Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is Mycobacterium_sp_KMS
Gene IDProtein IDProtein DetailsSequence
161485585YP_940731.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium sp. KMS]MTGQEYDVVVVGSGAAGMVAALTAAHQGLSTIVVEKAPHYGGSTARSGGG
VWIPNNEILKRDGVKDTPEAARQYLRAIIGDVVEPERIDTYLQRGPEMLT
FVLEHSPLKLCWVPGYSDYYPETPGGKPTGRSVEPKPFDAKKLGEDLPGL
EPPYGKVPMNMVVMQQDYVRLNQLKRHPRGVLRSLKVGIRATWAKATGKN
LVGMGRALIAPLRIALREAGVPVLLNTALTDLYVEDGVVRGIYVADTNAQ
TGTDSSEPRLIRARRGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAKAN
TGDGILAAEKLGAALELMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNM
SGKRFMNESMPYVEACHHMYGGEYGQGPGPGENIPAWLIFDQQYRDRYIF
AGLQPGQRIPSKWLESGVIVKADTLAELAEKAGLPADALAATVQRFNGFA
RSGTDEDFHRGESAYDRYYGDPTNKPNPNLGEISHGPFYAAKMVPGDLGT
KGGVRTDVHGRALRDDGSVIEGLYAAGNVSSPVMGHTYPGPGGTIGPAMT
FGYLAALHLAGRS
161485586YP_937150.2 50S ribosomal protein L13 [Mycobacterium sp. KMS]MPTYTPKAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDG
GDFVIVINAEKIAVSGDKLNNKYAYRHSGYPGGLRRRTIGELLIKHPTRV
VENAIVGMLPHTKLSRQVQKKLKVYAGPNHPHAAQQPIPFEIKQVAQ
119871517YP_941469.1 hypothetical protein Mkms_5494 [Mycobacterium sp. KMS]MPTRITPLRLEAFEQLPKHARRCVFWEVDPSTLGREDHLSDPEFEKEAWL
SMVMLEWGSCGQVAVRCPEAMSDEAAATDPSAEEPCVGYAFYAPPRAVPR
ARLFPTGPVSADAVLLTTVGVEQGDDTTGLPHTLLTSVVGDLVRRGVRAL
EAFGRTEAAAELIDPRLVPDELTPVVEALGDCSVHQCMLDADFLEQVGFT
VVSPHRYFPRLRLELEQGLGWKADVEAALERLLESAQLQQPVGAGSGRC
119871515YP_941467.1 thioredoxin [Mycobacterium sp. KMS]MADSATVTVTDDSFSEDVLTSSTPVLVDFWATWCGPCKMVAPVLEEIASE
KAGALTVAKLDVDANPTTARDFQVVSIPTMILFKDGEPVKRIVGAKGKAA
LLRELTDLL
119871513YP_941465.1 RNA polymerase sigma factor SigM [Mycobacterium sp. KMS]MVSFDAVGRSDAQLLADHVAGDRYAFAELFVRHQRQLERLARITSSNRED
AADALQEAMLSAHRKAASFRFDSAVSSWLYRIVVNACLDRLRTNRTHATS
TLVDDVGSAGDPTSRVDTAIVIERALLRLPVEQRAAIVAVDMQGYSVAET
ARMLGVAEGTVKSRCSRGRAKLAETLRGLDETETASPPPAGRGCHPVPRS
ARSRRRPTIERAVRHAGGGTPVDRP
119871511YP_941463.1 hypothetical protein Mkms_5488 [Mycobacterium sp. KMS]MAAPRMTTAVPRLLAALVLLLLTAISTVLPHAAAGEPGAAAFLQLRIDRV
TPDVVTTASDPVVTVSGVVRNVGDRTVRDVVLRLEHAPAVDSSSGLRTNL
TGNLDQFEPVADFVTVAPELDRGKEVPFTFAYPIRAADGPSLRIESPGVY
