobacterium vanbaalenii PYR-1]MSDRLRVLLLALLGLDGVLSALMAVFFLPLRLGPVPLPISALLSGALNLS
LVWAGLQWTSVPRLAALPLWTWLATVLLCMVFKPGDDIVFGGVGIMEFGP
VLLVALGALPAAWLLMRHPPAAGADPRTGAR
120405485YP_955314.1 FO synthase [Mycobacterium vanbaalenii PYR-1]MALNTQRGADLPSPVVPPRSGAPNPAALRRVLRRARDGVALNVDEAAIAL
TARGDDLVDLCASAARVRDAGLEAAGRRGDTGRLPVSYSRKVFIPVTHLC
RDTCHYCTFVTVPGRLRAEGKGMFMEPDEILDVARGGAEMGCKEALFTLG
DRPEARWPEARRWLDERGYDSTLDYVRAMAIRVLEETGLLPHLNPGVMSW
SELSRLKPVAPSMGMMLETTSRRLFETKGLAHYGSPDKDPAVRLRTLDDA
GRLSIPFTTGLLVGIGETLTERAETVHAIRRSHKEFGHVQEVIVQNFRAK
DHTAMASVPDAGLDDFLATIAVTRLVMGPKVRIQAPPNLVSRQECLALIA
AGVDDWGGVSPLTPDHVNPERPWPALDELAEVTLEAGYDLVQRLTAQPQY
VQAGAAWIDPRVHGHVAALADPDTGYARDVNPVGRPWQEPDEATESLGRV
DLHTAIDTEGRLTTTRSDLGDAFGDWESIRAKVEELAARAPERIDTDVLA
ALRSAERDPAGCSDDEYLALATADGPALDAVTALADSLRRDTVGDDVTFV
VNRNINFTNICYTGCRFCAFAQRKGDADAYSLSTAEVADRAWEAHVAGAT
EVCMQGGIDPELPVTGYADLVRAVKARVPSMHVHAFSPMEIANGVTRSGT
SIREWLTALREAGLDTIPGTAAEILDDEVRWVLTKGKLPTSMWIEVVTTA
HEVGLRSSSTMMYGHVDTPRHWVGHLNVLRGIQDRTGGFTEFVPLPFVHQ
SSPLYLAGGSRPGPTHRDNRAVHALARIMLHGRISHIQTSWVKLGTERTQ
VMLRGGANDLGGTLMEETISRMAGSENGSAKTVAELVAIAEGIGRPARQR
TTDYTPLAA
120405484YP_955313.1 fumarylacetoacetate (FAA) hydrolase [Mycobacterium vanbaalenii PYR-1]MKLRRVIADGRLELQSLGPDGSWAPAPDPSVLGGPVFDPAWELAAAQRHH
GLAGCVLPFQPASFRDFMLYEDHAIDAARGLVRRFHPAQSRAAETVEKLT
RKPFPLFKPKPLFYRQPIYYMSNHLSFVPSGAPVAFPSYSTALDFELELG
FVLKAPLFNASSAEAVDAVGAFVVVNDFSARDVQRAEMATGLGPQKAKHF
VSSMSAVAVTADEILPILESLSGSVTINGRTVSTVSSAGPQWTIGDMLAH
ASRDEKLYPGELFATGTLPGGSGMETGHWLRPGDRITLSIEQVGEISHQI
TS
120405483YP_955312.1 hypothetical protein Mvan_4531 [Mycobacterium vanbaalenii PYR-1]MTTVTSALSVGTWAIDPVHSSVGFSVRHLMVSKVRGVFDTFSGAITVAED
GTPSVHAEIAVDSVNTRNEQRDGHLKSADFFDAEKHPVATFSSTAVRQDG
DGYVVDGDFTLKGVTRPISLNLDFNGVNPGMGHGEVAGFEASVVLNRKDF
GIDIDMPLETGGAVVGDKVTITLEIEALRQA
120405482YP_955311.1 hypothetical protein Mvan_4530 [Mycobacterium vanbaalenii PYR-1]MSLSLVGVGGPDGYLQDKRTAVRIYSRAGRVSSTGPVGRVGYAPGVVFDE
RFGRLDPAVWTASYLPAWSSRDAAAATFEAGPDGLDLSIPQAQQLWCPDL
HDGPLRVSAVQSANWSGAIGSTDAPQPFRDGLVVMEEQPTVLGFLPHFGT
ISVTCSADLSPRSMFSAWMVGLEDEPDRCGEICVMEVFGDTVAGGRAAVG
QGIHKFRDPALREDFSAVPLDIDIAQSHTYAVHWRPGAVEFSIDGVTTRV
ANQAPDYPMFLTLGVFDFPDRPGPAEHVPHLRVSRLTYRPLPEGA
120405481YP_955310.1 4Fe-4S ferredoxin [Mycobacterium vanbaalenii PYR-1]MTYVIAEPCVDVKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVC
PVEAIYYEDDVPDQWSAYTQINADFFVELGSPGGASKVGQTDNDPQAVKD
LPPQGED
120405480YP_955309.1 N-succinyldiaminopimelate aminotransferase [Mycobacterium vanbaalenii MFPWDTLADATAAARAHPDGIVDLSVGTPVDDVAPVIRDALAAASSAPGY
PTTHGTPALREAAVSALRRRYGITHLAPGSVLPAIGTKELIAWLPTVLGL
GAGDTVVVPELAYPTYEVGALLAGAAVARADSLTQLGPSVPALVYVNSPS
NPTGRVLGVDHLRKVVGWARDRGVLVASDECYLGLGWDVAPVSVLHPDVC
DGDHTGLLAVHSLSKTSSLAGYRAGFVAGDPAVVAELLAVRKHAGMMVPT
PIQAAMVAALDDDAHEREQRERYARRRDALLPALLAAGFTVDHSEAGLYL
WATRGEPCRDTVTWLAQKGILVAPGEFYGPRGARHVRVALTATDERIAAA
VARLADSAR
120405479YP_955308.1 hypothetical protein Mvan_4527 [Mycobacterium vanbaalenii PYR-1]MVVTPAGLGLGQLLLALDRTMVTLVEAPRGLDMPVGSVALVDADDVRLGL
AVGPGSVDLFFLLGVADVDALRWLEHHADRPVAIFVKEPTAEAVARAVAL
GAAVVAVDPRARWEHLYRLVNYALEHHGDRDDPSRDSGTDLFGLAQSIAD
RTRGMICIEDADSRMLAYSASSEEADELRRLTILGRAGPPEHLEWIGQWG
IFDALRAGPDVVRVAERPELGLRPRLAVGIHLPADTRHAPRFAGTIWLQQ
GSSALADDAEEILRGGSVLAARIMSRLATAPSQHAARLQQLLGLTGVDVD
DVGALARELGIPEDARAAIVGFRGLGTAVPADVIALSAGAFRADAQVAAA
GDRVYVLLPKAGAAASLTSWVRGVVAALRRELGLEVRAVTAPLTGPAGAA
GARADVDRVFDSAERHPGAIDLVTSLDEARTTVLLDEIVSHVAAQPRLVD
PRVRRLRAGDPLLAETLQAFLDGFGDIAAIAARLHVHPNTVRYRIRRVEK
LLSTSLEDPDSRLVLALGLRATEPR
120405478YP_955307.1 delta-1-pyrroline-5-carboxylate dehydrogenase [Mycobacterium vanbaalenMDAISDVPLPSNEPVHEYAPGSPERHRLENMLADLAADPIELPHVIGGTH
RMGAGPSVEVVQPHRHSARLGICTNADHADAAAAVEAAVAAKPGWENTPF
DERAAVFLRAADLMAGPWREKIAAATMLGQSKTAYQAEIDAPCELVDFWR
FNVAFARQILAQQPLNSKGVWNRTDYRPLEGFVYAITPFNFTAIAGNLPT
APALMGNTVVWKPSPTQMFAAYLTMQLLEAAGLPPGVINLLAGDGLAVSD
VLLSDRRLAGIHFTGSTATFQHLWREVGTHIDRYDTYPRLVGETGGKDFV
VAHPSAQPDVLRTALIRGAFDYQGQKCSAASRAYIARSVWQKMGDDFLDT
TEALPYGDVTELANFGGALIDERAFVKNVTAIERAKSAAGVTIAVGGEYD
DSEGYFVRPTVLLSDDPGDEAFSTEYFGPLLAVHVYPDEDYERILDVVDT
SARYALTGAVIADDRAAVLTAERRLRHAAGNFYVNDKPTGAVVGQQPFGG
SRASGTNDKAGSALNLLRWTSARSIKETFVPPTSHTYPHMEV
120405477YP_955306.1 proline dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSVFDKIARPVILAASRREGLRRAAERMSVTRKVVRRFVPGESTADVITA
VGDLRDSHRLVSIDYLGEDVTDADAADATVEAYLTLLDALAGRGETAAAV
RPLEVSLKLSALGQALPRDGEKIALENARAICERAQRAGVWVTVDAEDHT
TTDSTLAIVRELRVDFDWVGTVLQSHLKRARADCAEFAASGARIRLCKGA
YAEPASVAFRDRDDVTDSYLQCLRILMAGRGYPMVASHDPEILGAVPSMA
REYGRGVDDFEYQMLYGIRDAEQRRLAEAGNHIRVYVPFGTQWYGYFVRR
LAERPANLTFFLRALAERRG
120405476YP_955305.1 hypothetical protein Mvan_4524 [Mycobacterium vanbaalenii PYR-1]MPARRAHHVLASATLVAAACVCADGTAQAAPPDWSGRYTVVTFASDKLGT
SIAARQPEPDFSGQYTFSTSCVGTCVATATDGPAPSNPTIPHPPRYTWDG
RQWVFNYNWQWECFRGADVPTEYAAARSLVFYAPTADGTMYGTWRTEILE
GLCKGTVIMPVAAYPA
120405475YP_955304.1 NUDIX hydrolase [Mycobacterium vanbaalenii PYR-1]MDSIRAVGTREIYRNNWLTVREDDIRRPDGTSGIYAVVDKPTYALVIPRD
GDRFHLVEQFRYPIGMRRWEFPQGTAPGRADLDAGELAVRELREETGLVA
AAMTEIGLLDVAPGMSSQRGRVFLATGITEGPHEREHEEQDMRSAWFSRA
EVEQMMRDRIITDAQTLAAWALMLLAGH
120405474YP_955303.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MLLASLNPAAVAAGADLGDAVRIDGVSLSRSDLVGAATSVAERVGGASRV
AVLATPTAATVLAVTGCLIAGVPVVPVPADVGAAERRHILADSRAQAWLG
ELPEEAEGLPHVPVRLHARSWHRYPEPSPDAAALIIYTSGTTGPPKGVVV
SRRAIAADIDMLAQAWEWTPQDTLVHGLPLYHVHGLVLGLLGSLRVGNRF
VHTGKPKPAAYARAVRELGGTLLFGVPTVWSRVVEDGDAARALAPARLLV
SGSAALPVPVFDGLAALSGHRAIERYGSTETLITLSTFASGERRPGWVGL
PLQGVTTRLVADDGTELPHDGESIGQLHVQSPTLFDGYLNRPDATAEVLG
DDGWYHTGDVAVIDSSGMHRIVGRESVDLIKSGGFRIGAGEIETVLLQHA
GVREAAVIGAPDADLGQRIIAFVVGDAQPDELIDYVAQQLSVHKRPREVR
VVESLPRNAMGKLLKKELAQWV
120405473YP_955302.1 hypothetical protein Mvan_4521 [Mycobacterium vanbaalenii PYR-1]MGLRFSEICIDATDIRMLSAWWSQVLGWPAENTDDGDVTLRAPGGVGPDW
LFLAVPEGKAVKNRIHFDFTPDDQDAEVERVIGLGARRVDIGQGEQSWVV
LADPEGNEFCILAADG
120405472YP_955301.1 peptidase M15B and M15C- D-D-carboxypeptidase VanY/endolysins [MycobacMAATLLSACGHSAEVMLVQTSIVVPPAPMPAPPPGDTLVIGSAAVDTTGG
WLPEGAMLSPFDTANPILSQLDPALLGAVQEAARAAQAAGVPFMVTSGWR
SKGFQQRLFDDAVTTYGSVQKAAELVATPEVSKHVSGQAIDIGPAEADRW
LIANGARFGLCQIYANEIWHFELAVDAQGNCPPLKASAAG
120405471YP_955300.1 putative transferase [Mycobacterium vanbaalenii PYR-1]MTSASGIGVATIAADGSVLDTWFPAPELTDGGEAGTVRLSVAEVPAELAA
LAGRDEDRDVDVVVVRTVIASLDDKAVDAYDAYLRLHLLSHRLVAPHGLN
ADGLFGVLTNVVWTSHGPCAVDGFETVRARLRRRGHVAVYGVDKFPRMVD
YVLPSGVRIADADRVRLGAHLAPGTTVMHEGFVNFNAGTLGSSMVEGRIS
AGVVVDDGSDVGGGASIMGTLSGGGTQVISVGKRCLLGANAGLGISLGDD
CVIEAGLYVTAGTKVTLLDGDRTATTVKARELSGANNLLFRRNSVTGAVE
VVKRDGTGITLNEALHAN
120405470YP_955299.1 LysR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTLRQLRYFAVLGHELNYRRAAEKLFITQPALSTAIKQLEHQFGVVLFHR
NTREVALTDLGAAWLPQVQQALSGVDAVVDNLIMLSGTRRGVLRVGYLIG
TGADLLFRLVRHFEAAYPDVTVEPIEFDFADPTAGLADGTTEVAIIRPPV
DLPEHRMLILDSESWVACLPRDHRLAERREVEIAELLDDPIVCAPLTAGT
WRDYWLAMDVRGNRPPTIAAVAATYEAETTAIARGLGISFTTSSVARFYD
RPGIVYVPICDRPPSHTALAWNPADLTPQADALVRHVQSQWSFGDGDNAD
HG
120405469YP_955298.1 amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-MTDAISPPTHSEQRQPALSDEDAKLAELGYRQKLDRSVGTLASFAIGFAT
ISATTAVFTGFGAGYFTAGAPFVWTLLLAGAVFALWAFIAADLTAKLPLA
GYSYQWVSRINGPDLAWFTGFIALMGWVCGMTGVGFILSGYLGGLLGWSM
TQTTQILLAIAVVFVCVLINIYGVRFATMVNNIGVSLELVITVGATALVA
IIAFSAPENHQPISALFTGGQAGDKDSYMLAWLAAALGPFFGLIGVESGA
DVAEETKDARRVVPKTMFYALVTSIVIEFLMYVVYVLAIKDPSAVQANSA
APIEEIITQQAGPAVTKVVVAIALTNILACLLANILVATRLTYSMARDNM
LPFSHVWRHVSPKSKAPTYAVVGLGFLSTVLLLSALVNEKAFNYIIGIAS
LLFFFVYILQTIGLLVGYRRGTIPAAEPGTFDLGRFRLPLYVTALSVFLG
VAVALLLLPQFATNKWVFLGIVVLAAVWWATGLKSRLSRGDAGADYAKTH
GV
120405468YP_955297.1 class IV aminotransferase [Mycobacterium vanbaalenii PYR-1]MGIDTGTSNLVAVEPGAIREDTPAGSVIQYSDYEIDYSSPFAGGVAWIEG
EYLPAEDAKISIFDTGFGHSDLTYTVAHVWHGNIFRLGDHLDRLLDGARK
LRLDSGYTKDELADITKKCVSLSQLRESFVNLTITRGYGKRKGEKDLSKL
THQVYIYAIPYLWAFPPAEQIFGTTAVVPRHVRRAGRNTVDPTIKNYQWG
DLTAASFEAKDRGARTAILMDADNCVAEGPGFNVCIVKDGKLASPSRNAL
PGITRKTVFEIAGAMGIEAALRDVTSHELYDADEIMAVTTAGGVTPINTL
DGVPIGDGEPGPVTVAIRDRFWALMDEPGPLIEAIQY
120405467YP_955296.1 succinyl-diaminopimelate desuccinylase [Mycobacterium vanbaalenii PYR-MLDLHGDPIALTAALVDIPSESRHEKRIADEIETALREQTAGFEIVRNGD
AVLARTDFGRPSRVLLAGHIDTVPAADNLPSRLADGVLHGCGTSDMKAGD
AVFLHLAATVAEPAHDITLVMYDCEEIEASANGLGRIERELPEWLAADVA
ILGEPSGGLIEAGCQGTLRVIVRATGTRAHSARSWLGDNAIHKLSDVLAR
LRSYQARSVDIDGCVYREGLSAVRIDGGVAGNVIPDAASVTVNFRFAPDR
SVEQAYAHVREVFDRLDVTIELTDAAAGALPGLTRPAAAALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHRVDESVDVAQITAVTDMLRR
YLIG
120405466YP_955295.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MSSVVCSHLSFSWPDDTPLFTDLSFTVGAGRTGLVAANGAGKSTLLRLIA
GELTATTGAVTADGVVGYLPQTLPLLDDRSVADVLGVAAVIDALNALAAG
DPSAHHFAMIGDDWDVEERTRAQLDRLGLGHIGLDRSLRSLSGGEVVSLG
LARELLRRPDVLLLDEPTNNLDADARHRLYDALDDFGGCLLVVSHDRVLL
DRMDRIAELYRGQVRFYGGNFTAYQDAVTDAQRAAQDAVRSAEQLLRREK
HQRQQARERADRRAGTAARTLGDAGLPKIVAGARKRRAQETAGRSDDVHA
SRVDDARSRLEDAERAVRDDDALVLELPGTLVPSARMVLRLNGIRVRRNG
CDVLDGIDLTVRGPERIALTGPNGAGKTTLLRTLLGEIEPDAGAVEVADG
RVAYLSQRLDLLDEDRSVAENLAAFAPSLTVTRRRHLLAQFLFRGDAVER
PVRVLSGGERLRATLACVLYAEPAPQLLLLDEPTNNLDLVSVGQLESALA
AYRGAFIVVSHDASFLDAIGVDRVLRLADSTLAPG
120405465YP_955294.1 hypothetical protein Mvan_4513 [Mycobacterium vanbaalenii PYR-1]MTEPLSVDADGVRSLGEIHNRVAAGLGSLAAASPGPAAVAGSHGTIAAAV
DTALTGALGSRSGTLAGTRTAGDTISELLHQAALAYERGDHRGAEAIRTA
ADQMAHGPTQAGAAGAAPPAGGTPTGGGADALGQAAGQLGQLAQMGQQLG
APLAALAQLPQLLTQGLAQLAQSSSAETGSGVAEIPDVGDRTPGREPDEE
PTADDDQPAAEDKEPEAPSDAGAAPGTPPGPGPAPVPQAPPRPAPTRPAV
G
120405464YP_955293.1 ATPase [Mycobacterium vanbaalenii PYR-1]MRAGAVLIGPAGVGKTTLARSAADRLGAEFPRVDWLFATASRQTVPFAAF
EPLWDVPETGTSTTVLRAALESLGDGRLLVVDDAHLLDPMSAALICQLAL
SRSARLLITATLGDAPVPAEIAALWRDGLVARIDLKPPGHDDARLMTQIK
EFAEALPAPAHRILELLTVSDPLSRADAEALTDLDAVEAALRSGAVVVEG
DELRPAHPLFLDAIRDALGGPDLRRLRTTMVAQISRGSVGVVGRLRLAAL
ALDSDRPLPVPDTCAAASDALRLGDLELSERLGRAALGKTPDLGARLTVG
YSLAWQGRGREADAVLAEIDPAALTEDELMAWALPTAANQFWMLSEPERA
TAFLRATRSKVTSPAARVTLDALSATFTMNAGSLGKATELADAVLASPDA
DDTAVGWAASAAALSSARMGRFTDVDALAERALAAGQPGLLRFTSGLGQT
TALLMTGRPEEALELALRITDFAQRRQPARAIGEVLVADVLIATGELSRA
VSLLREAATTLAPTGYSWGPLAWMLLAQALGRLDQTVDAGKALSRAESRH
GLKSMLFAPELALARAWTTAARHDTHGAVAAAREAVKAAERGGQRAVALR
VALDGARLGDARALDTLSRLAADVDCAFGRAALAEAGSPA
120405463YP_955292.1 hypothetical protein Mvan_4511 [Mycobacterium vanbaalenii PYR-1]MSRDPDREWAVCVYCASGPLHPELLELARKVGEGIAERGWTLVSGGGNVS
AMGVVADAARSRGGYTVGVIPKRLVHREVADTEADELVVTDTMRERKQVM
EDRADAFIALPGGIGTLEEFFEAWTAGYLGMHTKPIVMLDTLGHYDGLLA
WLRGLVRTGYVAEDAMGRLIVVDDVDAALAACAPG
120405462YP_955291.1 long-chain-acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MTNRSGTRSSVGLLDIAKQVPGLLKDAPTIVRGVVTGFGARPTAKTSIGK
VFQDRAAQYPNNVFLKFEDREITYREANDTVNRYAAVLAAKGVGHGDVVG
IMMRNSPEPILLMLAAVKCGAISGMLNYHQRDEVLKHSLGLLSAAVVVAE
TEFVEAITESGADTDGLITLDELKQLAETAPTTNPATTSAVLAKDKAFYI
FTSGTTGMPKASVMTHYRWLRALAGFGGLGLRLNSSDTLYCCLPLYHNNA
LTVALSSVINSGATLALGKSFSASRFWDDVIRYDATAFVYIGEICTYLLN
QPEKPTDRRHKVRVICGNGLRPAIWDAFTERFGIKRVCEFYAASEGNTAF
VNVLNIDKTTGICPTPIAFVEYDENTGEPVRDEQGRVRRVKKGEPGLLLS
KVSNYQPFDGYTDKKESEKKLVRDAFKEGDVWFNTGDLMRAQGLGHAAFT
DRLGDTFRWKGENVATTEVEAAVSTHHQIEECTVFGVEVPDTGGRAGMVA
IQLKEGHELDGQSLAKAVFEKLPSYAVPLFVRVVQELAHTSTFKSQKGDL
RKEGYGGSSGEGGDDDVKIDDPLYVLSGREEGYVPFYDEYPHEVREGKKP
K
120405461YP_955290.1 dihydropteroate synthase [Mycobacterium vanbaalenii PYR-1]MAGDRALIMAIVNRTPDSFYDRGATFTDDAAKEAAHRVVEDGADIIDVGG
VKAGPGAIVDVDEEIARVVPFIEWLRATFPDRVISVDTWRAEVAKQACAA
GADLINDTWGGADPDLAGVAAEFGAGLVCSHTGGAVPRTRPFRVNYGLSE
RGVVDDVIAEVTSAAERAVALGVRRDGILIDPTHDFGKNTYHGLSLLRHV
KDLVNTGWPVLMALSNKDFVGETLGVGLTERLEGTLAATALAAADGAAMF
RVHEVGPTRRVLEMVASIQGARPPKHTVRGLA
120405460YP_955289.1 putative glucosyl-3-phosphoglycerate synthase [Mycobacterium vanbaalenMTVLSDRVDELATYGVAEHRWLTDRSWCRPNWTVAELEAAKKGRTVSVVL
PALNEEETVAGVVETITPLLGGLVDELIVLDSGSTDDTEIRAVAAGARVI
SREVALPEVPPQPGKGEVLWRSLAATTGDIVAFVDSDLLDPDPMFVPKLL
GPLLTAEDVHLVKGFYRRPLKVSGKEDANGGGRVTELVARPLLASLRPEL
MCLYQPLGGEYAGTRELLTSVPFAPGYGVEIGLLVDTYDRLGLDAIAQVN
LGVRTHRNRPLTELASMSRQVIATLLSRCGIPDSGVGLTQFFADGLDYTP
RTSSVSLTDRPPMITLRPR
120405459YP_955288.1 hypothetical protein Mvan_4507 [Mycobacterium vanbaalenii PYR-1]MTLVLLYLVVLVLVGIVLFAVGSVLFGRGEVLPPLPQATTAAVLPASGVT
GADVEAVKFTQVLRGYKTSEVDWVLDRLGRELDMLRGELATVRAAHGLDG
PAEGDGPDGAHALPAEQTRGDA
120405458YP_955287.1 DNA-3-methyladenine glycosylase I [Mycobacterium vanbaalenii PYR-1]MTAAPADPRVRCGWIDQSRLSAADFELYREYHDTEWGRPLRDSAALFERV
SLEAFQSGLSWLIILRKRDNFRAAFDGFEVERIARYTDRDVERLMADPGI
VRNRAKIDATIANARVAADMADAGDDLGELLWSFAPPDRVTRVRPASMSE
IAAVTPESKAMAKELKKRGFRFVGPTTAYALMQATGMVDDHVANCWVPRA
DGG
120405457YP_955286.1 hypothetical protein Mvan_4505 [Mycobacterium vanbaalenii PYR-1]MAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPEEAAALGDEL
KGVTS
120405456YP_955285.1 glycogen synthase [Mycobacterium vanbaalenii PYR-1]MRVAMMTREYPPEVYGGAGVHVTELVAQLRHLCEVDVHCMGTPRPGVTVA
QPDAALVGANPALATLSADLNMVNSASAATVVHSHTWYAGMAGHLAALLY
GVPHVLTAHSLEPMRPWKAEQLGGGYRISSWVEKTAVEAADAVIAVSSGM
RADVLRTYPALDPERVHVVRNGIDTEVWYPAEPDTDESVLAKLGVDPTRP
VVAFVGRITRQKGVAHLVAAAHHFAPEVQLVLCAGAPDTPEIAEEVASAV
QALSQARTGVFWVREMLPTPKIREILSAATTFVCPSVYEPLGIVNLEAMA
CATAVVASDVGGIPEVVVDQRTGLLVHYDPDDTASFERGLAEAVNSLVAD
PQRARRYGVDGRQRCIDEFSWAHIAEQTLQIYRKVLN
120405455YP_955284.1 glucose-1-phosphate adenylyltransferase [Mycobacterium vanbaalenii PYRMREAPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGGYRLIDFVLSNLVN
ARFLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSMNLIYDEDPDYIVIFGADHVYRMDPEQMVQQHIESGAGATV
AGIRVPRAEASAFGCIDSDDSGRIRGFIEKPADPPGTPDDPEQTFVSMGN
YIFTTKVLIDAIRADAEDDDSDHDMGGDIIPRLVADGMAAVYDFNDNEVP
GATERDHGYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGGAENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVIDDGAIVEGSVIMP
GARIGRGAVVRHAILDKNVVVGPGEMVGVDLDKDRERFSISAGGVVAVGK
GVWI
120405454YP_955283.1 hypothetical protein Mvan_4502 [Mycobacterium vanbaalenii PYR-1]MELLTGFGLATAAGLNAYIPLLTLGLLARFTDLVTLPAGWAWLENGWVMA
IVAVLLVVEVVADKVPALDSVNDVIQTFVRPTAGGIVFGSGTAAQTAAVT
DPGAFAQTGQWVPVVIGVVVALVVSLTKSTVRPAANVATAGVAAPVLSTV
EDIVSVGLAFIAILLPVLVLVVAGALAWAAVRLIRRRRARQAT
120405453YP_955282.1 isoprenylcysteine carboxyl methyltransferase [Mycobacterium vanbaaleniMKLVAQTLASSVLGAAYFVAVLFWPAGTFDYWQAWVFLAVFIVTTLGPTF
FLAVRHPDALARRMKAGPTAETRPAQRLIITLTVVLVTATFVLSALDHRF
GWSSAPAWVVVVGNTLVALGLSGAQLVVVQNHYAAATVRVEAGQPLVSTG
LYGLVRHPMYTGTVVMMLGTPLALGSLWGLLGVAASAPVLVARILDEEKM
LTAELAGYREYRRQVRYRLVPGVW
120405452YP_955281.1 ABC transporter [Mycobacterium vanbaalenii PYR-1]MSTTAGLPTRGRHAAPAARSPWTGTGDLIGLALRRDRVRLSVWIAALTAM
TAYAPGAIKLAYPEEAQRQARVDLLKTPAGMMLGGPMFGGNETDLGAMMA
NELMLTMIIATSILAILTVIRHTRAEEESGAAELVLASVVGRYARTTAAL
ILVAAVNVVLAVTTTAAMAAGGFGVVDSAAMCVGVTAVAMVFGAVAAVTA
QMWRAARAATGAAMATLALAALVRGIGDVIDNSGSVLSWFSPIAWAQQMR
PFVELRWWPLALLSALSLTLVAIAAALEVQREYDDATIVSSGESPNARPI
RGVLALHLRLQRGQTLGWSVGLFAAGLAFGSMTKSLLEAAHDNELLARIV
STQGLDGVYTTMTQFLAAAAGAYVVSAVLRVFADEQSGLGEAVLAGAVSR
PRWLSTAVLSAVLGASVLMFFAGLGNGLGAGVTLGEPATVLRLTVAGLAF
VPALAVLAGVAALAVALRQSWIGWLAVTFVVASLYLGALLRLPGWLLDLS
PVAQTSYPADVPALGWFVMCCAAAALTVFAAVRYRHRDAV
120405451YP_955280.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MTDTGFAVDIHGLRKSFGHTKALDGLDLTVAPGDVAGFLGPNGAGKSTTI
RVLLGLLRADGGTVRLLGRDPWRDAVDLHRRIAYVPGDVTLWPNLTGMQA
IDFLAALRGDGTVDTRRRDQLIERFELDPHKKARTYSKGNRQKVAIVAAF
STRSELFVLDEPTSGLDPLMEQAFQQCVHEVAGQGAAVLLSSHILAEVEK
LCDTVTIVRAGRTVRSGALAQMRHLMRTTVTARTRGDGEHLRQAPYVHDL
RSDDGHLRFSVDRDDLDRVMADLSGLGIDELTVAPASLEDMFLREYQGAG
R
120405450YP_955279.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MRSADDLTAAARIRDAAIDLFGRDGFAVGVRSIASAAGVSPGLVIHHFGS
KDGLRKACDDFVAETVRASKSEAIQSSDPATWLAQIAEIEEYAPLMAYLV
RTLQTGGELAKMLWQNMIDNAEQYIEEGVRAGTVKPSADPRGRARFLAMA
GGGGFLLYLQMHDNPTDLRAVLRDYSEEMVLPALELYTNGLMTDSTMYDA
FVARRAQGIPFTSTEGAHDD
120405449YP_955278.1 O-methyltransferase family protein [Mycobacterium vanbaalenii PYR-1]MRGRFPRRGPGVSVSRQSLLWPYAAGMASTDEPGVGSGDPTARARQAEAI
VNHAEHSISEDAIVAAARERAVDIGAGAVSPAVGALLCVLAKLTGARAVV
EVGTGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFSEAGVGPGRT
RLISGRAQEVLTRLADESYDLVFIDAAPADQPHFVTEGVRLLRPGGAIVV
HRAALGGRAGDATAKDSEVAAVREAARLIAEDDRLTPVLIPLGDGLLAAA
RD
120405448YP_955277.1 RNA polymerase sigma factor SigE [Mycobacterium vanbaalenii PYR-1]MTDGAFSARPDHARLGNNIPTGRVVAFERSSPSDRTHLETEDPTTTTQAP
TAAPVAAPVTMAHLEQFTDAAWVEPADELTGTAVFDATGDKAAMPSWDEL
VRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLH
RITTNLFLDMVRRRGRIRMEALPEDYDRVPADEPNPEQIYHDSRLGPDLQ
AALDSLAPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALR
EYLARHSDAGAGRDTARSA
120405447YP_955276.1 hypothetical protein Mvan_4495 [Mycobacterium vanbaalenii PYR-1]MVFDPGHAFRRAFSWLPSQLASQSDDPVGPRQFGSTEHLSIEAVAAFVDG
ELRMSAHLRAAHHLSLCPECALEVDAQRQAREALRESRPVAMPSSLLGLL
SQIPNHTPVEAPEPADSPQLADGAQRSRRKRR
120405446YP_955275.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium vanbaalenii PYR-1MTNLDQTGRERLEPRPVSRPPVDPAAQRAFGRPTGVNGSFLGADQHRDQG
EYTPKDQAPDPVLAEAFGRPYQGGDSLQRHPTDAGALDAERDGDADELDD
PWRNPGAAAALGTPALAPAGPTQAAAPLGKLGVRDVLFGGKVSYVALVVL
GLVALVIGVAGGWVGRTTAEVVSAFTTSKVTLETSDTGGAESEGQFAKVA
AAVADSVVTIEATSKTEGSQGSGVVVDGRGYIVTNNHVISEAATNPSEFK
MSVVFNDGTEVPANLVGRDPKTDLAVLKVDNVDNLSVARMGDSEKIRVGE
EVIAAGAPLGLRSTVTHGIVSALHRPVPLSGDGSDTDTVIDGVQTDASIN
HGNSGGPLINMNSEVIGINTAGKSLSDSASGLGFAIPVNEVKQVVETLIK
NGKIAHPTLGLTARSVSNDVAKGAQIADISPNSPAERAGLLENDVVIKVG
DREVADADEFIVAVRQLAIGQPAPIEVLRDGRPVTLTVTPNGDDST
120405445YP_955274.1 sec-independent translocase [Mycobacterium vanbaalenii PYR-1]MFANVGWGEMLVLVIAGLVILGPERLPGAIRWTAGAVRQARDYVTGATSQ
LREELGTDFDDLREPLSELQRLRGMTPRAALTKHLLDGDDSIFTGKFDQN
GKSEKPEQKPEKPQSAPGPAAAVPDQPAGGRSGSTPYDTDAT
120405444YP_955273.1 hypothetical protein Mvan_4492 [Mycobacterium vanbaalenii PYR-1]MTSTPTDLEAAVRAALTKVIDPELRRPITEVGMVKNVTVDADASVHVEVY
LTTAACPKKTEISDRVTRAVQDVPGTGAVKVSLDVMNDEQRAELRKQLRG
DSREPVIPFAQPGSLTRVYAVASGKGGVGKSSITVNLAAAMATRGLSVGL
LDADIYGHSVPRMMGTTDRPTQVDSMILPPVAHDVRVISIAMFTQGNTPV
VWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQLIPGAEI
LVVTTPQLAAAEVAERAGAIALQTRQRIAGVVENMVDGPVIKMFGEGGGR
QVAESLSRAVGADVPLLGQVPLDPELVAAGDSGVPLVLSAPDSPAGRELG
KIADALSSRKRGLAGMSLGLDPAGR
120405443YP_955272.1 transposase- IS111A/IS1328/IS1533 [Mycobacterium vanbaalenii PYR-1]MIFVGDDWAEDHHDVYLMDESGQRLAARRLPEGLSGIRALHELIAGYAEE
PDQVIVGIETDRGLWVSALAAAGYRVWAINPMAAARYRDRHHVSGAKSDA
SDAKLLADLVRTDRHNHREIAGDRPQAEAIKVLARSHQSLIWARTRHANM
LRSGLREYYPAALEAFDSLTDSDALAILGRAPTPDQGARLSLAKIGSALK
SAGRQRNIESRAAEIQTALRGEHLTAPPAVAAAFGATTAAAVHVITALND
QIAELETALADHFEAHPDADIYRSLPGLGVILGARVLGEFGDDPNRYTTA
KCRKNYAGTSPLTIASGRKRAVLARHVRNKRLYDALDQWAFCTLTRSPGA
RAYYDQHRAAGDTHHQALRALANRLVGILHGCLRHHSPYDEHKAWAHRKP
AAA
120405442YP_955271.1 lytic transglycosylase catalytic subunit [Mycobacterium vanbaalenii PYMHIRGGAALVTARQRTGHFIRMPAFGVAAVLTPLVLAGAVGAAAPSTTTP
TRDSAVMPLAAVAPSADDRSGPSVVAVAKAPAPLRTVASTATAPPPPMIL
NSPGTLRIPSMALAAYRNAETTMAAAQPGCGLSWNLLAGIGRIESMHAYG
GATDSRGTAVRPIYGPALDGTLPGNEVIVQSRAADRVVYARAMGPMQFLP
GTWSRYASDGDGDGKADVQNLFDATLAAARYLCSGGMNLRNQPDVIAAIL
RYNNSMAYTQNVLSWAAAYATGVVPVDLPPITGEVPALGTIGDSHLDRPE
GIGPGLPLNATGLPANDPLSLIPLMTRTDVASQINTNLPGFVPGQTLGPL
PGPAPAPLAVPEPVAPPPPAWVPPWMQQPQQQPECAVFCIKDLPPAAPAP
APAPAGPLGLTPAPGPAPLLPAGPPPPPAPALPGMPPAPGPAPGPVG
120405441YP_955270.1 hypothetical protein Mvan_4489 [Mycobacterium vanbaalenii PYR-1]MSDASSRQRLDTPRVSRGLAPRLDIEAVGRFSERIARFLGTGRYLAIQTI
LVIVWVLLNLGAFAWQWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVALEEDRRRAEQTKADTEFLARELAALRLAVGEVATRDYLRRELEEIR
ELIQELHSRDRAETGGASKRDAGERKSKKSG
120405440YP_955269.1 MgtE integral membrane protein [Mycobacterium vanbaalenii PYR-1]MVSVNRVYAARLAGMVVLGPDGESIGRVRDVVIGISLVRHQPRVLGLVIE
LMTRRRIFVPILRVTAIEPGAVTLSTGNVSLRRFSQRPGEVLVLGQVIET
RVRVDDPDLPQLAGVDVVVVDLAIEQTRARDWMVTKVAVRQQRRLGRRSN
VYTVEWQNVQGLTPSGLAMPDQGVAQLLEQFEGQRAVEVADAIRELPNKR
RYEVVNALDDERLADVLQELPEDQQVALLRQLKTDRAADVLEAMDPDDAA
DLLGTMTPADAEQFLRRMDPEDSEDVRRLLSHSPDTAGGLMTSEPVVLAP
DTTVAEALARVRDPDLTPALASVVFVVRPPTSTPTGRYLGCVHLQRLLRE
PPAGLVSGIVDTDLPSLRPEDSLGALTRYFAAYNLVCGPVVDEESHLLGA
VSVDDVLDHLLPDDWRDREAEPVIVTAEKAT
120405439YP_955268.1 citrate (pro-3S)-lyase [Mycobacterium vanbaalenii PYR-1]MENRYRPRRTCLSVPGSSAKMIQKAKTLPADEVFLDLEDAVAPGAKEQAR
GQVAAALAEPGWAGQLRGVRVNDWTTPWTHSDIIEVVARAGASLDIVVLP
KVTDASHVHALDLLLSQLEATHGLPLGRIGIEAQIEDAKGLTNVDAIASA
PRVQALVLGPADLMASLNMRTLEVGEQPEGYTEGDAYHHVLMRILVAARA
NGIAAIDGPYLKVRDVASFRRVAGRSAALGYDGKWVLHPDQIEAGNEIFS
PRQQAYDHAELILEAYEWHTSQAGGARGAVMLGDEMIDEASRKMALVIAG
KGRAAGMQRTGEGFRPPS
120405438YP_955267.1 hypothetical protein Mvan_4486 [Mycobacterium vanbaalenii PYR-1]MTSSDNDAGRGESSDSTASGSEPSSAGYEPPPIEQTQSAPPPAQDYLPPP
AYDAPPAYPPSPGYEQQPGYPPSGGFAAPDYPPPPAGYPPPYPDAGPPPP
HPGYGAPGYGAPSYPPPPPYGTMPGGYPPAGGYPDAGYGYGAPAPQGTNS
LAIASLVASCVGLFCCIGSIAGIAMGVIALSQIKQTRAEGQGLAVAGIIV
GVITLLISGIATVAVMAS
120405437YP_955266.1 hypothetical protein Mvan_4485 [Mycobacterium vanbaalenii PYR-1]MHGTYRRSAETMTSPFQPGQNPAAAAGGPAAGRGRPVGLPTPPKGWPIGS
YPTYAEAQRAVDHLSDQQFPVEHVTIVGVDLMQVERVTGRLTWPKVLGGG
VLTGAWLGLFIGLVLGFFSPNPWSALITGLVAGVFFGLITSAIPYAMARG
TRDFSSTMQLVAGRYDVLCDPGSAERGRDLLARLTI
120405436YP_955265.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MAEIVLDRVTKSYADGTAAVKDLSITVADGEFVTLVGPSGCGKSTTLNMI
AGLEEITSGELRIDGERVNERSTKDRDIAMVFQSYALYPHMTVRQNIGFP
LTLAKLSRQEIAEKVEQTAKTLDLTDLLDRKPDQLSGGQRQRVAMGRAIV
RNPKAFLMDEPLSNLDAKLRVQMRGEIARLQKRLGTTTVYVTHDQTEAMT
LGDRVVVMLGGAVQQIGTPDELYRGPANLFVAGFIGSPAMNFFPAALTEI
GVRLPFGEIPLTGQVYERLKGHRTCDDLIAGIRPEHLEDAAVIDAYARIG
ALVFDVTVEMVESLGADKYVYFGVDGPGAEAVQLTEVAAESTVGENEFVA
RVPAQSGAAVGRTLQLALNPDNVLLFDPRTGANLSLPAVGA
120405435YP_955264.1 hypothetical protein Mvan_4483 [Mycobacterium vanbaalenii PYR-1]MSDILGVVRARVREHFVRNGITAEPDTASVTFLGADRIDVMRFAGPGDVA
VHYVSLGCSRYPMVDPTEMVADPVQGPRAEVVVALRGPSPAGLSRSVAVV
AAAPAVEGLVLAPDALVDLEMPLWEGAPFTAFLLGRSDIEDVVLPDPLSP
VVVLSAVPITATEAAWVRLKGAEAMREAWVQDGVDPTDPRRRAASPS
120405434YP_955263.1 magnesium and cobalt transport protein CorA [Mycobacterium vanbaaleniiMPSFRALPPSLVRQASKSRTAGQPNPPIPDARRIHVPVSQAMVDCGVYCE
GQRLPGKYTHAAALAKVHELEADGRKAFVWIGLHEPDEHQMQTVADVFGL
HQLAVEDAVHAHQRPKLERYDKMLFLVLKTVTYVEHDSIAKVREIVETGE
IMIFVGSDYVVTVRHGEHGGLAGVRKRLEASPANLQLGPYSVMHAIADHV
VDTYLDVTDLIKTDIDAMEEEIFSPLTATNIESIYLLKREVVELRRAVGP