PLMVNVNGTPDYGAPARLDDARFLLPVLGVPSEPGAESAAETLTSVVPPD
TSKPVRLTMFWPLADKPRLAAGIPGGTTPVRLIDDDLAASLAPGGRLETL
LAAVDFATGPTVDQGGELGRALCLAVDPDLLVTVNAMTAGYAVNDGPDAG
PTTPTRPGTGQEAAVGWLNRLKVLARRMCVTATPYAQADLDALQRVGDPR
LGAIATTGAADIVDQILGVPSTRGVTLVGDGPLTGAAAQLLSTQGRTVAV
TAATLTARDDATGLGSTADLAPVRYSPNLVAMPFDPTIGAALAGAGAEPA
APTYLDPSLDVPLRHDSAVARRQNAIGSLLWRGLQPDTGPRTQIVVPPLV
WSPRPDDAQAVLTSMGTAIRAGLALPRPLREVIAEGDAVPPQPDAGWPAD
DIGNPRGRIDDAVTSGIAATNGRLSGLTAALGVDERTGLTGIGYTAPLRE
DMLRALSQSVPPPARDGLARQRLAVVTDTVGDMFGAVRIMNPGGAYTLAT
ERSPLPLALRNDLPVPIRVRLAVDAPPGMTVDDLGEISLPPGYLPLRVPI
EVHFTQRVAVDVALRTAEGLPLGEPVRLSVHSNAYGKVLFIITMSAGAVL
VLLAGRRLWHRFRGQPDPADLDRPKRAVADRTHEAHAPTDPLDTALRYAP
GDQPVGDQK
119871509YP_941461.1 metal dependent phosphohydrolase [Mycobacterium sp. KMS]MPHDPDDAEDDTALLARAAVALNRDGEVLRDIGAVFAEAGHTLYLVGGSV
RDALLGRLGTDLDFTTDARPEQMQAFLRPWADALWDTGIEFGTVGVGKAG
HRMEITTFRADSYDQVSRNPAVRYGDRLEDDLVRRDFTVNAMAVAITAAG
PGEFHDPLGGLAALRAKVLDTPSAPEVSFGDDPLRMLRAARFASQLGFGV
APRVRTAMTEMAPQLSRITVERVAAELDKLLLGADPVTGIDLMVQTGLGD
VVLPEVGGMRLAIDEHHQHKDVYWHSLTVLRQAIDLEDGPDLVLRWAALL
HDIGKPATRRHEPDGGVSFHHHEVVGAKMARKRMRALKYSKQMVDDVSQL
VFLHLRFHGYGDAKGPGKWTDSAVRRYVTDAGPLLDRLHKLVRADCTTRN
KRRAARLQANYDDLERRIAELAAKEDLQRVRPDLDGNEIMRLLDIPAGPQ
VGEAWRHLKELRLERGPLSHDEAVDELLKWWNAEPRRDV
119871507YP_941459.1 serine/threonine protein kinase [Mycobacterium sp. KMS]MTGPELLAGRYELREVLGLGGMAEVRDGWDTRLDRAVAIKLLHPAMRAQP
DVRSRFEAEARSAAALTHPNIVAVHDYGEDDGTPFIVMERLPGRTLGDVI
AAGPMSPAQVRSMLGEVLAALEVAHAAGVLHRDIKPGNILLSADANTLKV
ADFGIAKTGGAAYTMTGQIIGTLAYMSPERVSGAPASVADDLYAVGVMAH
EALLGRRAFPQDNPAAVARAIMDDPPPPVTAFRTDVDPILAGVIERAMTP
DPPQRFGSATQMRAALAGDQHALFDGTAPVSPPPRPATRVLAAPLPPTSA
GPVPRGRPRRTRALAGAGAVLAAFAIAAVALAMDPFSSAPAQEPVSTSTT
LPPPPPSTTPPPPPSSVAPVVEQPQAPVVENKKPKGNGNGKGNGNGKGNG
KGN
119871505YP_941457.1 hypothetical protein Mkms_5482 [Mycobacterium sp. KMS]MVDARAPKAVWQSARGLPEFWRLLELRAVSQFGEGLFQAGLAGAILFNPD
RAATPWAIAGSFAVLFLPYSLLGPFAGALLDRWDRRLVLIGANSARLVLV
LGVAALLAGRVGDLPILLGALVVNGFTRFVSSGLSAALPHVVPREQVVAM
NSVAAATGAVAAFLGANFMLLPRWAFGADDAGASAIILIAALPVALALLL
SIRFAAHVLGPDDSARAVHGSVAYAVATGWLHGARTVLSVRAVAATLSGL
GAHRVVFGVNTLLVLVMVRHSDTAAVAGLGTTVLFVAATGAGSFLATVAT
PSLITRWGRYRTANGALVAATVIQLAAIGLQLPVMVICGSLLGAAGQIVK
LCADNAMQLDVDDALRGHVFTVQDSLFWMAFIGAIAAAAVVIPADGRAPG
LAAAGVGVYLVGLALHAVLGRPSHARN
119871503YP_941455.1 hypothetical protein Mkms_5480 [Mycobacterium sp. KMS]MVFVAVLCLCAAVAVAGLGLWLLTRPRSADPRQQILRAVAPTQLAASVML
AAGGVVALAAPPETGVLAVIACGVGAVATVAAGCWQSAKVVARTEAAQAA
AGADADCAGSCASCVLSCR
119871501YP_941453.1 leucyl-tRNA synthetase [Mycobacterium sp. KMS]MSSRADGRARTRPKRSLYPGEVTETPTAQPDRAADADTPQHRYTAELAGQ
IEGAWQQTWAVEGTFNVPNPVGELAPPDGTVPADKMFVQDMFPYPSGEGL
HVGHPLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAVQTGTHPR
TRTEANIVNFRRQLGRLGLGHDTRRSFSTTDVDFYTWTQWIFLQIYNAWF
DRDANRARPIAELIGEFESGVRTLDDGRPWSELSAGERADVVDSYRLVYR
ADSMVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWMMRITAYSD
RLLEDLEVLDWPDKVKTMQRNWIGRSTGASVQFGTDAGDIEVFTTRPDTL
FGATYLVLAPEHPLVEQLAAEQWPDDVDGRWTFGATTPREAVAAYRASIA
AKSDLERQENKTKTGAFLGAYATNPANGQQVPIFIADYVLIGYGTGAIMA
VPGHDQRDWEFAHEFGLPVVEVISGGDISEAAYAGDGLLVNSDYLDGLDV
AAAKAAITDRLVADGRGRARVEYKLRDWLFARQRYWGEPFPIVYDSDGRP
HPLPESALPVELPDVPDYSPVLFDPDDADSEPNPPLNKATDWVHVELDLG
DGLQTYTRDTNVMPQWAGSSWYELRYTDPLNKEALCAKENEAYWMGPQPA
EHGPDDPGGVDLYVGGVEHAVLHLLYSRFWHKVLYDLGHVSSREPYRRLV
NQGYIQAFAYTDSRGSYVPAAEVVERDGKFWFEGAEVFQEFGKIGKSLKN
SVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFLQRVWRL
VVDEQSGAVRVANHEALDTDTLRALHRTVAGVSEDYAALRNNTAAAKLIE
YTNHLTKEGVTARAAIEPLVLMVAPLAPHLAEELWRRLGHDTSLAHGPFP
VADPQYLVTDTVEYPVQVNGKVRSRITVDADAGKDTLEAAALADEKVQAF
LNGATPKKVIVVPGRLVNLVV
119871499YP_941451.1 short chain dehydrogenase [Mycobacterium sp. KMS]MPTAMITGASRGLGAAIATALAPTHTLFLAGRPSAQLDEVAQRLGATTWE
IDFDDVDTIPAAVEPIVELDVLIHNAGVAYPARVAESTVDEWRATMNVNV
IGAVALTLALLPALRAAPDGQVVFINSGSGINASPGLASYSASKFALRAF
ADSLRNDEAGLRVTSVHPGRIATEMQQDLRAYEGRDYNPADFLSAETVAK
VTADAVNAPADAHIHEVIVRPR
119871497YP_941449.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MNLTAKAKTAGPDTLDWRTMVETQTQVTELAGELQRVLSKVFSVLRRGDV
NRGAEGGDLTLAQLSILLTLLDCGPIRMTELAAHERVRTPTTTVAIRRLE
KLGLVKRSRDPSDLRAVLVEVTPEGLVQHREALATRRAHLATLLSKLSDE
ELDTLAKALAPLERLAEQHQD