LATDLQRIGADHDDLINVEIRRYMRDVHDHTIKASERIASYDELLSSLVQ
AALGKVAMQQNVDMRKISAWVAIAAVPTAMAGIYGMNFDHMPELHWTFGY
PAVLMVMISVCLLLYRNFRRNNWL
120405433YP_955262.1 malate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MGSVTLTPVVETVRTPQVVIVDAEIFEAHEGGKLSVALNSPLDTQRALSI
AYTPGVAQVSRAIAADKTLAARYTWAHRLVAVVSDGSAVLGLGDIGAAAS
LPVMEGKSALFKTFGGLDSIPIVLDTNDPDEIVETLIRLRPTFGAVNLED
ISAPRCFEIERRVIEALDCPVMHDDQHGTAIVVLAALHGAAKALGRDMHS
LRVVISGAGAAGVACANILLAKGIPDVTVLDSKGIVHTGRSDLNPFKAEL
AERTNPAGRTGGIAEALDGADMFLGVSAGLVPEEIIATMAPGGIVFALSN
PDPEIHPDAARKYAAVVATGRSDFPNQINNVLAFPGVFRGALDAGARRIT
EKMKVAAAEAIFSVVGDDLAVDHIVPSALDPRVGPAVAAAVAAASEE
120405432YP_955261.1 glycine betaine ABC transporter substrate-binding protein [MycobacteriMLVAAAIAAGCGGQSPPPSIPVGAPADPESQLIAHLYAAALRFYGNPAHV
QVTDAPLDLLDAGEIRVVPGFTGQLLQRFAPDASARADVQVYRALLSVLP
EGVAAGDYTTAAEDKPAVAVTERTADEWGGRDVIAVTRRCDDVSVGAVGS
TAHPLSVGTCRLPEARRFADAEAMFEALRAGQLDVAWTTTAAPDVPSEVV
VLSDKTALIRAENLVPLYRRNELTESQVLALNEIAGVLDAGSLADMRRQV
AEGVEPGLVAGQWLDEHPLGVGN
120405431YP_955260.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMEGFAGKVAVVTGAGSGIGQALAIELGRSGARVAISDVDTEGLAVTEERL
KAIGAQVKSDRLDVTERETFLLYADDVAEHFGSVNQIYNNAGIAFTGDIE
ITQFKDIERVMDVDYWGVVNGTKAFLPHLIASGDGHVVNVSSVFGLFSVP
GQAAYNSAKFAVRGFTEALRQEMALAGHPVKVSCVHPGGIKTAIARNASA
AEGLDAEELAKAFDKKLASTTPEKAAKIILDGVRKNRARILVGNDAKVFD
VVVRVLGAGYQSLFPKAVARLTPPAK
120405430YP_955259.1 hypothetical protein Mvan_4478 [Mycobacterium vanbaalenii PYR-1]MKLTYPVVAALVAAATVAATMSAAPAQADPTTDAFIATLQHYRLGDIDPA
TAMRVGQTVCPMLSEPGQNAANVAADVADALGRPLGPATMFTGLAISIFC
PRAVSAMTDGVPFSFLR
120405429YP_955258.1 alpha-ketoglutarate decarboxylase [Mycobacterium vanbaalenii PYR-1]MAGCRGVLARSEELRRKAAVNSPSPFGQNEWLVEEMYRKFREDPSSVDPS
WHEFLVDYSPEPTNDAPAGNGKPAAAPTAPPEPASAPAPKPASTNGGAPP
AKADTSTTRAPEKKPEEKTSPAPKAKTAAPAGVSDDDETQVLRGAAAAVV
KNMSASLDVPTATSVRAIPAKAMIDNRIVINNHLKRTRGGKISFTHLLGY
AIVQAVKKFPNMNRHFAEIDGKPVAVTPAHTNLGLAIDLPGKDGKRSLVV
AAIKNCETMHFGQFIAAYEDIVRRARDGKLTAEDFAGVTISLTNPGTIGT
VHSVPRLMKGQGAIVGAGAMEYPAEFQGASEERIAELGVGKLMTLTSTYD
HRIIQGAESGDFLRTIHTLLLDDEFYDEIFRELGIPHEPVRWRIDNPDSI
EDKNARVIELIAAYRNRGHLMADIDPLRLDKTRFRSHPDLDVNTHGLTLW
DLDREFKVNGFAGKTHKKLRDILGLLRDAYCRHIGVEYTHILEPEQQQWL
QERIEVKHEKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAET
VIPMMDAAIDQCAEHGLDEVVIGMPHRGRLNVLANIVGKPYSQIFTEFEG
NLNPSQAHGSGDVKYHLGANGTYIQMFGDNDIDVSLVANPSHLEAVDPVL
EGLVRAKQDILDKGNGPDGFTVVPMMLHGDAAFAGQGVVAETLNLALLRG
YRTGGTIHIIVNNQIGFTTSPYDSRSSEYCTDVAKMIGAPIFHVNGDDPE
ACVWVAKLAVDFRQKFKKDVVIDMLCYRRRGHNEGDDPSMTQPTMYDVID
TKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHAI
APSSSVESDQMVPAGMSTAVDKSLLARIGDAHLGYPDDFNVHPRVKPVLE
KRREMAYEGKVDWAFAELLALGTFLAEGKTIRFTGQDTRRGTFTQRHSVI
IDRQTGREFTPLDLLTVDSDGNPTGGKFMAYDSALSEFAAVGFEYGYSVG
NPNALVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEG
QGPDHTSGRIERFLLLWAEGSMTIAMPSTPANYFHLLRRHGLDGIHRPLI
VFTPKSMLRNKAAVSDLKDFTEMKFRSVLEEPTYTEGTGDRSKAKRILLT
SGKLYYELAARKSKEGRDDVAILRLEQLAPLPKRRLAATLDEYPNAEQYF
WVQEEPANQGAWPTLGLTLPEVLPEKLAGIKRISRRAMSAPSSGSSKVHA
VEQQEIIDEAFG
120405428YP_955257.1 hypothetical protein Mvan_4476 [Mycobacterium vanbaalenii PYR-1]MFARSRGKGQPPAVVDEDPGAAAKVLSQIIERGARVQGPAVKAYVERLRD
NNPGATPAEIIDKLDKKYLAAVMASGAAVGSTAAYPGIGTLVAMSAVAGE
TVVFLEATALYVLAVAEVHGIPAEHRERRRALVLSVLVGEDSKRAVADLL
GSGRTSGAWVSDGAATLPLPALSQLNSRLLRYFVKRYTLKRGALAFGKML
PVGIGAVVGGVGNRFMGKKIIANAHNAFGAAPARWPSPLHLLPAPRP
120405427YP_955256.1 Bcr/CflA subfamily drug resistance transporter [Mycobacterium vanbaaleMAPPGRTRMILVLGLLVALGPLTIDMYLPALPKIAEELSVSSSVAQLTLT
GTLAGLAIGQLVIGPLSDSLGRRRPLFAGIVLHMLASLLCLLAPNITVLG
VARCLQGMGAAAGMVVAIAVVGDLYKDNVAATVMSRLMLVLGVAPVLAPS
FGAAVLLHGSWHWVFAALVVVAGALLVMSVLALPETLPADHRRPLKARGI
ALTYLELLRDVRFVILVFVGALGMSGLFAYIAGASFVLQGRFGLDQTAFA
LVFGAGAIALIGTTQFNVVLLKRFAPQQIMVWALVAASLSGAVFVALAAA
HIGGLWGFVIPVWAILAAMGLVIPNAPAVALTRHPDAAGTAAALLGAVQF
GMGAAIAPVVGVLGNDELAMAVVMAAGVIVALTALLVTGVHRNTAPAAVP
GEAVAEPA
120405426YP_955255.1 EmrB/QacA family drug resistance transporter [Mycobacterium vanbaaleniMFETVTARVRGADPWPALWALLIGFFMILVDATIVPVANPAIMAQLGADY
DAVIWVTSAYLLAYAVPLLVSGRLGDRYGPKTVYLVGLAVFTAASLWCGL
SDSIGMLVAARVLQGVGAALLTPQTLTVITRTFPAHNRGVAMSVWGATAG
VATLAGPLAGGVLVDSLGWQWIFIVNLPVGVLGFALAVWLVPSLPTARAQ
RFDLPGVVLSGVALFLIVFALQEGQSHDWAPWIWATIGIGIAVMAAFLYW
QSVNTGEPLIPLIIFGDRNFSMSNLGVATIGFVATGMILPLMFYAQSVCG
LTPTQAALLTAPMAVATGVLAPLVGKLVDRSHPRPVVGFGFALMAIGLTW
LSIEMTPSTPIWRLVVPLTAMGVAMAFIWSPLAATATRNLPPQLAGAGSG
VYNTTRQVGSVLGSAAMAALLASQLSAKIPGEAPVPVEGQAGQLPAFLHA
PFAAAMSQAMLLPAFVALFGVIAALFLVGLGDRLPAPPRRPQETAEPVPA
FDPDDELYWADGEDEYVEYEVPWDDGAEPRRPAQEADTVDAAADTDVLDP
VTEPMHDGGGYPAPESAPRRDHADPTSHPDREWRSILDQLLDPPKPSDDP
TGQGRNGFHVTPSEDGRGASRGRHSLD
120405425YP_955254.1 FAD linked oxidase domain-containing protein [Mycobacterium vanbaaleniMTEALIDRLAAIVGATQVSIDADVLEGRSVDHTGRYRGHASALVRPGSAD
EVAAVLRVCRDAGVNVTVQGGRTSLVAGTVPEHDDVLLSTERLRDVGEVD
VVERRIRVGAGATLAEVQRAAAAAGLVFGVDLAARDSATVGGMASTNAGG
LRTVCYGNMGEQVIGLDVVLPDGSVVHRHSQVRSDNTGYDLASLFVGAEG
TLGVITALDLRLHPTPRQRVTAICGFADLDALIETGRVFRDMEGIAALEL
IDARASALTAEHAGVAAPVQGAWQLLIELAGETDLTDRLAEALESAELTD
EPAVGVDANAQQRLWQVREAVAEVLGVYGPPLKFDVSLPLSAIRGFAEDA
AALVAEHAPDAIPVLFGHVGEGNLHLNILRCDLTGERGLYSAMMALIARH
GGNVSSEHGVGTRKRDYLSMARTEADIAAMRTVKAAFDPTGYLNRAVLFG
120405424YP_955253.1 recombinase B [Mycobacterium vanbaalenii PYR-1]MFVATDADDVRVIYSASDLAAAARCEYALLRSFDARLGWGPAVSADDELL
ARTATLGDEHEQRHLDELRHDTEVAVIGRPRYSVSGLTAAAEQTLRAIER
RVPVVYQAAMFDGRFAGFADFLILEDSPDGPRYRLRDTKLARSVKVEALL
QMAAYVETLTAAGVPVGPEVDLVLGDGTAVSYPVDELLPVYRPRRAALQR
LLDEHFAGGRAVAWEDEHVRACFRCAECDKQVRAHDDLLLVAGMRVSQRA
RLLDAGITTVQELAAHDGPVPELSTRAVTALKSQARLQLADRVIENGNVK
PPYELVDPQPLMVLPDVDKGDLFFDFEGDPLWTTDGHEWGLEYLWGVLSV
ADDFEPLWAHNRSEERQALKDFLALVRKRKRRYPGMHVYHYAAYEKSTLL
RLAGRYGVGEHEVDELLRDGVLVDLYPLVRKSIRVGTENYSIKSLEPLYM
GNELRDGEVTTATASITEYARYCALRDEGRTDEAATVLKEIEEYNRYDCR
STRRLRDWLMARAIECGVPPRGPVPVTAGQEGAAADSPDPVDRKLLKFAG
DGIEPRTPEQAAVAMLAAAKGFHKREDKPYWWGHFDRVNNPVDEWADDGG
VFVAERHEVVADWHQPPRARKPQRHLRLFGEIATGELGREMYALYDPPSP
AGLSDDPDRRAFGSVTVTECDDPEAPTEVVIVERQPKGGDVFPQAPFALT
PGPPISTAQLQDAIADTAALVAAGLPNLPADGLTDILLRRPPRTRSGGPL
PRTGDAVADITAALLDLDSSYLAVHGPPGTGKTHTSAQVIATLVGRHGWT
VGVVAQSHAVVENLFTDVMRAGVDGTRIGKKAHTAHTVSGGWTELDRDDY
AEFLRQDGCVVGGTAWDFANDNKFTRGCLDLLVIEEAGQFSLANTVAVSR
AARNLLLLGDPQQLPQVSQGTHPEPVDGSALGWLVDGHHTLPPERGYFLD
RSYRMHPDVCRAVSRLSYDGRLLSNEHVTAARRLDGVTPGVRTLEVDHLG
NATESPEEADAIVTAITGLLATPWTDEGGTRPLAQRDVLIVTPYNAQVVL
VRRRLDAAGLTEVRAGTVDKFQGQQAPVVFVSMTASSIDDVPRGIAFLLN
RNRLNVAVSRAKYLAVIVRSQHLTDYLPGTPDGLVQLGAFLSLATCDTPT
E
120405423YP_955252.1 LprE [Mycobacterium vanbaalenii PYR-1]MKRAATIGCVLGAAALVATACSPGDSTVSKTPDQRTPAAAASASAQPPAP
AGPLPGPAPVDDPCDIDLAAPEIARAVSELPRDPRSNQGWNPEPLAGNYN
ECAQLSAVIVKANTNSENPNTRAVLFHQGKFIPTGVPDTYGFNGLDSTQT
TGDTVALKYSGGVPGLDSIVKFRWNGSGVELIGNTAR
120405422YP_955251.1 DEAD/DEAH box helicase [Mycobacterium vanbaalenii PYR-1]MTSSNAETESADLTFADLQIHPAVLQAVADVGYETPSPIQAATIPAILDG
SDVVGLAQTGTGKTAAFAIPILSKIDTDSRNTQALVLAPTRELALQVAEA
FGRYGAHLRVNVLPIYGGASYVPQLSGLKRGAQVVVGTPGRVIDHLEKGS
LDLSHLDYLVLDEADEMLQMGFAEDVERILADTPEYKQVALFSATMPPAI
KKITAKYLHDPVEVTVKSKTQTAENITQRYFLVSYPRKMDALTRLLEVEQ
GDAMIVFVRTKQATEEVAEKLRSRGFAAAAINGDIPQAVRERTISQLKDG
TIDILVATDVAARGLDVERISHVVNFDIPHDPESYVHRIGRTGRAGRSGT
ALLFVTPRERHLLGAIERVTRQKLVESELPSVEDVNEKRVAKFRDSITDA
LEKPGIDLFRTLIEGYERDHDVPMADIAAALALQSRNGEEFLMTEPPPEK
RRERRERDGRDGDDRGPRKPRERRSDLATYRIAVGKRHKVAPGAIVGAIA
NEGGLHRSDFGHITIKVDYSLVELPAKLSHKTLKALENTRIQGQLIHLEP
DRGPKPHRGRPQSK
120405421YP_955250.1 acyltransferase 3 [Mycobacterium vanbaalenii PYR-1]MSLSDHADRPWFPDRTDLGGGLESVSTGRVASLTGIRAVAALLVVLTHAA
YTTGKYPQGYVGLVYSRMEIGVPIFFVLSGFLLFLPWVSAAAAGGPPPSV
RRYAWHRVRRIMPAYVVTVVAAYLVYHFRTAGPNPGHTWEGLFRNLTLTQ
IYTDNYLYSFLHQGLTQMWSLAVEVAFYVALPVLAYLLLVVLCRRRWRPG
LLLAGLAVLAAVSPAWMWLVHNTTFLPDGAKLWLPGYLAWFVGGMVLAAL
RPLGVRAYALACVPLALVSYFIVSTPIAGEPTTSPAELREALAKTAFYAV
IATLVVAPLALGDTGLYSRFMASRPMVFLGEISYEIFLIHLVTMELVMVE
ILRSPVYTGSVWQLFFGTLVVTIPPAWLLHRFTRVRS
120405420YP_955249.1 FAD-binding 9- siderophore-interacting domain-containing protein [MycoMTDTKMSRGFAGAVLKLLRAGDYELTVTGRTEVSPHYLRLSFQAGGLLRD
RALHPTMWIRMWFTDGEKLHQRGYTLVNPDPVGDTVDVEFALHDGVASRW
AQQARPGDTIEVTVLGSNFALPEPRPAGYVIVGDTASLPAVNSLLDAIGD
APARIFLEAAHDDDKQLLVRRTADVTWVDRKNAGEALVSAVASAAFDAAD
HFGWVACDNRTTRAVAKLLREDYKIPRKSVKAQAYWVA
120405419YP_955248.1 sulfatase [Mycobacterium vanbaalenii PYR-1]MRRDILPIPDPQHVGLTTYDAKDPDTTYPPITPLRPPQGAPNVLIVLLDD
VGFGASSAFGGPCATPTAERLAANGLKLNRFHTTALCSPTRQALLTGRNH
HSVGMGGVTEIATSAPGYSSIRPKDKAPVAETLRLNGYSTSQFGKCHEVP
VWEVSPVGPFGQWPTGSGFEHFYGFIGGEANQYYPGLYEGTKPVEPEKTP
EQGYTLTEDLADRAITWVRQQQALTPDKPFFMYFAPGATHAPHHVPKQWS
DKYRGKFDDGWDVLRESMLDNQKALGVVPEDAQLTARHDEIPAWDDMPDV
LKPVLARQMEIYAGFLEQTDHEIGRLVDAIDDLGALDNTLIYYIIGDNGA
SAEGTPNGCFNEMCTLNGLAGIETPEFLLSKIDDFGTPDAYNHYAVGWAH
ALCGPYQWTKQVASHWGGTRNGTIVHWPNGIAAKGETRNQFHHVIDVVPT
ILEAAKLPAPTVVNSIQQAPLEGVSMMSTLRDRDADETHTVQYFEMFGNR
GIYHKGWTAVTKHRTPWIADQPPLDEDVWELYAPDDWTQAHDLAAEQPER
LAALQRLWLIEAVKYNVVPLDDRSFERFNPDIAGRPQLIKGTTQTLFSGM
RLLENCVLNIKNRSHAVSALISVPDSGAQGVIVSQGGGVGGWCVYAHENT
LKYCYNFFGIEYYFVTAELPLPGGQHLVGFEFAYDGGGLGKGGTVTLYCD
GEPVGTGRVERTEPMAFSADEACDVGSDTGSPTSPDYGPHGNGFNGRIDW
VKIDISTDDHEHLITPQDRFNISMARQ
120405418YP_955247.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAGDWLAARRTEVAADRILDAAGELFAAQPAATVGMHEIASAAGCSRATL
YRYFENREALYTAYVHREAYRLYVEMTDQITSIADPRERLIEGMLASLRN
VRESPALASWFATTQRPIGAEMAEESEVIKALTEAFVISLGPDDAELVAH
RARWLVRVMTSLMLFPGHDETDERAMLEEFVVPTVLPSRHAAR
120405417YP_955246.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTAVLSHGSPVHFALADASTWADPWPMYRALRDHDPVHHVVPEDRPNHDY
YVLSRHADIWAAARDHQTFSSALGLTVNYGELDLIGLADNPPMVMQDPPV
HTEFRKLVARGFTPRQVEAVEPKVHDFVVDRIEHLRANGGGDIVAELFKP
LPSMVVAHYLGVPDEDRGKFDGWTDAIVAANTSAGGLGGALDTLGDALGE
MMSYFTALIERRRTEPEDDTISHLVAAGVGADGDISGVLSILAFTFTMVT
GGNDTTTGMLGGSVQLLHRRPDQRTMLAENPDLIPDAVDEFLRLTSPVQM
LGRTVTHDVTIGDVTIPEGRRVMFLYGSGNRDERQYGDDAGELDVTRKPR
NILTFSHGAHHCLGAAAARMQSRVALTELLTRIPDFEVDESGIAWAGGSY
VRRPVSVPFTVTH
120405416YP_955245.1 FAD linked oxidase domain-containing protein [Mycobacterium vanbaaleniMQPLASLIAELPDGTVVTDPDIVASYRQDRAADPSAGTPIAVVRPRRTEE
VQATLRWATAHRIAVVPRGMGTGLSGGATALDGGIVLSTEKMRDITVDPV
TRTAVAQPGLLNAEVKKAVAEYGLWYPPDPSSFEICSIGGNIATNAGGLC
CVKYGVTTDYVLGLQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGSEGTL
GVVTEVTLKLLPAQSGACTVVATFDSVEDAANAVVTITGKIRPSMLEFMD
SAAINAVEDKLKMGLDRSAAAMMVAASDDRGPSGAQDAEFMAGVFTEHGA
REVFSTSDPDEGEAFVAARRFAIPAVEARGALLLEDVGVPLPALAELVGG
VEKIAGHHELMISVIAHAGDGNTHPLIVFDPDDPDMERRAQQAFGEIMDL
AIGLGGTITGEHGVGRLKRPWLAGQLGPEAMELNRRIKQALDPDGILNPG
AAI
120405415YP_955244.1 hypothetical protein Mvan_4463 [Mycobacterium vanbaalenii PYR-1]MRDSVVFAQVKTLQGMRRTALLSTGALEIHVRSVADRTGSKFPAFIPDER
LDAIAPGRITTMAAVELCMAGLWYRACDGYVIADLDLVERLGRPARGRWL
RAVSRFFREHLLPV
120405414YP_955243.1 hypothetical protein Mvan_4462 [Mycobacterium vanbaalenii PYR-1]MSDRAQPSTPPPQRQDGSRSRWTHPLTLAIIPAVASVIVGIFAIFPRPDP
APPDESSSAAATHEDGISFRLEPDLEEYSGGWQVVFDGPLPSTDDYPPGK
PRYADVYSWAKTRGAIDVDESHLRLLLQNDGAERVTIRSINAVVTSRKAP
LLTTYVMSPGAGTNEIVALGFNLDDGDLVSAQPDVEPKSAEAEADLPFFS
TKNITLDPGESTDVKITTRTTECLCLYKFEIEVVKPDSTATLEIGDESGG
PLAISAHVPRYANRYENGMLACGEYGLFYVEATSSGRMADCSRPA
120405413YP_955242.1 H+ antiporter protein [Mycobacterium vanbaalenii PYR-1]MTPNEAPSRRGPLLLILFAALMAGAGNGISLVAFPWLVLQRTGSALDASI
VAMAGTLPLLAATLIAGAAVDFLGRRRVSMISDALSALSVAAVPVLALAF
GTDVINVAVLAGLAALGAIFDPAGMTARETMLPEAANRAGWTLDHANSVF
EAIFNLAYIVGPGIGGLLIATLGGIDTMWVTAGAFGLSIFAIAALKLEGA
GRPDPTAMSDGVWAGIIEGLRFVWRNKVLRTLALVDLVATGLYVPMESVL
FPKYFTDRNEPAQLGWVLMALSIGGLIGALGYAVMSRYMKRRTVMLTAVL
TLGVAMTVIAFLPPLPIILVLCAIVGFVYGPIAPIYNYVMQTRAPQHLRG
RVVGVMGSLAYAAGPLGLILAGPLADATGLRTTFLALSLPMLALGIVAVF
LPALRDLDRPAAGP
120405412YP_955241.1 putative lipoprotein LppH [Mycobacterium vanbaalenii PYR-1]MRRKTVAILGICILVTGCADTISSADAAGSARPTRTMIPRPLVERELSEL
LLSPERAAAEMGVPAMTVIESQTTMSDHSAIMEPPECLAIDGAAELSVYA
DTGYRAERDQSLNDGEGWKHYLKQSVVLFPYQEKAGEFFDASVRQWPACH
RYTHTQSGSQWTVGEITVDGGMLSTVAMQQDAAAPGWGCGRALARRNNVI
VDVNTCSAEPGDSAVRIARQITANVDAQW
120405411YP_955240.1 uracil-DNA glycosylase superfamily protein [Mycobacterium vanbaalenii MMRPSHRQLPHPRTGDLFTSPVRPGSGWPGDPATRRTAVAATSADVVTMA
AAARSLSQLDAEISVCRACPRLVQWREDVAVEKRRSYADQPYWGRPAPGF
GSPRPRIFVVGLAPAAHGANRTGRVFTGDRSGDFLFGSLYRTGLANQQTV
TDSADGLVLNDIRVAAAVRCAPPGNAPTPAERSTCAPWLDAEWRLTAGHV
RVIVALGGFAWQVALAMIRRAGGAVGAPAPKFGHGVTATLQTPAGDVALL
GCYHPSQQNTFTGRLTPAMMDDIFATALAISRAE
120405410YP_955239.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MMRLSVLDLVPVRSDQSTSDAIAASTLLAQTADRLGYTRYWVAEHHNMPS
VAATSPPVLIAHLAAHTASMRVGSGGVMLPNHAPLAVAEQFALLEAAHPG
RIDLGIGRAPGSDPVTSLALRGAAGRDERDIEAFPQYLDDVVALMSSKGV
RVPLPRDLMRDNYILKATPAAVTEPRLWLLGSSMYSAQLAAAKGLPYVFA
HHFAGQGTEEALQYYRDNFRPSDLTPEPVTFLTVNAAVAETHDDAMRLIL
PNLQMMARLRTGQPMVPIDLVEDAEAQVVSPRAQAVIDAGLRQAVVGSPA
EAGDQLRALAEKFGVDEVMVHPVASAFRGVDPATAPAREATLELLAKEIF
120405409YP_955238.1 hypothetical protein Mvan_4457 [Mycobacterium vanbaalenii PYR-1]MGVALWVEQNIGTRLLMLHDKLYKSTGGRIGHRIPLPGVAPSLLLHTVGA
KTGKQRTNTLSYFPDGGSYYVVASKGGDPKAPGWYHNLKAHPDIEINIGP
KRFAVTATPVTAGDPDYPRLWKMVNDGNSHRYDGYQKRTSRKIPLVRLTP
KP
120405408YP_955237.1 histidine triad (HIT) protein [Mycobacterium vanbaalenii PYR-1]MSCVFCAIVAGEAPAIRIHEDDDYLAILDIRPFTRGHTLVLPKVHTVDLT
DTPAQTLAGMTALGQRIAKAARTSGLHADGNNIAVNDGKAAFQSVFHVHL
HVVPRQAGDKLSFAKGILLRRDPDREETGRLLREGLAQLDAAEQD
120405407YP_955236.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMTVSPIPAGYTSLTPFLCVDGASTAIDFYTEVFGAALVEKMDGPDGTVAH
AELDFGTGRLQLGDPADAYGIAAPDTSSDTVTFSIALYCPDVDDVVARAA
KAGATVREAPQNFATGDRFASIRDPFGVRWTVMTRVEDLSAEERDRRLGE
WAAQNV
120405406YP_955235.1 helix-turn-helix domain-containing protein [Mycobacterium vanbaalenii MGAWKNATAGEPLRGVVGRPASSSVFDLRRWAADGRTGRYVEHFWSVAWD
LRGRDPFDTSVITFPAMHITREWGEDGARHGFPLPNTLVHGVVEQVFRTT
ISERGWVVGARFRPGGFTARFGGDASTMTGRIQPVDDLSDVFGGPVLVPD
DVDAAAAEFDRLIAHGAEPDDTYRALAAVVDRIRDDSGIHRVEQVMSHSP
WSVRTTQRVFRRYVGVPVKWVLCRYRLQNAALEIETDPAVDFADLAVRLG
WYDQAHFINDFRAMLGSTPGEYAATHGRRP
120405405YP_955234.1 hypothetical protein Mvan_4453 [Mycobacterium vanbaalenii PYR-1]MTPPTLQSFPPLAAPGARILILGNMPGVASLQAQRYYAHTRNAFWGITGE
LFGFDPAAPYDHRVAVLTAAGVAVWDVLRHCRRAGSLDSAVEPDSMVPND
FASFFADHPAITHVYFNGAAAEKNYGRLVTAPATVSYTRLPSTSPAHTMS
FDRKLAAWRQITAAVRA
120405404YP_955233.1 putative adenylate/guanylate cyclase [Mycobacterium vanbaalenii PYR-1]MAEDLDLETSELLDGLEGDARGERAELIRWLVGRGVGIDQIRGNPAPMLL
ASRRVIGDDGLYVSARQAAANAGVDLELFERIQRAMGLPRVDDADAQVFL
RADAEAAKFTRDFLDAGIDPDELVQITRLLGDGLSRAAEAMRYAALAAVI
RPGATELEIAQQSEALVAGLAPLLGPMIQEVLLLQLRHAIETEAVNATER
AEGQHLPGARLVTIGFADLVGFTRLGEAVPPEDLEQLSQRLADMTREFAV
APVRFIKTIGDEVMLVSPEPAPLLDTLLRLVDETEDDDDFPRLRAGVATG
LAVSRAGDWFGSPVNLAARVTGAARPGSVLVAEATREAIGEDERFTWSFA
GGKHLKGFKSDVKTFRARRTTNL
120405403YP_955232.1 hypothetical protein Mvan_4451 [Mycobacterium vanbaalenii PYR-1]MGCSREDVLGAFDALDTVVESILALDYDALSAAERVGLDARLERNLRRLP
VAEQALIASVIAETEPARLGEGSWKKVLITALRVSGAEAGRRLRRAKTLG
PRRGLTGTPLPPLWESTAAAQAQGLLGEEHVAIIAKFHKDLPAWVDVDTR
AEADRQLARKGAGLGPEELDEAAGRLMMMIDQDGPEPCDKERARKRGVRI
SKQHSDGTATISGTLTPEALAVWQAIFAKEAAPGANKPESEHTEDSTSGG
TPRDTETSDHADASGDGVAPSSTAGDGNTSGDDGGDAPAEDHDPQPERRG
SDTRTQAQRNHDAFLAVGRRLLESGELGTHNGLPVTVIVSTTLQELEKGA
GVAVTGGGSLLPMPDLIRLAARAHHYLYVYDQHSGQSLYLGRAKRLANAA
QRIVLHARDRGCTRPGCTAPGYWCQAHHASADFVDGGLTNIDDLTLACPC
DHRMLDNTGWRTRKNGKNQTEWLPPPDLDTGQHRVNGYHHPERHLLPEDG
LPEDDLPEDDLPEDGQGP
120405402YP_955231.1 hypothetical protein Mvan_4450 [Mycobacterium vanbaalenii PYR-1]MAKDSDSNFGEPLFAAFPEWRALARREVNGCGEEMVVIDVSAPAAADVGE
GLWITWGDGEITVGLGDYHRHFEGWLSDDSWLGETGALEFVQGIVDERLA
VVTLFDDDKAVAYTTMDTGAPDRPVDSPHPYNRMRVRSWNGTFDADP
120405401YP_955230.1 heavy metal translocating P-type ATPase [Mycobacterium vanbaalenii PYRMNTIELSIGGMTCASCAARVEKKLNKLDGVTATVNFATEKARVAFGDEVS
PGQLVSAVESAGYQAELPERPDEPAEPTDDPTAALKRRLLICVALSVPVI
AMAMVPVLQFTYWQWLSLTLAAPVVVWGAWPFHQAAWTNLRHGTATMDTL
ISIGTLAALGWSIYALFWGTAGIPGMTHPFELTIARTDGTSNIYLEAAAG
VTTFILAGRYFEARAKRRAGAALRALLELGAREVTVRRGGAEQRIPIEQL
VIGDEFVVRPGEKIAADGTVVEGASAVDASMLTGESVPEEVQPGDQVVGA
TVNVDGRLVVRADRVGSDTQLAQMARMVEDAQNGKAQAQRLADRISGVFV
PIVIALSVATLGFWIGSGFPVAAAFTAAVAVLIIACPCALGLATPTALMV
GTGRGAQLGILIKGPEVLEDTRRVDTVILDKTGTVTTGSMTLVDVFAAEG
EQPDEVLRVAGAVESSSEHPIARAIAAGAQEKFGELPAVTAFTNLRGLGV
SGQVDGRAVLLGRLRLLADRSHEIPSELEVAVARAESDGRTAVVVGWDGQ
ARGVLMVADAVKPTSAEAISLLKRLGLTPIMVTGDNEAVARAVAAEVGID
EVIAGVLPQDKVDTVKRLQRDGKVVAMVGDGVNDAAALAQADLGLAMGSG
TDVAIEASDLTLVSNDLRAVPDAIRLSRKTLSTIKGNLFWAFAYNVAALP
LAAAGLLNPMIAGAAMAFSSVFVVSNSLRLRAFTPSR
120405400YP_955229.1 heavy metal transport/detoxification protein [Mycobacterium vanbaaleniMSTTITVEGMSCAGCANSVRAELTHIPGVREVDVDISNGTVTIDSDNPVD
PAAIREAVEEAGYTLAG
120405399YP_955228.1 hypothetical protein Mvan_4447 [Mycobacterium vanbaalenii PYR-1]MSSKRGLLMGAGAVGATFALLLSGCSDVGTQSADHDHTTHQHEAEHETMP
AGGAHTDADIAFARDMVPHHEQAIVMSDIILAKRDIDPRVTELANQIKAA
QGPEIATMQQWLAKWGTGAPSGHEGHGMGGDPSAHAAMGMMTEEQLEQLR
RAEGVEAARLFLTGMIAHHEGAVTMAQTEVDTGRDQEAVHLAHEIIETQQ
REIDAMKQILGSL
120405398YP_955227.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium vanbaalenii PYR-1]MRVLVQRVASARVTVAGETVGEIRPQSQGLLALVGVTHDDDDAKAQRMAE
KLWQLRILDDEKSAGDIGAPILVVSQFTLYGNTAKGRRPTWNAAAPGAVA
EPLVDAFAAALGRLGADVQTGVFGADMRVELVNDGPVTVLLEL
120405397YP_955226.1 hypothetical protein Mvan_4445 [Mycobacterium vanbaalenii PYR-1]MTGPGQGSWQPDPEGRFDYRWHDGQQWTDQVSHQGQVHRAPFGGAPAPQA
QQQAPQHQAPQHQAAQYQAQPVPGGGDGFAGISGELVDGRFSEKEAKPIA
NQNSKLLRVRLGEPFMARQGSMVAYQGNVDFAFEGGGASKFIKKALTGEG
LPLMRCAGQGDVFLAERAYDVHLLNLTNSGLSISGKNVLAFSSSLDWNIE
RVKGGSMVAGGLFNTTLRGTGWVALTTDGPPVVLNAAEAPTFADTNAVVA
WSANLQTQLKTSFKAGALIGRGSGEAMQVSFYGEGFVIVQPSEGIQVTTA
G
120405396YP_955225.1 hypothetical protein Mvan_4443 [Mycobacterium vanbaalenii PYR-1]MRHHPHGRRSSRPGGWQQADQPDAADAADWFAGRLPEGWFAGDPEVIVDR
EEITVIGRLPEAENPESEARASGRAARFREQTRSERMQIADEAEARYRRK
VAWGVEIHSDGETERILFTHLAVPVMTRLRQPERRVLDTLVDAGVARSRS
DALVWSVRLVGEHADEWLGKLREAMREVDDLRSAGPQL
120405395YP_955224.1 molydopterin dinucleotide-binding region [Mycobacterium vanbaalenii PYMSRTVHTFCRYCLAACGVEVTVEGNRVVKISADKQNPHSWQDFCAKGRTA
HQVVEHPRRIVAPMKRVGDRYVETSWDEAIDDIAARLNAAIDADGPDAVG
AYYGNPAGYSSSNLMFMNGWLDAVGTFNRYAVGSVDQNAMHVVAEKMYGS
ALLAPVSDVDNCDFFLLIGANPAVSAWNWLESVPGGWRRALARQQQGATL
VVVDPLRTESAGKADVHVAVRPGQDWALLLAMVKVILDGGLEHRGDCSDL
AVGVDRLRTLVAEADLDDLAMRCDVARTQIVDVATAFATSPRAMAVTRTG
VSLHLAGTVAEWLGHVLNVITGRMDRPGGRRFEPGYVDALRLAELAGTKP
HTSRLRGRPLVAGAHALSELPDEITTPGRGQIRALIVNSGNPVISGPDGA
KLDHALSQLDLLVAIDFVQRESHRHAHWLLPAVHWLERDDLLAFTSSLHD
EPYLHYGVRAVDPPAQARQEWRIFVDLALAMNRPLFGVPGLNRFVRASRR
LARLTRRPGLEFGPRWVDRLIVATGRKVNGRRIRWRDVLGHPHGWVLGPR
EFGHFREALRTPDKLVHVAPPEFLARARELLAEPVPQPPSGYPFQLANRR
NRHSMNSWLNDLPGLHPSGKGSEVVIHPDDAARLGIRDGDRVRVSSPVGA
VELGASVSDQPRPGVVVIDHGWGSRVFDPRGGADPQGYGVNRNLLVDGDP
VDPLSQTAALNSSYVAVTRA
120405394YP_955223.1 ABC transporter [Mycobacterium vanbaalenii PYR-1]MTGPLARSMRMAEPPQTRSRDFTGSALRLFRRLTPQRGMTVAVMLLGVGG
IAIGVIGPRILGHATDLLFNGVIGRQLPAGLTKEQAVEAARARGDGTFAD
LLSGMDVVPGQGVDFGAVGRTLALALALYLVAALMVWLQALLLNIVVQRT
MVALRADVEDKVHRLPLRYFDSRQRGEVLSRVTNDVDNLQQSLSMSITQL
LTSVLTVIAVLVMMLTISPLLTLLTVVTVPLSLWVTRSIAKRSRTLFVAQ
WTNTGRLNAHIEETYSGFTVVKTFGHRAHAEDQFRQLNDDVYHASFGAQF
LSGLVSPATIFIGNLSYAAVAVVGGLQVATGQITLGSIQAFIQYVRQFNQ
PLTQIAGMYNTMQSGIASAERVFDLLDAEEEPSEPDRRLAPDSPTVLPAR
DGRPGGRVEFDRVWFGYEHGAPVIEDLSLVAEPGTTVAIVGPTGAGKTTL
VNLLMRFYDVDSGRILLDGVDISAVSRASLRSRIGMVLQDTWLFAGTVYE
NIAYGRPEAGRDEVIDAAKAAYVDRFVHTLPDGYETRIDDGGTNISAGEK
QLITIARAVLAQPQLLILDEATSSVDTRTEVLIQHAMGRLRRERTSFIIA
HRLSTIRDADLILVMQAGRIVERGTHEELLARGGEYAAMVNR
120405393YP_955222.1 ABC transporter--like protein [Mycobacterium vanbaalenii PYR-1]MRHPNSGTARRVCDSSGMLWGLLRRYAWPYRRLLSVVAALQVISTLATLY
LPTVNAAIIDDGVTQGDLRRIVELGAVMLAVTALQVACAVGAVYFGSRAS
MGVGRDLRSTLFHHITGFSAEETARFGAPSLLTRTTNDVQQIQLLVQLTC
TMLITAPIMCVGGIFMAVHQDAGLSWLLLVSVPLLALTNYWIVSHLLPIF
RRVQRQIDGINRVMREQLTGLRVVRAFAREPFERNRFAEANTALAGSALE
AGRWQALMLPATTLVINVSSVALIWFGGMRIDTGHMQVGSLIAFLSYFMQ
ILVAVLMATFILVIIPRASVCAERITEVLATEPAITNSPAAVSPSTVGGE
IRFDGATFSYAGADRPVLQDVSFTARPGTTTAIVGSTGSGKSTLVSLVCR
LYDVTGGAVSVDGVDVRDWDIERLWGAIGLVPQRGYLFAGTVADNLRYGK
SDASDEQMWEALRVACADDFVRAHPEGLSMRVAQGGMNFSGGQRQRLAIA
RAVISDPVIYLFDDSFSALDVHTDARVRERLREASADATVIIVSQRISTV
AGADLIVVVDDGRVVGSGVHGELVQTCETYREFADSQSVSAGER
120405392YP_955221.1 putative lipoprotein LprB [Mycobacterium vanbaalenii PYR-1]MHGVTPSFRGHRRPVKALAVAAAAMIPVLGACSDSEPTGPVVPSTEAPQQ
SVSHGPFFPECGGISDETIAQLTEVPGLVNTAKTSVGCQWLSGGSILGPH
FSFSWFRGSPIGRERKTMELSRTSVEDINIEGHDGFIGINEDPDPKIGVN
LCEVGIQFNDDFIEWSISYAQPPFPDACEVAKELTRQSIVNSK
120405391YP_955220.1 putative lipoprotein LprC [Mycobacterium vanbaalenii PYR-1]MTRRVLTGAIAALASLVMLTGCSQTVAGTAAKSGSGDVPRNDNSERKYPN
LLKECEVLTEDILAETVGADPLDIQSTFVGAICRWQAANPAGLVDITRFW
FETGSLDNERSVAEQLEYQIENRSVAGIQSFVMRPNDPNGACGVASDAAG
VVGWWVNPQTPGMDACGMAIKLMELTLATRA
120405390YP_955219.1 putative phosphohistidine phosphatase- SixA [Mycobacterium vanbaaleniiMSDRHRTLVLLRHAKSDYPDGVVDHDRPLAPRGVREGALAGEWIRANVGA
VDAVLCSTATRTRQTLERTGITAPVQYVDRIYDATPGIVIEEINDVQSRF
GEVVSTLLVIGHEPVMSALALSLADEPSSDTPAYQQISAKFPTSAVAVLR
TATPWASLALRGAELVDFHVPR
120405389YP_955218.1 metallophosphoesterase [Mycobacterium vanbaalenii PYR-1]MRFLHTADWQLGMTRHYLNGDAQPRYSASRRAAVAALGPLAADVGAEFVV
VAGDVFEHNQLAPREVSTALEAMRAIPVPVYLLPGNHDPLDASSVYTSAL
LRSEKPDNVVVLDRPGVYEVRPGLELVAAPWSSKAPTTDLVGAVLDGLDA
SPAVTRVVVGHGAVDILVPDKDRASLIALAGVEAAIARGAVHYVALGDKH
SRMSVGSTGRIWYSGSPEVTNYDDIEPDPGQVLVAEIDEADASRPVQVDA
HRVGTWRFMSLRHAVDDKRDVADLDINLDQMPDKERTVIRLGLTGSLTVT
DKAALDACLDRYARLFAALVPWDNQTDIAVMPADGEFDDLGIGGFAAAAV
DELVVAARSAGEDAEDARAALALLLRLVEGGAA
120405388YP_955217.1 hypothetical protein Mvan_4435 [Mycobacterium vanbaalenii PYR-1]MKLHRLALTNYRGITHRDIEFPDRGVVVVSGPNEAGKSSMLEALDLLLES
KDRSSKKEVKQVKPTHADVGAEVTAEISAGPYRFVYRKRFHKRPETELTV
LTPRREQLTGDEAHERVRAILAESVDLDLWQAQRVLQSAPTSAADLSGCN
ALSRALDVVAGEVDDVSATGAGNVESLLVDRVEEEYRRYFTSTGRATGEW
AAATARLRAADEEVARCAAAMAEVDEAVRRHAALTTDMAQLAVETASAAE
RLQSARNAAAAVAVLQGELDQATARAEAARSVHAASKAALAQRRRARADL
DERSATVTSLQTESDTAADELDTANEMQVAAEEAAGKARSALAACQERVD
AARVAVQRLADREEADRLTGRIATIERHGRELEAVQRDLTAITLTDALLA
DIETAAAAVERATAAVEQTSAHIEVTAAADVEVRIGDADMTLRAGDTWAA
AVGTATGIDLPGVLSVQVIPGASAAATAAALDTAAARLADALRAAGVDDV
EAARALDRRRHELSAAGRQIRAILEALAADDSVDQLRARLADLQARTPAE
EGLFDTDTRGSLDPAAQRLELVEATAAHQQAIRDCETHRKVAEEAAKLSA
KRGLHAARLLEKLQAAQAELAAAGARLAEQRAATSDDELAVKAEADAEAA