119871495YP_941447.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMNVGRIAALITTMLMVATLCCAAPAGAQVDQCAPPGVESASALPTNLAAA
AQGPEADRYTTANVRPLDSIDVDALGLGTPGVLTVGTLSDAPPSICIDSS
GQFTGFDNELLRAIAEKLGLRVNFVGTEFSGLLAQTAARRFDVGSSSITT
TDARRRTVGFTNGYDFGYFSLVVPSGSPIDGFGKLGPGQRIGVVQGTVQE
AYVVDTLRLQPVIFPDYNTVYASLKTGQIDAWVAPSAQAEGTVQAGDPAQ
IIENTFSLDNFIAYAVAKENQPLIDALNSGLDAVIADGTWARLYSDWVPR
ALPPGWKPGSKAAPAPELPDFQAIAAQQQESDAGPAAPKSTLRQLSDSFL
NWDLYRQAVPDLLKTGLPNTLILTVSAAVIGLVLGMALAVAGISRSRLLR
WPARVYTDIFRGLPEVVIILLIGLGVGPIVGGLTGNNPFPLGIAALGLMA
AAYIGEIFRSGIQSVESGQLEASRALGFSYSSSMRLVVIPQGVRRVLPAL
MNQFISLLKASSLVYFLGLVADQRELFQVGRDLNAQTGSLSPLVAAGLFY
LLLTIPLTHLVNYVDARLRRGRRPTEEDPPTLQPAATQEMI
119871493YP_941445.1 hypothetical protein Mkms_5470 [Mycobacterium sp. KMS]MTPATHPVRIGVQLQPQHSPEYRHIRDAVRRCEDIGVDVAFNWDHFFPLY
GDPDGAHYECWTMLAAWAEQTSRIEIGALVTCNSYRNPELLADMARTVDH
ISDGRLILGIGSGWKQKDYDEYGYEFGTAGSRLDDLARALPRIKSRLAKL
NPAPTREIPILIGGQGERKTLRLVAEYADIWHGFTDRTTYPGKAEVLDRH
CADVGRDPSAVERSSGVPESGKDAMLAEADALVELGVTLLTVGVNGPDYD
LTAAETLCRWRDSR
119871491YP_941443.1 hypothetical protein Mkms_5468 [Mycobacterium sp. KMS]MALVPLNLFVSHDGKSKRQHITCRYKCGDACWKPVPNTSDNEYFGDVVKA
VTRRSMLQVTGVTVLAVGAGSVLAACGGGEQPAATTPTSDAPAEPPAGMK
FTSVAPNSEDTVVVPEGYEQAVVISWGDPILPGAPKFDVARQTGAAQRGQ
FGFNNDFAGLLPIEGQRNRFLLVTNFEYVDPVFMFPGYNPDAPTREHFDV
EIAAVGMGVVEVERTPQGLKPVIGRYNRRITADTPMTLTGPAAGTDFVKT
AADPDGRTVAGTFANCAGGVTPWGTVLSGEENFQDYFGAAEGAPAPNPVD
ADRLDRYGISPEPTALLWETFDPRFDLTKTPNEPNRFGYVVELNPWDPNS
KPVKHSAMGRLKHEGANIYVTDDGTVVAYTGDDERFDYMYKFVSSKKMQP
GAGASEATGDAYEPAAMAHNMTILDEGTLYVAKLTSDIPADEIDGSGKLP
STGSFRGSGTWIPLLRSGPGGQAESLVEGISAQEAAVFTRMAADKAGATK
MDRPEDFEANPKTGKVYVALTNNDERGASGEAPVDAANPRNDNKSGQVLE
ITDNHTGTDFTWELLLVCGDPAAADTYFAGFDKTKVSPISCPDNLAFDNH
GNLWISTDGNALDSNDGLFAVALEGANRGETKQFLTVPLGAETCGPIVLD
DLVMVAVQHPGEHDDNSIDNPLSRWPEGGNGTARPSMVAVWRNGGQIGV
119871489YP_941441.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MVTDAELLELDEFALLPENAEQIGVSEIPPAARIDAGPISAIKWGDDEPR
VVFLHGGGQNAHTWDTVVLGLGVPALAIDLPGHGRSAWREDGDYGPKLNA
ETLRPVLREWAPNPRLVVGMSLGGLTALRIAATEPALVPELVLVDVTPSA
PERHEQMTKAQLGAVALVQGDRTFPSFEAMLDVTVAASPHRDRNSLRRGV