AAAEAAVARVGAELAGHEPEAVAAALVDAERAAAEVGARHHEVGEALREI
AAQLKVYGTEGRKGGLDAAETERGRAEAEFVRVQRRARAAELLRSVMGRH
RDAMRQRYVDPFRGEVERLGRIVFGDSFEVDVDSSLCIGNRTLSGRTVPY
ESLSGGAKEQLGIVARLAGAALVAKEDSVPVVIDDALGFTDTERLTKMAE
VFDAVAGDGQVIILTCSPQRYAGVRTAQHIELIAG
120405387YP_955216.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MRVMTMNGRRRRAHDKLAALPGVRPVRRPVRPGVGDADEKFDVYYVRTGR
KSAHPLVIIPGGPGAASIALYRAFRRRAAVAGLDVIMVEHRGVGLSRHDD
SGADLPPEALTVDAAVDDIAAVLDDAQVERASVYGTSYGSYLAAGVGVRH
PGRVQSMVLDSPLLSADDIDAVRAQTRRVLWDGADLAPRMRRLAADGVLR
SEDVLLAIGLYELAGPEGLGRQLDLLLARRDWLWRVAESVTKLVTERKTA
YRHEPDLVERIAYRELNYGAVPDGGPLDPSVALRQMATGDVDFVAEPYDL
TSEMPGFAWPTVVVSGGRDLTTPPEVARRIADLIPDAALLELPTAGHSIL
DTREHAALRICEAVQAGQSHDLPSRSTELDALPANLTVRLLVRAITVAAR
AESAVPGAIPRVVRQLATS
120405386YP_955215.1 extracellular solute-binding protein [Mycobacterium vanbaalenii PYR-1]MRLLAVGSVVALLVSGCSSGQNDVPSTGGSAELGATADINPQDPATLQQG
GNLRLALTGFPSNFNNLHIDGNLGEIGRMYRPTLPRAFFIKPDGEMTVNS
DYFTDVELTSTDPQVVTYTINPNAVWTNERPVTWEDIAAQINATSGKDKR
FLFASPNGSERVASVTRGVDDRQAVVTFAKHYADWRGMFAGNGMLYPKEI
TQDPEAFNKGFLTGPGPSAGPFMITTVDRGAQRITLERNPKWWGTPPVLD
RITYTVLDDAAMLPALENNALDSIGLGTLDDLERARRAQGVTIRRAPAPN
WYHLTLNGAEGALLSDPALRAAITKGIDRQAITAVSQRGLTDDPAALNNH
IYLAGQEGYQDNSIGFDPEAAKRELDALGWTLNGQFREKDGKPLTLRDVF
YDGASTRAIAQVAQNQLAQIGVNLELVPAAGGSLFPDYITPGNFDIAQFA
WGGDAFPLGGLTQIYASNGESNYGKIGSPQVDAKIEETLSELDPAKARTL
ANELDKMIWEIGHSLPLFQAPGNVAVRSNLANYGPAGIGDINYSAIGFMK
120405385YP_955214.1 oligopeptide/dipeptide ABC transporter ATPase [Mycobacterium vanbaalenMSLLEVRGLTVTFPTDTDPVPAVRGLDYHVEAGEVVALVGESGAGKSAGA
MAVVGLLPEYAEVSGSVRLHGKELLGLTDRQMSQVRGANIGTVFQDPMSA
LTPVYTVGDQIAEAVRIHRRDIDKGAARKRAVELLELVGIAQPARRARAF
PHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILDVLRTAR
DVTGAGVLIITHDLGVVAEFADRALVMYAGRAVETAPVAELYRARRMPYT
AGLLGSVPRLDAHQGSRLVPIPGAPPSVTALPPGCPFAPRCPLAIDECDA
AEPDLQPVGPDHRVACIRNELVAGRSAADLYGVSMTPPTEVARPDDAVAL
RVTDLTKTYPLTKGVVLRRRIGEVRAVDGISFELQQGRTLGIVGESGSGK
STTLHQILDLRTPQAGTVEVLGRNVATLDRRSRRALRADLQVVFQDPVAS
LDPRLPVFDVLAEPLQANDFDRNAVRDRVAELLAVVGLRREDAGRYPAEF
SGGQKQRIGIARALALRPKILALDEPVSALDVSIQAGIINLLLDLQDRFG
LAYLFVSHDLSVVRHLAHRVAVMHKGVIVEQGDGDQVFDSPQHEYTRQLL
AAVPRAQADRR
120405384YP_955213.1 binding-protein-dependent transport system inner membrane protein [MycMTVSAPQEFVSRRTLVWRRFLRNRAAVLSLFVLAALFIGCYALPPLLPYS
HTDLDYYALQQPPSTTHWFGTNALGQDLLAQTLRGMQKSMLIGVCVAFLS
TAIAATVGAVAGYFGAWRSAALMWIVDLLLVVPSFLLIAIVTPRTRESGT
ILWLILLLSAFSWMISARIVRGMTMSLREREFVTAARYMGVSNRRIIVRH
ILPNVASILIIDTALNVGLAVLAETSLSFLGFGVQPPDVSLGTLIADGTR
SVTTFPWVFLFPAGVLVLIVFCANLVGDGLRDALDPGVRPARRKRDSHR
120405383YP_955212.1 binding-protein-dependent transport systems inner membrane component [MTRFLARRLLNYVVLLGLASFLTFTLTSMTFSPLDSLLERNPRPPQAVID
AKAAELNLDKPIPVRYGDWVAGAVRGDFGTTVGGQPVTDELWRRIGVSLR
LVIIGSIVGTFLGVVAGAWGAVRQYRLSDRVITTLALLTLSAPTFVIANL
LILAALNVNSFLGLQVFEYTGETSSDAVGGGWNQFVDRLQHLVLPTFTLA
LGAIAGFSRYQRNAMLDVLSQDFIRTARAKGLTRRRALFKHGLRTALIPM
ATLFAYGVGGLFTGAVFVEKIFGWHGIGEWFVQGIGSQDTNIVVAITVFT
GVTVLLAGLLSDVLYAALDPRVRVS
120405382YP_955211.1 two component transcriptional regulator [Mycobacterium vanbaalenii PYRMANPQSAHGDDPARVEMRRADGSPIHVLVVDDEPVLAELVSMALRYEGWE
ISTAGDGATAIAIARDNPPDVVVLDVMLPDMSGLEVLRKLREQIPGLPLL
LLTAKDSVEDRIAGLTAGGDDYVTKPFSIEEVVLRLRALLRRTGVSTDTS
GAKIVVGDLVLDEDSHEVTRGGDPITLTATEFELLRFMMRNAKRVLSKTQ
ILDRVWSYDFGGRSNIVELYVSYLRKKIDSGREPMIHTLRGAGYVLKPAR
120405381YP_955210.1 integral membrane sensor signal transduction histidine kinase [MycobacMFRSPRSWSLRSRLIVIQVLLLAAACAGIAVATEFALQRFLMNQLDEQVV
EAGRRSSVIFELGPPPPPGMRPPPMPPPGAMVAPPPPGQGHRIVIRDDQG
PGPAFLNAPGQAIYTVGALVSAGQVEEAGVITADGSRAQVSATAAGQLAA
VAVDERPHTVDLDGLGRYRVVAFPAHIPGQVVVAGLPTGDVDDTLFWVAV
IFGAVGAVALVAAGTAGIVIVRRQLAPLARVSAAARQVADLELDRGEVNL
PTPIVKVDPAAEHTEVGQLGTALNRMLDRIAGALSARHASETRVRQFVAD
ASHELRTPLAAIRGYTELAQRKQAQLPEDVAHAMNRVESETERMTQLVED
MLLLARLDSGRPLDRETVDLTRLVVDAVSDAHVAGPDHAWELDLPDEPVT
VQGDEARLHQVLANLLANARIHTPAGTVVTTSLGVGDGGSAVLTVLDDGP
GIPDGLQPEVFERFARGDTSRSRRGDTSRSRGGGSTGLGLAIVAAVVRAH
GGTIDVHSVPGRTEFVVTLPGDSQPGHSSGQSDA
120405380YP_955209.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MTLLTPAEKTQTRTQQRHGTRFHVFSRQVMALGGLLVATGVLYLWNLGAS
GWANAYYSAAVQAGSQNWTAMLFGSSDAANAITVDKPPAALWVMDLSARL
FGFNPWSVLVPQALMGVAAVAVLYAAVRRASGPGAGLLAGAVLALTPVAA
LMFRFNNPDALLVLLLVIAEYCTQRACEKGASRWWLIAAGVAIGFGFLTK
MLQALLVLPAFAAAYLLAGHRPVGRRILDALTAAGAAVVSAGWYLLLVEL
WPKESRPYIGGSQTNSITELTLGYNGIGRLTGNEPGGLGNLNHDVGWGRL
FGFGMGADIAWLLPAAVICLAAGFVLTRGRPRTDRTRASLILWAGWLVVT
ALVFSYMNGIVHPYYTVALAPAIGAGIGIGSNLLWQNRRDVRSATAMAGA
VLVTTVLAAVLLARHSDWMPWLRAAVAVGGVGATVLLLVVGRLHRRAARL
VAALAVTSCLAGPAAFSVATAASPHSGALPSVGPSRHGGPPGGFPGGGLL
SSPNPHPDLIRLLTTDAGQFTWAAAVVGSNNAAGYQLASGAPVMAVGGFN
GTDPSPTLEQFVADVQAGRIHYFVVGPRLMMGRSGTETTESAAIRDWVEA
RYLELTVDGTVVYDLTQGAGNLTGGA
120405379YP_955208.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MSTRPENTMDAMTDLALQSGLRCAERPFGARPNAALVARATGAPVLDVVV
PVYNEQAALADSVHRLHRYLSESVPFPARITIADNASVDDTPRIAAELAA
ELSGVRVVRLEEKGRGRALHQVWAESDAAVLVYMDVDLSTDLAALAPLVA
PLISGHSDLAIGTRLARGARVRRGPKREIISRCYNLILKSTLSAGFSDAQ
CGFKAIRADVAAQLLPYVEDTGWFFDTELLVLAERSGLRIHEVPVDWVDD
PDSRVDIVATAAADLKGIGRLLRGFASGAIPVNAIAAQLGNSRAAAPPRS
LLRQAVRFGTVGIASTLAYILLFMLLQGWAGAQLANLIALLLTAIGNTAA
NRRFTFGIGGRPHLARNHVEGLIVFGIALAITSGALGLLHAATASPHHLV
ELGVLVTANLLATVVRFVLLRGWVFHPRRTHTEGSTQ
120405378YP_955207.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MTATADLAPRTTADAEPVATERPRWMWPALLALLGATAVLYLWGLGSAGW
ANQYYAAAAQAGTQDWKAWLFGSLDAGNAITVDKPPAALWVMALSGRLFG
FSPFTMLLPQALMGVASVAVLFAAVRRVSGPGAGLIAGAALAVTPVAALM
FRYNNPDALLVLLLVVAAYLTVRAIQTGGTRWMVLVGIVLGFAFLTKMLQ
AFLVMPGLALAFLVAAPVGLWRRIGTLLTGALAMVATAGSFLAMVSLWPA
DSRPYIGGSTDNSLLQLALGYNGIQRVMGGEGGPGGGAGAPPGGPGGPGG
GANLFFGGDPGLGRLFGASMGAEASWLLPAALIGLVAGLWFTRRAPRTCA
VRASLLLWGGWVLVTGVVFSFMDGIIHPYYTVALAPGIAALIGICVVELW
RGRRHFAPRTTLAVMSAGTGVWAFILLDRTPDWQPWLRWVVLIGSIVAAA
VIAVGAHRLGRATAAVAAAAILFGAAAPAAYAIETAGNAHDGPVAMSGPA
RTDVDLGGPPGPGGPGASVADNTELQHLVQATDSRWAAASVGSMVAGELE
LQTGTSVMAIGGFTGGDNSPTLQQFQDYVADRQVRYFIAGGHGGPGRNSG
SAGDITAWVEQNFAPMDVGGTTVYDLQR
120405377YP_955206.1 carbonic anhydrase [Mycobacterium vanbaalenii PYR-1]MSVTDEYLKNNEEYAKTFSGPLPLPPSRHVAVVACMDARLDVYRILGLKD
GEAHVIRNAGGVVTDDEIRSLAISQRLLGTREIILIHHTDCGMLTFTDDG
FKQQIQDEIGIKPEWAAEAFQDPDEDVRQSLRRIDASPFVTKHESLRGFV
FDVATGRLNEVTP
120405376YP_955205.1 sulfate adenylyltransferase subunit 2 [Mycobacterium vanbaalenii PYR-1MTATDELTQNAGRYELSHLRALEAEAIHIIREVAAEFERPVLLFSGGKDS
IVMLHLAIKAFRPGRLPFPVMHVDTGHNFEEVLAARDELVAESGVRLVVA
KVQDDIDAGRVVETIPSRNPMQTFTLLRAIRENKFDAAFGGARRDEEKAR
AKERVFSFRDEFGQWDPKNQRPELWNLYNGRHRKGEHIRAFPLSNWTEFD
IWSYIGAEKIKLPSIYYAHQRKVFERDGMLLAVHKHLQPRKDEPIIEKSV
RFRTVGDVTCTGCVESTAATVSEVIAETAISRLTERGATRADDRISEAGM
EDRKREGYF
120405375YP_955204.1 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinMSASTTLLRIATAGSVDDGKSTLIGRLLYDSKAVMEDQLAAVERTSKERG
HDYTDLALVTDGLRAEREQGITIDVAYRYFATAKRKFIIADTPGHIQYTR
NMVTGTSTAQLAIVLVDARHGLLEQSRRHAFLASLLGIRHIVLAVNKMDL
IDWDRERFEKIRDDFHDFAARLDVHDVTTIPLSALNGDNVVTKSAATPWY
EGPSLLAHLEEVYIAGDRNLVDVRFPVQYVIRPQTREHADHRSYAGTVAS
GVMRPGDEIVVLPTGKTSRITEIEGPSGAVQEAFPPMAVSVSLADDIDIS
RGDMIARPNNQPRVAQDFDATVCWMADAESLEPGRDYVIKHTTRTTRVKV
TGLDYRLDVNTLHRDKSATALKLNELGRISLRSQVPLLLDEYSRNSATGS
FILIDPNTNGTVAAGMILPFVSARTASPNTVRHESLCTSEDRLTKGRTVW
FTGLSGSGKSSVAMLVEQKLLEKGIPAYVLDGDNLRHGLNSDLGFSMADR
AENQRRLAYVASILADSGQVVLVPAISPLAEHRALARKVATDQGLDFFEV
FCDTPLEDCERRDPKGLYAKARAGEITHFTGIDSPYQRPRNPDLRLTPDR
TPEEHADAVIELLESRER
120405374YP_955203.1 inositol monophosphatase [Mycobacterium vanbaalenii PYR-1]MTDDHALAAQLATEAGELLLDVRSELAGAPAEERKAAGDKRSHDFLLAVL
TAERPDDAVLSEEGVDDPVRLSARRVWIVDPLDGTREFSELGRTDWAVHV
ALWERNGSSGELVAGAVALPAQGATLATPTVPAPPAGPGAPRVVVSRTRP
PAVALAVKEALGGTLIEMGSAGAKVASVVQGLADVYVHAGGQYEWDSAAP
VAVARAAGLHTSRIDGSPLVYNRRDPLLPDLIVCRPELAEAVLAVTAG
120405373YP_955202.1 isochorismatase hydrolase [Mycobacterium vanbaalenii PYR-1]MSDLPTLRSLSGLPLQPVSLADSALVLIDCQNTYTYGVMELEGVQAALDE
AAALLDRARTAGIPVVHIQHDDGPGSPYDITAEIGAIVDRVAPRGDEPVV
VKNYPNSFVQTDLDDRLKAVDASNLVLAGFMTHMCVNSTARGAFNLGYAP
TVVAAATATRALPGVGGEDVPAAAVHSASLAAVADLFAVVVPGARDIPD
120405372YP_955201.1 BadM/Rrf2 family transcriptional regulator [Mycobacterium vanbaalenii MRMSAKAEYAVRAMIELATADDGALVKTDDLAKAQGIPPQFLVDILSDLR
TDRLVRSHRGRDGGYELARPAADISIADVLRCIDGPLASVRDIGLGDLPY
SGPTAALTDVWRALRASMRSVLEQTSVADVASGGLPGHVRALADDYRRQE
EARGHSVG
120405371YP_955200.1 hypothetical protein Mvan_4418 [Mycobacterium vanbaalenii PYR-1]MAAVIGGRVDPVRNDGRGNRPARTWRQIGESGHHRICRRIGGQHAVDPVP
TEPTVAPERDVGLRTMTEASGVEMLAAVMQTWDLLT
120405370YP_955199.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMSELSEKELGGLPTVAGREWIRACATGELPDDGGHQIDTTPPVSVFAVAG
EFFCIDDTCTHEMYSLSDGWIEEKECVIECSLHMAKFCLRTGAALTPPAS
APVAVHPVARVEDTLYVALPPSYFQGA
120405369YP_955198.1 benzene 1-2-dioxygenase [Mycobacterium vanbaalenii PYR-1]MNADVTSCPSTYRTVDPQIQHSVEQFLYAEAELLDQHRYLEWVELFAEDT
HYWVPTRMTRPNRERHLEVAGEDEAALIDDDKFFLRGRARRYSSGISWSE
EPPSRTRRLITNIRISRRTESNDLEVCSNFYVYRSRLERHQDWFVGERFD
VLRAADINTTGYPYVIAARKVVLEQTTLLCPSLSIFL
120405368YP_955197.1 ring hydroxylating dioxygenase subunit alpha [Mycobacterium vanbaaleniMIDFTDLVDPEHGWVSPQIYTDPEIYERELQHVFGRSWLFLAHDSQLPKP
GSFLQTYMGEDPVLVVRQRDGSVRAFLNQCRHRGMRICRSEAGVSKAFTC
TYHGWSYDLAGNLINVPLEERAYHSSIDKKEWGAMKVPRVANYRGFYFGT
WSEETPEFDAYLGDMAFYFDAIVDRFDSGLEFVKGTTKWVIDCNWKFASE
QFASDMYHTQSAHASALLALTDDPNPIGPLNDPNVPGRQFSGNGHGSGGY
FLPAPVVKTPEMTDTMFEWFKSREEEMVARIGADRLSKVSITHNTIFPNF
SWLGAHSTMRVWHPRGPGQIEVWAWTYVPKDAPPKVKNEIRELTQRTFSP
AGSFETDDGENWTEIQQVLRGSQARRNRLHTAMGVGYEERDAFGLPGLGN
DVYSETAARGFYRHWLDMLTGKPWSEIQKWTPNGNHGELRDEGVTA
120405367YP_955196.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MSSEITEQYTSRDIETKSGTIHYNEAGEGYPIVMLHGSGPGATGWSNFGS
NIKGLADRFRVIAADMPGWGQSEAVKPDARDHVAAALQLLDGLGIEKAAF
VGNSMGGGTAIQFAVAHPDRISHLITMGSRAPGPTIIGPDGLTEGLKTLL
KGYTDPSPTSMRELVEIMTYDSANATDELVQQRYAAAIGRPDHLENFMIA
GLLGIPQATVEEIAGIETPTLIFHGKDDRVVSYEAALKLVSLIRDSRVVL
INRCGHWLQTEHSDEFNRLVADFVSNR
120405366YP_955195.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMNRVVGLGYLIIEATDLEEWQTFACDLLGLQAVVRTPDRLSLRVDEKAYR
IDVRQAESDAVAVIGWEVRGPRELGQLANLLQANGYDVKWAGAEVARERR
VSGLAGFTDPDGQAVELFWGLQEHRDRFVSPTGARFVTGAAGLGHVFQAV
DDADVYSELYQNLLGFKLSDIIDFGPGASATFLHTTERHHSYAFAALPGL
PNGVGHVMLEVDDLDIVGRAWEKVRDGAAPMVLDFGKHTNDEMLSFYVKT
PSGFELEYGYGGKTIDDATWTPSRYDAASYWGHRRTRPTDPDSAELSV
120405365YP_955194.1 2-3-dihydroxy-2-3-dihydrophenylpropionate dehydrogenase [MycobacteriumMDWLDNQVVLVTGGGSGLGRSLVERFIDEGAQVGVLELNEEKAAAIAARW
GDRVCSVVGDATSYADNERAVQATVAAFGKLDTLVGNAGLWDFGTPLEQL
KPEQISPAFDEIFGLNVKGYLLGARAALAELRETRGSIIFTVSNAGFWPG
GGGPLYTASKHAVVGLVKQLAYELCPEVRVNGVAPGGMPSDLRGPRALDL
QETAFDSLPVDELVQRLSPLEAPIHAEDYTGHYVLLASRANGSTATGSVH
NCDGGVGVAGRKLTEKVRAELFGRGA
120405364YP_955193.1 regulatory proteins IclR [Mycobacterium vanbaalenii PYR-1]MNQASIAIDPVRSSEHDSIHQSPTNSVRRTLQVLAAFDGSRTVLGVSEVA
ARADVPKSTAHRLLNVMSQQGFVRREGNRYRLGERLFELGARALEPRGLR
ERAIPFMAELHHSTLETIHLAVLRGDQVLYVEKIYGHGAAPCPTTVGGRN
PATCTGLGKAILSSCSEEAVDAILGSRLPRPTRNSLHTRQALHRNLTISR
EEGVAVDYEELRMGLACVSAPIIDRSTGAAVAALSISAPTSRFNRRRFTV
QLLKATEALSLGSLRSA
120405363YP_955192.1 dehydratase [Mycobacterium vanbaalenii PYR-1]MTLHIDGIRKLKTLVGQRLGESPWITLDQSLINSFADNTWDHNWIHVSPE
RAKASPFGGTIAHGYHSLALIGGLIQEVFLIDNLRMALNYGVNKARFPQA
VPVDSRVRLTVDLTDMAEAADGAADVFYHCVIEIEGSSKPACAADIIFRY
YPETDPR
120405362YP_955191.1 FAD-binding monooxygenase [Mycobacterium vanbaalenii PYR-1]MPNDKLHVIHPLVVVGAGPVGLTAALAARHHQLPVLIVEAEPEDRTRPGS
RATYLFQETLDLLESVADGVTAPITEQANNWESLRTTYSGRQIYFKRFPP
CRPGKFGAAISQRESEQVLLKRCHEEGVQFRWKTSVTGVHTTSDRVTLTL
DDGSRLHASYVIAADGARSAVRRALGIELDGDRSESSFVIVDVAEDPAAP
LERTRSFHYRSPAVDGRNVLMVPFAGGWRIDLECRPDEDVRPWQEEPLLS
QWVAAVAGPKYASRISWVSTYRFHRSVALSYTDDHARVLLTGEAAHLFPP
FGGGRGLNSGVPDAIFGVEAIAKALSDPASARQIINAVATERRLAGIANR
DAASSALVHMEARGRLLRLQQRLAALLARWFRRPGEWLDRAPMGPSRPVS
ARSRF
120405361YP_955190.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MFRPYRIWDSRCDRDFTHVLAEKESSMAHPDPGTRADTVYTVFRQSAENH
PDREFSVHRASRLSWGTTLTLVDQCARALDRAGVRSGDRVGILSPTRPET
AIVLLACAKIGAIYLGMGTRLRRADMDYLCADACPSITFAMPDPYLGDRT
DDMVAAATGQGLSHPILLSFTDDGSISPEFSEFLAGHQENAERAYDVDQF
DPLAIVYTSGSTGDPKGVVLSHRSLLNYRSLLHRWPLTQPRLLSDMPVDH
IGYIGNELTAAILSGGTLVQVPRFDAREVADQIERERVTVWMGAIPTMLT
RVVALDDLESRDLSSLELVWWAGQLPESTARKVATFAHQVGASYGMSEMC
CITLTDPGISPEQAVRTVGRPLDDIEVKVLPVPGEERSGEFALRRIGMMT
EYWGKPDKTADAIDRDGWFHTGDLGFIDDDGSLVITGRLKLLIRSGGYNL
SPFEIESVLEGHPGVAMAVVVGLPDPEYGEVAHAAWTAARDTAVTDDELR
SYLREHLSGFKVPKQFHQISRIPLLANGKPDRSRIREQLHVSVPGADGRH
VATTPSKETDHAQ
120405360YP_955189.1 putative GAF sensor protein [Mycobacterium vanbaalenii PYR-1]MSEPRSVIAAQTALIAALRDVVSARSVADVESATLAAVRSLLSADAAFWM
DRVDDGFAMTALSGLIQPESHELSLVPPGAGLAAEIVANDAPASSSDYTV
DPRAIPAFAAMFRRENIRSTAGAPMRSSEGVVGVLFVFARRSREFTEDEM
QLLMSIAGVARALRERLREGEFQRELLEQERSRAAAGDRLLRAAETFSSS
MLRGQPLAAGLEAASDELGVRLHVRGLPAPGSPTSHMLPIEDAPTVSSGP
EARIPGADLAVLSADGALPEMQLALLAQLIGIDFRRQRVELETELALTDQ
MVHSLLTGDFQELERLWSRTALLGMNPAVPRVLVSIGRDRPVDRMLLDRI
RREMRSRISGGYSTTYGGDVVLLCPVPEVEQEAKLVGQVESIVTACRPER
LTAGIGPVCRKADDYPLGVREALFARQVAAQSRTGKAVVSSAELGMYRLF
AHVGGTDALLGAVLETLGPLLDADGRDGSDLLNTLHAFLEHDRRIAETAR
ALHLHVNTLRYRVDRIARLLKTDLDDPEKRFFILLALRLRGVVGLGPNDS
RQAPSSAGENVQ
120405359YP_955188.1 FAD-binding monooxygenase [Mycobacterium vanbaalenii PYR-1]MPEFNDGIAETPLPDSAVIETDVLIVGSGPAGASAALFLSTLGIPNIMIT
KYRWTADTPRAHITNQRAMEIFRDMGIEDQVLADATRHALVGDTVFCTSI
AGEEIGRIHTWGTRPDREADYRLASPCELVDIPQTYLEPILVRNATSRGT
QTRFSTEYVSHAQDTTGVDVQVRDRLTGNQYTIRAKYLIGADGARSKVAA
DIGLPFEGAMDIAGSMNITFKADIASHVAHRPSVLYWVIQPGANVGGIGA
GLVRMVRPWNEWLIVWGYDINDEPPALDEDEAVNIVRQLLGISDLPVEIT
GASLWGNNEMYATHLQQGRVFCAGDAVHRHPPSNGLGSNTSIQDSYNLAW
KIAAVLRGQADPALLETYSAERAPIAEQIVKRANKSSREYGQFFEVLGLL
DANDEQEMAARIEERKAATPRGAAMREALVAAMELKNYEFNAHGVDLGQT
YQSAAVVSEGSTLPIPARDPELFYEMSTVPGSHLPHAWVGDSRTKLALMD
LAPYTEWTVITGIAGEAWAGAADKVGHELGIPLRTVVIGPGREVTDLYYD
WAKLREVDEDGALLVRPDKHIAWRSMSMPDQPHAALRSAMAQILGRD
120405358YP_955187.1 iron-containing alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1MGFVHEGHRQRVRFATGEATGQLAEEITALGVSRVMVIAADEEADLAREI
AGALPVAAWHHDVAMHVPIEVAERARAVATGRHADAVVSVGGGSTTGLAK
AVALTTGVPIVAVPTTYAGSEATNVWGLTEGAKKTTGVDERVLPRAIIYD
AALTLSLPVDMSISSGLNALAHCIDSLWAPNANPINSALAEAGIRALNAG
LPQVAADALAIPGRELSLQGTYLSAAAFSAAGSGLHHKICHVLGGMFNLA
HAQTHAIVLPHVLAFNVSNAEEAQQRIARAFDSESAQTGLANLRRALDAP
SALRDYGMPESGLAEAVDAIVAVAPASNPTPVTPEGIAALLRAAWEGDEP
Q
120405357YP_955186.1 intradiol ring-cleavage dioxygenase [Mycobacterium vanbaalenii PYR-1]MTMSDAAIVVEQDRRELDLIDRVQRSFDNCTDPRLKELMYALVKHLHAFL
RETRLTEEEWTRAIEFLTAVGRITDDKRQEFILLSDVLGVSMQTIAINNA
AYKNATEATVFGPFFAEGSPEVAMGGDISGGAAGEPCWVHGSVTDTSGNP
VANALIEVWEADAEGFYDVQYGDGRTAARAHLYTGADGTYCFWAITPTPY
PIPHDGPVGEMLEAVGRSPMRASHLHFMVTAPGLRRLVTHIFVRGDEYLG
SDTVFGVKDSLVKDFQRPSTTSAPGGRSIDGPWSAVQFDIVLAPAEA
120405356YP_955185.1 3-oxoacid CoA-transferase subunit A [Mycobacterium vanbaalenii PYR-1]MSFTTIHESADDAVAEIGDGATLLIGGFGLAGMPFDLIDALVRQGSRDLT
VVSNNAGNGEVGIAALLKAERVRKIVCSFPRQSDSFVFDELYRTGRVELE
LVPQGNLAERIRAAGAGIGAFFCPTGVGTPLAEGKESRTIGDRTYLLEYP
ISGDFALIAADTADSAGNLVYRKTARNFGPVMATAATTTIAQARRIVCSG
QLDPEAVVTPGIYVDDLVQIPRPRSPIGGAAP
120405355YP_955184.1 3-oxoacid CoA-transferase subunit B [Mycobacterium vanbaalenii PYR-1]MTAAHEVVQRTDRPPLSMDELAILIAKDIAPGSYVNLGIGHPTKIAEHLP
ADSGVVLHTENGMLGMGPAAIGVAVDPDLTNAGKEPVTELPGAAYFHHAD
SFAMMRGGHLDVCVLGAYQVSESGDLANWHTGKPDAIPAVGGAMDLAIGA
KSVFVMMSLFTKAGVPKVVPACSYPLTGVACVSRIYTDHAVLDVHPSGIQ
VRRTFGISLAELKNRLGDCRIHAWTGP
120405354YP_955183.1 hypothetical protein Mvan_4401 [Mycobacterium vanbaalenii PYR-1]MLTRSLQGLGGLFAMSVDTMVLLSRRPFAWQEFLRQSWFVARVSLLPTLL
LAIPFSVLLVFTFNILLTEFGAADFSGTGAAYGAVTQIGPIVTVLVVAGA
GATAMCADLGARTIRDEIDAMRVMGINPLQALVLPRVLAASFVAVMLSSA
VILVSLVGSYVFGVFIQNVTPGAFAAGMTLLTGVGDVVVALIKAAMFGLC
AGLIACYKGLSVGGGPAGVGLAVNETVVFTFMALFGINIVTSAVAIEVLS
120405353YP_955182.1 hypothetical protein Mvan_4400 [Mycobacterium vanbaalenii PYR-1]MSAVSPPLRLQRRLSQWAAGLDRLGLQTLFYGHTLRSTGDAAIHYRAEIL
RQIAQMGFGVGALAAIGGTVVIVSFLTVSVGALVAVIGFNQLSQVGVEAL
TGFISAFFNVRLIGPLIAGIALAATIGAGTTAQLGAMRINEEIDALEVMG
VRSVSYLASTRLIAGTLVVVPLYCVALISAFVAAKVGTTVFYGQSVGVYE
HYFYTFLNPDSVVWSFLLAVTMAVVIMLVHTYYGFNAAGGPAGVGQAVGQ
SVRASLVAATVMTMFVSLALYGQTGDFNFSG
120405352YP_955181.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MNHYQGHRKVRPAWWSLALCAALALIIFICWSLFAGTFRSYVPVTLTSER
SGLVMEPGAKVKLRGVEVGRVGDIRHGAQAASLQLQIFPDQISHIPANVE
AQVRATTIFGAKYVDLVYPEQPSGQRLAAGAELVSRNVSIEVNTVFDNLV
HLLEHIDPAKLNAVLNAWAEAVRGRGERIGEAITASNQVLASVNPLMPTV
QRDWQSLQGFADTYAEAAPDILDILQGASTTSATITSHADDLDRLLLSTM
GFSQTGTDLLSSTRDSFPEAVNILAPTTALLLKYSPEYTCLLQGAKLALD
RGWYDAAGGNGKSIVLDAGLTWATDPYRYPDHLPKVAATGGADGKPGCGS
LPDVSKNWPVRHLVTDTGYGTGLDLRPNPGIAHPWWGNFLPVTRAVPEPP
SLRGMGPPAIGPVPYPGSPPYGGSLYGPDGLPLWAAPPPGMPPPPVPGVP
NPPPPYGTGIPPQSHPAPNP
120405351YP_955180.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MRSDLPGVAARLGLFTMACAAGTFALIMIFAQLRFAPSNHYDAQFVNVSG
LKAGEFVRIAGVEVGKVKRIAVNEDGTATVTFGADDSVLLTEGTRALIRY
DNLIGDRYLELQEGAGAVQALEPGGTIPVARTQPALDLDALVGGFRPLFK
ALDPTQVNALSAQLVQAFQGQGTTINSFLAQTAEMTAALADRDALIGEVI
TNLNTVLGSLADESDNFDEAVTSLSQLVEGLAARKTDIGESVSHSNAAAA
SITDLLADIRPPFAETVAQSDRMNSVVLSDHEYVDDLLATLPDAYRVLGR
QGIYGDFFAFYLCDLVLKVNGKGGQPVYVKVAGQDSGRCAPR
120405350YP_955179.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MKPLQERNLAVIGAIGVGVTAGVVLAALQYDKLPVFSGGERYSAYFTEAS
GLQPGADVQVAGHKVGKVSDINLDGGRVLVNFEIGENIAIGDRSEAAIKT
NSLLGLKVLEVTPRGADSLAQPIPIDRTTPAYQLPDALGDLSSTISNLNT
TSLNDSLATLAAEFADTPDDLKNAVEGVMRFSATLNSRDQQLRDLLANAR
SASTVLADRTDQVVTLIEHSAALLAQLRVEREALDDISGNISDLTEQLSA
LIDEHRTSLRPALEKLSGVMALIDNRRDKVQESLKLLHPFMLSLGESVSA
GPFFKPYITNLLPGQFIQPFIEAAFSDLGLDPNVLLPSQLSDPQTGQPAT
PALPVPYPRTGQAGDPHLTLPDAITGNPGDQRYPYREPRPAPSPGGPPPG
PPAGTTPAGSAPAPPQSPEPGSPIETGGPT
120405349YP_955178.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MSRVEKLRLPIALVLVAVLAVAIGFVSVRSWSSSSQTQLVAYFDSSTGIY
PGDDVLILGVKVGEIESIEPEPHQVGITFNVADEYQIPAGVHAAIISPQL
VTARAIQLTPAYTEGPTIGNDATIPLERTAVPVEYDDLRVQLQKLSDSMQ
PSGSGQLSPVGEFINTAAKNLRGQGDQMRKAVIELSQAMSAFGDHSDDVF
GTVEDLSVLVSALQSSTVLMRELNSNLAGVTEVLSNDPGEVGQAIAAIDA
VSTDITNFVAEHREPLGTATEKFSSISTALVESTDDIKQILHLAPNVLSN
YNNMYYPALGGAASALAVNNFANPIEFICGGVQAASRLGAEQAAKLCVQY
LAPILKNRQYNFPPIGTTISPALIPVTGAKARPNEITYSDDRMRPDYHAP
AAADPNTVPAAPPEQSEPPISTDPAAGLQGLMVPAGGGR
120405348YP_955177.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MKRILQLGAAMVAAVMVTCVAGCEWRGLNSLPLPGTAGGGSGAYTVTAQL
PDVSNIEPNSRVRVGDVTVGNVVKIERQGWHALATIKLDGDIELPANTHA
AVGQTSLFGTLHVELFSPIDAAPVGRLREGSLIPLSNTRSYPTTEQTLAS
LSFLLNGGGIGQMQDITAAFSTALNGREDDLRGFNEQVGMFMESLNMQRD
DIIAATESLNRLVSRFGERQETLDAALRTIPKALTVLKDQRENMVEALVE
FGRLSALTTETLEKSEENLVREVSDLGPVFAALAAAGPSLTRSASLLTTI
WPKENLTKWFRGDYGNLTMVLDLTLNRLDAGLLTGTRWEGDLTALELQWG
RTIGQLPSPYTAGNPLLAPYHHEQGR
120405347YP_955176.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MHLSRRIRIQLALFMAVTLGAFGVLGFGYLNAPATWLGVGRYTVIVELPD
AAGLYATGNVSYRGTNVGRVTDVRLGASGVEAVLSLRTDVPIPSDLDAAV
HSVTAIGEQYVALTPRAAAPPLRDGDVIPRDRASVPPDVNTLLESTNRAF
EAIPDQNLSVLVDESYRAFGGLGPELARIVEGSTRLAVDARKNLEPLVAL
IEGTAPVLDTQVDTSAAIQDWSSQMAEIAGQFRDRDEELAGVLEKVGPSF
DELQTLFQRFQPTLPVLMANLVTVGQVAVAYQPALEQLLVLLPPFVEGAQ
GGTMANGDTKDGYRGLYQSVALNINLPPPCVTGFLPPQQRRNPTLVDYPD
RPEGDLYCRTPQDSPFNVRGAKNYPCLTVPGKRAPSVKMCESDQQYVPLN
DGYNWKGDPNATMSGQDVPQVHHATPDQAESPELPLPRLPIAEYDPATGT
YLAPDGREYTQSNLAETGPAEKSWQSMLTPPGT
120405346YP_955175.1 hydratase/decarboxylase [Mycobacterium vanbaalenii PYR-1]MHVSDPIAQANQRPSAGLADGPGRAAKRLMDAAAQRKPCAPVRDILGESD
IALAYEAQEAIVNDRIHGGGVVTGRKIGLTAPAVQQQLGVNQPDFGVLFA
DMDVSSMTRVPAHLLLQPKVEAEIAFGLSRDLDIPDIDMPTLRDSVAWAA
AALEIVDSRIANWDIRITDTVADNASSGLYVLSGSRIPLQNFVPREVTMR
MFIDGEPVSEGTGAACLGDPLEALLWLARTARQYGRPLRGGQVVLSGALG
AMVPVAPGSKVTAEISSLGEVSAWLGHRDELQP
120405345YP_955174.1 acetaldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MRKVAIIGSGNIGTDLMIKVLRVSDLLEVAAMVGIDPDSDGLARARRLKV
QTTHEGVEGLLALDEFDEIDIVFDATSAGAHIKNAETLRKFGKYLVDLTP
AAIGPFVVPAVNLTDQLNRNVDNVNMVTCGGQATIPIVAAVSQVTPVAYA
EIVASISSKSAGPGTRANIDEFTETTAQAIESVGGAARGKAIIILNPADP
PVIMRDTVLCLTGDVDQDAVRDSVSTMVEEVSRYVPGYHLKQEVQFDRVS
AADVRTLLPAGVGTVSTQISVFLEVEGAAHYLPAYAGNLDIMTSAALRVG
EGIAERLNHAEAPRRSRA
120405344YP_955173.1 4-hydroxy-2-ketovalerate aldolase [Mycobacterium vanbaalenii PYR-1]MTTTVYVQDVTLRDGMHAIRHRISPRNVARIAAALDRAGVDAIEVAHGDG
LAGSSLSYGPGSHTDWEWIDAVAGAVTNATVTTLLLPGIGTVAQLDEAYR
RGVRSVRVATHCTEADIAAQHIAHARELGMDVSGFLMMSHMAQPADLAAQ
AKLMESFGAQSVYVTDSGGRLTMHDVRDRVLAYRDVLAPSTQIGIHAHEN
LSLAVANSVAAVEAGATRVDASLAGQGAGAGNCPIEPFVAVADLFGWKHG
CDLFALQDAADDIVRPLRDRPVRVDRETLTLGFAGVYSSFLRHAEDASAR
YGVDTRAILVEVGRRGLIGGQEDMIVDIALSLSAGVP
120405343YP_955172.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMAITLNHTIVAARDKTASANFLTELFDLPSPKPFGHFLVVSVGSDNPVSL
DYAEVGEDEEIHPQHYAFLVSEDEFDAIYGRIREWGLQHWADPRGAHPGE
INHNDGGRGVYFQDPGGHYLEILTRPYGSGGGSAS
120405342YP_955171.1 2-nitropropane dioxygenase [Mycobacterium vanbaalenii PYR-1]MSFDVRDLSVPVLVAPMAGGPSTPELAAAGTNAGGLGFVAAGYLTADVFA
ERVRAAQRLTSGPLGVNLFVPQPSAGTPAAVAAYAERLAEEARRYGTELG
APRFDDDHWNAKLEVVLDLRPALASFTFGLPTVEERRRLSAAGIATAATV
TTPAEARLAADCGVDILVAQGPSAGGHRGTFDPTATPSGQPLDELLAAVT
ADHAIPVVAAGGLMTATDIRRVRQAGAAAAQLGTAFLLSDEAGSSPVHRA
ALIDPQFTETAVTKAFSGRYARGLRNRFIVEHEAEAPFGYPEVHYLTSPL
RAAAVRAGDPQAVNIWAGTGFRQAGGGSVRDIMDTLIGRD
120405341YP_955170.1 amine oxidase [Mycobacterium vanbaalenii PYR-1]MLALTRRQFTLGLGAVAATPLLTSCGGGGDTTRGHVVVVGAGMSGLAAAR
RLTDAGVPVTVVEARSRIGGRTWTDTSLGLPVDLGAAWIHGSQGNPLTGL
AAQAGARTVETNFDDVVVLDGGRAVDPAAVEEVSRDWMGVLDEIEPMTAD
AAPDVSLADGLVWAGADLEDPLMQWMVSAAIGAEYAADPEELALRWFGHE
GEFDGPDLILPGGYRQLIDHLARDLDIRLDAEVTRIAYDDVGVTVETAQE
VLRADRVIVTVPLGVLKAGVIVFDPPLPQAKRAAVERLGFGLLDKVVLVF
DEPFWTEAFDIHSDMLGIAGGAQPVSDLVNGLRFTDVPLLVGLRGGANAR
AREADSDQQTVGEVLAALRAPDPVGVFVTRWAADPYARGSYSFLAVGSSP
ADQQALAEPVADRVAFAGEATHPEFFATVHGAYLSGLREADRILR
120405340YP_955169.1 hypothetical protein Mvan_4387 [Mycobacterium vanbaalenii PYR-1]MTSSVTAAAPPPAPATPPPPLSPGGRTAVRVLLILAAAALVLGTVAALTT
AAVGVSTFRVVKDSMPLPRTLTSVVIDTGSVPAAVRITADRAARDPRVDM
RMVNSTRAGSDPLAVTEDGTTARVTIDAEPSEFLQWGRAGEITLVLPPEL
ARRLTVTTQQETGVVFAQADIDQLYARTVDGAVFLSGSARRIEITNEHGD
ITTREPIAVSDSFRATTTTGDVNVDFSEAPKTVDAETEHGDVVISLPPPG
PYFVDATTGMEHGTTVVRVPQTRDRGSAAAVVTARTETGDVVVEEQR
120405339YP_955168.1 two component LuxR family transcriptional regulator [Mycobacterium vanMIAEDSALLRAGIERILTDAGHQVVAGVPDATNLLRLVNDERPDLAILDV