FHNSKRLDDGSWTWRYDSFRKGDGFEGLWDDVPAITMPTTLVRGAKSFFV
NDEDADAFAKGAPGFQRTHVVADSGHSVQGDQPKALVEILRDVLTRQS
119871487YP_941439.1 PadR family transcriptional regulator [Mycobacterium sp. KMS]MLELAILGLLLESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQVDG
LIVEDAAPAGTVTRRRARRVYQLTDAGKQRFAELVADTGPQNYSDDGFGV
HLAFFNRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLH
QLGLESSEREVKWLNELIAAERLGQGSPDNT
119871485YP_941437.1 hypothetical protein Mkms_5462 [Mycobacterium sp. KMS]MRLQRQVVDYALRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSS
VMCPICRKEQLTLVSWVFGDHLGPVSGSARTAEELVLLATKFDEFSVHVV
EVCRTCEWNHLVKSYVLGAVRPPKAPRGTRPARKSARTASE
119871483YP_941435.1 hypothetical protein Mkms_5460 [Mycobacterium sp. KMS]MSPSPLAQDLRSAEDRDLPSRTDRIGAALSETIGGPVGRHALIGRQRLMT
PLRVMLIIAVVFLALGYSTKAACLQTTGGGSADQRVANWDNNRAYYQLCY
SDTVPLYTAELLNQGKFPYKSSWIETDGSGEPRMTYDGQVAVRYMEYPVL
TGLYQYVSMALAKTYSAVTRAASIPVVAEVVMFFNIAAFGLALAWLATVW
ATAMLAGRRVWDAALVAASPLVIFQIFTNFDALATAFAVGAMLAWARRRP
VLAGALIGLGVAAKLYPLLLLVPLALLAVRTGRWREVAKTAATAFATWLL
VNLPIMVLFPRGWSEFFRLNTRRGDDMDSLYNVVKSFTGWGGFDTGLGFW
QPPTVLNAVTAVLFASCCIAIGVIALTARQRPRLAQLAFLVVAAFLLTNK
VWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMLYLYGEANRGL
PEQWFTATVLLRDIAVITLCALVIRQIYRPELDLVRYGGRVDDPAGGVFD
RAPDDPPRWLPDWLRPTGQRVRVDAPPPAPDEEPTDFAAQTRLL
119871481YP_941433.1 single-stranded DNA-binding protein [Mycobacterium sp. KMS]MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVME
VEVDEIGPSLRYATAKVNKASRGGGGGGGFGGGGGGGSRAGGGGGQAAAA
EDPWGSAPASGSFSGADDEPPF
119871479YP_941431.1 50S ribosomal protein L9 [Mycobacterium sp. KMS]MKLILTAEVDHLGEPGDTVEVKDGYGRNYLLPRGLAIVASRGAQRQADDI
RRARELKTVKGLEHANEIKTALEALDTVELAVNASADTGKLFGSVTATDV
VAAIKKAGGPNLDKRTVALPKAHIKSLGTHSVSVRLHPGVEASVSLNVVA
ES
119871477YP_941429.1 hypothetical protein Mkms_5454 [Mycobacterium sp. KMS]MYVRSMSGHDLQAAVTALRAAFDEVASCDVALLDRAELVAALDELEALGC
RLPTMSHRLLARLRSEATPQQMGAKSWREVLTVRWRISGSEANRRLTEAG
LLAPRQALTGPSLPPVLPATAVAQAHGLINSEHVEVIRRAVDKLPGFVDT
VTREQFEVTLVRTAVGVGPKELKDTADLTLFLLDQDGPEPDDTERARKRG
VSRSKQRPDGMVDLSGHLTPEAWAVWEAIFAKYAAPGMCNPDDPEPCTSG
TPSQEQIDNDHRTLAQRQHDAMVAIGRIALMSGELGQLNGLPVSIIIRTT
LEDLESRAGVGTTGGGTVVPIADVIRMAGHANHYLAVFDGATGSALDLFR
AKRTASAAQRIMLIARDGGCTKPCCTVGAYGCQVHHVDADWSDGGNTNVD
ELGLACGADNRSVDKDGGWSTRMNDQCEVEWIPPPRLDTGQARLNHYHRP
ERLLRPPDDPSVPGDPVVWAEPADANGISDAEPADECDETVPAEPDSPTQ
SADSAGEPGGPAPPEGRAA
119871475YP_941427.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MSFTDEELAYMASQPLARIATVDDEGLPDVVPVGFEFDGTYINIGGFRPA
NTRRHHNVAAGHYKVALVIEDLASTDPWSPRYLRVYGTAEVVGGPNPYLR
VRPTVSWSWNLGGEPLNHHKMVAPKKTVH
119871473YP_941425.1 transposase- mutator type [Mycobacterium sp. KMS]MLTVVHDAIEANESTGGAGRSLLDEIVRDGARQMLAAALQAEVAAYVAQF
ADQLDEKGHRLVVRNGYHQVREVLTAAGAVEVKAPRVNDKRVDPDTGERK
RFSSAILPAWARKSPQMSEVLPLLYLHGLSTSDFTPALEQFLGSGAGLSA
STITRLTSQWQDEAAAFGRRDLSGSDYVYLWVDGIHLKVRLDQEKLCLLV
MLGVRADGRKELVAITDGYRESTESWADLLRDCKRRGMTAPVLAVGDGAL
GFWKAVREVFPATKEQRCWFHKQANVLAALPKSAHASALSALKEIYNAED
IDKAQVAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTT
NPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRAVNAPHLV
ALVRAGAVFHKGKLLERPTEITPPTPPSDGDQQAGTEVA
119871471YP_941423.1 activator of Hsp90 ATPase 1 family protein [Mycobacterium sp. KMS]MPVTEFNTNIDDLTLTITAEFAAPVERVWQIYADPRQLEKIWGPPDYPAT
VVDHSLTPGGIVTYFMTGPDGDKYPGYWKVIAVDEPRSFSFEDGFADDDL
KPASDMPVAHSVYTFEPAGDGRTIATYVSRYASAEGLQKVLEMGVEEGST
QAINQIDAFLAG
119871469YP_941421.1 hypothetical protein Mkms_5445 [Mycobacterium sp. KMS]MHWPPPESCSGIGRSRRWVAGTLFEPLGYDFERRVRIFENITRLNVGIAM
VTDRLPFSNPIRERKKKTGAAARARIAMLNKIARGRQIPLTYTHHDRSAK
GEGFTG
119871467YP_941419.1 twin-arginine translocation pathway signal [Mycobacterium sp. KMS]MQVSRRDALRYATAVSALAGLGAVSAGRYAPAAAAAAPTLIDYAMRQIPA
QDIRAAGHAGVINYVSTSRPGSSFGAKPITLPYARSLAAAGLAIVSNYQY
GKPGGTAPSDFTRGYAGGVADARTGWQLHSAAGGGQSAPIFFSVDDDVDR
EAWNTLVLPWFRGINSVVGVQRTGIYGGIRACQWAVADGVIGRSRSPGKV
WAWQTRSWSNGQIYPGAVLYQRIIDTASNPGPVVGGIRVDVNDVLAQDCG
QWNLHP
119871465YP_941417.1 nitrate/sulfonate/bicarbonate ABC transporter periplasmic component-liMFKHFSRLARWGAVASAAAVVLTACGSGGGTEPAKTDGGLDKVNVGTIPA
ILSAPLFVGIEEGIFEKHGLEVQVNFADGGAAVIPSVLSGENQFGYSNTV
SQLAAIDQGLPLRLVQPAWAPCCQPDQDDHGVLVLPDSGINDPKDLEGAN
IAVNTLQNIGEVHIRRAMDNLGVNHESLTWTQLPFSDMGEALERGDVDAI