RMPPTFTDEGIRAAALLRSQNPESPVLVLSHYVEERYAADLIASDTRGFG
YLLKDRVADVPAFLDAVEVVGSGGTVLDPEVVSQILVRSRRRNALDALTP
REHEVLQLMAEGKTNSAIAAALHMSVGSAEKHIASIFTKLDLAPDENRRV
LAVLRYLDS
120405338YP_955167.1 integral membrane sensor signal transduction histidine kinase [MycobacMTAVTHADAATDRVPVSSHDHAGAAPPRPRTLGVAASASLLVGGAIASVW
FWVPLGILVIAVSSIPSVIGFLLAGVVFIYLIRGVDHVERVRSEAVFGMG
IPVPPRALSHYTGFQRWAHQLWLDLSSARFWKTVAHHYLRMAYDALVTGL
AFALTVFAFLAPAAAIAIGHSDPEAGLSFLPTPLAWLLALVALAAAAALV
AFAPTLDAMIDRWLLPPSSTAELQHQVTALADARQGAVTSAQTERHRIER
DLHDSVQPRLVSLAMTIGLAQTKLDSDLPAAKALIAEAHDDAKNALVELR
NVVRGIAPTILSDRGLDAALSSVVQRSANSGVPTTLSVHLPHRLPDEVEA
CAYFVVAEALTNVSRHSGASHAAVTVRLDESANQLHVSVFDDGRGGARIV
GDDGDMDATGLRGLDERVRAARGTFSVSSPVTGPTIVTAVLPCGS
120405337YP_955166.1 C4-dicarboxylate transporter/malic acid transport protein [MycobacteriMTNPPPTILGYLGPNWFASVMGTGIVATAGASLPVHVPGLRGFALVVWVL
SALWLLVLIFATFAHWLRNPVVARSHVRNPQMAHFYGAAPMALLTVGSGA
LLVGRDLIGERAAVDLAWVLWTTGTLGALFTAMTIPYLMFTQYRVEPDAA
FGGWLMPVVPPMVAAATGSLLIPHMAEGPGRATMLYGCYAMFGLSLVASL
IIITMVWSRLAHYGTSGTARVPTLWIVLGPLGQSITVAGLLGTDAALAVD
ARLADGMAVFAVLYGVPVWGFAVLWIALAAALTVRTLRRGMPFALTWWSL
TFPVGTFVTGTAQLALHTGLPAFRYAAAVAYLGLLCTWLLVAVRTVRGGL
RGGLFAPPAAGQIRAYKDPPTATG
120405336YP_955165.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MPVMEPDLDRATLRSWAQLVDGGPFSSLCWGERIAFDNPESLTLLGALAA
WTDRVRLVTTVVIPQLHDPVMLAKQLATGDMLCGGRLTVGIGVGGRHEDY
RAVGVDPATQTMRQMAERVAVMKRVWAGEKVTESTLPVGPPPVQPGGPEL
HVGTLGPKTVRSAAAWADGLAGITMDLAVDKQGELFDVARDAWQQAGKGK
PHLATSFWFAIGDGDAPRAQVHRHLLRYMNWIPAEFVDALAPTTGFAGTA
DDLREVLQRFADIGTDEVHLIPTSQDIDQVRRVAEVIDDFS
120405335YP_955164.1 hypothetical protein Mvan_4382 [Mycobacterium vanbaalenii PYR-1]METAKALPPIVSRSEWERARAELLVREKELFRLKDAVSAARRRLPMVLID
TPYLFDTEAGPLTLLDLFEGRSQLIMQHFMFGSDWDEGCSGCSMMADHIG
PLSHLYAKDTSLVLVSHAPVGKLVAFKDRMGWDLPWVSSGRTTFNEDFHT
TVDGQERHSISVFLRDGDRVFHTWQTFDRGEEPFMMVFDLLDLTPYGRQE
NWEDSPPGWPQQPPYEWIRLHDAY
120405334YP_955163.1 hypothetical protein Mvan_4381 [Mycobacterium vanbaalenii PYR-1]MQVAVRTIRVAGVTLLATSTIAAAPALPTTGISPASRDVHLAATTAVIKP
ADFYRHIVVETTRNVGGLWGAFSAQPFPVAQVAVGNQVAFVSDLVETVSG
VLRGEYPPTEILAPIGDAVATASRNVVTVAAGLVAALPALTISVVLPVVS
TVVSAAFAVADIVRAVAHLDVVELVDAIVNVPGWIVNGFLNGTVIPNEAV
PLAIPGFLTVENGFLPVGPAATVIDRTQLVAEQMSRYPTTAPAEPDAGPV
DEADVDSTDAVPSPPGEDADVPVDDDRVPADGNEPAAPGAVELRGDVLDD
LDVLAASEPAPETSTADTPSDAAAMIDPSDTTASEDGVPAEVSTRRAAES
THRAVAAATPEGSPPSSPAARTE
120405333YP_955162.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFQFSEEQVLLRDTTRDMLSRKYDPETRLKAIDSELGWSRDVWKQLAEV
GVLGLGFDEDAGGQLEVLVVLTEIGRRLAPEPVLHAALGPGALIAEVGTE
AQRGLLDEVAGGERLLAFAHLEPGMRLPTAKVSTTAVREGDSWTLSGRKN
PVLAGDCADTLVVSAALPDGGTGLFLVDATSSNPVQRTPYRTFDGQRGAQ
IDFDSVAAEPLGEAADASDAISRALVRISSGLCAEALGAMEEALRLTSEY
LTQRKQFGVTLSKFQTLTQRAADMYVSLELARSMAFYANMSVADGNLDPT
IAARAKLQIGRSGRHIAQESIQLHGGIGVTAEYPISHYAARLTAIDNTLG
STQDQLHVLIGQLGDYEIVTV
120405332YP_955161.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMQLALTAEEAAFRDELRTFYRTKIPAEIRERTRSGTEANRDDIVTANKIL
NDHGLMVPNWPVEWGGKDWTPIQHQIWLDEMQLASVPEPLTFNAKMVGPV
IAEFGSQELKERFLPPTAAVDIWWCQGFSEPEAGSDLASLRTTALRDGDS
YVVNGQKTWTTLGQYADWIFCLVRTDPDAPKKQAGISFLLIDMNTPGITL
RPIKLIDGSYEVNEVFFEDVRVPADQLVGEENQGWSYAKFLLGNERTGIT
QIGRTKLRLSEVKERAKASGLLDDPLFAARLAETENDVLALELTQMRVAS
GSKDGKPNPASSVLKLRASELQQAATELLVEVAGADALPFGSHGIASADW
AQDAAPRYLNYRKTSIYGGSNEVQRTIIASTILGL
120405331YP_955160.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMATMWSPARLGDMSGQRIIVTGATNGVGLATATALARAGAHVILAVRNLE
LGAQRAAEMGGDTSVVKLDLADQSSVRAFPGLVDGDVDVLINNAGQVAQH
RSDTVDGFEITLGTNFLGPFALTNLMFGRVRSKIVNVGSDAHKSASLAFD
DLHLRSRRWSSFPAYARSKLAVMLWGLELDRRLRTAGSPVTTYLTHPGWV
SSNLAKVSDTALMTRVHSAVTAVANVIGNDIDAGAAPTLYCLTEPIPPGS
YVGIAGRLGFKGPPTLSGRAPVACDYADAQRLWEFAERETGTTLPA
120405330YP_955159.1 hypothetical protein Mvan_4377 [Mycobacterium vanbaalenii PYR-1]MLAFVAVLLAAVAGLSTGSAHAAPPVEISEQSEQILQSMLAADGGSPDAE
LISRQFLGTPYGANTLVGSATVPEQLVVDLKQVDCFTYADYVEALKRADS
RDEFIRSLVDVRYRNGDVTFENRKHFFTDWAASAPAVATDITATVSENAL
QSMKNLNAKDSGGVYLPGLPVVPRSVAYIPSAAVDAAVVGRLRTGDYLGA
YAEDGGLDVTHVGIFVDTPDGPVFRNASSSSADGKVVDSALDDYLQTVPG
IVVLRPVV
120405329YP_955158.1 lytic transglycosylase catalytic subunit [Mycobacterium vanbaalenii PYMSCNRVGGLAALIACVLVGCSSPTTPPTGDPAAATTGAGVLTSARPTPAP
APAAPATAQPALESDPARIVDDLTADEQTLRAPGAPEAALVAAARRQQKA
YRVLARHPEWDAVVRPRVPRPLLDVYDRNIDARRQLGAMSRGKVALPAWR
VERPPAADQLLGFYRKAEAASGVSWNYLAAINFVETAFGRITGVSTAGAQ
GPMQFMPSTFAAYGAGTDIHSPHDSIMAAGRFLAAHGFARDRDQAIYRYN
NSRQYVRAINQYATLIAADPAAFSGYYRWDVYYNSTAGDVILPVGYASTT
QIPVEEYLKTHPQ
120405328YP_955157.1 hypothetical protein Mvan_4375 [Mycobacterium vanbaalenii PYR-1]MASLPVAAPAGSAEAAMVALSVSGSSSWFLAAGRSDGWLSTGSRASSSSG
PSATSAWASVPASGSGAPGPVSAVCTGSSSACDCSTAAPMLRSAVSTDSA
MTVPAATRRPASARAAAPTARAGSPVAASSRANASGVSNTADSTWLKAGK
TTAATMLVASTTATCSTPRGRTVGVGLATIGALRAANVSSRAVSSALTTP
GSPSAAAGRTLSRPTTPTWKAFSARGATMVPSARIAAWAAAFVGPVTDAA
AAPNARSRSPDPEAVTKVTGACTVVTAAVTAVSTSSGQMIAQYRIWLPTK
LVMSPPGGTVVAARWTSRDTPGGGGGEVAIGTTGSAAAAVSPRTATPLLM
TWRRWSARFIGPPRSTVCRGHERRARSVHCGCVFKYSSTGICVVDAYPTG
RMTSPAVEL
120405327YP_955156.1 hypothetical protein Mvan_4374 [Mycobacterium vanbaalenii PYR-1]MSTQGLSREELLAESALALPDKEVVSILDLNADVDVAIDAASPIDLAAAA
NLNVAAPIDAAAGANVLTYGSGSQATVDQGTSIEQMLDADAYATSTQVSG
IDQGGMDTDGDDTTGGTVTDGTVTDGTDVTDGTDGTGTTVDTSPGALLDG
NLLNVNVNVDLDSDLAAPISGAVAANANVAAPINAGVSANIGSIDSDAIS
VAEQDAIIKQTVIGEAVAEADQESTISQGDGDAGTTTDSGTSGDSGSTDG
GSTAG
120405326YP_955155.1 hypothetical protein Mvan_4373 [Mycobacterium vanbaalenii PYR-1]MDAAPLQVRLQRADDVEMIGKLPGSGYRVPPALVRRADGQTVQLTPLLYA
ILQAVDGDKTAAEVAAAVSESTGRSVSEANVDQLVEEQLRPLGLMTLPDG
SQPATRKRNPLLGLRFRYAVTDADRTRRLTDPFRVLFRPWVAVPALAAFA
VVCWWVFFEKGLASAAHDAFERPGLLILVFVVTIVSAGFHEFGHAAAARY
GGATPGVMGFGVYLVWPAFYTDVTDSYRLGRGGRLRTDLGGLYFNALVAI
VITGLWLWLRYDALLLVVATQILQMLRQLAPLVRFDGYHVLADLTGVPDL
YSRIKPTLLGVLPWRWGDPQARQLKWWARAVVTLWVILVVPLLLATVAIA
VWALPRVLGSAWASLRTQREVFVTAWADGDVVQAVARVLAMIAIVIPVAG
VLYMLGRLARRTAAGSWKATAGKPLMRTMAMMAGGVVLCGVAYAWWPQEG
RYQPIQPWERGTLGDIVYALKIDRMNRPAQPDTVAAPRRLVNGQQGVMQA
VWDARMPTPTQQSPQLALVLTPRTTVAETPFRGGSGGGAAAAAPDQVADG
WVFPVDKPLAPEPGDTQALAVNTTDGTTVYEAAFAMVWIADNSDAMNVNE
AQAYASCESCAAVAVAYQVIFVVDTDDADDNVVAPQNLAGALNYNCVNCL
TYALARQIFVTLDDPLSQQAMDELDALWGNIAAFAEQIEAGTVPPEDIEA
RLAVYTEQLMGVLQTAAPTAIPQQTATSTAPTTSNGAPTPTADAPATTSA
PSPTAPETPVTETTAPETIQAVAPATTETAASSEVAEPTAGPTTSVSSPD
PSATSEPEASGASTGADTADADTTG
120405325YP_955154.1 hypothetical protein Mvan_4372 [Mycobacterium vanbaalenii PYR-1]MVFGEELPMFSRSVARLALATLLLSPLAGVSVSPAAAQPQATPCVGGGQA
VDPLSLILSQDGLFEPPLQEPDTPSPSCDSQRQECLSGSAQTGIYGERYV
PPEAVAMCMEQYRACIGAQSEGEG
120405324YP_955153.1 hypothetical protein Mvan_4370 [Mycobacterium vanbaalenii PYR-1]MKVRRGVATAWISAQVAVLAVAACTSAPAPNPDTTAPSTSDVTTAPMLAP
PALFYSKAGSLYISDPAGAPGRKLTDGPADSEPAPSPDLAHVAFIRKADA
SGYGGELWVLDLSPDREPEGAPYRLVEPASLPSIYADTEVGDVPRRIVSP
RWSPTGDQVAFLDAGEGGGLLLVAYAVNGEIVSPEQRLFADAGYAWAPDG
QHIAWTGGRSDVSPVDVNVLAVGGDSTSVVKDTNAFSVSYGDAGRTVLFA
NGDASGELFADIPFALRGGGVYSVATPGGVPIDPPAAPTSLFAGQAMFGD
VAVLESGAVAFTETGADGDSKTIQVLDPRSSVPRTAVADVAADSPGPVWG
RGDVVAYVDAAPSRPLIVTDSENRTPEPIDTGVDAFAWPPPPR
120405323YP_955152.1 hypothetical protein Mvan_4369 [Mycobacterium vanbaalenii PYR-1]MRSVALLVLFCFLASASVVSAQAEPPGIPDLRGYRTVPVDDFVVDGAAYF
QTPDGLDCAILPTNGTAGCDGPLPATPAGANEIVLAAEVDTRGLRTTANP
SFLAPPGHAVPELPEGAKIVYGDFECAAGSGPITLCAKGTPAMQWMMISA
ERTGIGPATDGLPPGFPDPNDFVVGDDEYLVGTGPKNMFPIFTVEGGLTC
SIVTFSGGEIGCNGPLPGVSGGENEIFAQLPGATGIRRTDNPKFSTPDYP
GQIRQLPVGHRVNGIGGTCMAIAGGVACYGTVAGRAQGFEVSATETTTFG
120405322YP_955151.1 hypothetical protein Mvan_4368 [Mycobacterium vanbaalenii PYR-1]MAESISAKRNADAVSRFLAAQRYTRDQVFSEPCPVPTEAGVHGWWFRDIP
GGIDVTGCQQQDGWTLLYVGITSGPPRADGKPRAPQDLRKRIRYHFGAGG
ASADGSTLRKSLGVLLGGELGFALRRVGSGKRMTFAGGESVLTQWMAENA
AVSWVLHPEPWYLERKLIDALELPLNFQDNDSNAFAPELKRLRRDAAVKA
GKMRVLAEWS
120405321YP_955150.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaaleMSHPSTRISRLAEKQSASRAELNALLDATPLATIALVRDGHPVVFPTGFA
RIGDSLVIHGSTGSPWMRAVADGAAVAVSVTTLDGVVVARSAFESSFHYR
SAVLFGTFDVVGAEQKTAYLEALTDTFIPGRVAELRPSSRRELAATMVLR
LAIGDDNWSLKVSGGWPDDPEEDVAAGAWAGVVPLATSYGEPRRAPDCPA
EVPTPRSVLAMTGELANHRR
120405320YP_955149.1 hypothetical protein Mvan_4366 [Mycobacterium vanbaalenii PYR-1]MVTPPLNNVSLVMSDGDDTWEVLPAQPIQSKCTAPLSKQVHENMQLSDFL
TMAQLGGLVGDIRNIEWLADDPPDASVTMADGQVFAVELSSISVTDVTRS
RLSELRMIEDALVQRIADDVASYPHLFGRTVALSELASDGNRPPKRNSAQ
MTALVDRFAEELRTDFGVVGTAADGPGIPEVITFDAANIGRRYIEQYSVE
TWQTGAADVKPQFVSSAQIDVSHNLLCERIIKVAEAKDKSTNQVLVITTG
IVDRRGYRIPSDRYVFRIAFELAKTRLKLPALNYLNQVILHFWSEPRFLV
LYQREGAPVLVDTSSVTIRG
120405319YP_955148.1 hypothetical protein Mvan_4365 [Mycobacterium vanbaalenii PYR-1]MRFVAAETIRTANCCRCALTCHALARVVGIGMGCLVNIDHNCVDRLVISP
RSVWSVAGAASSAKVVWGWSLSSAIPWERRHSVREPPNSSWLKTC
120405318YP_955147.1 phage integrase family protein [Mycobacterium vanbaalenii PYR-1]MAGKKGHRGWGWIRQLPSKRYQASYIGPDLIRHKASTTFGARIDAEGWLS
QERRSIELDTWTPPAQRAAEVKAKAVTLGEYSTKWIEDRNVKPRTRSSYR
DILRLHIEPRLGSMAMKNLTGEVVRSWYAGLGTDYPRRNSHAYGLLHAVC
ATAVSDGLLQSNPCNIRRAMNPPRRRDPVILAVADIAALAEAIQPRRLRC
LVLLAAWCGVRWGEVSELRRKDLSDGCEVLSVSRAVTRRDGVYRVDTPKS
GKGRAVVIPPHIREDVINHLAENVESGPESLLFPAARGGHMNDRVFSREY
FSDALKAIGRQGVRVHDLRHFAGTQTAQVANLAESMARLGHSTVKASLIY
QGLVTGRDAAIADALSQLAVGES
120405317YP_955146.1 hypothetical protein Mvan_4363 [Mycobacterium vanbaalenii PYR-1]MTNSTTPARSTNVSASDALKYAAAQARQTANWALDAIAGSCCNSDHEAEL
DALHSLVDQIEDFATELGDLGRYSDGRLVRSATWIVEGDLSTGHVWHPDV
AAEEPRTWRGHLSPACPGAPSPGVYEVTTDPLTQEIHVRVVRTVPEDGDR
120405316YP_955145.1 hypothetical protein Mvan_4362 [Mycobacterium vanbaalenii PYR-1]MSDVVGLLSGLLAGAPSLPGARCRGRGSLFDPPYRGENPDTTKARHAQAL
GLCGRCPAAERCRAWFDGLPKARRPRGVVAGQVVDGMTANVTFCGDCP
120405315YP_955144.1 phage major capsid protein- HK97 [Mycobacterium vanbaalenii PYR-1]MTTRIVDDPWDTTQIRGSGDDYVTQMRSHACAAIEKMPFADDKVREVATR
FVERDGEEHAPVANLVLATTSPDYSRAFTKMIRSRGNPTVLSGREVQAYQ
RAMSLTDNQGGFLVPMQLDPTIILTANGSFNQVRQISRVVQATGKSWTGV
TSAGVSGSWDGEAVEVSDDSPELQQPEIPVHKLQIWVEFSHELQHDAAGL
ADDIAKMIAFEKDVKESIAFATGSGVGQPRGVITALMGSDSVVNSAVTDT
FAAGDVHNLDGDLPQRYAFNASWLAHRKIYSKIRQFDTNGGASLWGQLAE
GRKSELLGRPDYVAEAMDSSITNGQDNHVLAFGDFQNFVIADRLGTTLSY
IPNLMGPNGRPVGKAGWHAWIRVGSDVVNPGAFRLLNVT
120405314YP_955143.1 Phage-related minor tail protein-like [Mycobacterium vanbaalenii PYR-1MVTMVVGTEIDDNSLRQSANDIQRRFDRLGQNVGGDFMTQFADGAAANAP
KVQKAVDKAADATGRLRSEQEKLDALTANGASRDRIVTQSEKVAKARRDE
ARAYREATAAVEDYDRAGQRAGNSFTSGLRSGEAGAAEAGGGFADSFAGG
FAGASSLSGLGGGLLKAGGWITAGIAAGKLFSDAVGDGMATIQLRDQFQA
RMGLDDSAMAEFGDAAGRAYANNFGLSLEDTLSTSQAALRTKLVDPDATA
AEVQAVIEQLEGMEAVTEATATELSRSMATLMRTGLADSMSEASDIITAG
FQSGLDVSGDWLDTINEYSTQFRKFGLDAGEFMTLLSQGLEGGARDTDKV
ADSLKEFSIRAVDGSQSTAEAFAALGFSADEMGRMFAQGGDSAKVALDAT
FDAIKRIDDPMQQSLIWQQLFGTQFEDMGDAINRFDLDPVKNQFADIEGV
AARSTQTATDNFSSKWGTATRTVGQYFSDLKTDIAAWFSGLPIVSDVLPE
MLTTLFGDQPRLQAPGAIQGAVPGTPLNPLDIAAGGTGGWWGTSNVPQAE
TGVPGVVLPPDAASTPLGELLLPSQQGPTPPTGPVAPRPTAPTQGTPVPI
VPDGADAGSGDKPVIDPSRYSLDSVPISIRPDQLPGVASSPSMSQQVWDM
ETQLLSQRQSVEEARLRVLELEAGGTATQSEINAARTAQQIAERQYVSQL
QKLAEAQQGTWQKLEDSAASFASGMEDIGAALDSDFGLSEGLPGLAENLT
KFIANLAAAPLLGQLSAIKQAAGDEGSGLMGILASNGAFGPRFMPNNNGI
GAPGYSPSTMGPAELQQAMTYGVTGGGAPYGLPAGSGSGAQFPAWVRQLE
RIFGVSASTYAGHQERDGLNKGIDWSGPVENMQRFADYLATIPGSLEQVI
WQNPNTGGKTGIADGQFVGPGTSQPGYYANDWGGHQDHVHTRQSYSLPVP
AAPAVPPVPSYPQYQPSTGVAPAPAPVLPSAPVNAGPLPPLPAPGTVPSG
GSAMPGTGFPQAPAFMAPPGTPGNPIGQSVIPGQPPGVVPGAGAGMTGGI
SGIPLAAASAAASSLDFLAPGAGAAANLGIQLANRTIGFVGQQVGNLWSG
VAETFTLSGSGGAPDFMKSLPGRALAGIAGARPSMPNTAGGGGQQPQADP
RQQQGQQQGPNSGPMVEISGDIYQQPGQEPTSVANEISSQVRAAEFSSGW
MNARGI
120405313YP_955142.1 hypothetical protein Mvan_4359 [Mycobacterium vanbaalenii PYR-1]MDMSSDDPTLDDHRRAAALMALRSYGDPSSVVAFLSDPETAARGVQLLRA
VDAAYRSAIADLRTELGVALLNGIVDDTVTHATEPRMKRAAQVIVAMRNQ
DRDAFTAVLHAANG
120405312YP_955141.1 hypothetical protein Mvan_4358 [Mycobacterium vanbaalenii PYR-1]MPPHTPRRTAMPTHGTTDARGYGSRHKRLRKQLEPIVTSGQAICWRCAER
ILPGQSWDLGHDDDDRNAPYRGPEHALKADCAAGGNRSAGIRKRHGTALN
LDDDDESVTYPPCDTSRVW
120405311YP_955140.1 hypothetical protein Mvan_4357 [Mycobacterium vanbaalenii PYR-1]MSTTYWVEMSLLVSGSPDANLVEFVEDFATTLDDEHDGEVMYTFASKTGD
LTLTVSIVSDEDTAQVCAKVVGTVRSAAHGMGAHTPGWPQAPVTLSDFTG
FSIKSLDRATVPC
120405310YP_955139.1 hypothetical protein Mvan_4356 [Mycobacterium vanbaalenii PYR-1]MKIFLDESCNMKIVTAVRAMFQDHTFLVAGIDSEKGILDIPLYPIVADLG
CEVYICADNGQLDTRPAERAACRKAGLHWVGLRKVPAKGKRGATADAARL
IAAFLHILDDIKGAGGPRYYRLERGPKNADEAIDEVGEL
120405309YP_955138.1 hypothetical protein Mvan_4355 [Mycobacterium vanbaalenii PYR-1]MFPVPLTVTMTGVTKSQLAGWRRAPVVLAPEHGTRPRALYSFQDLVALRT
FARLRSKVSLQKIRKALSTLDMLELTEHPSKYTLVAHGESIALVDNDEAI
DLVEAPTTRVMVEMVDVFNSFINRNEVAVVDFKHPRPQLEVNLNRLGGWP
TIKGTRVPYDAIVDLVADGDVSYDEVAEYYPSVTPDAVADAVAFAQLIED
AA
120405308YP_955137.1 hypothetical protein Mvan_4354 [Mycobacterium vanbaalenii PYR-1]MFLSVTYMDNEPTPSVYSTPPRKSAGGDDRGATITVHPFGPDVAAMFEDG
YVAPVPLPEPEKGSVSINLSLAEAEELARRLVVVVQAAKQGIYSNMGEQL
KRYTREKRLNEAWQALMSEDDK
120405307YP_955136.1 hypothetical protein Mvan_4353 [Mycobacterium vanbaalenii PYR-1]MAGTDERRRQVVVFAHWLPREDDARLVDSRPVGEVCAVVQELEAVGVRVD
PQDPDVGRVRIEAVKSSTELLRCFNAQCLWINHGLYVPGGSGRGSRSSSS
CAIDSSTFT
120405306YP_955135.1 hypothetical protein Mvan_4352 [Mycobacterium vanbaalenii PYR-1]MATPQIPEVPLPAGAVPAADLAKSWEDGAFEYRCIEGEQKTIQLSGYPDA
EVFVFPGAVQMADGSIQPRGEQPHLQSGPTVSVQVRWDEYMTAAEARQLA
RYIEDAADIVDRWAGPDGHSCSFDWCRCRWRSESGHWWIEYVAATLRLGD
PYHLQQGQTPLKVGVGVSYDEEEQPAVVIHIDGGPADEDVDAHLKLTEAV
ALRDLLNRSIENAAEALQHMTRQMMKAAGR
120405305YP_955134.1 hypothetical protein Mvan_4351 [Mycobacterium vanbaalenii PYR-1]MRENSATVQSRSLLLASAMSRHPAGHALRQAHPIAAAAGTAVADVEMGPA
QRIPAVCPLCHGVGWVRAVAELPLQILCPACGVA
120405304YP_955133.1 arginyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]MTPADLAELLKATAAAVLAEHGLDSAALPAIVTVERPRNPEHGDYATNLA
LQLGKKVGANPRELAGWLAAALVAKDGIAAADVAGPGFVNLRIEASAQNV
IVGDVIAAGATYGASGELDGRRVNLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLSTQGAEVVREYYFNDHGAQIDRFTNSLIAAAKGEPAPEDGYAGTYI
ADIAAQVLAKEPGALELPDAEMRETFRAVGVNLMFDHIKESLHEFGTDFD
VYTHEDSMHTSGRVDQAIAKLRETGSIYEKDGAVWLRTTDFGDDKDRVVI
KSDGQPAYIAGDLAYFLDKRKRGFDLCIYMLGADHHGYIARLKAAAAALG
DDPDTVEVLIGQMVNLVRDGQPVRMSKRAGTVITLDDLVDAIGVDAARYA
LIRSSVDTPIDIDLALWSSASNENPVYYVQYAHARLSALARNAAELGVAA
DTAHLDLLTHDKEGTLIRNIGEFPRVLKTAASLREPHRVSRYLEDLAGDY
HRFYDSCRVLPQGDETPGDLHAARLALCAATRQVIANGLGILGVSAPERM
120405303YP_955132.1 diaminopimelate decarboxylase [Mycobacterium vanbaalenii PYR-1]MIAHPAGPRHAEEVHPVATPDRPRTAAEVLQLAPNVWPQNAVRGADGVVS
IAGVSVADIAAEFGTPVFVIDEADFRARCRDIAAAFGGGEHVRYAAKAFL
CTEVARWIDEEGLSLDVASGGELAVALHAGFPAERIALHGNNKSVAELTA
AVEAGIEHVVVDSMTEIDRLDKIAGEAGVVQDVLIRVTVGVEAHTHEFIS
TAHEDQKFGLSLASGAAMTAVRRVFETDHLRLVGLHSHIGSQIFDVAGFE
LAAHRVIGLLRDAVAEFGVEKTSQMSIVDLGGGLGISYLPHDDPPPMGEL
ADKLHAIVRHESAAVGLPAPRLVVEPGRAIAGPGTITLYEVGTVKDVAIS
SDRNRRYVSVDGGMSDNIRTSLYDAEYDVRLVSRTSNAEPTLSRVVGKHC
ESGDIVVRDAWIPDDVGPGDLLGVAATGAYCYSMSSRYNLIGRPAVVAVR
DGRARLILRRETFDDLLSLEVSEVKR
120405302YP_955131.1 homoserine dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSDEIGVAVLGLGNVGSEVVRIIEESAADLTARIGAPLVIRGIGVRRVDA
DRGVPVELLTDDIEALVSRDDVDIVVELMGPVEPARKAILAALEQGKSVV
TANKALMAVSAGKLAEAAEKAHVDLYFEAAVAGAIPVIRPLTQSLAGDTV
LRVAGIVNGTTNYILSEMDSTGADYASALADASALGYAEADPTADVEGWD
AAAKAAILASIAFHTRVTADDVYREGITKVSAADFASARALGCTIKLLAI
CERLTTGKGKQQVSARVYPALVPLEHPLASVNGAFNAVVVEAEAAGRLMF
YGQGAGGAPTASAVLGDLVMAARNRVQGGRGPRESKYAKLPVAPIGVIPT
RYYVNMNVADRPGVLSAVSAEFSKREVSIAEVRQEGMVDDEGQRCGARIV
VVTHQAKDAALSETVAALADLDVVQSINSVLRMEGTSE
120405301YP_955130.1 threonine synthase [Mycobacterium vanbaalenii PYR-1]MSTARAVHQPWPGLIEAYRDRLPIEDSWTTITLREGGTPLLPAPRLSEYT
GCTVHLKVEGLNPTGSFKDRGMTMAVTEAVSRGQQAVLCASTGNTSASAA
AYAARAGITCAVLVPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARK
LTSDFPTVSLVNSVNPFRIEGQKTAAFEIVDALGDAPDVHSLPVGNAGNI
TAYWKGYTEYHRDGLAARLPRMLGTQAAGAAPLVLGEPVSDPETIATAIR
IGSPASWSSAVEAQQQSGGRFVAATDEEILAAYHLVARAEGVFVEPASAA
SIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVDPV
AVVAKLGLV
120405300YP_955129.1 homoserine kinase [Mycobacterium vanbaalenii PYR-1]MTRTLPPGLTATAVVAASSANLGPGFDSMGLAIGLYDEIVVETTESGLVV
EVEGEGSGQVPLDGSHLVVRAIERGLRETGVSAPGLIVRCRNDIPHSRGL
GSSAAAVVGGLAAANGLAAQTDSTLMSPERLVQVSSEFEGHPDNAAAAVL
GGAVVAWTAAGAGDPRYAAAPIRLHPDIAIFAAVPQVRSSTAETRVLLPE
HVRHTDARFNLSRAALLVVALTERPDLLMEATEDVLHQPQRAAAMPASAE
YLAMLRRCGVPAVLSGAGPAVLALSTETELPAEALRYGADHGFAVKRMSV
GHGVSWTSGVAVRT
120405299YP_955128.1 transcription termination factor Rho [Mycobacterium vanbaalenii PYR-1]MTDTDLFTAGSADSGELPNTVTATNSASSEQAGAPAAAPAADEAPAATRA
RRGALTSLVLPELRAMAKEIGVEGASGMRKSELIAAIRERRGEANGKPAA
KSDTAEATAAAPSGDTSAPAGDTAAPAGDTAAPAGDTSADSAASEQAAEA
QPQQRRRERRGSSREQGGPNAGEQAGDQAGGQDKTEAGRPESGQAEGRGK
NAPQEQQGGGRETRERTESQGGQASKAEGRADSDTRSDGGDQQGGQNRGR
GGEGGGNRAADNDDDGDGRQGRRGRRFRDRRRRERGGEGGGGGDRDTELR
EDDVVQPVAGILDVLDNYAFVRTSGYLAGPNDVYVSMNMVRKNGLRRGDA
VTGAVRVPKDGEQSNQRQKFNPLVRLDSVNGGPVEEAKKRPEFQKLTPLY
PNTRLRLETSSDKLTTRVIDLIMPIGKGQRALIVSPPKAGKTTIMQDIAN
AITRNNPECHLMVVLVDERPEEVTDMQRSVKGEVIASTFDRPPSDHTQAA
ELAIERAKRLVEQGKDVVVLLDSITRLGRAYNNASPASGRILSGGVDSTA
LYPPKRFLGAARNIEEGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAEL
KLDRKIAERRVFPAVDVNPSGTRKDELLLSPDEFAVVHKLRRVLSGLDPH
QAIDLLMSQLRKTKNNYEFLVQVSKNTPGGVDND
120405298YP_955127.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MDAQPGTAVLMYIAHREVESRVMAALARSGVGDVTVAQSRLLQRLDPGGM
RLTDLAEQARVTKQTAGALVDQLERAGYVTRQPDPSDARARLVTLTDKGA
EMCRRAGAEVARVEQEWRQHLGDDAYGALRAALLSLREITDPYL
120405297YP_955126.1 hypothetical protein Mvan_4343 [Mycobacterium vanbaalenii PYR-1]MDRDTVWHHIDNQRLELADLIDEIDARDRALWDTPSLCAGWTVRNVAAHL
THSTIGMPRMFFEAARSGFRFNAVVNRMAVSDDRSPAQIAANLRAVVGSR
RHPPGTTERDPLTDVLVHTQDICVPLGIDRPMPVDAAVAAAERVWNADFP
FHARKRLAGTRLVATDADFTVGEGREVAAPISALLMLLTGRE
120405296YP_955125.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSMSVGTVPNSAGSNSAASARAEPGSVRDRLIDAAEQCLTAKGIRATTVS
EVAEVAGVSRGWLYRHFPDKAELLGAAIVRLNDAFWSESRTRLDAVAGLD
QQIAVGVELARKESETPGALVLKLRQEEPEAFTACVGLGVRGLIPEIAAF
WVPYIQAAVDRGEIHPDTNSAEAAEWIARIMMSLATVPGEQCNVDDHDSV
LRHARRYIVAALRSDPNQ
120405295YP_955124.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MAETVQQLLRERLDSDGIALKYEGSTWTWREHLGEAAMQAAALIGAADPE
RPLHVGVLLGNNPDMLTAMAAAGLGGYVLCGINNTRRGDALARDIRRADC
QFLITDDAHRHLLDGLDLSGVRVLVVGTPEWKELTGRAGTLTPHREVTAT
DTYMLIFTSGTSGDPKAVKMMHAMVLLAGAALMGRYELTSDDVCYLSMPL
FHSNAVLAGWSVAVNSGAAMAPAQFSASRFVDDIRRYGATYMNYVGKPLA
YILAGPERPDDADNPLRVAFGNEASDRDIAEFARRFGCQVWDGFGSTENA
VTVTREDGCPPGSIGKGFPGVAIYDAETLTECAVAEFDEHGALANADDAI
GELVNTQGAGMFAGYYNDQGATDERMRHGMFWSGDLAYRDADGWIYLAGR
TADWMRVDGENMTSAPIERILIRLPAISMAAVYPVPDEFVGDQVMAALVL
QDEATLTPDEFARFLAAQPDLSPKAWPRHVWIADALPSTATNKVLKRELV
AMGVEPAGRTLWRRDGGTYRTVSAQE
120405294YP_955123.1 50S ribosomal protein L31 [Mycobacterium vanbaalenii PYR-1]MKSGIHPDYVETTVLCGCGASFTTRSTKQSGQITVEVCSQCHPFYTGKQK
ILDSGGRVARFEKRYGKRKTTADK
120405293YP_955122.1 peptide chain release factor 1 [Mycobacterium vanbaalenii PYR-1]MTETAPAIEAILAEYGELEQRLADPELHADPAAAKKVGRRFAQISPIVST
YHKLEAARGDLEAARELAADDASFAAEVDELTTKVADLDDRLTDLLAPRD
PHDADDIVLEVKSGEGGEESALFAADLARMYIRYAERHGWTVTMLGETTS
DLGGYKDATLSIAGKGDSADGVWSRLKFEGGVHRVQRVPVTESQGRVHTS
AAGVLVYPEPDEVEQVQIDESDLRIDVYRSSGKGGQGVNTTDSAVRITHL
PTGIVVTCQNERSQLQNKARAMQVLAARLQALAEEQASADASADRASQIR
TVDRSERIRTYNYPENRIADHRINYKSHNLDQVLDGDLDPLFDALAAADK
QARLQNT
120405292YP_955121.1 HemK family modification methylase [Mycobacterium vanbaalenii PYR-1]MIDDAAAVLAAAGVGSPRVDAELLAAHVTGTERGRVAFVQPDDAFAARYR
ELVTARAERVPLQHLTGTAAFGPVTVQVGPGVFVPRPETESVLEWAVAQP
LPARPRIVDLCTGSGALALALAVAFPAAQVTAVDDSEAALDYARGNVADS
SVQLVRADVTAPGLLADLDGSVDLLVANPPYIPAGALLEPEVAQYDPAHA
LFGGADGMSVIGPIVDAAARLLRPGGRCAVEHDDTTSEQTVAAFTRDGGF
VDVTARHDLAGRPRFVTAVRAG
120405291YP_955120.1 Sua5/YciO/YrdC/YwlC family protein [Mycobacterium vanbaalenii PYR-1]MTETFDCTDPEQRDTGIASAISALKGGRLVVMPTDTVYGIGADAFDGEAV
AALLAAKGRGRNMPVPVLVGSWHTIQGLVYSVPNSAKELIRAFWPGALSL
VVRQAPSLQWDLGDANGTVMLRMPLHPVAIELLREVGPMAVSSANISGRP
PAVTAAQAREQLGDLVEVYLDGGPAEQQAASTIVDLTGAHPRVLREGPVT
LDAIADVLGVDAATLTAQPD
120405290YP_955119.1 glycosyl transferase family protein [Mycobacterium vanbaalenii PYR-1]MHLASATMTIAQAGESVMALSDRGAGVPLRELALVGLTAAIITYLATGWV
RVLATRWGAVAYPRERDVHVAPTPRMGGLAMYLGVVAAVLLASQLPALTR
GFVYSSGMPAVVVAGGLIMVVGLIDDRWGLDALTKFAGQITAASVLVTMG
VAWSVLYIPIGGVGTIVLDQVASILLTLALTVAIVNAMNFVDGLDGLAAG
LGLITASAICIFSVGLLRDHGGDVLFYPPAVISVVLAGVCLGFLPHNFHK
ARIFMGDSGSMLIGLMLAAASTTAAGPISQTAYGARDVFALLSPFLLVVA
VMFVPALDMLLAIIRRTRKGLSPFSPDKMHLHHRLLEIGHSHRRVVLLIY
LWVGIAALGAASSIFFDPRRTAAVMGGAILIAIVVTLIPLLRRGNSAAAE
VYDEK
120405289YP_955118.1 hypothetical protein Mvan_4335 [Mycobacterium vanbaalenii PYR-1]MTTPAQDAPLVFPSVAFRPVRLLIVCVALTALALLASGLTGNIFFGAFFG
LGLGLGLVNALLVRRAVEAITAEDHPLKKKMAVNSATRLLVITAVALTVA
FVFREHGGIAVLFGLAIFQALLVMSTSIPVLRKIRSDGLNVLDTDSKD
120405288YP_955117.1 F0F1 ATP synthase subunit A [Mycobacterium vanbaalenii PYR-1]MTESILAAEEGGPAIHVGHHTLVFEMFGMTFNGDTILATAITAVIVIGLA
FYLKSKVTSTGVPGGVQLFWEALTIQMRGQIEQAIGMKVAPFVLPLAVAI
FVFILISNWLAVLPLQYGGSDGAAGELYKPPASDINFVLALALFVFICYH
AAGIWRRGIVGHPIKVVKGHVAFLAPINIVEELAKPISLALRLFGNIFAG
GILVALIAMFPWYVQWLPNAIWKTFDLFVGLIQAFIFSLLTILYFSQSME
LDHEDH
120405287YP_955116.1 F0F1 ATP synthase subunit C [Mycobacterium vanbaalenii PYR-1]MEIDPNAIITAGALIGGGLIMGGGAIGAGIGDGIAGNALIAGIARQPEAQ
GRLFTPFFITVGLVEAAYFINLAFMALFVFATPGLQ
120405286YP_955115.1 F0F1 ATP synthase subunit B [Mycobacterium vanbaalenii PYR-1]MGELTTSIVAAEEGGGTSNFLIPNGTFFVVLLIFLIVLGVIAKWVVPPVS
KVLAEREAMLAKTAADNRKSAEQVAAAQADYDKTMADARGEASSIRDEAR
VAGRQVVDEKRAVASGEVAETVKSADQQLSQQGSAAQSELQSSVDGLSAT
LASRILGVDVNSGGSR
120405285YP_955114.1 F0F1 ATP synthase subunit delta [Mycobacterium vanbaalenii PYR-1]MSIFIGQLIGFAVIVFILVKWVVPPIKGLMQKQQEAVRVALAESAEAGKK
LADADAMHAKAVEDAKAAGAKVTEEAQQDSQRITAQLAEQADAEAERIKA
QGAQQVQLMRQQLIRQLRSGLGSESVQKAEEIVRNYVSDPAAQASTVDRF
LDELDAMAPSSAVLEAGASLNLRAASREALAELVKKFESVAESADTAALA
TLADNLSAVARLLLTSATLDKHLAEPTGDSAAKVRLLERLFGGKVDDNTM
DLLKTAVAQRWSTEGNLIDAVEHVARLALLVRAEREGQSEEVEDQLFRFG
RVLDAQSQLSRLLADPVIPADKRVALLKKVLDSGGGVNPIAEALLTQTVE
LIRGASADDAVNDLAELAVARRGEAVAQVTAAADLSDAQRTRLTEVLSRI
YGTPVSIQLEVDPEVLGGLLITVGDEVIDGSISSRLAAARTGLPD
120405284YP_955113.1 F0F1 ATP synthase subunit alpha [Mycobacterium vanbaalenii PYR-1]MAELTISASDIEGAIEDYVSSFTADSGREEIGVVIDAGDGIAHVEGLPSV
MTQELLEFPGGVLGVALNLDEHSVGAVILGEFEKIEQGQQVKRTGEVLSV
PVGDAFLGRVINPLGQPIDGQGDIEAEGRRALELQAPSVVQRQGVSEPLQ
TGIKAIDSMTPIGRGQRQLIIGDRKTGKTAVCVDTILNQREAWATGDPKQ
QVRCVYVAIGQKGTTIASVKRALEEGGAMECTTIVAAPASDAAGFKWLAP
YTGSAIGQHWMYDGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD
VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITD
GQCFLESDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLELSQY
RELEAFAAFASDLDAASKAQLDRGARLVELLKQPQYTPYPVEDQVVAIYL
GTGGHLDSVPVEDVARFESELLEHVKASHGDILAGIRESKKLSEEAEQKL
ANVINEFKKGFSASDGSSVVVNEAEAEAMDEADVEKESVKVRKPAPKK
120405283YP_955112.1 F0F1 ATP synthase subunit gamma [Mycobacterium vanbaalenii PYR-1]MAATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYSAEI
TSMLTELASASALDHPLLVARENPRRAAVLVVSSDRGLCGAYNANVLRQA
EELFSLLREEGKEPVLYTVGRKALGYFSFRQREVVESWAGFSERPTYENA
REIADTLVTAFMSGADDEGDDAGADGILGVDELHIVFTEFKSMLSQSAAA
RRIAPMVVEYVGDEQPEEGPQTLFSFEPDPETLFDALLPRYVATRVYAAL
LEAAASESASRRRAMKSATDNADDLIKALTLAANRERQAQITQEISEIVG
GANALADAK
120405282YP_955111.1 F0F1 ATP synthase subunit beta [Mycobacterium vanbaalenii PYR-1]MTATAEKTAGRVVRITGPVVDVEFPRGSVPELFNALHAEISYKDLSKTLT
LEVAQHLGDNLVRTISMQPTDGLVRGVEVTDTGTSISVPVGDGVKGHVFN
ALGDCLDEPGYGKDFEHWSIHRKPPAFADLEPRTEMLETGLKVVDLLTPY
VRGGKIALFGGAGVGKTVLIQEMINRIARNFGGTSVFAGVGERTREGNDL
WVELADANVLKDTALVFGQMDEPPGTRMRVALSALTMAEFFRDEQGQDVL
LFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGELQERITSTRGK
SITSMQAVYVPADDYTDPAPATTFAHLDATTELSRAVFSKGIFPAVDPLA
SSSTILDPAVVGDEHYRVAQEVIRILQRYKDLQDIIAILGIDELAEEDKQ
LVQRARRIERFLSQNMMAAEQFTGQPGSTVPLKETIEAFDKLTKGDFDHL
PEQAFFLIGGLDDLAKKAESLGAKL
120405281YP_955110.1 F0F1 ATP synthase subunit epsilon [Mycobacterium vanbaalenii PYR-1]MAELHVEIVAVERELWSGDATFVFTRTTAGEIGILPRHIPLVAQLVDDAM
VRVEREGEDDLRIAVDGGFLSVTEEAVRILVENAELESEIDADAAKQDSE
SDDERTAAWGRARLRALGQLD
120405280YP_955109.1 hypothetical protein Mvan_4326 [Mycobacterium vanbaalenii PYR-1]MVALVGVLLLVVVALSYRLWKLRQVGGTAAILRDVPAVAGHGWRHGVMRY
RGGEAGFYRLSSLRWWPDRTLTRRGLEVVSRRAPRGDEFDIMTDEIVVLE
LRDTGPERGRGYEIALDRGALTAFTSWLESRPSPRARRRSY
120405279YP_955108.1 ATP--cobalamin adenosyltransferase [Mycobacterium vanbaalenii PYR-1]MAVHLTRIYTRTGDDGTTGLSDFSRVSKNDARLAAYADCDEANAAIGVAV
ALGSPGEQILPVLRQIQNDLFDAGADLSTPVVENPEYPPLRIGQSYIDRL
EKWCDEFNEPLPALNSFILPGGTPLSALLHVARTVTRRAERSAWHAVEAH
GDSVSMLPARYLNRLSDLLFILSRVANPDGDVLWKPGAQGQ
120405278YP_955107.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Mycobacterium vanbaMSERFVVTGGGRLSGEVAVGGAKNSVLKLMAAALLAEGTSTITNCPDILD
VPLMAEVLRGLGATVELDGDVVRITSPDEPKYDADFAAVRQFRASVCVLG
PLVGRCKKAKVALPGGDAIGSRPLDMHQAGLRQLGARCNIEHGCVVAEAD
HLRGAEIQLEFPSVGATENILMAAVLAEGVTTIHNAAREPDVVDLCTMLN
QMGAQVTGAGSSTLTITGVDRLYPTEHRVIGDRIVAATWGIAAAMTRGDI
SVTGVDPAHLQLVLHKLHDAGATVTQTDDGFRVVQYERPKAVNVATLPFP
GFPTDLQPMAIGLAAVADGTSMITENVFEARFRFVEEMIRLGADARTDGH
HAVVRGIPQLSSAPVWSSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYP
KFVENLVSLGAEIERVN
120405277YP_955106.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium vanbMDNMRYRTMDSPVGLLTLAGSTGRLQHLRMVDQTYEPDRAGWEKDDSAFP
EAVMQLQEYFRGERREFDLDLELAGTAFQRRVWEALLTIPYGETRSYGQI
AQQIDAPGAFRAVGLANGHNPIGIVVPCHRVIGANGSLTGYGGGLDRKKM
LLGMERKNSPTIPTLFD
120405276YP_955105.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MHTDFDRCYRAVQSKDARFDGWFVTAVLTTRIYCRPSCPVRPPYARNMRF
YPTAAAAQRAGFRACKRCRPDASPGSPEWNVRGDVVARAMRLITDGTVDR
EGVTGLAARVGYTVRQLERLMQAEVGATPLALARAQRTQMARTLIETTEM
PFSDVAFAAGFSSIRQFNETIRTVCALTPSMLRTRARARFGRDHTAGAGV
MSLRLPVRAPFAFEGLFGHLAASAVPGVEEVRDGAYRRTLRLPRGNGIVS
LTPHPDHVRCHLVVDDFRDLAAAIARCRRLLDLDADPEAVVDALSADDRL
AALVAKAPGQRIPRCVDEHELALRVVLGQQVSMAAARTHAGRVAAAYGQS
VDDPEGQLTHVFPSVAELSEIDPRHLAFPKARQRSLGALVTALAEGTVVL
DPGCDWNAARERLLALPGIGPWSAEMIAMRGLGDPDAFPVTDLGVITAAE
QTGLPTAPRLLADHSDRWRPWRSYATQHLWTALDHSVNQWPPREK
120405275YP_955104.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAERWTKERRTEHTRQILLDAAEEVFARKGLTGAALEEIAEAAGFTRGAI
YSQFGAKEKLFLAVVDRQRQRFLDGFADVMMSFHRLSDVDIDELAERWRQ
LSSGPDRAALGHELTLYLLRNPEARESVAGQRRETVRALGEFISKNVARI
GGTLTIEAETLARVVLAANDGITLNSHLDGEDLYRPYLQLVISSVQTPP
120405274YP_955103.1 hypothetical protein Mvan_4320 [Mycobacterium vanbaalenii PYR-1]MGYRVDVITDSVSEAVRHAGGLMFDRSRAGWDVVVLTDDPDNSRALAILG
ARTQGPGQLDDRFHRREREIRTVVTAIGGFGAEGTSAAVPGLEPHAQLLL
WGQQVDDELARVLQPVRHRLGAAALSFKTHALHAIGVATTVEECEHFWAD
PTHGADRTAARSPTAMGG
120405273YP_955102.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMPATRPGEWLDPASGLGLGLDDVQPGTFNMTISTDRYTCPDYAARERGSI
WMRTWQIAGRVEDLPKPGDWKKYEILDQSFIIVRGKDDVLRGFVNACRHR
GNALCTTDTGNAKRGFLCQYHLWSYDLEGKLKGLLRENLAGPIDKTENSL
LQVSVDTFAGFIFLNPDPDAAPLREYLGEDVVSLLEPYNIEQFTTVMDVT
EAIECNWKVVMDAFEEGYHINGIHPQLLQVLHINPKTARYRFFENHSVAM
APFEVVGAGVQDQVAGILALPETFPGTVAVIPRFQELIAPYQDSDGNVAF
PDGVTARALLQQATREVLTGMGLDVSRLTDDQMVDNQGWVLFPNYFMTVR
AGECHVIMSVPHPDGDPNRCIWHVASYMYVPQDFRDAVRAEALVVDTPGS
YKYFEALQQDYEQMPRQQKGLRNDRLDHMSLVKEEVVIAHYHSVVDRHLA
DSVTADTARSTSSVKESRD
120405272YP_955101.1 hypothetical protein Mvan_4318 [Mycobacterium vanbaalenii PYR-1]MTTIDDVIGEATGRSRAVLEYSQTMSRLVKSAKEPGFSVHSWAPLGELVA
IDDFVRIGPFKEVQNWAEYTEFLTAWATSSDWECSFKRISEAGDVVFLEL
EERSRIGDFSSVVNSASVYEFDADNKIRYIAVYLQMQLPDPAALPNFQNA
GDAQ
120405271YP_955100.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTEQLTPTDIDEVDFFTDNTVLHDPYGYLAAMRNECPVRRERHHDVVMIT
GYEEAVAVYNDNARFSSCTAVTGPFPGFPVPLVGDDVSGLIAEHRDKLPF
NDQLPTLDPPLHTDHRALLSRMITPKRLKENEEFMWRLADRQYDEALAGG
RCEFVGEFGNPFAMLVIADLLGVPESDHNDFKDQLLTSTGTIGSSGGDAM
HHSPLEYLYGKFTDYITDRRENPRDDVLTGLASALFPDGRTPPVIDVVCV
AANLFAAGQETTVRLLSTAVMMIAEDPALQAKLRADRSLIPGFVEEALRF
ESPIRGDFRLSKVPVSVGGVELPAGTTVMLNNAAANRDPRRFTDPDTFDL
QRPNARQHIAFGRGAHSCPGAPLARAEAKVSINRLLDRTSDIWIDEDKHG
PVDARRYKYLPTFILRGLTRLHIEFS
120405270YP_955099.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MPFEPRPSHPRQRRTQHMNSTDGAESLLAPLTAAEWGDDEYAAFGALLGL
PGEKVPRAGSGHAADPLKFDIIGLLARHPKMARRFLTFNGWLLQCGELPL
RLRELAILRIAHTRRSAFFWGEHTKVATEGGVPEADIARLAEGNEAFTGA
DRLVLDATDELLHDGHAEPATWHRLTDELGTHQAMELIFVVGTYAMLAMA
FDTWRLPPPAGSASLPEPPAGVPPGGGTH
120405269YP_955098.1 LysR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MDIDFTRLRYFVAVADELHFKRAADKLMITPPPLSKQIKLLEKELGGPLF
ERGYHDVRLTPLGQRLVGPAREILRQVEEFKAVATQAVRGLAPVRVSATA
YAPSDLLGELEAAIASLPVPTEFSVPGSAAEVTAKLIAGQAELGLIHLPA
NDKRLRYKVVASYQGGIAVRFDDPLAAKDLVSIEELRDREVAIDVARPNP
VVLAGLTRGLNRKGVHRIVRTTNQRGGEVEMATQVFNRHLVAVVSYAPDS
FIGKIFSPPEFKLIPLDESTWAPAEIALAWVPERVQARLTEVELMVEQIA
DRLGPVHRGA
120405268YP_955097.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMSSPAADGSAYDPPLAGVQILDLSSGPMTAVGRLFADLGAHVTALHLRGV
TGDEPVGPHVDSVAVGSAINRHGMDTVEIDPGTPTGRQRFAELVAGADIL
IENTRPGSPAETALSIREIRDQHPALVILSISDFGRDTDYRNWQASGPVF
HALTSELSRSGIPGREPLIPPADLPYQVAAAQAAVMTLSLFLDRLRTGEG
DLIDFSVLDGAMQTLDPPFGTAGSASAGVAVSAQQRDWNAERQRYPIIPC
KDGHVRICILSRRQWHGMFALMGSPEEFADPSYDKLGKRFRSPHLLEAIE
RFCADKTRAELEAAGQAHGVPTAALLTLAEALNADHFTARGFFRDVELAP
GVVAPVPVGVSEVDGHRASALQSAARSSEIDRLDTAPLLANRRRAGQGLP
LEGIRVLDLGVIVVGADTARLFGDLGADVVKIEHSAHPDGLRVGKLTSMT
QPFAAGHRNKRSIGIDLRSDEGRRLAHRLVEQSDVVLTNFKPGVADALGM
DYATLRQVNPNIVVVDSSAFGPTGPWAKRLGYGPLVRAAVGFTDLWVYPG
EAETYCDTVTVYPDHVAARIGALAAMALLLRRERTGAGGSASISQAEVML
SHLAADIAADALLRSGHTHTGASRPDAPWGLFPAQGDDRWVAITVRDDAD
RRALGEVVGFTGADRQLFDDAVRAWTTQRSHLEAMEQLQAAGVPAGAVLH
ADEIPGWGYYEQRRAFREELHPYGSAPFMMENVQIHCDHVADPPLGQAPL
LGEQTVEIAAELLGLDPAQIDDLHRRGVLETPEVETATQS
120405267YP_955096.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTTPSLPSADELGAEVRDWLRDNWTPLPKNTDPWASSPERIAWLEKVLDA
GYAVPTYPAEWFGRGYPNKLANVIGQEFAAIKAPGSRQDKYNIPANTVLA
LGTGKLREDLLRDFLVERARTCLLYSEPGAGSDLASVRTTAVRQGDHWVV
NGQKVWTSGAQTADYALLLARTDWDVPKHKGLSLFIMPMNQAGIEVRPLV
QITGESHFNEVFISDATVSDDYLLGGEGNGWRALQTALAYERSIMGDSGR
GSRNRKADSLIDLAREHGVLDDSAVRHQLASVLAMRELNRLNNARAKAST
TQGTSSSIMSLGKLAMSRILHTEAAMKTQIIGAEALLAGPDNPVADDVNF
LALNAFFTSIGGGTDQIQRNIIGERVLGLPKEPEADRDIPFRQARRS
120405266YP_955095.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTISVAERAELRTAVGELLAERCTESDVRRVMTSDEGFDRDLWRQLANQG
VLGMLVDGEYGGLGFGALELEAVAEETGTAALPAPFISSAVLTVALINAA
GSDEDKQRLLPALADGTAIGTVALTGKSGSWTPEGVDVQAAADGTLTGSA
HYVTWGQVADVVLVVARTDDGFGVFEVSVGADGFERSAATVFDPTVRLST
FSFAGTPARRLGTAGWDAAKEALDHAVIASAGEQVGGARRIFDMTVDYLK
TRIQFGRQIGSFQALKHMAADLLIEVENATSAAQHAASEKAGNSENADGA
VALAGFACAEAYETIAMNAIQMHGGIGFTWEHPAHIFLRRARTGLHLFGG
PRLHRERYLVSKGA
120405265YP_955094.1 hypothetical protein Mvan_4311 [Mycobacterium vanbaalenii PYR-1]MSDPTPAIAGLGITEQGKVYGRTARQFAAQAVRLAAADAGIEMADIDGLI
VSGGIKARIGINLQNALGLVDLKLLTEMQGFGSTAAQMVQYASMAVQSGM
ASTIAIVWADAPLKEKSRSSAAYSGGGRSLPRGFDGITASNGIMSPTTMY
ALAARRHMQKYGTTSDQLGHIAVAQRAWAQLNPIAQFCGTPLTLQEYHDS
RYIAEPFHLYDCCLVSNGGVAVIVTSLERARALRQPPVRVLGWAQAHPGR
AGIRNDDFGLVSGAAQSGPDALKMANTSLDEVGVAQIYDCYTFTALLTLE
DYGFVPKGEGGPAMAEPGMIGPGGRIKFNTGGGELSSFYMWGMTPLHEAV
VQARGQGGERQVDDHDRVLVSGNGGILDYHSTLVLGTDN
120405264YP_955093.1 hypothetical protein Mvan_4310 [Mycobacterium vanbaalenii PYR-1]MPVFPIERDSASAEFLDGTKRGEFLLVRDTETGEILSPQFDVSVQPDRYT
RVPAAGTGTVVSWSVVHQRGLDGAVHRLPVGIVELDEGPWWWTSFPGADP
AADLFGARVKVAFEVLGEAEAAEAIPFFELV
120405263YP_955092.1 putative adenylate/guanylate cyclase [Mycobacterium vanbaalenii PYR-1]MNATKSVPYRLGRVLERVTRQSGRLETPDYGSWLLGKPEESQARRRIRIQ
VILTFLLLFTNILGIAVSLLLNTVAIPVPSVFSDAPAWLTFGVVPAYMVV
ALVLGTAWITSRTVGSLRWAIEERSPTRTDQRNVFVAPSRVAQMLLLFWG
FGAALLTLLYGLQDSAFIPRFLFAVGFPGIVVATACYMITEFALRPVAAQ
ALEAGRPPRRLAHGVMGRTMTVWLLSSGVPVLGILLLAIFTLSLRNLSAT
QFAVAVMIISVVALMFGLILMWLLSWLIATPVRVVRSALKHVEDGDLDCN
VVVFDGTELGELQRGFNSMVHGLRERERVRDLFGRHVGREVARAAEKQKI
ELGGEERHAAVIFVDIIGSTQLVTSRPAVEVVELLNRFFDVVVEEVDNHH
GLVNKFEGDAVLAVFGAPVSLDSAETEALSAARAMARRLRTEVPECPAGI
GVAAGQVVAGNVGAKQRFEYTVIGEPVNEAARLCELAKNVPALLVASADA
VGGATESERALWKLGETVTLRGHDQPTRLATPAGEL
120405262YP_955091.1 hypothetical protein Mvan_4308 [Mycobacterium vanbaalenii PYR-1]MRLVIAQCTVDYVGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWM
SPPCWIVEPTDGDATVWVVENKAGEQLRITVEAIEHDSSHELGVDPGLVK
DGVEAHLQALLAEHVELLGAGYTLVRREYMTPIGPVDLLCRDEQGRSVAV
EIKRRGEIDGVEQLTRYLELLNRDSLLAPVAGVFAAQQIKPQARTLATDR
GIRCLTLDYDKMRGMDNDEFRLF
120405261YP_955090.1 hypothetical protein Mvan_4307 [Mycobacterium vanbaalenii PYR-1]MAKRRVPRRREPVGDPLPAPRRIETGADGYDYEVRPVAAARATKIYRCPG
CDHEIRPATSHLVVWPADSSGGIDDRRHWHTSCWAHRERRGPTRRWS
120405260YP_955089.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium vanMTAEQTDARPVLATALVTAIDHVGIAVPDLDAAIKWYHDHLGMIVLHEEV
NEEQGVREAMLTVRGAAVGSAQIQLMSPLDETSTIAKFIDKRGPGLQQLA
YRTSDIDALSERLREQGVRLLYDTPRRGTADSRINFVHPKDAGGVLIELV
EPAKDSGEGSH
120405259YP_955088.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MTTSVIVAGARTPVGKLMGSLKDFSGSDLGGVAIAGALEKAFPNIENPAR
LVEYVIMGQVLTAGAGQMPARQAAVAGGIPWDVASLTINKMCLSGIDAIA
LADQLIRAGEFDVVVAGGQESMTQAPHLLMNSRSGYKYGDVTVLDHLAYD
GLHDAFTDQPMGALTEQRNDVDQFTRAQQDEVAATSHQKAARAWKDGVFA
DEVVPVRIPQRKGDPIEFTEDEGIRADTTAESLGGLKPAFRKDGTITAGS
ASQISDGACAVVVMNKAKAEELGLTWLCEIGAHGVVAGPDSTLQSQPANA
IKKAAEKEGISLDQLDVLEINEAFAAVALASTKELGVDPEKVNVNGGAIA
IGHPIGMSGARITLHAALELARRGGKYAVAALCGAGGQGDALILRRP
120405258YP_955087.1 hypothetical protein Mvan_4304 [Mycobacterium vanbaalenii PYR-1]MTVMTSAYDLRTPAGWFRVIAFAEAVSWVGLLLGMYFKYLGSPRTEVGVK
VFGPVHGGVFVAFVVAALVVGLAVRWSVGTWLLALLASIVPLGSVMFLIW
ADRTGRMGSEAVVAGLGRPGPPVPETT
120405257YP_955086.1 thioredoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1MTRPGPRISPALAGAVDLSALKQRASAGGGAPAGNPGGVEVTEANLEAEV
LVRSTEVPVVVLLWSPRSDSSVQLGDALAALSAADGAKWTFATVNVDTTP
RVAQMFGVQAVPTVVALAAGRPLSSFEGIQPPEQLRRWIDSLLNAVAGKL
GGTGEDEQAEAVDPEVEQARAHLDAGDFEAAQSAYQAILDANPNHDEAKG
AVRQIGFLQRATAHPRDAIAVADASPNDIDAAFAAADVEILQQDVQAAFT
RLTALVKRTAGDDRTKVRTRLIELFDLFDPADPEVVAGRRNLANALY
120405256YP_955085.1 glycogen branching protein [Mycobacterium vanbaalenii PYR-1]MTNVSNLNNQVDSPHLRPHTADLNRLLAGEHHDPHAILGAHEYDDHTVIR
AYRPHAVAVVAVVGKNRYPLRHIEAGLFAVAVPFTNLIDYRFEIRYSEDE
SAFVHTVADAYRFLPTLGEVDLHLFAEGRHERLWEILGAHPRSFTTSDGV
VNGVSFAVWAPNAKGVSVTGDFNHWGNEAQMRVLGSTGVWELFWPNFPDG
GLYKFRVHGADGSVTDRADPMAFATEVPPQTASRVFRSDYTWSDQEWMSG
RALRNPVFEPMSTYEVHLGSWRPGLSYIELAEQLTDYVVEHGFTHVEMLP
VAEHPFGGSWGYQVTSYYAPSSRFGTPDEFRYLVDALHRAGIGVIVDWVP
AHFPKDAWALGRFDGTALYEHGDPRRGEQLDWGTYVFDFGRSEVRNFLVA
NALYWLQEYHIDGLRVDAVASMLYLDYSRPEGGWSPNIYGGRENLEAVQF
LQEMNATVHKINPGIVTIAEESTSWPGVTRPTNLGGLGFSMKWNMGWMND
TLEFIKRDPIHRSYHHHEMTFSLLYAFSENFVLPISHDEVVHGKGTLWGR
MPGNDHMKAAGIRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGVDWFQ
LDEQGFSGGILRMMTDANEIYRSRRALWSRDTQPEGYSWIDANDSANNVL
SFLRFGDDGSMMACVFNFSGSEHTRYRLGLPHAGRWREVLNTDSDTYHGT
GIGNYGAVEATDEPWHGRPASAVMVLPPLSALWFEPE
120405255YP_955084.1 alpha amylase [Mycobacterium vanbaalenii PYR-1]MTAGRIEIDDVQPVVSEGRFPAKAVIGEIVPVTATVWREGHDAVSATLVV
RYHGTGYPPLADEPPGRVRPTEAVPIQEVVKPGQRIRPVALPMSLGRTPD
VFHGQFSPDEVGLWTFRVDGWGDPIATWRRHVIAKLDAGQSEGELDNDLL
IGARLLDRAATGVPRQDRYPLAEAAARLREPGDPFYRAGAALAPEITALL
DQYPLRELITRGRQYGVWVDRPLARFSSWYEFFPRSTGGWDSAGHPVHGT
FATATKALPRVARMNFDIVYLPPIHPIGKVHRKGRNNSVTAAPGDVGSPW
AIGSDEGGHDAVHPDLGTIDDFDDFVSAARDEGLEVALDLALQCAPDHPW
AREHPEWFTVLPDGTIAYAENPPKKYQDIYPLNFDNDPTGLYEEVLRVVK
FWVSHGVKVFRVDNPHTKPPNFWAWLIGEVKNTDPDVLFLAEAFTRPARL
FGLAKLGYTQSYTYFTWRTAKWELTEFGQSIADHADYCRQSLWVNTPDIL
HESLQHGGPGMFAIRAVLASTMSPTWGMYSGYELFEHRAVREGSEEYLHS
EKYELRPRDFDAALSDGESLEPFITRLNEIRRVHPALQQLRTITFHHIDN
DALLAYSKFDPVSGDQVLVVVTLNAFGPEEGILWLDMGALGMEQQDRFWV
RDEISGDEYQWGQSNYVRLDPARAVAHVLNMPQVPADQRANLLRRE
120405254YP_955083.1 alpha-glucan phosphorylase [Mycobacterium vanbaalenii PYR-1]MKALRRFTVRAHLPAQLAALERLSVNLRWSWDKPTQDLFAAIDAALWEQV
GGDPAALLGQVGPGRLEELAADDSFVRRLDAIAADLDDYLTRPLWYQQLG
GEQSGAGDEAGLPKGIAYFSMEFGVAAVLPNYSGGLGILAGDHLKSASDL
GLPLIAVGLHYRSGYFRQSLSADGWQHENYPSLDPQGLPLRLLTDASDNA
VLVELALPDGAQLFARIWIAQVGRIPLLLLDSDIPENEHDLRSVTDRLYG
GDQEHRIRQEILAGVGGVRAIRAFTELEGLHAPEVFHMNEGHAGFLGAER
IRELIEAGLDFDTALSVVRASTVFTTHTPVAAGIDRFPVDMVERYFGPDP
GDPSVGGSRLLPGVPLDRILAFGAEDDPTKFNMAHMGLRLAQRANGVSLL
HGRVSRSMFNELWDGFDPAEVPIGSITNGVHAPTWAAPQWMELGRELIGS
DDLTSLRETEAWSGLREVDPGHLWWIRCQLREELIEDVRARVRRSWLERG
AADAELGWTATAFDPGVLTIGFARRVPTYKRLTLMLRDPDRLARLLLDEE
RPIQLIVAGKSHPADEGGKALIQQIVRFADREDVRHRIAFLPDYDMSMAR
KLYHGCDVWLNNPLRPLEACGTSGMKSALNGGLNLSIRDGWWDEWYDGEN
GWEIPTADGLTDEGRRDDLEAAALYDLLERAVAPKFYDRDDNGVPIRWVE
MVRHTLQALGPKVLASRMVREYTQKYYLPAAQALRLVIEPGRSDTAEFAV
PFGAARELAEYRRRAERAWPQIKIADVDSYGLPDTPLLGSELTLTAQVDL
GGLGPDEVVVQAVLGRVDAGDALFDPDTVAMTHTGTAESGHEIFTATMPL
PITGSVGYTVRVLPHHRLLAGDNELGLITLA
120405253YP_955082.1 LpqM [Mycobacterium vanbaalenii PYR-1]MSPSRRPGTRIGVAAAVCAVLAATACSTTLQGNAVSVFDDPFRVAGMPAT
DGPTGVRPNAEPPARDVEGTDGGAIDELAASAISDIEDYWAVAYEETFDE
KFRPVAELISWDANGFDGEFCGEDTYGLINAGYCYPDRTIGWDRGELLPG
LQRAHGDMGVVMVLAHEYGHAISRLAGLTKKDTPTLVAEQQADCFGGAYM
RWVAEDSSARFTLSTGEGLNNVLAGVISFRDPLLAENDPDVGFDEHGTAF
ERLSAFQFGFTDGPSACAAIDPAEIDQRRGELPVLLPEDQTGELPVTEDS
TRSIIDAMGILFSPKNPPALSFDADEAESCADARPSPPASFCPATNTIVV
DLPALEEMGAQADPQDGGSLATGDNMAYSVLVSRYMLAIQQEHGGAALDT
AEAALRTACLTGVATVKMTEDVTTPDGDTIALTAGDIDEAVSGILTNGLV
ASDVNGASVPSGFSRIDAFRLGVLSDTERCFKRFP
120405252YP_955081.1 DEAD/DEAH box helicase [Mycobacterium vanbaalenii PYR-1]MEVADLLATAVEALGGASRDGQIAMAEAVAQAFTSGRHLAVQAGTGTGKS
LAYLVPAIAHALDESRPVVVSTATIALQRQLVDRDLPRLADSLADVLPRR
PTFALLKGRGNYLCLNKIHNGSAGSEPDDVPQEELFSPVASSALGRDVQR
LTEWSETTATGDRDELKPGVADRSWSQVSVSARECIGVSRCPFGTDCFSE
RARGRAGDADIVVTNHALLAIDAIGDANVLPEHDLLVVDEAHELVDRVTG
VATAELSATSLGVAHRRAARIVAPELAERLEAATATFSAAIFEARPGRID
VLDEELASYLAALRDAAHAARTAVDTAPNDPKTTSARAEAATALSEVGDT
ASRILDSFVPAIPDRTDVVWLDHIEDARSGSRALLRVAPLSVAGLLRSRL
FGHTTAVLTSATLTIGGNFDSMASAWGLTGAADREQDRTGEGAGWRGLDV
GSPFDHAKSGILYVAAHLPPPGRDGTGSAEQLDEIAGLIEAADGRTLGLF
SSMRAAKAAAEVMRERLATPVLCQGEDTTSALVQRFADDEQTSLFGTLSL
WQGVDVPGPSLSLVLIDRIPFPRPDDPLLTARQRAVAARGGNGFMAVAAS
HAALLLAQGAGRLLRRVDDRGVVAVLDSRMATARYSGFLRASLPPFWATT
DGAAVRAALQRLRAPN
120405251YP_955080.1 nicotinate phosphoribosyltransferase [Mycobacterium vanbaalenii PYR-1]MTPSSPDLSDMSGLSGLSMAMLTDKYELTMLAAALRDGTAHRRATFEVFA
RRLPDGRRYGVTAGTARFVEALQAFRFDDAELTALDGFLDSATLGYLADY
RFTGDVDGYGEGELYFPGSPVLSVHGTFGECVLLETLALSIFNHDTAVAS
AAARMVSAAAGRPLIEMGSRRTHEQAAVAAARAAYLAGFTGSSNLEAERR
HGVPALGTSAHAFTLLHTTDGGTPSDWEKSAFRAQVDVLGVGTTLLVDTY
DITAGVANAVEVAGTRLGAVRIDSGDLGVLARQVRDQLDGLGATQTRIVV
SGDLDEFSIAALRAEPVDVYGVGTSVVTGSGAPTAGMVYKLVEVDGIPVE
KRSSHKESHGGRKQASRLAKKSGTIVEEVVYPAGDPPPHPADLEARTLTV
PLMRAGEPVADIGLAAARTRVGDGLLSLPWDGLSLSRGDAAVPTRMVAPR
RGRV
120405250YP_955079.1 ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium vanbaalMVTPAKARPGTREDRDVREDATTDAPWVTIVWDDPVNLMTYVTYVFQKLF
GYSEPHATKLMMQVHNEGKAVVSAGSRESMEVDVTRLHAAGLWATLQQDR
120405249YP_955078.1 hypothetical protein Mvan_4295 [Mycobacterium vanbaalenii PYR-1]MRKWKRVEGAGGPRFRSALAAHEAELLSSLVTSLLGMLDDREASAPVDEL
AEITGMRTGNSVPPQDDTLKRLLPDFYRPATEHPAGSGTAESLNSALRSL
HEPAILDAKREAAQRLLDTVPAGGGKFELSEDDAHAWAAAVNDVRLALGT
MLDVGSDGPDHLPGDHPMAGHLDVYQWLTVLQEYLVVCLMGNNR
120405248YP_955077.1 peptidase S58- DmpA [Mycobacterium vanbaalenii PYR-1]MSGSITDVGGIRVGHHHRLDDDAGMGSGWATGTTVVLTPPGTVGAVDGRG
GAPGTRETDLLDPSNSVRHVDAVVLTGGSAFGLAAADGVMTWLEEQNRGV
ALDGGVVPIVPAAVIFDLPVGGWKCRPDADFGYRAAAAAGTDAGIGTVGA
GVGARAGVLKGGVGTASVTLESGVTVGALVVVNSAGDVIDPGSGLPWQAS
HIEEFGLVRPPADELAAYADRHGELGLLNTTIAVVATDAALSKAACRRVA
VAAQDGLARTINPCHTPLDGDTVFALATGAVEVNPDPTTPASMTPELPLV
TAVGAAAAEVLARAVLVGVMAADRVAGIPTYRGLLPGAFE
120405247YP_955076.1 Mov34/MPN/PAD-1 family protein [Mycobacterium vanbaalenii PYR-1]MLTIRADLVDAMVSHARADHPDEACGIIAGPEGSDRPERFIAMVNAERSP
TFYRFDSGEQLKVWREMDHADEAPIVIYHSHTATEAYPSRTDISYASEPD
AHYVLVSTRDPDEHEVRSYRIVDGVVTEEPVTVVDQY
120405246YP_955075.1 hypothetical protein Mvan_4292 [Mycobacterium vanbaalenii PYR-1]MTVQVSIPTILRPHTGGEKRVSASGDTLQAVIADLEANYSGISERLVDNG
KLHRFVNIYVNDEDVRFSGGLDTTIADGDSVTILPAVAGG
120405245YP_955074.1 cysteine synthase [Mycobacterium vanbaalenii PYR-1]MARYNSLLETLGNTPLVGLQRLSPDWDGSPHVRLWAKLEDRNPTGSIKDR
AALRMIEDAEREGRLQPGVTILEPTSGNTGISLAMAALLKGYQMVCVMPE
NTSIERRQLLELYGARIIYSPAEGGSNTAVAYAKEIAAENPSWVMLYQYG
NPSNAAAHYDGTGPELLADLPEITHFVGGLGTTGTLMGTGRFLRERVPGV
QIVAAEPRYGEGVYALRNIDEGFIPELYDPDVLTTRFAVGSYDAVRRTRE
LVHVEGIFAGISTGAILHAALGMAAKAVKAGERADIAFTVCDAGWKYLST
GAYAGSLDDAEDALEGQLWA
120405244YP_955073.1 rhomboid family protein [Mycobacterium vanbaalenii PYR-1]MTGIGGHPGIPAEPKKRPAWMVGGLTVLSFVVLLWVIELFDSLTGHRLDG
NGIRPLETDGLAGILFAPLLHSNWEHLLANTVPALVLGFLMTLAGLSRFI
FATAIVWIVGGVGTWLIGNIGAHCPYVGVRCETNHIGASGLIFGWLAFLI
VFGFFTRKVWEIVVGVVVLFVYGSVLLGVLPGTPGVSWQGHLSGAVAGVL
AAYLLSGPERKARERRKATNPYLTT
120405243YP_955072.1 glutamate racemase [Mycobacterium vanbaalenii PYR-1]MSGPTEPTGMPIGIFDSGVGGLTVARAVIDQLPDEDIIYIGDTGNGPYGP
LTIPEIRAHALAIGDDLAGRGIKALVIACNSASSACLRDARERYAPIPVV
EVILPAVRRAVATTRNGRIGVIGTAATIASGAYQDTFAAARDIEVFGVAC
PRFVDFVERGVTSGRQVLGLAEGYLEPLQRAEVDTLVLGCTHYPMLSGLI
QLVMGDHVTLVSSAEETAKDLLRVLTKRELLKPHPGDPAVRAHRQFEATG
DPEAFTALAARFLGPTLDGVRPVQRHVGTRT
120405242YP_955071.1 beta-lactamase-like protein [Mycobacterium vanbaalenii PYR-1]MGVRITVLGCSGSVVGPDSPASGYLVTAPDTPPLVLDFGGGVLGALQRHA
DPNSVHVLLSHLHADHCLDMPGLFVWRRYHPTPAPERGVVYGPANTWARL
GAASSPEGGEIDDFTDIFEIRHWRDNQAVEIGSLTVVPRLVCHPTESYGM
RITDPSGATLVYSGDTGYCDQLIELARGADVFLCEASWTHSPSRPPRLHL
SGTEAGRAAARAGVSELLLTHIPPWTSREDVISEAKAEFDGPVHAVVCNE
TFEVTRS
120405241YP_955070.1 ribonuclease PH [Mycobacterium vanbaalenii PYR-1]MSRREDGRLDDELRPVTITRGFTTHPAGSVLVEFGQTRVMCTASVTEGVP
RWRKGSGQGWLTAEYAMLPAATHERSGRESVKGRVGGRTQEISRLVGRSL
RACIDLAALGENTIAIDCDVLQADGGTRTAAITGAYVALADAVTYLAAAG
KLSDPRPLSCAIAAVSVGVVDGRIRVDLPYTEDSRAEVDMNVVATDTGTL
VEIQGTGEGATFPRSTLDKMLDAAMAACDQLFEIQRAALELPYPGVLPEP
GEPAKKAFGS
120405240YP_955069.1 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [MycobacteriMLDAAGVSGLTLLSLDDVPPFDEAPETGATFEENAMAKARDAFAATGLPA
VADDSGLEVDALNGMPGVLSARWAGRHGDDAANTALLLGQLGDVPEERRG
AAFVSACALVFGPGEAERVVVRGEWRGSIVREARGDGGFGYDPVFLPTGS
ARTAAELSPAEKDASSHRGRALAALLPSLRALI
120405239YP_955068.1 acyltransferase 3 [Mycobacterium vanbaalenii PYR-1]MSASLGVRCGAAPAGPPDHTSPRDPALTGLRAVAALLVVSTHAAFATGYL
LHGYLGTMYARLEIGVAVFFVLSGFLLFRPWVRAAAAGRRAPSARRYGRQ
RMRRIVPAYVVTVVAVFEIYTVFTPGPNPGQTWQGLLRYLTFTHIYTDDY
LVTLLHPGLSQMWSLAVEASFYVALPALAFLVLQVLCRGRWRPGRALVGI
ALLAAVTPVWLVVVTATDLLPNSAGMWLPAHLAWFAGGMALAVLEAVGAR
CAAIVAIPVAVGLYLAVSTSLGGTLAGPDPAWTPIVKALLYAVIATLAVA
PVALGSRDSYSRVLASRPMVWLGEISYEIFLVHVAVMALTMHLVLGWPLF
TGSMPGLIAATLALTVPVAWLLNRVTRPQIKARSDGSNAASALPRCDEAS
FSAGLSSAAVLAEPVGRNTGS
120405238YP_955067.1 hypothetical protein Mvan_4284 [Mycobacterium vanbaalenii PYR-1]MTAPQSPAPITPVETIRKALTGYRVLAWATGIWLIALCYEMVMKYAFQDD
SLGWIAVVHGWVYFVYLLFTANLAVKVRWPIAKTVGILLAGTIPLVGIIV
EHFQTQNIKEQFGL
120405237YP_955066.1 putative lipoprotein [Mycobacterium vanbaalenii PYR-1]MSTTRRRRPALILLVIAAAAGCLALAWWQWTRYESTSGSFQNLGYAMQWP
LFAGFCVYAYFKFVRYEEAPPEPHPHDAVTEIPAGLLPERPQPARRGNAN
RDADPDNDDPDDDTTLREYNAYLAELAKADAEDQKMTGTGT
120405236YP_955065.1 hypothetical protein Mvan_4282 [Mycobacterium vanbaalenii PYR-1]MTRSVEEFEKVQQLIAEGLNDCAVARDTGIPRTTVRDWRRRPPRRLSHPS
DPLSCGVVHDFDSLHAASYAYLLGMYLGDGCISKASRTDTLRVTCDKRYP
TIIARCRLAIDALFPRQRAGVYWRRSGCADVYQCSKHWPCLLPQHGPGRK
HLRKIALEPWQQKIVDGEAEEFVMGLIHSDGCRVVANDRGVLSVRYHFSN
RSEDIIGLFTAALDHLGITWRRSDKHTVSIYRKAATARMDEFIGPKDLAV
PLNGVHYTT
120405235YP_955064.1 hypothetical protein Mvan_4281 [Mycobacterium vanbaalenii PYR-1]MKNWGDVIVVENGEWQGYDWHWADRRILDMLIGGPELALRHIASFRRSDD
RDFYGLMPERSAAVLDLDRRRLLFFGDDLMGRVPHRRVLLAALAELWTGF
QAGWAYGGARELAAYVGVDCPPRDFDREPRIEVTPDRYSPCQVISVVGPD
GGVRFWPMVEYSHPEVYGPSLLDMLPRRARPKLSLRIEPASGVHVDPSRK
AIGVWQTVDTAGILDQLPEIWAGWDFEFWEDRYEEQLARCGDALHVPPRK
LSVEIREVQELMRRRVFGSDWDSPAGEALELLAVLRRHAPDLAIRDGDVI
AGLIRPTAQQWKRFTTACDGYAAASAA
120405234YP_955063.1 hypothetical protein Mvan_4280 [Mycobacterium vanbaalenii PYR-1]MIDRAEGIPGSDDPFNETVATTGLFLIVTAIIALAFALASWGLSENLIAL
FAGAIAVVSFTASILCFMNQATDAAPSTGEATA
120405233YP_955062.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MSDLKYLDLHGDRVAYRDVGRGEETLLLLHGMAGSSDTWRAVLPQLAKRY
RVIAPDLLGHGQSAKPRSDYSLGAFAVGLRDFLDELGISRVTVVGQSLGG
GVAMQFVYQHPDYCQRLVLISSGGLGQDVGWTLRLLSAPGAELLMPVIAP
PPVVRVGNTLRNWFSAVNIQSPRGAEMWSAYSSLSDAQTRQAFLRTLRSV
VDYRGQAVSALNRLHLTSDLPLLVIWGDEDRIIPVEHGYALNEARPGCRL
EILAGVGHFPHVEKPTEVVDLLEDFISTTGQSSAVETPTH
120405232YP_955061.1 transcription factor WhiB [Mycobacterium vanbaalenii PYR-1]MSMTTETEGKVSMNSIRIEEEAWTAPCTRDPDRWMVTADEGAKSLCRACP
RRWQCARDACVTPGAVGLWAGIVLPEGGRNRQFALKQLRSLAERNGFSAR
RR
120405231YP_955060.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MVSDVGRTGAEEPRNIERIRAAALRSLAANGAAATTMRGVAAAAGVSLGL
VQHHFATKAGLINDVDEYVLRLITTTMSRPLADPPVDSVVEIGDRVTTLF
SEHPDVATYLGRALVDGSPAGVRIFDTLFAVGVARWQQRLDRGELRPDVD
ITWAAINGLVLALGAISLRSHLDRHLAEPLISPGQLARWQKAVDALLREG
LFRRPVSE
120405230YP_955059.1 AraC family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTVSASSDRILSEAANLGAGPPRRVIDLRRGGRALGGSYLYEGDALITGW
HSHDVHQIEYALHGVVEVETDSAHYLLPPQQAAWIPAGLEHQAVMNPDVK
TVAVMFDPTLIPDGGDRARILAVSPLIREMMIYALRWHIERGPGAGDDDG
VADGFFRTLAALVCEALDHEAPLSLPTSDNPIVAAAMAYTKQHLDTVTCE
EVSRAVSVSERTLRRLFAETLGLPWRTYLLHARMLRAMALLTAPTQSVQG
TATAVGFDSVSSFTRAFTQFCGETPSAYRKRVADASD
120405229YP_955058.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MQTDDLILVSIDDHVVEPPDMFLRHVPAKYREEAPIVVTDDKGVDQWMYQ
GRPQGVSGLNAVVSWPAEEWGRDPAGFAEMRPGVYDVHERVRDMNRNGIL
ASMCFPTFTGFSARHLNMHREEATLVMVSAYNDWHIDEWAGSYPDRFIPI
AILPTWNVEAMCAEIRRVAAKGCRAVTMPELPHLEGLPSYHDDDYWGPVF
RTLSEENVVMCLHIGTGFGAISMAPNAPIDNLIILATQVSAMCAQDLLWG
PAMRNYPDLKFAFSEGGIGWIPFYLDRSDRHYTNQKWLRRDFGDKLPSDV
FREHSLACYVTDKTSLKLRHEIGIDIIAWECDYPHSDCFWPDAPEKVLAE
LNAAGASDSDINKITWENSCRFFSWDPFKLTPKEQATAGALRAKATDVDT
SIRPRAEWARLYNEKQQFAQA
120405228YP_955057.1 sulfatase [Mycobacterium vanbaalenii PYR-1]MTTERPDIVVVMTDEERATPPYEPDTVRAWRSRTLGGRRWFDENGVSFLR
HYTGSLACVPSRPTIFTGQYPDLHGVTQTDGIGKAHDDSRLRWLRRGEVP
TLGNWLRAAGYDTHYDGKWHISHADLIDPGTGRSLDTNDDDGVVDPAAVH
RYLEADPLSPYGFSGWVGPEPHGAKLSNAGIRRDPLIADRVVAWLKDRYA
RRRAGDPDAMRPFLLVASFVNPHDIVLFPAWARRNPLPASPLDPPPVPAA
PTADEDLSTKPAAQIAFREAYYSGYGPAWSIERTYRRNAQRYRDLYYRLH
AEVDTPIDRVRRAVTEGGSGDGPDDTVLVRTADHGDLLGAHGGLHQKWFN
LYDEATRVPFVIARVGARPTTARTVTAPTSHVDLVPTLLSAAGVDVDAAA
TVLAESFSEVHPLPGSDLMPVVDGAPADDHRCVYLMTRDNVLEGDTGASG
LARALKLTSKVPAPLRIRIPAHTAANFEGLVIRVDEDAAPGGRGHLWKLV
RSFDDPGTWTEPGVRHLAADGIGGPMYRTDPLDDQWELYDLTDDPVEQHN
RWTDPDLHELRAYLRAQLKSVRAESIPERNRPWPYVRRQPPQPARWSPGR
ALRRLRD
120405227YP_955056.1 cyclase/dehydrase [Mycobacterium vanbaalenii PYR-1]MLNEAVAEVSRSRTVSAESAAIWARLADFGSLSAWADGIDHSCLLNGDDH
PEPVGLTRRIQSGRDTFVETIVAFEPSRVLGYEIAGVPKGFRVSNRWNLE
PRAHGATTVTLTTTIRTSRALLRPLGERAFARLMARRSDSLLDSLAKATE
GNP
120405226YP_955055.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MATDIAAPRRRSEKSRTAIVEATRKLLMERGFDKLTIEAVAARAGVGKQT
IYRWWPSRHALVADVTLEDADRILRPVARTDDVAADLCAWAVTLATALTT
VRGNAMLRALTTAGVEHQDTAARLHAGFNQPIHDAVRGRLTAEGLTAESA
RDATDAIVGGIVYAILSEGRSFDPHRAESITRTVIAGITTR
120405225YP_955054.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MAGTKLVIGASGFLGSHVTKQLIAAGEDDVRVLIRTTSSTRGIDGLPVQV
HYGDIFDTGALRAAMAGCDVVYYCVVDARPWLRDPAPMWRTNVDGLRNVL
DVAVGAGLHRFVFTSSIGTIGLAADGLADEDTAHNWLDKGGAYIRSRVEA
EQMVLRYSAEKGLPAVAMCVANTYGPGDFLPTPHGGMLAAAVAGRLPFYI
DGYDAEVVGIEDAARAMILAAERGRTGERYIVSERFMSTREIHEIGCAAV
GVAPPKFGVPIRVMSAAGYLSEGVARLRGKDTMLTPLNIRLMHIMSPMDH
SKAVRELDWHPQPTSEAIVAAAHFFRDRRQRAAQGAR
120405224YP_955053.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTIGLTPEQQQLAAAVAQFAARHAPIDKTRGSFDALAAGELPLWWDQFVA
NGFHAVHLPEEVGGQGGTLTDTACMLEAATTALLPGPVQSTVTAGAVALL
ADDTEARNTLLVALAGGASAAVIFAEDNDFRAVPVAGGWEVSGASVPTLG
ARSAHTMLAAADAGERTLWFVIDPQGPGIDVVGRRGTDKTVDVGAVRLDG
YRCTDSAVLTGIDDARARCVAIALAAGAASGVIRWCVHAVTEHLRTREQF
GKPIGAFQALQHQAAMLLVNSELATSAAWDAVRSASEERTQNQIAAWGAA
LMAISPAPDLVLDTLTMFGAIGYTWEHDLHLYWRRATSLAASIGPAGRYA
ESLGDLSRTQNRDVSLKLGDLDADFRRSVATVLDEASTLRNDRPGRQGDY
ENLATGPQRTLIAEAGLIAPHWPRPWGVDATQLQQLIIDEEFAKRPGLVR
PSLGISEWILPTLISSAPEHIQQRFIPATQRGELGWCQLFSEPGAGSDLA
SLTTRATKVDGGWRIDGHKIWTSSAHTADYGALLARTDPDAAKHRGIGYF
IVDMRSEGIELQPIRQATGESHFNEVFLTDVFVPDELLLGGPTDGWNLAI
ATMAQERVAISGYVNFDRASILRGLAAADRPDRSRVLAALGEADAYANAI
KVLAVREVMRLLDGQAAGPASSIAKVAMNVMLRRTFKATLELTAPAALVE
DSDPAIVEPYFHLPAELIGGGTREIQLNIIAQMILGLPRA
120405223YP_955052.1 hypothetical protein Mvan_4269 [Mycobacterium vanbaalenii PYR-1]MGLRGEAAIVGYVELPPERLNKATPAPFTLEQWAELGAAALDDAGLSGEL
VDGIVTTHLSESEIFVPSTVTEYLGVRANFAEMVDLGGASAVGMVWRAAA
AIELGICDVVLCAIPARYLTPTSPKKPKPLVDAVFFGASSNQFGSPQAEF
EIPYGNLGQNGPYGQVAQRYASVYGYDERAMAKIVVDQRFNANHTEGAVW
KDKPLTIEDVLASPVIADPLHMLEIVMPCLGGAAVVVAGAEVAARARNRP
VWIKGFGEQVPYKTPTYAEDLLQTPIARAADTAFTMSGLTRDQMDMVSIY
DCYTITVLLSLEDAGFCEKGKGMEFVSQHDLTFRGDFPLNTAGGQLGFGQ
AGNAGGMHHVCDATRQIMGRAGEAQVGNCNRAFVSGNGGILSEQTTLVLE
GD
120405222YP_955051.1 hypothetical protein Mvan_4268 [Mycobacterium vanbaalenii PYR-1]MSTPTFERPMPVKTPTTAPFWDALAEHRVMIQYSPSSQSYVFYPRVRAPR
TLANDLEWREISGMGTVYSFTVARRPVGPHFADAVPQLLAIVEWDEGPRF
STELVNVAPEDVEIGMRVKPVFCDYPEHDVTMLRYEPADR
120405221YP_955050.1 hypothetical protein Mvan_4267 [Mycobacterium vanbaalenii PYR-1]MTRDDRQEISDVLVRYATGIDTRDWPLFRTVFTDDCELDYGEIGTWRGVD
AVVEFMTATHEMAGYTLHRITNQAATVDGDTATARAYIDALIMSQDNTSG
VSAVGFYDDELVRTDTGWRIRRRTFTPVLMRTI
120405220YP_955049.1 general substrate transporter [Mycobacterium vanbaalenii PYR-1]MTVKETRPAAPGAVSRAVRGAAIGNAVEWFDFAIYGFLATYIAEKFFPPG
DETAALLNTFAIFAAAFFMRPLGGFFFGPLGDRIGRQRVLALVILLMSAS
TLAIGLVPGYDSIGVLAPILLLLLRCLQGFSAGGEYGSGACFLAEYAPDR
HRGFVVSFLVWSVVVGFLLGSVTVTALEATLSESAMNSFGWRIPFLIAGA
LGAVGLYIRLRLGDTPEFEALRESGEVSTTPLKEAVTTSWRPILQIIGLV
VVHNVGFYVVYTFLPSYFTRTLEFSKIDAFYSITVASLVGIVLIPPLGAL
SDRVGRKPLLLAGSIGFAVFAYPLFLLLNTGSLAAAIAAHAALAAIEAVF
VCASLAAGAELFATRVRSSGYSIGYNVSVAIFGGTAPYVATWLVSRTGND
IAPAFYVIAAAVVTFLTVLTMRETARQPLRKLVSD
120405219YP_955048.1 putative adenylate/guanylate cyclase [Mycobacterium vanbaalenii PYR-1]MRPRRLLIRYAAGLTSAYVLTLAEVVAIVVSLAGRSVVTVGNVITLTVVG
LVGTATVALGAVLIVRPSLRWLDSGRPPTPAEIRTTAKTMRRQAAITLAP
WLLTAAILVPLNLHAPATVFVVLTTALLFGAIATVSTGYLFTLRTVRPLL
AGVPADAAPPGSPGVRVRLVLTWVVCTALPGSAIAVLLILRSRNWLLDES
SPIELALVVLALVAVVLGLRSMLLVSMSISDPLDEVADAMADVEKGKLDR
TIDVYEWSEIGRLQSGFNRMVAGLRERDRLRDLFGRHVGEEVARRAFEQA
TAQNDASTGDERDVAILFIDLVGSTQLANEREPHEVAEVLNDFFEIVVAA
VDESHGLVNKFQGDAALAVFGAPLRIDDPASAALSTARILARQLHKLPVD
FGIGVSAGPVFAGNIGARNRYEYTVVGDAVNEAARLADRAKEFDGRTLCS
GTVLSQASGAEQRLWAAHGEARLRGRSESTDLYTPSGS
120405218YP_955047.1 hypothetical protein Mvan_4264 [Mycobacterium vanbaalenii PYR-1]MIKNGTRLQSQVCDTQVIVVRSADSLDDLRAGGAPMVPIGEAVDESLSLD
DALADGTLMGKRYVDDGGAEVLVTKAGKGTLSIGSTPLSLKEAKPLPASD
120405217YP_955046.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MSISLLLEMAQDAGPDRTAVVSDDLRLTTAELSALADGGAGVIAASGARH
VAYVGAGGAMLPLLLFASARAAVPVTPLNYRLSADGLRALLDRLPDPLVV
VDDEYRDAVGDGYRTIGSAEFLDAARTAEPAAEFADPDAVGVVLFTSGTT
SKPKAVELSHANLTSYIMGTVEFASAEPDDAALICVPPYHIAGVSAALSN
LYAGRKMVYLTQFDAGRWVDLVTGEGVTSATVVPTMLDRIVSVLETRGTT
LPTLRTLAYGGSKVPLPLVRKALSLLPAVGFVNAYGLTETSSTIAVLTPD
DHRAALAASDEAAIRRLGSVGQPVPGIEVEIRADDGTVLGAGETGELFVR
GEQVSGKYTDIGSVLDEQGWFPTKDVAFLDEEGYLFIGGRSDDTIIRGGE
NIAPAEIEDVLVEHPHVRDCAVVGADDPEWGQIIVAVVVAQPGTEPDVED
LRSHVRSQLRGSRTPDRVVFRDELPTNATGKVLRRELVDELNQDPSPAQP
AV
120405216YP_955045.1 short chain dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSGTSNETGDIGGTRFAGRTMVVSGGSRGIGLAIALGAARQGANVVLLAK
TAEPHPKLPGTVHTAVADVEAAGGKGVAVVGDVRKEEDVARAIDTAVEHF
GGVDVVVNNASAIATEPTEALSAKKFDLMMDINVRGTFLLTKAALPHLRK
STSGAHVITLAPPLNMNPHWLGAHPTYTLSKYGMTLLSLGWASEYADAGI
GFSCLWPETYIATSAVSNLADGGDLVKSSRSPEIMGDAAVQILSRPPAEV
NGQCYIDAAVLADSGVTDLSGYGGGDDPILDIFVDGRVS
120405215YP_955044.1 methylmalonyl-CoA mutase large subunit [Mycobacterium vanbaalenii PYR-MSEQVHPLVETPSGIPLEPVYGPGDRAADPPPPGEYPFTRGNFASGYRGK
TWTFRQYSGFGTAEESNRRYRYLLEQGGTGLSVALDLPTQCGYDSDDAEY
GEEVGRVGVAVDTLADAEILFDGIPLDKISTSFTINGTAAILLAFYVAAA
EKKGVPREKLTGTIQNDILKEYASRGTWIWPPEPSLRLIADTIEFCAAEV
PKFNAISVAGAHFRDAGANAVQEMAFTLADGVTYCDTVVERGRMTIDKFA
PQISFFFYTHGDFFEEIAKYRAGRRRWATIVRERYGATTDKASMFRFGCV
AGGASLYAPQAQNNLVRVAYEAMAAVLGGVQSMFTAAWDEPFALPSEESA
TLALRTQQILAYETGVTKVADPLGGSYFVEALTDATEEKIIEIMADLEAH
GGMVRCIEDGYLQGLIADEAFKIHQEVESGVRPVVGVNKFVVDEPPPDLA
TYELDAEGRDKQLKRLAKVKADRDDVAVKEALAALARAAEGDDNLMHKLI
DCANAYCTVGEMVSTLKSVWGEFQQPVVF
120405214YP_955043.1 cobalamin B12-binding domain-containing protein [Mycobacterium vanbaalMGVRVLVAKPGLDGHDRGAKIVARTLRDAGFEVIYTGIRQRIEDIVSIAL
QEDVALVGLSILSGAHVALTTRTVDALRAADAGDIAVVVGGTIPQGDVQK
LLDAGAAAVFPTGTSLEDLVRDVRALTEKVEQS
120405213YP_955042.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MKLGVMIGAERGDMARKVGKLVSDIEWAESAGLDTAWMPQVPNDFDCLTM
VALMAAHTSRIELGTAVVPLQAQHPIALARQALSVHAMAQGRLALGVGPS
HHWIVRDMLGLPYEKPAAYTRDYLEVLNAALAGPGDVDVENDTFTVHNPT
VLGAEQPLPVLVAALGPVMLQIAGERADGTVLWMADEKAIGGHIAPKINK
AAAEAGRPAPRIVAGIPVCLCANSEIDAAKDRANRILAEAETSPNYQKLL
DRGDARSVGDLCAAGDEDAILARFKQFADAGVTDLSVRLLPIGETRDELV
ASKYRTREVIGELAKAVR
120405212YP_955041.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMSSGPLAGIRILEVGVMLAGPYATMMLADLGAEVIKIEPPGGEISRQVSD
SYFASLNRNKQSVVLDLRSEQGRRRLGELVADSHALLVNMKPSAIRRLGL
TYDSLREFNESIVCVAMTGFGLDGGDDPAFDYVIQAATGVAAMTGDPQGP
PTLPGYSSADNSTGLTAALGLLAQIVSGRGGQVDVSLQDVMLSQLNYRAA
AYLNDGIEPQRHPNGAHSYYVPAQLFPTADGYLALFITHDGFWAAFAAEA
GIEGFPTMAERAERRDEVLALVSAALETDTAANWQHRLRPLGIPVAAVRT
LPEALTATPEALITAGEFRLVGSPIRIAGYQPAYRPAPRLDEHADAAAHS
S
120405211YP_955040.1 ferredoxin [Mycobacterium vanbaalenii PYR-1]MTDPQTPRAGSVVTAADAPTSGTITITLDGSTASVAHRPNETLLESARRA
GMGPPFSCEAGNCGTCMALLTDGTATMRVNDALTEDEVAEGYVLTCQAVP
DTPDVTVSYDE
120405210YP_955039.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MSDPWALAFEDRQYSLADLDALAGGMAAELHRRGVAAGSRVAVMSSNRPE
FVVALRAIWRLGASAVLLSPAWKQAEVGHALSLTEPTHAVGDHPVLAGSM
PMLSLDEEIAPVAHGAVQPAPTPDADAVFVFSSGTTGMPKAVRHTHASLA
VAVRHWRAALGLTSADRMQVMTPPSHILGLLNIVMALDTGAWIRLHRRFD
IDAMLRHIESDRITIEMAVAPIALALSAHPGLEEHDLSSLRYIMWCATPV
TQTVAEAVSARTGATWVTAYGASELPVISCNDLQDARLDTVGRAVAGVDI
RIVSLESGAPLGPGDEGEIQVRSDSAMAGYLPDHWTADAFCDGWYRTGDV
GSLDADGWLRITDRAKEMIKVRGFQVAPAEVEAVLHGHPAVEDCAVFGVP
AADGEAIVAAVAASGPLDTDDLVALVAERLAGYKRLSQVFVVDEIPRLPS
GKVLRRVLRERAMSARAESGGFGGRPSDQ
120405209YP_955038.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDVRLTSEQQQLRDAAAEVAGDFGPGSVADLDDQARRTRLEKAVDATGFR
TLRSDGASAVEVAIVAEEFGRGLVDVPFLGPVLADDLQRRLGRDVGAAPN
TAPESVDLTGSLAGVVESPPELADLSDDESGRWYALALAATTADIIGAAR
GTHALATEYAKVREQYGSAIGSYQAVAHMLAESLALIEGSISVARHAAWA
VDELPVREAVEAARIAKIYSARAAMTVCETSIQVHGGIGNTWECLAHIYL
RRVLAATETWPAKLEELTIGLS
120405208YP_955037.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMDFRDSPEEAAFRDRLRGWLSEQKGKFPTSGDAYWAKAGEWHQALFGAGF
FGTSWPKEYGGQDLPPVYDVIVDEEIAKAGAPARPSLGYLVVGLSHHGSE
ELRQRFLPGMINGSERWCQGFSEPGAGSDLASLTTTAVRDGDEYVIHGHK
IWTSYSDVADWCLLLARTDKDVPKHKGISAFIVNMHQAGIEQRPLKMISG
VTKEFGQVSFDGARVPAENMVGAPGEGWKLAMTVVSHEREPSTLGFSARY
GKTVRQMASRLDGAPNQELLWAWVQTEMLRLHVRRRLSEQLDGLTHGPQG
SLDKLLMTWVEQSVGHAALATVGTSDEELFGAYMYSRAQSVMGGTSQIQK
NIIAQRILGLGA
120405207YP_955036.1 enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]MYGMPEEIDVRADGALRIITLNRPDDLNAVNDNLHVGLAKIWEELNEDAG
ARAAVITGAGRAFSAGGDFNYLDELRNDEALRQKTIKHGRDLVIGMVRCR
IPVVAAVNGPAVGLGCSLAALSDVVYIAENAFFADPHVSIGLVAADGGPL
VWGSQISLLQAKEFALTGVRIKAQRAVELGLANHVVDDPVAEAIACAKKL
IELPQQAVEATKRLMNIQLEKSVMASLDYANLAEYVSFGTADFNKIVDGL
IAKK
120405206YP_955035.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTLHGKVAFVAGASRGIGATVAAALARAGASVAVAARSEQEGKLPGTIGS
VAQGISAAGGRALPVACDVTSEESVNAAVAETVAEFGGIDILVANAGVLW
LGPIETTPLKRWQLCLDVNTTGVFLVTKAVIPHVRARGGGSLIAVTTTGV
NMTDHGANAYWVSKAAVERLYLGLAADLKPDNIAVNCLSPSRVVLTEGWQ
AGGAGMQIPPEMVEPPEAMADAAVFLAGQDASGITGTIQRSEALTF
120405205YP_955034.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMQIAGSSALVVGGAGGLGEATVRRLHDAGAKVVIADLADDKGRQLESELG
VRYVRTDATSEESVNAAITEAESLGPLRISVDTHGGPAGGGRLVGKDGSP
LSMEAFETTIKFYLTAVFNIMRLSAAAIAKTEPLEEGGRGVIVNTASVAG
YEGQIGQLPYSAAKGGVIGMTLVAARDLSPLGIRVVTIAPGTINTPAYGK
AADQLEQYWGPQVPFPKRMGRSTEYAQLAQSVIENDYLNGEVIRLDGALR
FPPK
120405204YP_955033.1 LAO/AO transport system ATPase [Mycobacterium vanbaalenii PYR-1]MKRSLSSKENIILDNGRVLRRGGARLRTLCEVTIEELIAAARGGSQRATG
RLLSFVESPRRDEVLDALGDLLPAQVVGITGPPGAGKSTTVGALVGAYRL
AGKRVAVLAVDPSSPYNGGALLGDRIRMAAHINDPDVLIRSVATRGHLGG
LAAAVPAAIRLLSALGYDLVILETVGVGQSEIEIAAVADPTVVILNPGAG
DAVQAAKAGLLEVADVVAVNKADRDGADQTVRDLRAETDVPILKLVAAQG
DGIAELKEVIEAHHRADNPARRAARARSQVLSLAQSLLRQHAGLDGLAES
VAEGRMDPYTAAARLIVPDSAN
120405203YP_955032.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTTAGTRFSAITRTAAQTRVLDAALDLISEHGVSGTSLQMIADSMGVTKA
AVYRQFKSKDDIVIALTEREFGRLEDALEAAEAEESAPRARELLLNQVID
EAIERRRHVATLQFDPVIIKFLASHQPFQAFIARLYAVLVGDAGREAKLT
AAMLSGAIAVGVMHPLVADIDDDTLRRELLHYTRRLIDLPE
120405202YP_955031.1 fumarate reductase/succinate dehydrogenase flavoprotein domain-containMTDWDHEADVVVLGSGGAGLTAALTAAVNGATVEVYEKAETVGGTTAVSG
GIVWIPAHPRSGDGELTAEDAMAYLRAQSLGYMDDELVETFVQSGAPMLD
FLEAHSDLVFEVAAGFPDYKPELPGGKPGGGRSLHAGPFDLARLGDWRDR
ITSFPADFSNVGIDAETRARIHAAVDNESGDYCVAGTALIAGLLRSLLDR
GITPHTEARAVELIADPLGITGVRIEQGDSDFRVRAHRGVVLGTGGFEWD
QRLVEAYLRGPMRGAVSPPNNTGDGLRMAMAHGADLANMGEAWWVPIVQI
PGDTFEGQPRSRSVRLERTRPRSIIVNRAGRRFLNEAGEYNSMAGPFHFL
DPKLGYANDPAWIVFDSIHLKHYGFLGVDPDGPVPEWFCQSADLEELGEK
TGIDPVGLGATLAAWNSNVTQEHDPDFGRGASAYDGYWGDTTATTTAGQT
LGPIDTAPYFAVPVSIGAMGTKGGPRTDRDGRVLHVSGTAITGLFAAGNA
MAGATGKAYGGAGGTLGPAMVFGYRAGYTAATGKSAP
120405201YP_955030.1 regulatory proteins IclR [Mycobacterium vanbaalenii PYR-1]MNRPAGDQAPVTGEPGPATAGAGAPGSQTLARGLNALQLVAKSPTGLTVG
QVAEDIGVHRTIAYRLLSTLAQYRFVAKGEDGRYRSAAALAVLGASFDNN
VRQLCVPTLRALADELGTTVSLLVAEGDQQVAIAVMVPTNVFYQLSFHEG
SRYPLDRGAAGIALLASMPPRPGERDLVQQTRQQGWVITHGEIEPNTYGL
AVPVRRRPPSPPTCINLISHREDVVLDGRDSVIKAAAELSEALN
120405200YP_955029.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MTEFESVWSDLQGVPFSQGYLDAGGVRTRYLHAGDPGKPALVFLHGSGGH
AEAYVRNLEAHAEHFSTWSIDMLGHGYTDKPGHPLEIAHYVEHLAGFLDA
IGASRAHISGESLGGWVAARFAADRPERVERLVLNTAGGSQADPEVMKRI
VTLSMAAAENPTWETVQARIKWLMADKTKDYDDIVASRQRVYRQPGFVNA
MRDIMALQDPEIRARNLLGTNEYGAITAPTLVVWTSDDPTADVKEGRRIA
SMIPGARFEVMPGCGHWPQYEDPKTFDRLHLDFLLGRA
120405199YP_955028.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium vanbaalenii PMTAPSGSTPDVDVVVVGAGPSGLTLANILGLQGVATLVVDERDTLIDYPR
GVGLDDESLRTFQAIGLVERVLPHTVPNQILRFFDADRRLLAEMAPPDAR
FGWPKRNGFVQPLVDAELFGGLERFDHVEVRFDHRMQSCSETAGGVTVTF
DGDRDPVRARYVVGCDGGRSTTRRQMGVSFDGTTSSTRWLVVDVANDPLG
HPNSEVGADPARPYVSISIAHGIRRFEFMIHPDETDEQADDPAFVRRMLG
QRVPYPERVDIIRHRVYTHHSRIAGSFRKGRLMLAGDAAHLMPVWQGQGY
NSGIRDAANLGWKLAAVVNGQADDALLDTYDLERRKHARAMIDLSTMVGK
VISPTNRGLAALRDRVIHAASVVPTLKRYILEMRFKPMPRYQQGAVYHDA
QPSPTSPTGTLFIQPRVDTREEFNVLLDDVLGPGFAVVCWSNNLRAVLGD
EAFDRWKGLGARFVEARPMTQLHWPGYDDADVEVVGDRTGALKKWFDVST
DSVLFVRPDRCIAGACIAQRAPEVSTALFAVLHLTREGGAGSHGEKSDGT
VLHVAQSAAEPSGTSAGTP
120405198YP_955027.1 3-(2-3-dihydroxyphenyl)propionate dioxygenase [Mycobacterium vanbaalenMSHSPLLNLPGPAQELLDDIEGAIAAAREFVAAFDPDLVVTFSPDHYNGF
FYRAMPPFCVGTAAAGVGDYGTYQGPLDVPADLAIDCARAVLDSDVDVAV
SAAMDVDHGTVQPLQKLFGDATAKPVIPVFVNSVATPLGPMRRVRALGAA
VGTHLAGLGKRVLVIGSGGLSHDPPVPTLATAPPAALDRIVRGVPMTTEQ
RQARQAAVIEAAREFASGQGALAPLNPDWDRAFLDLLDNGRLAEVDSWDN
RWIAEQAGNSAHEVRTWVAAFAALAAQGKYETGNRYYRAAPELIAGFAIR
TAVCTS
120405197YP_955026.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium vanbaalenii PYR-1]MSSVVGQTFEHFTDVLVIGSGGGGMTAALAADASGLDTLVVEKSPRFGGS
TALSGGGIWVPGAPSQRREGYVPDPDEVFTYLKEITGGLVSDARLRKYVD
AAPEMMEFLEKLSPWLEFVWKPGYADYYPELPGGSALGSTINVPEIDLRV
LGDEEQHLLAPLALAPRGIWFAPKDLRLFYQVRQSWRGKAVLLKLIWRMF
RARVFGDRMAAIGQSLSARLRLAMKQQNIPLWLNAPMTELITDTDGPEGR
VVGAVIERDGRPIRVRARGGVILASGGFDHDMQWRRQHLPELNRVDELAG
CGKDWSFGNPAATGDGIRAGEKVGAATDLLDEAWWFPAICWPDGRLQFML
NERMMPSQFVVNGDGERFINEAAPYMDFAHAMIEGQRSGVTHIPCWLITD
IRSFHRYVVAGHLPIPKVPFAPVPTGWKVPAAWLESGVVKTGSTWEELAD
QIGVPGTRLRGTAERFNALAAKGHDDDFNRGDSAYDNYYGDPTLPNPNLH
PLGAPPYFAFQIILGDLGTSGGLRTDEHARVLRGDDSVIGGLYAVGNASA
AVMGRSYAGAGATIGPAMTFGYVAARHIADSAGGTTDRTTTSTESPGSSR
R
120405196YP_955025.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MKISLFYEFPLPRPWSEDDEHQLFQHGLDEVELADKAGFSTVWLTEHHFL
EEYCHSTAPELFLAAASQRTKNIRLGFGVMHLPPPINHPARIAERVATLD
HLSNGRVEYGTGEGSSVAELGGFNIDPADKRTMWEEALEVSIRCMTEAPF
TGFKGEHVEMAARNVIPKPLQQPHPPVWVACTRPSSVQMAAQKAIGALSF
AYTGPEALKERVDGYYKEFEEQGAPITPAINPNILAIGGDLSMMVAKTDE
EALERLGIGGGFFSFGIMHYYLTGMHTPGRTGVWELYEKAVKEDPTLAYG
PGRGAIGSPDTVREFLRGYEASGVDEIILLLNPRSHEGTMESIEIMGRDI
LPEFIERDEKAVKDKAKRLEPVIEKVEARRQSWDAPLFDETYAFGGLPTG
RGGKFTAGEIPEAMAEINEGRVKAAQAEKDAKAAKEAAS
120405195YP_955024.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium vanbaalenii PYR-1]MAHQLGSLGARVTGLDLREPDAQSAIQDFVQLDLAEPRSVDAAAAAVDGR
VDALFNVAGVSSGIKDPLLVMRINFLGMRQFTEALIARMPEGSSITNVSS
LAASAYLENAATTAGLLETGSVAEGLQWCADHPEALADGGYRQSKEAIIL
YGMRRTADLGARGIRINCSAPGVTETPILDQLRSAYGQQYLDSFTAPLGR
VSTAEEQAAMLIFLGSRAAGYLTGQVVWTDGGILAQRISAQMTDIQAAQG
S
120405194YP_955023.1 hypothetical protein Mvan_4240 [Mycobacterium vanbaalenii PYR-1]MTGTMKDFRRVADEVRNWGRWGDDDEVGTLNFITPAKVAEAAGLVKQGKV
ISLGGDFSSGGPQGAFKFRQNPVHVMTVDGGDASTLVEYGPQWLRNAVAA
DMSAFFADNPFRFNDDIIVMPLQAATQWDAMSHVYYEDKLYNGFPADSVT
SFGAFHLGIEKVDNKGITSRGVLLDVVAHRGVDTFCQPGAPITPDELDEI
VARQNVEIRSGDIVVVHTGWWTRFLSTGDGGEAGSGLHWTCASWLHEHEV
AAVAADNLMVEDPDPGNGVEGTFLPMHMLCLRDMGLMLGEYWDLGPLAAD
CAADGVYEFQLVAPPLKVVGAVGAPVSPIAIK
120405193YP_955022.1 NADPH-dependent FMN reductase [Mycobacterium vanbaalenii PYR-1]MTGTNQPFIVGLGGTLRANSSTERALRYCLASVERQGGRTRLFSAEDLDL
PMYAPHELERTPRALELVKTLRDADAVVVGSPGYHGAISGLVKNALDYIE
DLRDDPRVYLDNTPWGCISCAYGWQAAVGTLTQLRSIGHALRAWPTPLGV
AINSADPVWDSSGELAATEQGRAVANQLDLLTSQVLAFAQTNRDSVT
120405192YP_955021.1 alpha/beta hydrolase fold protein [Mycobacterium vanbaalenii PYR-1]MALEPKSVLVDGLRTSYLEAGHGEPVVLLHGGEFGASARIGWEHTIAPLA
QRYRVLAPDMLGFGDSAKVVDFTDGRGMRIRHIARFCEVMDVEAAHFVGN
SMGAINLLVDVTSDAAVLPVRSLVLICGGGEIQRNEHVDALYDYDATFEG
MRRIVAALFADPAYPTDDEYVRRRYESSIAPGAWESLAAARFRRPGLDPP
ATPSSARAYDRITVPTLVLEGRDDKLLPTGWAAEIAGQIRHGRSAVIDDA
GHCPQIEQPAAVNQELLDFFEEQT
120405191YP_955020.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTELVGKVAIVTGGASGIGRGIAERFAAEGARVVIADVRDDLGEPLAAEL
NSRGAKTVYRHTDVGDQRQVAELVAAAVDTFGGLDVMVNNAGISSPLRKG
LFHEDLEEFDRVMRVNLLGVMAGTRDAGRYMADHGGGSIINLGSIGGIQA
GGGVSTYRASKAAIIHFTKCAAIELAHYEVRVNCLAPGNIPTPILASSAT
DEDRERLERFEARIRRQMRDDRPLKREGTAEDVAEAALYLATDRSRYITG
TVLPVDGGTVAGKVIVRKPPPAEAAT
120405190YP_955019.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSFLNQSLDLVGVTGFTEWVTTARTVRADRASSTQEAILKAAERLYAEHG
VFAVSNRQVSEAAGQGNNAAVGYHFGTKADLVRAIEHKHRGPIEELREQR
VAAIGASTDMRDWVAALVCPLTDHLAALGNPTWYARFAAQVMTDPAYHNM
IVKDALSSPSLVRVLDGINSCLPDLPVDVRVERNIMGRNLLMHSCADRER
LLAQGAPVARPSWQAAATGLIDAIIGLWHAPVTEPA
120405189YP_955018.1 putative ferredoxin [Mycobacterium vanbaalenii PYR-1]MRVTVDQDKCVSSGQCVLNAGAVFDQRDDDGVVELLIPEPGPEYAEETRK
AATACPALAIHIEE
120405188YP_955017.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTETLAQEAVSVPEYPMERTAGCPFAPPQQMLEMNQVKPLSRVRIWNGTT
PWLVTGHEVARTLFADSRVSVDDRREGFPHWNEHMLSTVDKRPRSVFTSD
AEEHTRFRRMLSKPFTFRRVEALRPVIQQVTDECIDEILAGPQPADMVAK
LALPVPTRVISDMLGVPYEDHEFFQEHANAGLARYAAADAMQKGAMSLHQ
YLINLVEEKQAHPAEDAVSDLAERVTAGEISVKEAAQLGTGLLIAGHETT
ANMIGIGICALLENPEQAALLRDSDDPKFIANAVEELMRYLSIIQNGQRR
VATEDIEIGGETIRAGEGIILDLAPANWDARAFPEPDKLDLTRDATQQLG
FGYGRHQCVGQQLARAELQIVFHTLLRRIPTMKPAIPLEEVPFKHDRLAY
GVYELPVTW
120405187YP_955016.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MSIRTTAATATATLYPPEGFGAPKNRHGHAAEGGLTGLPEGTEIFSADNH
ISVADDIFYERFPEELKGAAPRIWYEDGAYMVGMKGKAWTGGDFGRVLMQ
YDDLAGAASNNIEARIRELKEDGIDKELAFPNAVLALFHYPDKALRERVF
RIYNEHIAELQERSNGHFYGVGLINWWDPKGTRSTLEELKSLGLRTFLLP
LNPGKDDDGNIYDYGSTEMDAVWDEIEAAGLPVSHHIGETPPKTPCQNNS
VVVGMMVNVDSFREQFAKYVFSGILDRHPALKIGWFEGGIAWVPTALQDA
EHMLASYRHMFNHELAHDVNHYWAHHMSASFMVDPLGLQLIDRIGVDNVM
WSSDYPHNESTFGYSEKSLASVVETVGAEAAVKIVSTNVQKFLGLRTQGA
IGAEA
120405186YP_955015.1 peptidase M24 [Mycobacterium vanbaalenii PYR-1]MTTSTQSGVTQIARTGYSWLDIPAEPDFARLRREVGVRLHAAMADQGVDA
LVLLGNGNVMYATGISWPLADAGLSHVERPVAVVLADDEHPHLFLPFREG
AAMESGVPTDHLHGPVYLEFDEGVGEFATILAGLIPAGATIATDELTGAM
RRAGSALFPSAPVDAAPVIGAAKLVKTIDQIACIRRACQITEQAVAEIQK
SLAPGARQIDLSAEFVRRTFELGATTNMFDSIWQVMPTSKAEGTWTTTGD
LALPLLTTERELQQGDVLWTDVSIAYHGYCSDHGRTWIVGQDPTPAQQAQ
FDKWSGIVDGVLAVTKAGATCGDLGRAAIAAAGGEKPWLPHFYLGHGIGT
SAAEMPMIGTDLGQDWDDNFVFPAGMLLVFEPVVWQDGTGGYRGEEIVVV
TEDGWMPLTEYPYDPYEVSSGN
120405185YP_955014.1 peptidase M24 [Mycobacterium vanbaalenii PYR-1]MGTEIEADGRALRFSRRERALAQMEAHDLDMLVLGRQANVRYISGAPQLW
VVGTRPFGPICEFVRATGEIHLNSTWDEGIPEEIPHQNLYGFAWNPMTLV
GILQSIKGADTVRRVGTDALTPTFAKLLPMAFPHADLVDAEQAMQAARRI
KTPEEVQALRRALVVAEEGLAAGVAALRPGIAEKALAGAVLEAEAAGGVS
TPATQDAAWVTSKEHPWRRSDGDGLVREGDLVAMSAGVLADGYVAEVART
LYVGDPTDAVRALYRRRDDLWDRLLQACRPGAPVSSLLDAYGQAGEPLPA
MPVAHGLGLGFDPPVVSPNLRATMEAERLEEGMVLAVTAYVWEQGLGGVF
TRDAVLITADGAEILSTAPAYGESVHG
120405184YP_955013.1 enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]MAERPQPPAAERPAPEEIILYDKDPKTKIATITFNRPEFLNAPTSMARLR
YADVLRAANTDNDVKVVIIRGVGDNLGSGADLPEFMEGNDNPAARLAELR
LEDDGVGEVTYPPKGTFRNGATISAWYANSQAGNRALQDFKKISIVEAKG
YCYGWHFYQCADADLVISSDDALFGHPSFRYHGWGPRMWTWVQMMGLRKF
QEMVFTGRPFTAAEMYDCNFLNKVVTRDQLEAETRKYALACARNRPVDTV
FQQKMFFEIFKQQQGEYMGSLLSAFFESMGNGVANDSDDDLDMFESIDSG
LSAAVNDNDSKFPPEFRLSKRNRAKKD
120405183YP_955012.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMPPVPDPPLTGYVVVDLSSGIAGAYCTKLLADGGARVVKVEAPQGDPLRC
WSASGAGAESGPGAGAESGPGAGAESGPGADGALFSFLACSKHSVVAEPD
ADGELVDALLAEADAVIWSRGPGMAERPEFAPAEIRNRHPHLTVTAITPF
GLEGPWCDRPATEFTLQAWSGGIVGLGRGAPDRAPVYVGGQVGEYLAGAY
ASAATLASRMRGGAESIDLSMLETAILGLTYYPVSYFEMLGRPWRDARRL
TVPGIARAKDGLVDIGCGTAQQWFDLCAMTGHVEWIDEDSPLSITQQANE
KADELYAWVADQTVDEIRDLATAFRIPNAPVANGANVETLDHFVQRGSFL
VNPRDGFTQPAPPYRMSPATLRPPTPAPRLGEHTEHYRSLSVPRNSIPGR
DSSSTTAGNVPRKRVVPPIPRKDSLPLEGLRVVDMTTFWAGPSCTHLLAM
LGADVIHVESTRHPDGTRLIAGIPVTEDKWWERSPIFSGLNTNKRGITLN
LQSDTGRDLLKKLIATADVVVENFTPRVLESMGLTYDAVRAVKPDVIMAR
MPGFGLDGPWRDNPAFAYVIEAAAGISWLTGYPDLNPFEPYSVGDPNAGV
HALNAILLALEHRRRTGEGSMVEAAMVDAALNVAAEQVIEYSAYGALLQR
AGNRGPTAAPQNLYLTNEIDEFGRDDCWVAIAVATDAHWAGLCQALGRPG
WAMVDELATAPGRRAHHDLIDRHLAAWCAERTGDQIVTALWDNGVPAAKV
MQPHRQTEIPQLASRGFFEYVQHPVNPTTRHSTLPFRSSRGPDRVHTAPA
PLLGEHNREVLAELGVTDDELGRLEVDGVIGTAPAR
120405182YP_955011.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTIAPSDILLTGRVAVVTGGGAGIGKGIAHGLAAFGASVAIWERDPQTCG
EAAASVGALGLPTDVRDAEAVQAALERTERELGTVSILVNNAGGTFNSPL
LETSENGWDALYRSNLRHVLLCTQRVARRLVEVGQPGSVINITSIEGSRA
APGYAAYAAAKAGVVNYTKTASFELAPHRIRVNALAPDLTMTEGLQKLAF
GDLSGTMADMVPMRRVGHVDEMASAAVFLASDMAAYITGQTIHVDGGTAA
AGGWYFHPETGVPTLGPA
120405181YP_955010.1 NAD-dependent epimerase/dehydratase [Mycobacterium vanbaalenii PYR-1]MSGTSGTVLVTGGFGLVGSATVRRLVELGRSVVVADLDTPANRASAAQLP
AGVTVRWTDLTDAEQTSALVSEVAPAVIIHLAAIIPPAIYKNRALARRVN
VEATATLVRIAEAQPTPPRFVQASSNAVYGARNPYKSAGPVTADMPMKHS
DLYSAHKAEAEAIVRASSLEWVVLRLGGVLSTDPNAIPFSADALYFESVL
PADGRIHTVDVRDVAWAFAAATTADVAREILLIAGDDSHRVLQGDVGRAL
AESRGLKGGLVPGRNGDPNSDENWFVTDWMDTRRAQEALQFQHYSWQNML
DEAQRRAGASRYVLPVFAPLVRAVLKRRSAYWKQPGQYADPWGAIKRGIG
DPSPDS
120405180YP_955009.1 phospholipid/glycerol acyltransferase [Mycobacterium vanbaalenii PYR-1MTFSFPESSISGTMSDELAETAKWDPGFTRRITGWVGPVIRRYFRAEVRD
IESVPAEGGVLIVSNHSGGMLTPDVMVFAPAFYEHFGYDRPLYTLAHYGV
LIGPLGDLLRRAGVIEASRDNAAEALRSGAVVLVFPGGDYDSYRPTMAAN
VVDFAGRTGYVRAALESGVPIVPVVSIGAQETQMFLARGDAIARRIGLTR
ARMEILPVSIGFPFGLSVLVPPNLPLPSKIVTQVLEPIDITAQFGQDPDI
DEVDYHVRSVMQAALDELARNRRFPVLG
120405179YP_955008.1 acyl-CoA synthetase [Mycobacterium vanbaalenii PYR-1]MADPLGLLATLWRARLIAPMRPDRYLRMGLAMRRAGLTATVGFAAAAQRC
PDLPGIIDELGTLTWKQLDDRCDALAAALQKHTPRTVAVMCRNHRGFVEA
LVGANRIGADVLLLNTSFAGPAMAEVIEREGADIVIYDQEFTATVDRALR
DVPGTTRILAWTDADDGSTTLEALIDAHLGQRPEPATRKSDIILLTSGTT
GTPKGAKRSAGSGGASDLKAVLDRTPWRAGEPIVIAAPMFHAWGFSQLLF
AALLACPIVTRRKFDPEATLALIDRHRATGLAVVPVMFDRIMELPAEVRN
RYSGRSLRFATASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGMIATATP
ADLRAAPDTAGRAADGTELRILDAEHRDVPTGEVGQIFVRSSTLFDGYTS
GTTKAFHDGFMASGDMGYLDGAGRLFVVGRDDEMIVSGGENVYPIEVEKT
LTTHAAVAEAAVLGVDDEQYGQRLAAFVVPAAGASVTVEELKQHVRENLA
NYKVPRDITIMAELPRGSTGKILRNELRGR
120405178YP_955007.1 hypothetical protein Mvan_4224 [Mycobacterium vanbaalenii PYR-1]MQVVAYPFMKRLNGMDAMLLYSETPNLHTHTLKVAVIDASNCADGYDFDA
FRRTVARRLPLLDPLRYRLIDIPWRLHHPMWLEDCPVDLDYHLRRVRVPA
PGRRRELDRVIGEIASTPLDRSRPLWEFHFAEGMADDRYALIGKVHHTLA
DGVASANLLARLMDLTGTPPNHHADPVVVCEEPTRRELLWEAQLDHFRNI
AELPGLVADAASGLSRLRRRAKERNSVLDLAKPFNAPSTFLNHVVSPVRT
FATAALPLAEVKETAKHLGVTFNDVVLSLAAGGLRELLLRYDGQADRPIM
ATVPVSTDKSTDRITGNEIGGMMVSLPVHIDDPLERVRLTSMATRRAKET
NDLLGPTLQGRMLEYLPPPLAPALFRAQAKRADHNRLMNVAVSNVPGPRR
RGHIGGAPVSEIYSVGVLSAGSAFNMTVWSYVDQVDIAVLSDDRTFDEPH
EATSAVTRAFDELRRACGLARATAVESAMPPASAG
120405177YP_955006.1 hypothetical protein Mvan_4223 [Mycobacterium vanbaalenii PYR-1]MTASELSIPQDWDEITPAWMTSALAQHFPGAEVGHVRVALRDDGTNRRAR
LALDYSVGSGPATVFAKAVDPAHADLVELTSGLYHEPRLFSCGARLPLDH
PEVYLAAIDEERRDFLMIMEDVASRGADPRDSTRPMTVEQAAAGVRGLAR
LHGEYWGERLTGDPALNWVEPFVAFEGLEYAPLHIAHERLGDTVPAEVLD
LSGTDLFVDIWARYIGSLTRSVPTLLHGDPHIGNTYVLPDGTVGFLDWQM
VRRGSFSLDLGYFLQGSLTTEDRRRAEHDLLDEYRAALRLPAQELPTRED
IWLGYRASVAHGLAIWMATLSGGDAWQRADICLAFAQRYAAAFVDLDTRE
ALDAIT
120405176YP_955005.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMAGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKQIDSVLIPL
SSPEDLAETADLVKNAGGRIHTAEVDVRDFDALKAAVDAGVEEFGRLDII
VANAGIGNGGQLLHDTGEPDWDDMIGVNLSGVWKTVKAGVPHILAGGNGG
SIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRTFAVELGAQNVRVNSVHP
TNVNTPLFMNEPTMKLFRPDLENPGPEDMKVVGQLMHTLPIGWVEPEDIA
NAVLFLASDEARFITGVTLPVDGGSCLK
120405175YP_955004.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTISADDSDVQNADTAAELYYDPYNVDLNMDPHGVFARLREEAPLYYNDK
HDFYALSRYEDVNKGVIDHQTFISGRGALLEIIKSGMEIPPGTLIFEDPP
IHNIHRNLLSRVFTPRKVQALEPQIREFTARCLDPLTGTNRFDFVRDLGA
QMPMRVIGMLLGIPEEDQRRVTDHGEATLQSDSVDLMATGEVFAEFIDHR
TEHPSDDIMTDLLNAEFEDETGTRRRLRRDELLMYLTVIATAGSETTTRL
IGWAGKTLADYPEQRAQLVADPALIPQAIEEILRWEPPALQIARYVTRDV
EYYGQVVPEGSAMLMLVGSANRDHRRFPPNGDVFDIHRELRSHMTFGAGT
HFCMGNALARLEGKIALEEILKRFPTWEVDWPNAVPSQTTAVRGWESMPT
IVS
120405174YP_955003.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MARRSPVQSVRVLPNRPASEPPVTSPSEEPAWKQRAVERSIKTAKLRAAQ
RVQRFLDAAQAIIIEKGSTDFTVQEVVDRSRQSLRSFYLQFDGKHELLLA
LFEDALSRSADQIRAATGGHEEPIERLKVAIQLLFESSRPDPAAKRPLFT
DFAPRLLVSHPSEVKVAHAPLLALLTELMEEASAAGQLRDGINPKRMAAM
TMQTVMFVAQSSGDVDENAANPITADEVWDFCAHGFAAV
120405173YP_955002.1 enoyl-CoA hydratase [Mycobacterium vanbaalenii PYR-1]MYIDYDVTDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDNEVSVIV
LRANGKHFSAGHDLRGGGPVPDKITLEFIIAHEAKRYLEYTLRWRNVPKP
SIAAVQGRCISGGLLLCWPCDLIVAADDAQFSDPVVLMGIGGVEYHGHTW
ELGPRKAKEILFTGRAMTAEEVAATGMVNRVVPRDQLDAETRTLAEQIAK
MPPFALRQAKRAVNQTLDVQGFYAAIQSVFDVHQTGHGNALSVGGWPVLV
NLEEMKANIK
120405172YP_955001.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMAPGMDEASLDMLEASLRKTMLSSSGPELDAALTEMGWADMLSEVPELAV
PLVFRLLGETGSHASVLVDVVLHATGNTIGDTVELPLPYAGNGWVVWDRG
GASEATGDDRSPESLDPTLGGLPLRREEEGYPIRLAEARVAVGWWLVGSA
RAMLSLARQHALDRVQFGKPIASFQAVRHRLAETLVAIEGAEATLSLPGA
DNPDLTALLAKAAAGKAALTAAMHCQQVLGGIGFTEEHHLHRHVKRALVL
DGLLGSSRELTRRAGAGLRARGSAPRLAQL
120405171YP_955000.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTVAVDTSNASEFRSQLKAWLDENDLTPPADHSLQGHIRQFARVQRALYD
AGWSRYGWPEHAGGLGGPAILRAIVGEEVVGRRLAEPGPYSMLEVLAPTM
IDYAPAELAAEMVPKLLSGEEQWCQGFSEPGSGSDLASLTTRAVQDGDKW
IINGQKVWTSFAQYSHRCILLTRTGDADTPNHKAITAFFVDIDTPGVTVR
PLRTMHDVDEFCEVYFDDVAVDSSRMLGQPGDGWQLAMDLLPYERSTCFW
QRIAYLYSRFDALVDEVKRQGQSVDQDMGEVYLALHTLRCRSRATQHRLA
DGHKLGPDTSIDKVLLATAEQRLYDTARDLLPGVVELDDTEWRTEYLYSR
AATIYGGTAEVQRNIIARRLLDLGKE
120405170YP_954999.1 hypothetical protein Mvan_4216 [Mycobacterium vanbaalenii PYR-1]MSTQPTRTEDLVEIQQLLAKYAVTITQGDIDGLISVFTPDGTYSAFGSTY
TLARFPELVDAAPKGLFMTGTALVDLNEGEDTASGTQPLCFIEHSKHDMR
IGYYRDTYVRSDDGWRLRTRAMTFIRRSGEHDSGRPHAIGRPEAG
120405169YP_954998.1 amidohydrolase [Mycobacterium vanbaalenii PYR-1]MLTLKAAGLLDVVSGEIIRPGVVTVDGDRIVSLGGTPPPDVEVIDLGDSI
LLPGLMDMEVNLLMGGRGENPGLSQVQDDPATRVLRAVGNARRTLRAGFT
TVRNLGLFVKTGGYLLDVALGKAIDAGWIDGPRVIPAGHAITPTGGHLDP
TMFAAFMPGVLELTVEEGIANGVDEIRKAVRYQIKHGAQLIKVCCSGGVM
SLTGEAGAQHYSDEELRVIVDEAHRRGLRVAAHTHGAEAVKHAVECGIDC
IEHGFLMDDEAIQMLVDNDRFLVSTRRLAEYMDVSKAPPELQAKAAEMFP
KARTSIKAAYEAGVKIAVGTDAPAIPHGKNADELVTLVDWGMPPAAVLRA
ATVVAADLINRSDSLGRIAEGYLADIIAVPGDPLADIGVTKNVTFVMKGG
KVYKNEHATDTN
120405168YP_954997.1 hypothetical protein Mvan_4214 [Mycobacterium vanbaalenii PYR-1]MSETNGTKERLLPEEFADLERFSDWILPTEPERYAKRLASTMEEMQNLYD
VGMARLEDVMVYLDARFPLHGMPDDAKRLMHLMQSVVMVSFPVEVWKQPR
VLDSGAAWVEIVREPVV
120405167YP_954996.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMAHFPKPAAGSWTENWPELGTAPVDYTDSIDPEQWKLEQQAIFRKLWLHV
GRVERLPKAGSYFTREMPSVGAGTSIIVNKDKDGQVRAFYNLCRHRGNKL
VWNDYPGEEVSGSCRQFTCKYHAWRYALDGELTFIQQEDEFFDVDKADYP
LKPVRCEVWEGFIFVNFDDDAEPLVDYLGDFAKGLEGYPFHEMTEVYSYR
AEINSNWKLFIDAFVEFYHAPILHMKQATAEEAAKLAKVGFEALHYDIKD
QHSMISSWGGMSPPKDLNMVKPIERILHSGLFGPWDRPDIKGILPDELPP
AVNPARQPTWGQDSFEFFPNFTLLLWAPGWYLTYNYWPTAVDKHIFECNL
YFVPPKNTRQRLSQELAAVTFKEYALQDANTLEATQTQIGTRAVTEFPLC
DQEILLRHLHHTAHKYVDKYKLEQAAKAATNGSASKTEKEGANV
120405166YP_954995.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MRLAPLPADQWDGVAEQALSGLMPAELRNPETAGNLVGTLLRHPKLARAF
LRFNFQLLYGTTLPERLREFVVLRVARLSNCEYEWRHHVAMGRDAGLSDD
VIAGIERGEAVDEFDRAVLTAVDELHHDSVISDSTWTALSSHLDERQLMD
LVFTIGCYGALAMAINTFGVEPDQER
120405165YP_954994.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MSRAPARKGGNGRSAVMNRDDMILISVDDHIVEPPDMFKNHLPRKYLDEA
PRLVHNPDGSDTWQFRDVVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGC
WQVDERVKDMNAGGILGSMCFPSFPGFAGRLFATEDAEFSLALVQAYNDW
HVEEWCGAYPARFIPMTLPVIWDPEACAKEIRRNAARGVHSLTFSENPSA
MGYPSFHDFEHWKPMWDALVDTDTVLNVHIGSSGRLAITAPDAPMDVMIT
LQPMNIVQAAADLLWSRPIKEYPDLKIALSEGGTGWIPYFLERVDRTYEM
HSTWTGQDFKGKLPSEVFREHFLTCFIADPVGVATRHQIGVDNICWEADY
PHSDSMWPGAPEQLDEVLKVNSVPDDEIDKMTYQNAMRWYHWDPFTHIPK
EQATVGALRKAAEGHDVSIQALSHKEKTGATFADFAARAKEITGNTD
120405164YP_954993.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMTSMPGGMSFELTEDQELIRKSVRELASRFDDHYWMEKDQAHEFPQEFYD
AIANGGWLGMTIPEEYGGHGLGITEATLLLEEVSRSGAAMNGASAIHLSI
FGMQPVVKHGSDELKAATLPRIVNGDLHVCFGVTEPGAGLDTSRITTFAK
REGDKYRVNGRKVWISKALESEKILLLTRTESPDDLEKRGAKKTDGMTLF
LTDLDRNHVDIRPIRKMGRNAVSSNEVFIDDLMVPVEHRVGEEGKGFKYI
LDGLNPERMLIAAEALGIGRVALEKAVKYGNERHVFNRPIGMNQGLQFPL
ADSLARLDAAELVLRKATWLYDNGKPCGREANTAKYLCADAGFGAADRAL
QLHGGMGYSEEYHVSRYFRESRLMKIAPVSQEMILNFLGEHVLGLPRSY
120405163YP_954992.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMRGYFDLAGRSALVTGAAGGIGSAVAQALADAGAAVLVTDIDKDAAAVVA
QRISDSGGRAEAAALDVSDRDSADAAAAQAAALTGGALHIVVNNAGVTRP
AMFDKTTPESFRLLFDIHVMGAFNVTQAALPFIPIDGTGRIVNVTSAAGL
TGTLGQVNYSAAKAGIIGFTKSLARELATKGITVNALAPLAATPMTETIR
TNEKFAANMMNRIPMKRWAEPSEIAGAFVFMASDAASYVTGQVLPVDGGM
VI
120405162YP_954991.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMSSSQPSAAPLAGVTVVAMEQAVAAPMCTRVLADFGARIIKVENPNGGDF
ARDYDDVVNGPGGLAAHFVWSNRGKESVTLNTKTAGGLDLLHRLLDRADA
FVSNLAPGATARLGVAPADLAARHPRVIPVEIDGYGPGGPLSHKRAYDLL
VQAESGSCAVTGYPGMPAKPGPAVADFSTGLYAAISILALLYGRARHPGS
APAPSVELSLFDVMTDVMGYALTYTQHSGIDQEPLGVGSPAVAPYGAFPT
RDGQTVVLGTTNDREWQRVAREIIDRPDLADDPRFATNSDRCAHRQILEE
AIGSWCAQHDLAEIQKTADAAGIGNSRYNLPSEVVVHPHLAARDRWRTVA
TPKGDIQALRPPPVISDFEQPMGAIPGLGEHTDAVLTEIGVTPDELRQLR
ADGAIGPAYRG
120405161YP_954990.1 enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]MVDDQVLLSTDRDGVRTLTLNRPERRNALDARLWVELADALRDLKRDHDV
RALVLTGAGGAFCSGADIGTGEQIHPRYKLDRLTDVALALHELAVPTIAK
VTGIAVGAGWNLALGCDLVVATPESRFCQIFSKRGLSVDLGGSWLLPRIV
GLQQAKRLVLLAEMIGADEARDLGLVTWVKPSGEIDAFVDDLADRLAGGP
PFALAQSKALLNDGANATLREALANEARAQPGNFATADSVEAYAAFAAKR
EPEFTGAWVQYEKPTQKDEE
120405160YP_954989.1 acetyl-CoA acetyltransferase [Mycobacterium vanbaalenii PYR-1]MRETVIVGAVRTPVGKRNGGLSEQHAADLSAVVLNELVERTGVDTDVIDD
VIWGCVSQVGDQSSNIGRYSVLAAGWPEHIPGTTVNRACGSSQQALDFAV
QAVMSGQQDVVVAGGVEVMSRVPLGAARATGMPYGPKVFARYDDFSFNQG
ISAEMISQKWGFSRTQLDEYSALSHERAAAAQDAGAFKDQIVPVFTDGGI
VTDDEGIRRGTTVEKLAGLKPAFTEDGVIHAGNSSQISDGAAALLVTTME
NAVNLGLTPLVRYRAGAVTGADPRLMLTGPIPATEKVLHKAGVTLDEVGV
YEVNEAFAPVPLAWLADTGADAAKLNPLGGAIALGHPLGASGAVLMTRMI
HHMRDNGIRYGLQTMCEGGGTANATLIELVK
120405159YP_954988.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMRRDLFTEDHEAFRELARDFVDKEVVPHYPQWEKGGRMPREVFERMGGLG
ILGVAIPEEYGGGGQPDYRYNVVLQEEAARALVTLSTVRTQLEVILPYFL
HYANDEQRDRWFPGLASGTVLTAIAMTEPGTGSDLAGMRTTAVRDGDDYI
VNGAKTFITGGMQADLVIVVARTSTDPDNRRKGLTLLVVEDGMDGFTRGR
ELEKMGCKVQDTAELSFVDVRVPAANVLGEVDEAFGYLGHNLAQERLTVA
VGSVAQARSAIAAAIEYTQSRKAFGTPVASFQNTKFELAACSTEVEAAQA
MLDRAVSLHVEGELSGADAARTKLFCTEMQQRVVDRCLQLFGGYGYMMEY
PIARLYTDARVARIYAGTSEVMKVMIAKSLGL
120405158YP_954987.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSAPESAASDLGNAKRPYATLFAKGEDRRQRILAVAERLLARNGWRSTSL
AQIAREAGVTPAGLLHHFESKEQLLNAVLDARDADDDAHADRSGDLIAEL
TRVPKRFERSPELVGTFMVLLAENLAPDAPLHDRLHQRYRAAADIIKDLI
TRGQQKGLYRKDFDAATKATEILAFINGMEIQWLLDPSIPLTEVYQGYAE
SLARDLAAQPSPT
120405157YP_954986.1 hypothetical protein Mvan_4203 [Mycobacterium vanbaalenii PYR-1]MRYRLDVVAPNVADAVRCAGGWVYDRVMAGWDVTVLVGADEDVRPLEILG
AATLDLESVLAAWEQRPHPQTVAVAAGLFGRDERVRRGVLGALEQGGTEV
TLWGGPVPSELGGSVDPVQHRLSAAARAFKAAALAAACGAATEPVGLSET
FCCGMMASVAADLVPAS
120405156YP_954985.1 alcohol dehydrogenase [Mycobacterium vanbaalenii PYR-1]MRAAVCPQYGPPEVVRVEERPEPSAGPGQVVVRVEAAAVNFPDVLLVADS
YQVSVAPPFVPGSEFTGVVDEIGPHTTGFTVGERVAGTGMFGAFAERVVA
DAAGLTPVPDGVDARTAAAFGVAHRTAYHALRSTARLSAGDELVVLGAGG
GVGLATVQLGVALGARVTAVASSNEKLAVAGGYGAATLINHRDGELRQAL
RQAIPDGADVVVDPVGGDVSEPALRSLGRGGRFVSVGFASGVIPRIPLNL
VLIKGVHVLGFQFQDVPADEFTRNEVELRELLVSGRVKPHVGAVYSLDDT
VAALRHVSDGRAIGKVVIDLS
120405155YP_954984.1 aminoglycoside phosphotransferase [Mycobacterium vanbaalenii PYR-1]MSESLDTARLADWMDNSGHPGKGEPLAARFLSGGTQNVIFEIRRGDHHCV
LRMPPPGAPSDRDKGILREWRIIEALDGTDVPHTAAVGVCTDASVLGRPF
YLMGFVDGWSPMDTHGKWPEPFDSDVSTRPGLSYQLAEGIALLSKVDWRA
KGLQDLGRPDGFHERQVDRWIGFLERIKRRDLPGLEVATDWLRAHKPLDF
IPGLMHGDYQFANVMYRHGAPAQLAAIVDWEMGTVGDPKLDLGWMVQSWP
EHTDAPEPSEMGYVDMRGMPSRDDVVAHYAEVSGRQVDDLDYYLVLAKWK
LAIVLEQGFQRAGDDEKLLAFGPVVTGLMASAAELAESTDYRG
120405154YP_954983.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMWSFETDPEYQKVLDWADEFVREEVEPLDLAFPHQQFVPLDGERRRAIDP
LKEEVRRRGLWATHLGADLGGQGYGQLKLALLNEILGRSQWAPVIFGCQA
PDTGNAEIIAHYGTEEQKQKYLRPLLDGELFSCYSMTEPHAGADPTMFTT
SAVRDGDDWVINGWKFFSSNAATASFLIVMVVTNREVSAYQGMSMFLVPT
DTPGVKIERNIGLYGEGAEHGSHALIHYDNVRVPAEALLGGEGQAFVIAQ
TRLGGGRIHHAMRTIGLSRKALDMMCERALSRETQGSRLSDKQFVQGYIA
DSYAQLLQFRLMVLYTAWEIDKYNDYKKVRKDIAAVKVVMPTVLHDIAWR
AMQVHGALGVTNEVPFLGMVTGAAVMGLADGPTEVHKTTVAKQVLRDYRP
AEGLWPSEWIPAKREAARAKYAEYLENEVGNL
120405153YP_954982.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MPHKPGREERRQLEPSGDERQQGEHQRGGPQHTHATHSAEDDLQVPIVRL
RSTIGSHDFACYLHDVAATRPDTQPDHGQRRASFQRARSRETKRMLVQAA
MALWRTKGYATTTVADICTAAGVSKALFYFYFPRKEDVLFEVGVLSTQSA
HRTIHALLKKPYEIESVVSAALTAFERSMARNPRELIIETILEGYRHEHR
IMADGSPPDVDADMFTELFTRARSDGKLPGTVDTAHLAYLAQTMVSEGAR
HWAAGAFGSRSFAEVVTADICTLVNGYTARRPHVEFRDRP
120405152YP_954981.1 luciferase family protein [Mycobacterium vanbaalenii PYR-1]MRIGLMVGSDRDRPRPDRLDGVITDGTAAEALGFSSFWFPQVPGYLDAMT
ALALLGASTTTIELGTAVVPIQTRHPMILAQQGLTTNAACGGRFTLGLGL
SHDWIINGQLGIPYQRPVRELRDHLEVLTAAFDGPGQVDVDNDSFRVHSP
VDVSDLSPPVLLAALGPTMLRIAGERTDGTILWMADERAIAEHVAPRITA
AAHAAGRPAPRVVAGVPVAVCAPGDVDAAQRYASELLGHAHFSPNYVALL
EHGDAADVGDTMAAGDESCVLNRLRAYRDAGVTDLAARIVPLGDDPASRR
RSRERTAEFLASVVSEF
120405151YP_954980.1 von Willebrand factor- type A [Mycobacterium vanbaalenii PYR-1]MTTERCEPDRFRFLAGFLAGRPVGVAEVPAGGSAYTDGRVVFVSANADED
TQRREVLVQSALLGAGSLDAEYVRRLRARPPLARRYLALEAHRVLAELAQ
RVPLAAAVGPAAPPQSTSSEESLNIASGRTKLDAPPDWFGTIKPSKLIHA
GVESGGRATDADIRTAVEHADGSELDDDDDDGPAEKSWLLRLFEVPLGAQ
APANFLRTLFGRSRSSGSEGAGGELGVGSIQRMSRAGVHARPLPTPIRFT
GDEKPGAAIGIGGAWYPEWDVYRGGYRQDWCRVIDFPVTAAAGATVAGAE
RDAALGRRLARIGLGPKVLHARADGDDVDTEALIDLFVDLRSGHSPPEHV
YTERRKLARDLGVLILVDASGSATDADGDGLAVHEHQRRAAATLALTLEE
LGDRVAVYGFRSQGRRAVHLPVIKSFGERFGAKGPARLGQLHPSGYTRLG
AGIRGAGDILKKQAGTPHRLLLVLSDGFPYDDGYEGRYAEADSRKALEEL
RADGVGCLCLSIGAATDAEAMDRVFGSASHASGATLAELSSRMDEWFLAA
LKELSVPRPREVYAARRRRK
120405150YP_954979.1 ATPase [Mycobacterium vanbaalenii PYR-1]MTVNNFRLTTEAGSPAPFYRAAGPEVEIFRAAARRGSPVLLKGPTGCGKT
RFVEAMAHDLGRELITVAGHEDMTSADLVGRFLLKGGETVWVDGPLTRAV
REGAICYLDEIVEARQDTTVVIHPLADHRRELPIDRLGTTLSAAPGFQLV
ISYNPGYQSILKSLKDSTRQRFVAISLDFPAAEIETEVVAQEAGIDESTA
GSLVALGNAIRNLDGAALSEVASTRMLILAGGLVAEGLHLLDAVQSAVVE
VLSDDPDVIRGLGELVDAVLPRR
120405149YP_954978.1 hypothetical protein Mvan_4195 [Mycobacterium vanbaalenii PYR-1]MQPAGSAAPPTASTIVKGKPIMSDLSRKPAVTESVSGTADLGKQGPSQSN
AFKVWATVGAVFLAYTLYVFIRWVSGPYFEPVAGGPSEPPLYMKIPLMAN
AVVLWIGLPFALWFFLIRPWVREKRITLDGMLLVSMGLMMFQDPMLNYYS
TWCTYNAWLFNQGSWAPHIPGWVAHEEPGHTVPEPLLTNIPGYMYGVLLL
TIVGCALMRKIKNRWPGISNLRLVLVTYAVAIVFDFIMEGLILLPIGFYS
YPGAIQELSINAGTYYQYPIYEGFMWGGVQAALCCLRFFTDDRGRTVVER
GLDRVRGGFVKQQFVRFLAIFGGVSACFFLFYNVPATWLGMQGDPWPEDV
QKRSYFNPGICGEGTDRPCPNPDLPLPTKHSGYVNHDGELVLPEGVEIPP
VVPIQRPNSDDSQ
120405148YP_954977.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAERWTRERRLEHTRSVLLDAAEEVFAEKGFTPATLDDIARTAGYTKGAI
YKHFATKEDLFLAVSDRYWRRYFDNFAEVMASASRVGAHELDEIAERWRQ
LSIDRGADHAALGLEFTLYLLRNPDARERVAAKRAEVVDQLAKFINEGMT
RLGASLLISPLTFAQALVATSDSVVLASQLDDIDLYRPVVEMYTSVIKLP
D
120405147YP_954976.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MAERWTRQRRVEHTRTLLLDAAEEVVARLGFGAAALEVIADAAGYTRGAI
YSHFGTKEELFLAVMERQLQRFLDGFTDIVESFQSLEELDVDKLAGRWRE
LTIGNPDRAALGYEFTLFLVRNPEARARVAAQRRQTADSLAGYITSHIEK
IGGRMRVPAATLARVLIATNEGVTLGSHVDGEDLFRPFLEMVLGNVEPAG
120405146YP_954975.1 hypothetical protein Mvan_4192 [Mycobacterium vanbaalenii PYR-1]MDLVDRIAKHRRMAESYRDKYVLQKVQEGESYDEWEFADDAVYTSPYFVA
DQELVLKDVATHWDTAATIEAKAYGVTFPDWRPVDFKVWPAENGFVQRYR
WEGTNVNTGETMGFYSISFVETDDECRIVHWSTYVNDDEYGPFLEAAIGA
RGPFHGDEYMQALARHFEKHSITL
120405145YP_954974.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMPGRVEGKVAFVTGAARGQGRSHAIKLAEEGADIIAIDVCKNVDNVQLDL
ATPGDLLETKARVEALGRRIIAEEVDVRDYDAMKAVVDRGVAELGRLDII
LANAGIGNGGQTVETLEEDVWQTMMDVNLTGVWKTVKAGIPHMIAGGRGG
SIVLTSSVAGLKAYPQMSQYVSAKHGVVGLMRSCATELGQHMIRVDSVHP
THVNSPMVMNDETFRMFRPDLENPGPDDIAPICQMFHTMPRPWVEVEDIT
NAVMFFASDDSRYVTGVAMPIDLGSCLK
120405144YP_954973.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMARFPKPPEGSWTQHYPQLGTGPVSYRDSVDPAFYELERKAVFRRAWLNV
GRVEQIPRKGSYFTKEMKVVNTSIIVVRTTTGEVKAYHNICRHRGNKLVW
NDMPLEETSGVCRQFTCKYHAWRYDLDGNLTFVQQEGEFFDLDKSRYGLV
PVHCDVWEGFIFVNFAKQPEQSLRDFLGPMITDLEGYPFDRMTSRFHYRS
EVKANWKLYMDAFQEFYHAPVLHANQSPTAYSKAAAEAGFEAPHYRIEGP
HRLVSTSGIRAWELADEMRKPIEDICESGLFGPWDKPDLGEMPVGLNPAK
CDPWGLDSFQLFPNFVMLFWGQGWYLTYHYWPTSHNTHLFEGTVYFPQPR
TPRERIAQELAAVSFKEYGLQDANTLEATQSMVESEVLDEFVLCDQEVLI
RHLHTETAAWVDEYRRKTAGV
120405143YP_954972.1 hypothetical protein Mvan_4189 [Mycobacterium vanbaalenii PYR-1]MSMAAQAATAKLPPEFADLEAFSDWCLRSEPERYAKRLSSSMPELQAFYD
AITARAEEAIAYCDKFSLDDMPEDVLNLMHMLYSMIQASFPVECWKQPKV
PDTGATSLDCDAEPVP
120405142YP_954971.1 amidohydrolase [Mycobacterium vanbaalenii PYR-1]MTGTVLKAARWADVEAGVVRAPAVIVVEGNRIQAINPAGEPADSPTVIDL
GDVTLLPGLMDMELNLLIGGPGGPEGLPSPMHGVQDDPAYRTLRGAVNAR
TTLDAGFTTVRNLGLMVKTGGYLLDVALQRAIEQGWHVGPRIFPAGHAVT
PYGGHLDPTVFQRLAPGIMPLSVAEGIANGVDDVRACVRYQIRHGAKLIK
VSASGGVMSHSTAPGAQQYSDEEFAAIADEAHRAGVRVAAHAVGDSAIRA
CIRAGIDCIEHGFLASDETIQMMADHGTFLVSTTYLTEAMAIDRIAPELR
KKAEVVFPQAQAMLPKAIAAGVRIACGTDAPAIPHGQNAKELRALVSRGM
SPMQALRAATMTAAELIEADDELGRLAPGYLADIIAVAGDPSNDIATTLD
VRFVMKDGVVHKGAEGGGREG
120405141YP_954970.1 MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MDARDVTGIELTDNILWLLKQAFYFSLTTVNEAISEHGVSTAQIGVLRQL
ANEPGLSGAELARRLLISPQGVQLALTALERQGLVERKQNPAHGRILQAF
LTDKGRKVAAAVLHDAIAAHDRVFGVLSKAEQQTLRELLGRVVEQGTGHE
LYTDHVDP
120405140YP_954969.1 ferredoxin [Mycobacterium vanbaalenii PYR-1]MAEELTDPAEGFAPLRIRRVVRETADAVSLVLDVPECCSHRFQYKAGQFL
TLRVSVGGRDLRRCYSMSSAPVEDELRITVKRDPGGVVSNWINDTAAAGD
ELHAAPPEGRFTLTESDSSPRELVAFAGGSGITPIMSLVRAALAGSDRTV
KLFYANRGRDSVIFSEPLARLAEQHADRLTVEHHYDEDAGVVTASAVESF
AARVGDADFYVCGPTPFMDTVETALLGAGVPKQRLHLERFTVAAAPDTVT
DGDAQACEEVVIELQRQKVTAAYRQGDTLLQTARLQGLKAPSSCETGSCG
TCMARIVEGSARMLNNDALEPDEVEEGWVVTCQALPTSSKVHMIYE
120405139YP_954968.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMTRVAVVTGGASGMGEATCHELGRRGCKVAVLDLDGQAAQRVAEELRGDG
VPALGVAADVTDRAAVEDAFAKVRTELGPVHILVTSAGLVDFAPFLEISP
DRWQRLIEVNLNGTFHCAQVAIPDMLAAGWGRIVMISSSSAQRGSPGMAH
YAASKGALISFTRSLAREYGPAGITVNNVPPSGIETPMQHQSQAAGFLPP
NEQMAASIPVGHLGTGDDIAAAVGFLCSEEAGFITGQTLGVNGGSVMA
120405138YP_954967.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMAKWPKPVEGSWTQHYPDLGTGPVSFRDSTSPEFYELEREAIFKRAWLNV
ARVEELPRAGSYLTKEIEVAKTSVIVVKGRDEQIRAFHNICRHRGNKLVW
NDYPNEEVKGTCRQFTCKYHGWRYNLTGDLTFVQQPGEFFGLDEKDYGLA
PVHCDVWNGFVFINFDREPRQTLREFLGPMITALDDYPFESMTERYDFVA
HNNSNWKIFADAFQEYYHVPSLHSQQVPSAVRQPNATFECGHFQIDGPHR
LVSTAGTRRWLLAPEYMYPVERVTRSGLVGPWRTPETHQSAGLNPGGIEP
WGITNFQIFPNLEILIYHGWYLLYRYWPTSHSTHKFEAYNAFHPARTVRE
RIEHEVASVVLKEFALQDAGMLGGTQAALEYGLDEPIVDDYPLNDQEILV
RHLHKTAVDWVEEYQNERRPVGV
120405137YP_954966.1 hypothetical protein Mvan_4183 [Mycobacterium vanbaalenii PYR-1]MAEPKLPGTFAEFERFAEKWCLATEPDRWQMRLSTPMGEIHEFYDAFTPR
FEEAIDYCDKFPLDELPEDVLNLLHLIYSMIMVSMAVEVFGTQKPADSAD
AVIDRVGAPVP
120405136YP_954965.1 taurine catabolism dioxygenase TauD/TfdA [Mycobacterium vanbaalenii PYMTLLTINKLTSSVGAEVTGLDPGRLAGDDALGTAVLDALEDNGVLVFPGL
HLEPEVQVEFCRRLGEIDFSSDGHHRVAGIYPVTLDKSKNSSAAYLRATF
DWHIDGCTPTGDDYPQMATVLSAKQVAESGGETEFASSYAAYDALTDAEK
QRFASLRVVHSLEASQRRVNPDPSPEELARWRARPTHEHPLVWTHRTGRK
SLVLGASADYIVGMDPEEGRALLSELLDRATTADKVYSHHWAVGDTVIWD
NRGVLHRAARYDENSPREMLRTTVLGDEPIQ
120405135YP_954964.1 carboxymuconolactone decarboxylase [Mycobacterium vanbaalenii PYR-1]MSPLPTEEWDDEVLDALAPLLPPSRSNPRDAGNVLATLVRHPALTRAYLH
FNAHLLLASTLSPRIREVALLRAVHVRRSDYLWEHHIPIAQRAGITPDEI
DAIRQGRPADEIDRLVVGAVDELDAANTVSDATWSALRDHFDERQVLDLI
FTVGCYQLLGAAVNTLGVQPEPH
120405134YP_954963.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MAEDLTTVDFFRDSRLTDDPYTFYEALRNKCPVSREEHYGVTMVTGWQEA
VDVYNDAESFSSCVSVTGPFPGFPVSLEGRQDDDITALIEQHRDEIPFSD
QLPTLDPPTHTNHRALLMRLITPKRLKENEDAMWQLADDILDDYLAQGEG
EFIKGFAGPFTLRVIADLLGVPEEDRPELLERLAKGTHGGGLGNADKTLT
KTPLEYLYDVFATYVEERRAEPRDDVLTGLATANFPDGTVPEVGDVVRVA
TNVFSAGQETTVRLLSTALKVIGDRPDIQERLRADRSLLPNFIEECLRIE
SPVKGDFRLSRVPTTIGDQALGAGCTVMVINGAANRDPRRFEDPDAFDPE
RKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTSDIRISESKHGP
AGNRRYDYIPTYILRGLTELHLEYDVR
120405133YP_954962.1 ferredoxin 1 [Mycobacterium vanbaalenii PYR-1]MKVAVDEDRCAGHGMCLTLCPEVFSMTDDGWAVADPGDVPAGLEPAVREA
IDNCPERAIREID
120405132YP_954961.1 hypothetical protein Mvan_4178 [Mycobacterium vanbaalenii PYR-1]MAKGYVIITEDIKDPAGMAEYGKLASQTMGNAKVLAFGPAAESLEGQWHG
TQTVLLEFESVEAAKEWYYSDEYQAAAKLRQAAADCNGVIVAGF
120405131YP_954960.1 esterase EstC [Mycobacterium vanbaalenii PYR-1]MRFVLVHGGFHAAWCWERTIDALQALGHDAVAVDLPGHGDRVDEESTLAN
RREAVVAAMQAGGGKCVLVGHSGGGFDATLAADARPDLVHHIVYLAAALP
REGRTYPEAMAMRDAEQGPAELGDEFDGDVGEMLGYLNFDEDGAMTFADF
EGAWKYFYHDCDEATARWAFERLGPERFGDTTVTPVSVPDFWAADLPRSF
IVCEQDRSMPRWLADTVARRLGVEQLTIDASHSPFLSRPRELAELLVRAT
TTTPVSPLVPH
120405130YP_954959.1 hypothetical protein Mvan_4176 [Mycobacterium vanbaalenii PYR-1]MSKKIEVDFGLCESNAVCMGIIPEVFQVDEQDYLHVLQEDVTPENEAQVN
EAVRQCPRQAISIVDK
120405129YP_954958.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MTAPELRFDPVSQDYFDNPYEIYRRMRDEAPIYYDAEEDFYALTRHEDVA
AALKDHEAFSSARGCDLGMVRSEDGPVKSIIFMDPPEHRHMRSLLNKAFT
PRAIQSQRETVIELVEHYLSKVDPDNFDVVQDFSGPFPVEVITRMAGVPE
EFRQQVRHWIDKGLERKPGQIEWSDENMQANIDSGVYYYGLVQERRRNPQ
DDMISRLIAAEIPGENGEMRKLDDIEITGFTSLLGGAGAETVTKLLGSAV
VEFARHPEQWQMLLDDRNLIPDAVEELLRYVGPVQYNVRYTVKEAHVPSG
TIPAHKPVFLMKAAANRDPRAFDNAETFDITRDRTQAQNLGLGYGIHSCL
GAALARTETAIALEHLLDFMPRFEVDFSGLQRVNMQNVAGYHHVPVKVLR
120405128YP_954957.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MGAPMVTRLVQAGHDVRALGRSPDKRAAIGESRARAVAALDEVADGADVV
VVCVFTDDQVREVCLDGGLLDAMAPGSVLVVHTTGSPRTVEALAARAPAV
AVLDAPVSGGPHDIAAGQITLFVGGDATAVERARPVLAAYGDPILRVGEL
GAGQWVKLINNTLFAAQLGMLREAASFGARVGVDEAGLLGAIGHGSGASR
AAEIVGTRGSVQSFIESVGEFLGKDVAVVREVAAETGSDLGLLEGLLDVV
VGAPSG
120405127YP_954956.1 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]MRVGFIGLGSQGGPMARRIAEGGFETTLWARRPASLEPYADTPAKTAATP
AELGANSDLVCLCVVGDDDVREVLYGESGVLAGLAEGGIIAIHSTVHPDT
CREIAEKSAAQGISVIDAPVSGGGPAVEQGTLLVMVGGDEEVAQRCRPVF
ATYADPIVHLGPLGSGQNTKILNNLLFSANLGAAVSTLELGESLGIPRQK
LVEVLNRGSATSKAVASISMFGGTLEGLAPIAGALLQKDVRHAASLAASA
EAAEGAVFTAADAALEAMDHRR
120405126YP_954955.1 hypothetical protein Mvan_4172 [Mycobacterium vanbaalenii PYR-1]MTSESPRPRVVLVDGVPMSALVAQAPDPRAVILAVHGGATSSAYFDCPGR
PDLSLLRAAATAGFTTIALDRPGYGTSAVYAAEFADPARRVASSFAAVDK
ILAGADRGAGLFVLGHSAGCELALRMATSGDDVVGVELAGTGLRYGEKAK
DVIATATVTNRPAGLRDLLWEPTDLYPAEVLTGALSAPGVAYEGDVTANW
ARRDFPAIAADVRVPVQFSIAEHEKVWETDPEAVSAIAGLFTASPRVRIN
EVAASGHNLSVGLTAGEYHRTVMSFIDECIAAADGRDREQVEAS
120405125YP_954954.1 hypothetical protein Mvan_4171 [Mycobacterium vanbaalenii PYR-1]MSRLPLPQLTFDNEFFWKSGADGVLRIQECGDCKALIHPPQPVCRYCHSH
NMGPREVSGRAVLSAFTVNHRFSIPGLQAPYVVAQVAIEEDPRVRLTTNI
IDCDPDELELGRVVEVVFEENDDVWLPLFRPTAETETAPLPEDEIAPQDF
GKFVRPMLTTEKFEDAAAITGIGASRMGRRLMVSPLSLTVEACEAAIADA
GLTLADIDGLSTYPAMDAMGMGEGGVTALEGALGIRPTWINGGMDTFGPG
GSVIAAVMAVATGMARHVLCFRTLWEATFNQLMKEGRVSPPGGTRVNSWQ
APFGATSAAHTLALNAQRHFHRYGTTKETLGWIALNQRANAALNPTAIYR
DPMTMDDYLNARPITTPFGLYDCDVPCDGAVAVVVSAVDAAVDLPKPPVY
FEAVGTQIIERTDWDQTTLTHEPQVLGQAAHLWTRTSLRPADVDVAELYD
GFTFNCLSWLEALGFCGIGEAKDFLDGGKAIARDGVIPLNTHGGQLSHGR
THGMGLIHEAVSQLRGEAGERQVDGARVAVVSSGGLTPSGALLLRTAT
120405124YP_954953.1 hypothetical protein Mvan_4170 [Mycobacterium vanbaalenii PYR-1]MTDRMRIKLDRTLCDGFGICAKHAPEYFSLDDWGYAVLVGDGDIPERDRD
AVSRALMDCPVHAILEIGERRPDGTGIQPLREPDLENLKTEDNEAEWGFS
R
120405123YP_954952.1 respiratory-chain NADH dehydrogenase domain-containing protein [MycobaMSTAMNTELTVAAWPGLAPRLLRDGTDTESAAQYRDAGGYLPLSDVDALH
DEIARAGVLGRGGAAFPLAVKLSTVRRAHQSGRDTVLVANGEEGEPASVK
DRWLLRHRPHLVLDGLRLAARIIGARHTHVYVSDDRAAAAVLAALDEITP
DALDGVTVSVHTVAPGYVAGEETAAVRAINGGPAKPTDKPPRPFEEGVGG
LPTVVSNVETLANLPYVHRHDAAAYRELGTDGSPGTFLATLTGGGRPPGL
YEIPFGTAAAELIALHGVPAERVRGALMGGYFAGLVDRRILGGVLDHESL
RGLGSGLGCGAVSVITDECPVAVGASVLAYYDRENAGQCGSCFNGTAAMS
AAATALRDGIADGEDLARLRRWSEVLRGRGACATLDAACNIAASMLAMFP
EEVARHLDGTCVGCDAGGFTATRPFEVESL
120405122YP_954951.1 hypothetical protein Mvan_4168 [Mycobacterium vanbaalenii PYR-1]MRTAVVRIGVDLTGELTADELTAGTAELSRLAAEVGAELIDNNLAALPPK
RREVEILMAGTDPTMLQTRAASLCAKAFRTEPVIGVLTFISHGTDEDAHG
VLAGFGLTGVIERRPGDDGWDIITVTLRKSDLTRVPESRVHTALEASTNC
EVRIVTVD
120405121YP_954950.1 hypothetical protein Mvan_4167 [Mycobacterium vanbaalenii PYR-1]MPNQKIEINGGNVVYETLGDQGEFIVLTPGGRFSKDIPGLRPLAEKLVEG
GYRVLLWDRPNCGKSDVQFYGQSESHMRAETLAQLIAKLDIGPCIIAGGS
GGARDSMLTTMLYPELVRKLVVWNIVGGVYGSFVLGSYYIVPSILAVRGA
GMKAVSKIDEWQERIAENPDNETRILEQDPQAFLKLMLRWLNAFVPKPGQ
TIPGVEDEMFDNITVPTLIIRGGENDLDHPKRTSLEVSCLIKGSTLIDPP
WPEDAWERAGEDRASGKVKRFNMFDTWVQAAPAILDFLGR
120405120YP_954949.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii PMDKDKTPRLAQGREHVVATVDEIPPGTHKLVPIGRHGVGVYNVNGTFHAI
ANYCPHEGGPLCSGRARGRNIVDESVPGDAVMVRDMEFIFCPWHQWGFEL
ATGTTAVKPEWSIRTYPVRVVGNDVLVQA
120405119YP_954948.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MTVTANPRVAATERIAVRCVDSDVHPTPRRGELLPYIPEPWRSKYFLTRK
VGEQIYYDAPDYAHSYAMRVDTFPPDGEFACSDPDLAFKQLIMEAGADIA
VLEPAAYPARIPEAQHAMSVALNDWQANHWLDSHNNWHERWRGSICLAIE
EPEKSVEEIERWAGHPYMAQILIKAEPRPSWGNPKYDPIWAAATKHDITV
SCHLSRSHYDELPMPPVGLPSYNHDFMVTYSLLAANQVMSLIFDGTFDRH
PNLRIVFVEHAFTWILPLMWRMDALYEARKSWVDIKRRPSEYVKDHIKFT
TQPLDYPEDKTELSRAFEWMECEKILLFSSDYPHWTFDDPRWLVKHLPEH
AREAVMFRNGIETYKLPDTVPALEGQVRVF
120405118YP_954947.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MKVLSDGSAGALEAQVKVPVIDASVHIFCQSNKDLRRNFLQEPFRSRGFP
DYEMDWYGAPGGEYAERTTGPDDQYPGSDPEVVAKHLFTDRGVDIAVLHP
MTRGIMPDRHLGTALAAAHNEMMVTRWLDHPQLGEKFRGTLRVNPDDIAG
ALREIDKYKSHPRIVQLGIPLQSRELYGKPQYWPLWEAAVDAGWPVAVHF
EVGSGVQLPPTPSGLTRTYEQFVGFTALNFLYHLMNMIAEGVFERMPALK
FVWADGAADMLTPFIWRMDCFGRPHLEQTPWAPRIPSDYLPDHVYFVQGA
LDGPGDVDFAGEWAGFTGKDDMVMYGSSYPHWQLNELSVPTAYTPDQRDK
LCWRNAAALYGIESPVIPAVSTTAAAQ
120405117YP_954946.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMLLEFDADQKLWQETVRDAVSKQCPASLIRDIAENGADATPLWNSYLDAG
WTELTDPENAVELAIVLEELGRATDPTPFLATLTQFAPLVGDRYDSSVAG
TAVYSGVTANRDAQGWVLSGTDRFVLDGDRADRLAVVTPAGVFCVDPRAD
SANVTTRRVDVFDPVLHVAEVSFAGTQVSDSDRLLVDTERARHVALMGMA
VTMVGACQRILDLVLEHAKSRQQFGVAIGTFQAVQHKATDMFVAIERARA
LSYFAALTIAADDPRRRLAAAMAKASAGECQSLVFRHGVQLFGAMGFTWE
NDLQFALKRAKAGELMLGGAAEHRAMIAEEYREMV
120405116YP_954945.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaaMQLTFEPDVEEFRAEFSAFLDEHTPSAAETLERPRSVSHMPQWAREWQRL
LFDNGWLLPAQPPEFGGRNASVLQTFVHAEELCRRRIYHSFNPQGVNIIA
ASLLTFGTDEQKHQWAVPVLRGERTASLGMSEPSAGSDLASLRTKAVLVS
ESGGSYFVVNGQKVWTSGAHDADFLLTFVRTDPDAPKHKGISVLLIPTDL
EGVVCRPFADMTGIDNLDFNEVFFTDVRVPVENLVGPLNGGWGVANGSLG
HERTMMWLGFADRIANCIADFKPKNPLERDALATSIMDYQALRLLGSVGI
AKAARGEVDVASVSIPKLLGAEAEQRIEGLALEAAGPDGLVHPATSGPYE
HMNLDHYFASWFERYCRSFGGTIAGGTSEIQRNIIAQQVLGLPRR
120405115YP_954944.1 hypothetical protein Mvan_4161 [Mycobacterium vanbaalenii PYR-1]MRLHKIGTIAAALMAAATLVAPPSSASFAIGNYDLLTNRYTRASWFWFVS
LCIPEKNPDCLNVAARPRLAYYQYYESKVWLVDGRYTFTVDVPDGLQCPG
HVMPTRETYSWDANTLFGTIDSKYNVGCFNGPPGTQFWTFKLQRL
120405114YP_954943.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MSVDDVVSGTADDSRKQNRYYFDRHTPEYRLQFEKITEEMQTKCPMAWSD
TYGGHWVAADSKHVFELARCPVVSNHHDISGETPFQGITIPKASRATVVR
GGILEMDEPEHSAYRGALNPYLSPAAIKRWEPFIHEITRAALDEHIESGR
IDFVDHLANVVPAVFTLAMMGIKLDKWNVYSEPTHASVYTPEHAPEREKI
NEQHRAMGLDLITNMMEIRENPRPGLVNALLQLRIDGEPAPDIEILGNLG
LIIGGGFDTTTALTAHALEWLGEHPDQRQRLSSERATLLDPATEEFLRFF
TPAPGDGRTFADDVEVEGQRFKKFERLWLSWAMANRDASVFDRPNEVVLD
RKGNRHFSFGIGVHRCVGSNVARTLFKSMVTAVLDRMPDYVCDPEGTVHY
DTIGVIQGMRNLPATFTPGKRLGPGLDETLEKLQRICDEQELARPITERK
EAAVID
120405113YP_954942.1 hypothetical protein Mvan_4159 [Mycobacterium vanbaalenii PYR-1]MKVRVDSERCQGHTLCAMIAPDSFELSDIDGTSSPINEVVPADQEDAVRE
AAHSCPEQAISIEE
120405112YP_954941.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMGRVQGKVAFITGAARGQGRSHAVRLAEEGADIIAVDLCENVDTIGYPMA
TAEDLEETAAFVEKTGQRIVTAKADVRDAAQLKKALEDGIAQLGGVDIVV
AQAGIAGMKGNPPMQAWTDVINTNLVGTINAIQVALPHLKEGAAIVATGS
TAALMDAHNKPNPGNDPGGMAYMTSKRLLSQYVHDLATELAVRGIRANVV
HPTNCNTDMLQSPPMYKSFRPDLENPTRADAEPVFGVQQAMKVNFIEPED
ISNAILWLVSDEARYVTGMQLRVDAGGYLKWYDYHA
120405111YP_954940.1 short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii PYRMKNAVVTGGASGIGAAIAERLRADGMRVATIDLNPGDEKFSYAADVTDRA
AVDAVLSEIHTELGPVTVLVNAAGLDRFKKFLDLTFDEWQKVVDVNLNGV
FHCTQAVLPDMIEAGWGRIVNISSSSTHSGQPYMSPYVAAKSAVNGLTKS
LALEYGPDGITVNAVPPGFIDTPMLRKAEQRGFLGDTQKQIEQTPVRRMG
RPEDIAAACSFLISEEAGYITGQILGVNGGRNT
120405110YP_954939.1 aldehyde dehydrogenase [Mycobacterium vanbaalenii PYR-1]MQETATISDERSGAGQAAQRAERHLLIGGQLLETERTFPSLNPATGEVLG
YAPDATVADAEAAVAAARRAFDAGVWATDTELRIRCLEQFHAALVEHRDE
LAALTVAEVGATPALCQGAQLDQPIEIVRYYADLLKTYPLTEDLGNIESR
GMQHHRWVEKEAGGVVAAIIAYNYPNQLALAKLAPALAAGCTVVLKSAPD
TPLVTLALGELIAKHTDIPAGVVNVLSGADPAVGAALTTSPDVDMVTFTG
STPTGRAIMAAASGTLKKVFLELGGKSAAIVLDDADFNTAAMFSAFSMVT
HAGQGCALTSRLLVPKKHKDELVELVKNNFGLVRYGDPTAAGTYMGPLIS
EKQRDKVDGMVKRAVEAGATLVTGGEKVDPGYFYTPTLLADVDPDSEIAQ
EEVFGPVLVVIAYEDDDDAVRIANNSIYGLSGAVFGSQDRALAVARRIRT
GTFSINGGNYFAPDSPFGGYKQSGIGREMGRAGLEEFLESKTYAVVVPEA
GGQA
120405109YP_954938.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium vMSKPLDGIRVLEVAMYGFVPSAGAVLAEWGADVIKVEHAVTGDPQRGLRQ
TGLLRVEGDPNPNIEHANRLKRSIGLDMSVAEGREVLLELARRADVFLTS
FLPGHRQKFGIDVDDIRAANPKIVYARGSALGPRGEESVKGGYDMTAFWC
RAGTAATITPPGTPGMVGPPGPAYGDTISGTNLAGGIAAALLKRERTGEP
SIVDVSLLGSGLWALGHTVALTNHLHERMEAFPPGAHGSPINPLVGLYPT
ADDRYISFVMMQPTKFWADVCSHMDLDELVDDPRFATAESIAENTADAAE
ILKEAMSKRTLAEWSERFATLAGPWAPVQDTLQAAEDAQVRANEYLVQAG
ELELVANPVQFDVAAPASGPAPGFAEQTDDILVELGLDWDRIIELKTAGA
VT
120405108YP_954937.1 hypothetical protein Mvan_4154 [Mycobacterium vanbaalenii PYR-1]MPYVASVGTYLPCWGTSLHRVAGDDEDAVTMAVEAGRAALTAGGAVERVV
LVSRDLPLLESSNAAVLLAGLGLDPELEVDERLGGAPATVDAVSSARPRT
LIIGADLAPAGAAAILTAENGLQVRTAARVARSLPVRTRKATGDVHDYGD
PRLLHERGLIASLAAAWLDTPVAVAGVDRQRAVELCLPDPPAVPTSGASA
SLFALAAMAEQGRTGPLVAVEQAILSGISVSGGSAQICRREPPSRALPDG
TFIADAEIPISLAAYERAFEAKVRWEAGRFDESGELDFPPRYRVGDDGAL
ATDYELVPLPRTGTVYTETTVHIPVPGLRTPYTLVIVELDGVAVRALVKV
TGAQPGTVDIGHRGRLVLRRVAVRSGVPDYGYAFEPDPVPSGVRGAA
120405107YP_954936.1 thiolase family protein [Mycobacterium vanbaalenii PYR-1]MRRVAIVGAGMTPFGEHFALGMKDLLPMAFSECARTVDKGLSKADLQAAW
FGAMGTADGFPSGILADTLGLPELPVTRVENSCATGHDAIRNALFGIASG
AFDVALVMGADKLRDTTSAEMLWEWEAMARDMAWDYPLGLVAPAGFALHV
RRYLHESPATEEHLAMVAVKNHRHGVNNTKARLRFEITMEQALNAPTVVT
PFRLYDCAPQSDGAAALVIAADDVVDRFTDRPVWITGVGLGLDSVMHQHK
PDLTTFPATTRAAKQAFAMAGRSPSDVDVAEVHDFLTGIELMSYEDLGFA
ERLGGYKLLEAEVTSLGGALPVNPSGGLKAKGHPPGATGVAQCVELFAQL
RGEAVNQVDGARIGLAHNIGGPTAVSAVTILEGPSGN
120405106YP_954935.1 hypothetical protein Mvan_4152 [Mycobacterium vanbaalenii PYR-1]MATKGPERWTTGIALPNGLSGAMAAVGGFFSMALDAVRFVFVRPFQWREF
LEQCWFVARVSMAPTLLVAIPFTVLVSFTLNILLRELGAADLSGAGAAFG
AVTQVGPLVTVLIVAGAGATAMCADLGSRTIREEIDAMEVLGINPVQRLV
TPRMLAAGLVALLLNSLVVIIGILGGYFFSVFVQDVNPGAFAAGITLLTG
VPEVIISCVKAALFGLIAGLVACYRGLTITGGGAKAVGNAVNETVVYAFM
ALFVINVVVTAIGIRMTTG
120405105YP_954934.1 hypothetical protein Mvan_4151 [Mycobacterium vanbaalenii PYR-1]MGTSTLLRQRFPRLVDHLGRPVALLSRLGDHVLFYGRAIGGVPHAAVHFR
KEIVRLIAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAIQGYSSLGNIG
IEALTGFLAAFINVRIAAPVVAGIGLAATFGAGVTAQLGAMRINEEIDAL
ESMGIRPVEYLVSTRIVAGMVAIAPLYSIAVILSFVASQFTTVVLFGQSG
GLYDHYFDTFLNPIDLLWSFLQAVLMAIAILLVHTYFGYFASGGPSGVGA
AVGNAVRTSLVVVVSVTLLVSLSIYGSNGNFNLSG
120405104YP_954933.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MSSNLGPGPLHRSETTSGAAPLAASSGRHFGVSNVVRPLAGLGLVVALLV
ILAVSIGLFAGKFTETVPVTVISNRAGLVMNPDAKVKMRGVQVGSVRSID
YRPDGTAALQLEMDPSQLHLIPSNVNVDIASSTVFGAKFVQLEAPPNPTG
ELKRGQVLAGDHVTVEINTVFQQLVNVLDAVDPAKLNETLGAIAQAFNGR
GEKFGQTLTDFNALLAKIEPSLPNLSHDIEAAVPALTAYADAGPDLVSII
ENTTTLGNSIVDEQDNLDEFLVSSIGLADLGNEVVGGNRQALTTTLDLLV
PTTDLLYSYRKSLWCGIGGLVPFAKSPPQFSGIFVSSGLTLGVERYRYPR
DLPKVAASSGGRDYCAELGLPEMPAEFVPPLIVGDVGSNPAQYGNAGILL
NSEGLKNWLFGPLDGPPRNTAQIGMPG
120405103YP_954932.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MTRSAATLVKFTAFGLVMALLTAFLFLVFSDTRTGAANEYTAVFKDASRL
KTGDTVRIAGIRVGTVKDVELQADRSVLVTFDADRNTVLTTGTNAAIRYL
NLVGDRYLELVDTPDSTQIVPAGGQIPEDRTTPALDLDVLLGGLKPVIQG
LNPEDVNGLTSALIQILQGQGGTLDSLFSKTSSFSNSLADNNQVIEELIV
DLRTVLDTLSKDGEEFSGAIDKLEQLVSGLSSDRDPIGTAITALDNGTAS
IADLLGRGRAPLANTVDEMNRLAPLVDNDLDRLDATLQRLPEIYRKLARV
GSYGAWFPYYICGISFRASDLEGRTVVFPWIKQEEGRCVDE
120405102YP_954931.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MLKYRGSQLARAGFIGVVLIILVIAVGLQPERLLSWATAIRYQALFAEAG
GLTVGNDVTVSGIKVGSVSSIELDNGDALVGFTIDGKYALGSDTTAHIRT
GTLLGERVLALDSDGSGTLDPQQVIPTTRTSSPYSLTDAVSELTANTRDT
DTASLNQSLDTLAQTLDQVAPQLGPTFDGLSRLSQSLNSRNESLAELLRT
AGDVTGIFSERSSQVNALILNANDLLAVLNERRYAITSLLANISAVSQQL
SGVVADNEAELAPALERLNNVTQMLEKNRDNLAKMLPGAAKYYLTQGEIV
SNGAYYNALIPNIQPAQLLQPFLDYAFGFRNGVDIGQPPDNAGPRAQLPF
PVNSLPQPGDLPNDGNP
120405101YP_954930.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MMATRKRWVAGTALLLAILLIAGAALLVRQVFFGPKTITAYFPTATAIYP
GDEVRVSGVKVGTIDKIEPEGTLTRMTLKVDRDVPVPADAKAVIVAQNLV
AARYVQLTPSYREGGGPTMGDGGTIPESRTAVPVEWDEVKTQLMRLSEEL
GPQADVSGTSISRFVDSAANAMEGNGEKLRETLRQLSGVARIFAEGSGNI
VDIIKNLQVFVSALRDSKDQIVLFQNRLATLTSVVNDSRSDLDAALTDLS
FAINEVQRFVAGSRDQTAEQIRSLGQVTQVLVDNRLALENVLHITPNAIA
NFENIYYPNGGSVTGAFSVSNFSNPVWFVCGLIGGVANTTAPETAKLCAQ
YLGPALRSIPIHNLPFPINAYLRPAVSPERTIYTDPKLAPGGAGPGDPPE
MPPTVSAYTGAGDIPPPPGWGAPPGPRGIYQPDPDAPATPSPALYPGAPI
PGPPNILSNIPAQPQPQTVDGLLLPPQGNPGGSPPPAPAPAVAPTGPLLP
AEGMPPA
120405100YP_954929.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MIRGVKQLTVLGCSAALSLSGCAFQGVNSLPLPGAVGRGPDAVSYNVQVP
NVATLESNSPVMIDDVVVGSVGKMTVQNWHADVEISVKPDVVIPANAVAT
VGQTSLLGSMHLALNPPLGDEPKGRLQPGSTLPLNASSTYPTTEQTLASL
STVANGGGLGQIGDIVHNMNTALSGREPEVRELLTRLDNFVGVLAEQREN
IIASIQQLRRVAGTFANQREVIDRALKEIPPAIDVLIRERPNFTTALDRL
GQFSNTATQLVNDAGDDLVKNLENLGPVLGALADIGPDLNEAVLWASAFP
YGPTFADRITRGDYINLYAIFDLTYPRLKKTLLAGTRWGDQNAKLIPAPG
DPYYLNYAYNPMMVGITPPPEEALPPPAQGGAPSSLTGVPAQPILPVVPP
PPAAPWLPQAQPMAGDQIFAGPFGAPTPPPVAPPAPSVPTPGGGG
120405099YP_954928.1 virulence factor Mce family protein [Mycobacterium vanbaalenii PYR-1]MLTRFVRNQLIIFTIASIVGVAVMLFAYMQVPTLLGVGRLVVTLELPESG
GLYRFSNVTYRGVQVGKVTGVSLTENGAEATLSLETSPKIPADLQAEVLS
VSAVGEQYVDLRPNTDEGPYLEDGARIPVANTTVPQQVGPMLDQLSALVG
SLPKDRIPDLLDETFKAFNGAGPDFGSMLDSAATLTNDVNGVSDQMRSLI
DDSGPLIDSQAETADAIRTWAQSLNGISAQVVQNDPQVRALLQQGPAFAQ
EVSALLNQVKPTLPILLANLSTVGQTLLTYNPAIEQLLVLFPGIIAAQQS
FGLPQNSPTGLPMGDFALTISDPNPCTVGFLPSTQWRSPEDETTIDTPDG
LYCKLPQDSPMNVRGARNYPCIEHPGKRAPTVELCNDPRGFVPTAIRNHI
TGPYPFDPNLVSQGVPIDSTVEGPDRIYLPPEGTPLPPGAVRAGTPPVSE
PGTPPFPVGAPAPMVPGAPPPAQPPILPPAPLLPGQGPLLPGQAVPVAPA
SGAVPVAPSAFGSNDSGVPTVGTAQYNPQTGEYIAPDGSMNRVTNVASGA
NPKSWKDLLPM
120405098YP_954927.1 hypothetical protein Mvan_4144 [Mycobacterium vanbaalenii PYR-1]MRATRLVSGLAATAIAVLGSLSIAPVAQADDSDWGVDISGTWRVFSDGQW
ARTNQVKIEQQSVLETWTVNVSCVSPIECSGEVKSSLGWTGTARLDDFWF
VEHVVPNWMPCPNGTFATGYQKFLLWGVDPPTQHRIRRNMSIMAGRNITK
SDSGACGVNLSKVIELPVRMEKIS
120405097YP_954926.1 hypothetical protein Mvan_4143 [Mycobacterium vanbaalenii PYR-1]MRSLVSVLAALAAPAVLMTAPPVSAQPPPPPPGGECNYPNCTPGIQPNVV
LGSYCANTTYYVFGVTDWGRLVFCGSPRRYEPRWFRAPEMHGVKNQGDLC
PALDGQVAQAPDGLFLTCIAKDNRSYWERGDASVGGGNPPPQ
120405096YP_954925.1 hypothetical protein Mvan_4142 [Mycobacterium vanbaalenii PYR-1]MVFYKTLPVVAALVAGTFAASTVVAGGTAAAQPPLHRVQYTVGASQDIAN
AEIYWRQVDPPDWGAYSHNPYEFTPNVEANLGPNQAWVHETWLADPNQWA
MVVVGLPAQSTPPLAEPGFVCELKVDDVVVATDAGTKGALCSMRPW
120405095YP_954924.1 cytochrome P450 [Mycobacterium vanbaalenii PYR-1]MSDFDTIDYFTDPSLVPDPHPYFDHLRSKCPVVREPHYGVLAVTGYEEAA
TVLKDSDTFSSCIAVAGPFPPLPFTPEGDDITGQIAAHRSQMPMFEHMVT
MDPPDHTNARSLLNRLLTPSRLKENEDFMWRLADEVLDDIISRDPVGRCE
FLSAYAKPFSLLVIADMLGVPEADHEEFRTVLGAPRPGANVGSLDHSDLV
GANPLEWLDEKFIGYLEDRRKEPRDDVLTALATAKYPDGSTPPVIEVVRS
ATFLFAAGQETTTKLLSASLRVLGDHPDIQERLRRDRSRIPIFVEEALRM
DAPVKSQFRLAKKNTRVGDMDVPAGTTMMVCPGAVNRDPSRFEHPHEFDL
DRKNVREHIAFGRGVHSCPGGPLARVEGRVSIERILDRMGDIAIDEELHG
PPGARRYNYEPTFILRGLTDLNITFTPVR
120405094YP_954923.1 TetR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MTSPRRIGAPDAKNRVVLLDAAEQLLIEEGYAAVTSRRVADRAGLKPQLV
HYYFRTMEDLFLAVFHRRAEEGLAVLSTALASPQPLWALWRFSTAPEATR
LTMEFMGLANHRKALRAEIVYYAERFRQEQNRAIADALQRYGTDFTDVPP
VVWTVFATSVSQALVMERALGMDTGHAETFAFCEEWIRRLEGDPLPPLDQ
RA
120405093YP_954922.1 thiolase [Mycobacterium vanbaalenii PYR-1]MTNSSPNAAGEVAIIGVGLHPFGRFDKTAMQMGAEAIQSALTDAGVEWKD
IQFGFGGSYEVSNPDAVTRLVGLTGITFTNVFNACATAASAIQQTADTIR
LGKYDIGIAIGLDKHPRGAFTDDPAKLALPQWYAENGQFVTTKFFGMKAN
HYIHKHNISEETLARVANKNFRNGVLNPNAFRRKEISVEEIMASPVLNYP
LRQYMFCAPDEGAAAVIMCRGDIAHRFTDKPVFVRASEIRTRTFGAYEVH
ATSAPLEEDPSPTVFAAKAAYEAAGIGPEDVDIAQLQDTDAGAEVIHMAE
TGLCADGEQEKLLADGATEIHGSIPVNTDGGLIANGEPIGASGLRQVHEL
VRQLRGQAGDRQVPGQPRVGLAQVYGAPGTASATILSL
120405092YP_954921.1 hypothetical protein Mvan_4138 [Mycobacterium vanbaalenii PYR-1]MVNCVSTTQRALAPEISTWPADDPQLIGSSCGTCGATTFPVQQRCPKCSG
GEMSEVLLPRRGTLIAWTTQGFPPGAPYKGPTGKDFVPFGVGLVQLDDVI
RVEGRLTENDPAKLKFGEQVELTMLPFTTDEDGTEVVTFAFRPVEN
120405091YP_954920.1 hypothetical protein Mvan_4137 [Mycobacterium vanbaalenii PYR-1]MTLPGPIRQIGYVVTDLDRALDSWVALGVGPWYVIREMPQRVTYRGEPCA
VTLSLALANSGDLQVELIHQHDDTPSIFTEFLDSGRPGFHQLAYWTDDFE
GTMGSVAEAGWPVVWNGASGPGGAVTRFAYVEPPDSPAAVIEIMELSPAT
EGMATFLREAAAAWDGRDPVRELSV
120405090YP_954919.1 enoyl-CoA hydratase/isomerase [Mycobacterium vanbaalenii PYR-1]MVFSSCENANTVNGECPMVDLELDDGLAVITIDRPHARNAISLETMEQLD
KALDGAEGAAALALTGAGDKAFVSGGDLKELSALRTEEQAAAMAFRMRSI
CDRIAGFPGPVLAALNGHALGGGAEFAVSADIRVAADDIKIGFNQVALAI
MPAWGGAERLVKLVGYSRALLLAGTGRILDAADAERIGLIDQVIPRASFD
EQWRLIARSLASAPAGEVKRVMRGVPTTEAVAAFARLWASDEHWAAADKV
MKKGK
120405089YP_954918.1 AMP-dependent synthetase and ligase [Mycobacterium vanbaalenii PYR-1]MRRIPAQLVERYQREGYWTQETLGDMLARGLAGSPEAGFCVHSSIRPYRG
TFGEVERDARRLAAGLRERGVGPGDVVAMQLPNWREAAVTFWASAFLGAV
VVPIVHFYGRRELAHIMATAKPRVFVTAEEFGRMRYQPDLCGDVAVVGLV
GAAHPAAGNEHAFEQLLADEPMAGTVAADPAAPTLIAFTSGTTRDPKGVI
HSHQTLSCETRQLLENYPPDRGRQLTATPVGHFIGMLGAFLIPVLEGAPI
DLCDVWDPGRVLKLIESDGLSIGGGPPYFVTSLLDHPDFRPEHLRRFKTV
GLGGSTVPAAVTQRLTDLGLFVFRSYGSTEHPSITGSRPDAPEVKRLFTD
GNVRPGVEIRLGEDGEIFSRGPDLCLGYTDDELTARAFDDDGWYRTGDVG
VLDDDGYLTITDRKADVIIRGGENISALEVEEVLLAMPAVAEAVVVAAPD
ARLGEHTAAVLRIREGQSMPALGDVREHFKQAGVATQKWPEELHRVPEGQ
DFPRTASGKVQKFVIRQQLAAGELSAIATGQE
120405088YP_954917.1 amidohydrolase 2 [Mycobacterium vanbaalenii PYR-1]MGQLSHRVDIPFPLFDADNHLYEPPEAMTKYLPKEYKDVVQYVEVNGRTK
IALKGQISNYIPNPTFSVVAKPGAWEEYFKFGNPDGKSKRELFGEPMKAI
PAFFEPEPRIKVMDELGIQRSLMFPTLASLIEERLSDDPVAIHVIIHALN
EWLHEVWGFNYQGRIFTTPVITLPIVEKAIEELEWAVKRGARAILIRPAP
VPGFRGPRSFALPEFDPFWERVVHHDIFVGMHSSDSGYSRYTSEWDGAAQ
EMLPFQTNAMSILNEWRPIQDAVASWVIHGALFRFPKLKVGIVEAGSKWM
FPLLDSMAEVYKKAPEAFLGNPIEEIKNRIYVSPFYEEGIDDLINLIGVD
QVLYGSDWPHPEGLAEPTHYVTALEHLSVEDQAKIMGGNLGRLVTT
120405087YP_954916.1 long-chain-fatty-acid--CoA ligase [Mycobacterium vanbaalenii PYR-1]MTFQSRWQTIPEMVASAADRFGDAEAVVDGPLRLSFTELVERISCAAGAF
AELGIEKGDRAAIWAPNSAEWIIAAFGLLTAGGVLVPVNTRFKTDEAADI
IARSGAKAVLVQQGFLGVDYTAPGGVPVIDLRSDFLSSGTPFSRPVQGTD
VSDIIFTSGTTGRPKGVMMNHRQNLRLYQEWCDLADLRQGDRYLMVNPYF
HTFGYKAGLIASFIRGATMLPVSVFDVDRVVELIAAERITMLPGPPTLYH
SLLNVTDKSKLATLRAGVTGAADIPVELVRRVHEELPFQTLATGYGLTEA
GTVTLSRPGDSFTDIATTAGVACDGVEMRIADDGEVLVRGYTVMQGYLDD
PVATAETIDPDGWLHTGDLGTVDDAGRLRIVGRKKDMFIVGGFNAYPAEI
EGFLLEHRAVAQAAVIGVPDERLGQVGKAFVVAKTPADGSGAALTAEGLI
AWCRDRMAGFKVPRYVEFLDELPLNATGKVMKDRLQNRQS
120405086YP_954915.1 hypothetical protein Mvan_4132 [Mycobacterium vanbaalenii PYR-1]MPSFRRRDAVIDADRVEESTVEPESVTEADQARALAEEAEAEAAEAEAMA
AAAKARARAARLRRQALAADVAAKPEVGEDSATVGDADVDGDDDAVTGSA
DAEPEVVDIETAETDETAETDDSAPADGGAAPSRRRRIPRPGWKAAVATV
VALATVALLGASGYMVWTHRGAEKLRQQNAEYAAAARQSVVTLMSLDFNK
AEEDVQRIIDNSTGQFKTDFESQAADFVKVAQDSKVVTEVSVNSTAVESM
SDDSAEVLVAASSRVTNTAGANQEPRTWRLSVSLKREDGQIKMAKVEFVP
120405085YP_954914.1 twin-arginine translocation pathway signal [Mycobacterium vanbaalenii MTDENRTEDAAETDAALVEGDVIADVDSTDEADDVDEAAAGREPGDDDKA
EADSGAATTKPPTRRPVRGLVTAILLAVALLASAGMAGWLYLNDYRPDQQ
TDPAAAQVALDAARTGTVALLSYSPESLDQDFANAKAKLTGEFLSYYTQF
TEQIVTPAAKEKSVKTAASVVRAAVADIQPESAEVLVFINQTTTSKENPD
GAFAASSVKVGLKKIDGNWLIESFDPV
120405084YP_954913.1 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Mycobacterium vanbMTVTAILPVPESYVQRREAVFAPVAGESPLVRIVRALAAVGDVVVAAAQS
LADEVRETLAAQALPAVRTVGARSPGARADCIAAGLAALGDGDGPVLLHD
LTWPLIADATLDAVLSAVHGGADAVLPIRPVTDSVKAVDARGAVTATLDR
SPLRTVQFPRGFDAAVLERLLADGAADFDELGAALSVGTPLTLVEGDTDT
MSFDLPADSAFLAAVIAGR
120405083YP_954912.1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [MycobacteriuMDAVGVVLAAGLGTRVGADGNKAYLPLAGRSMLAWSLDTLTRLPDIARTI
LVYRRGEATLARDTVQSELDSDAVEFVEGGDTRHGSETNVLRYLADDIES
GAVDVVAIHDAARPLAGPDMFVEAITLARRFGGALPTLPIRDLARQGAKG
LECIADPSTLVRVQTPQAFRARDLLHAYLRAERDGFEGTDTSSCIERYTD
LEVRTFPGRAANLKVTYARDAAVAQHLLAQAGGPTALR
120405082YP_954911.1 low temperature requirement A [Mycobacterium vanbaalenii PYR-1]MHVSTGRLHRIRPMSGRDPHEQGRVATPLELLFDLTFVIAFGIAASEFAH
LLAAGHVAAGLAGFFFAMFAVCWAWINFSWFASAYDTDDWPYRLTTMLQM
VGVIVLALGLPQMYSSIEHGGHVDNAVVVAGYVVMRVAMVAQWLRAARQD
PLRRRACLTYALWITIAQIGWVVAIFVPTSVPVTAAIVVSLVLVEVTGPV
VAEWRQGGTPWHAHHIVERYGLFTIIALGEGVVGTVASLTAVVGAQGWSV
EAVFVAVAGTGLTFGMWWIYYVLPQADILHLRRERSFWFGYVHIVVFASI
VGTGAGLHAAAYYIEHHSALSSVATVLTVVIPVGVYIVTVYVLYAVMART
VALFHVVTVVLSAAVLGLAVVLAAGGISMANCLLVVTLAPVVSVVGHELV
GHRHVVATARTQGLD
120405081YP_954910.1 major facilitator superfamily transporter [Mycobacterium vanbaalenii PMRPWIVWATGLLAYIVAVLDRTTLGVSGLAAADRFGAGPSLLSTFVVLQV
VVYAGAQVPAGLLLDRYGSRALIASGAALMASGQLGLAFTESLPAAIAAR
AVVGLGDAVTFISVLRLVPHWFAPRQIPVVTQLTGICGQLGQVLSAIPFL
ALLSASGWSVAYASAAALGVLSIVLTLAIVRNTPDGSAATSETMSVRETL
TSVKTVWLRPGTRLGFFTHMGTQFSITVFALMWGLPYLTEAQGLSAGVAG
ALLSLSVVSAIGCGVLIGILTGRYPHRRSRMVLAIITSNAVVWTVVLALP
GPAPLWLLIVLIVVISVGGPGSMVGFDFARTFNPRATLGTAQGMVNMGGF
IASLLLMQAMGMVMQAMGGISFESFRSAWMVQYVVWALAVVGILITRRKA
RRLLRDGNDRILLEGVNP
120405080YP_954909.1 MerR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1MSAMDWPATCYVWGPGVAEYRLEDLARESGISARNIRAYRERGLLDPPRR
VGRSALYDDYHLSQLNTISQLLRKGYNSAHIAEFFASMRQGTDLADILGL
QRAVLGQTPEPRNRNTAVKIDAKSEEARKLVAFGMAEVVDGEVLMIDCAA
ADILARSPDQLLYVRALLRFVEAAEDSVDDLAEAFVTSLGELYHARVGAD
YLPRPDEVDEIRQVVQDYRALGEKVMVARFDQATRRRMVASASGYTAGIL
LSGAWEPKRGA
120405079YP_954908.1 dehydratase [Mycobacterium vanbaalenii PYR-1]MTINDQHRATTDSDGQVAQGFEPLTGTHALVDRLHSGEPYAVAFGGQGGP
WLENLEELVNSAGIESEISQLVAEAELMLEPLARELVVVRPIGFEPMKWI
RALAADEPLPAAKDLTTAAISGPGILLTQMAAQRALKRQGLDLDGHPPVA
IAGHSQGVTAVESLKAGGTRDVELLAIGQLIGAAGSLVSRRCGMVGRGDK
SPMVSVLNVDPARIAELLHDFAQDVRTVLPPALSIRNGRRSVVITGTPEQ
LARFELYCEKITEKEEAERKNKVRGGAIFRPVFNQLNVEVGFHTPRLAGG
VELVNEWASRTGLDRELTRKLTEAIFIDPVDWVSEVEGLAEAGAKWIVDL
GPSDTVTRLTAPVIRGLGIGIVAAATRAGQRSLFTVGAAPAVAPAWSSYA
PQPIALPDGSVKASTKFTRLTGRSPILLAGMTPTTVDAKIVAAAANAGHW
AELAGGGQVTEEIFDARIKELTQLLEPGRAIQFNSLFLDPYLWKLQVGGK
RLVQKARQSGAPIDGVVVTAGIPDLEEAVELIEELHTVGISNVVFKPGTV
DQIKSVIKIAAEVPGRDVIVHIEGGRAGGHHSWEDLDDLLLTTYGELRKY
SNVTICVGGGIGTPERAAEYLSGEWAKAYGFPDMPVDGILVGTAAMATLE
ATTSPAVKQLLVETTGTETWVGAGNAINGMASGRSQLGADIHEIDNTASR
CGRLLDEVAGDADAVAERRDELIAAMANTAKPYFGDVGDMTYLQWLQRYI
ELAIGDGDSTADTAAPGSPWLADTWRERFEEMLKRAEARLNEKDSGPIES
LFSDSGASSGGQALLDNPDAAIAALLARYPDAESVKLHPADVPFFVTLCK
KPGKPVNFVPVIDKDVRRWWRSDSLWQAHDARYSADQVCIIPGTQAVAGI
TRVDEPVGELLDRFEQEIVDRVLAAGVQPVPVVSRRQARADVSGPLAVVL
DSPDVLWAGRTAINPVHRIGAPGEWQVNDVPGKPSATHPNTGARLEQATD
DSGHVSVTLSVPLSDIWIDIRFTLPAATVDGGAPIVTVEDAAKAMRSVLA
IAAGVEGPESLPPVQGDTAAVTVEWDPEKVADHTGVTATFGAPLAPGLTL
VPDALVGLCWPAVFSAIGSALTEDGFPVVEGLLSLVHLDHAAHLLTSMPS
SKSELTVTATASAATDTEVGRVVPVDVTIADSEGTVLATLSERFAIRGRT
GAAELADPPRAGGAITDNATDTPRRRRRDVVVNAPVDMSAFAVVSGDHNP
IHTDRAAALLAGLKTPIVHGMWLSAAAQHAVTATDGRATPPARLVGWTSR
FLGMVLPGDEIEFRVDRVGIDRGAEIIEVAAKVGGELVMSATAQLAAPKT
VYAFPGQGIQSKGMGMDVRARSKAARAVWDTADKFTRETLGFSVLHVVRD
NPTSLIASGVHYHHPEGVLYLTQFTQVAMATVAAAQVAEMREQGAFVEGA
IACGHSVGEYTALACVSGVYELPALLEVVFHRGSKMHDIVPRDAQGRSNY
RLAAIRPSQIDLDDADVKDFVAEISDRTGEFLEIVNYNLRGSQYAIAGTV
AGLEALEAEVERRRELSGGKRSFILVPGIDVPFHSSVLRVGVADFRRALE
RVMPNPNDPNLLVGRYIPNLVPRPFTLDRDFIQEIRDLVPAEPLDEILAD
YDTWRNERPSELCRKIVIELLAWQFASPVRWIETQDLLFIEEAAGGLGVE
RFVEIGVKNAPTVAGLAANTLKLPEYSHNTTEVLNAERDAAVLFATDTDP
EPDPEDDVADATPAAETAPAEAVPAEAAPAAPAPAAAPSGGPRPDDLAFD
AADATMALIALSAKIRIDQIEALDSIESITDGASSRRNQMLVDLGSELNL
GAIDGAAEADLAGLKGQVTKLARTYKPFGPVLSDAINDQLRTVFGPSGKR
PAYIAERVKKTWELGDGWAKHATVEVALGTREGSSVRGGALGGLHDGALA
DAAAVDKAIDAAVAAIGARKGVSVSLPSAAGGGGGVVDSAALGEFAEQVT
GPDGVLASAARTILDQLGLGNQFVTPDASADAELIDLVTAELGSDWPRLV
APVFDGRKAVVLDDRWASAREDLARIWLMDEGDIDADWARLSERFEGAGH
VVGTQATYWQGKALAAGRTVHASLYARAAAGAENPGKGRYHDEVAVVTGA
SKGSIAASVVAQLLDGGATVVATTSKLDDNRLAFYRQLYRDSARFGAKLW
VLPANMASYNDIDALVEWIGTEQSESLGPKSVHIKDALTPTLLFPFAAPR
VGGDLSDAGSRSEMEMKVLLWAVQRLIGGLSHISADRDIAARLHVVLPGS
PNRGMFGGDGAYGESKAALDAVVSRWKAETSWAQRVSLAHALIGWTRGTG
LMGHNDVIVDAVEEAGVTTYSTEQMASMLLDLCDVETKVAAAREPVLADL
TGGLAEVELDLSALATKAREEATSTSADEDGDDEAADHLIAALPSPPRPV
TPAHAPEWADLDVDPADLVVIVGGAELGPYGSSRTRFEMEVDNELSAAGV
LELAWTTGLVKWEDDPQPGWYDTESGDLVDESELVERYHDAVVERCGIRE
FVDDGAIDPDHGSPLLVSVFLDKDFRFVVSSEADARAFVQFDPEHTLARP
IPDSGDWEVIRKAGTEIRVPRKTKLSRTVGAQIPTGFDPTVWGISPDMAT
SVDRVALWNIVATVDAFLSSGFTPSELMRWVHPSLVASTQGTGMGGMTSM
QTMFHGNLLGRSKPNDILQEVLPNVVAAHVMQSYVGGYGAMVHPVGACAT
AAVSVEEGVDKIRLGKAELVVAGGFDDMTLEAIIGFGDMAATADTEMMRA
KGISDSKFSRANDRRRLGFLEAEGGGTVLLARGDLALKMGLPVLAVVGYA
QSFADGVHTSIPAPGLGALGAGRGGRDSVLARSLAKLGVGADDIAVISKH
DTSTLANDPNETELHERLAASLGRSDGAPLFVISQKSLTGHAKGGAAVFQ
MMGLCQVLRDGVIPPNRSLDCVDDELATSAHFVWPRETLRLGEKYPLKAG
LVTSLGFGHVSGLIALVHPQAFLATLTPEQRAAYTAQAQERVLAGQRRLA
SAIAGGRPMFERPADRRFDHDESEKAQEAAMLLDAASRLGEDGVYRR
120405078YP_954907.1 4'-phosphopantetheinyl transferase [Mycobacterium vanbaalenii PYR-1]MLPVAIVGIGIDLVSIPEFAEQVDRPGTVFAETFTPGERRDAADKSSSAA
RHLAARWAAKEAVIKAWSGSRFAKRPVLPEAIHRDIEVITDMWGRPRVRL<