WVSEPHRTPGLNKGWKQIIAPGVQSFPDQIGGYYSTSQQFAESNPEVVRK
FREAMTEVNGFAQDNPDRVGEVAVAEMGIDAAIIDQVNFPKFPTEDDGQA
LRNYGAAVVEYGIIDKEPEDYDALFAATD
119871463YP_941415.1 binding-protein-dependent transport systems inner membrane component [MSTFMVAASTGRGRIALGVLGAVGALTAWFLVSANSGNAYFPPLSAVLEQ
AAEYWSTPEGLANIRASLTTLSAGLAIAVVVGVAAGLVIGQLPIVEKTVS
PTLEFARAIPSTALIPFAMMLFGVSPEMKIFLIALGCVWPVLLSTADGAR
RLDSTMIASVRAFNITGLQRQWYVVLPAVLPRVLVGVRIAIPLSLILMVT
SEMVGARTGLGFVITQAQATFQLLTMWSGILVLGILGFLMTFLYALAERR
LLRWCDPRRSDTR
119871461YP_941413.1 FAD-binding monooxygenase [Mycobacterium sp. KMS]MPTALICGGGVAGLSSALHLKQQGWKVQIFESDSELRTAGVGLNIWPNGV
RVLDGLGLGAQFRSFAAAMDRWWALDSDGELTSDIDVSHWNELLGAPVTG
ARRRRLNAMLADALDPVEIQFNTTAVGYTQTDDTVTVHFEDGRSATGDVL
LGADGIGSRIRNAMFGAPPAFTDEAIVRWRGVFETAQAGVPARVQADVYG
ARGHFGWIPIDATHAYWYGSVGGLSTFDEFRAVYDTWTNTPVPQIIASSE
PESIIGREIGHYREHLPRWVDGRVALIGDAAHPMYPGMAQGANQALIDGQ
TLTHHLTVHGDVPTALQMFERERIPVANKMVDYSRLHFDYERTRKEYRSG
QGNLQINRYLEFES
119871459YP_941411.1 D-isomer specific 2-hydroxyacid dehydrogenase [Mycobacterium sp. KMS]MSLNVVVAGLPKAVQNAEDPDEGIWLTPEQKDRITAVADDVWLEHIPVSE
LNAGKAPQRPPHAIMVETSGSKKEIEIEQGILKMPGLQQLFNPDLKLLQS
MSAGAEHLVNIMPEGVVLANASGVAANAIAETVIAGILAQAKMLRERWSN
QAAREWKELPARELADTTMTVLGTGNIGARTATIAGVLGIRTIGVNRRGN
AVEGFDETVPTAQLHDVLAESDYLVIAAPLTPATRGLIDAKALAALKPGG
WVANVARGAIHDADALTDALERGHLSGALIDCHVTEPLPADDPLWKAPGA
MVFPHDSHASQLLGDRQVDVFVDNLQRLVAGREFRNVVDLSLGY
119871457YP_941409.1 L-glutamine synthetase [Mycobacterium sp. KMS]MARDAAEVEVMAKQLKEDGVRFSIAAYTDLHGNIKGKMVPIDHFVQMAGG
SELFTGAALDGLPQDVSDEELSAHPDLDRGFVLPWRKDIALFLSDLYVGG
EPFEASTRNILGRQMKAAEELGFVFNLGVETEFFVLEDGPVGPSALSERD
TLEKPCYAVPMLLDNFGWLQELVDYMNELGWDVYSFDHEDAQGQFEIDFA
YADGLSMADRVSFFRLMANEVARRHGAYVSFMPKPFADRTGSGAHFNMSL
AGLDDGHNVFESADDPRAAGLSDIGYHFAAGIVRHAAAICAVIAPTVNSY
KRLVRQGSMSGSTWAPIFASCGNNNRTNMLRIPLGGGRVECRAVDSAANP
HLAAALLLAAGLEGVREQLELEHFHTDNLYEVDAGEYEKRGLSLLPRTLE
EAVDAFEADPFTKQVCGEKLWQSFIDYKRSEWTSYATAVTDWERDRYLKF
F
119871455YP_941407.1 DNA topoisomerase [Mycobacterium sp. KMS]MSYTAADITELDDVQHTRLRPAVNLGLDVLNTALRELIDNAIEEVADPSH
GGSAVTITLHDDGSVSVADDGRGLPVDSDPVNGKNGIVKTLGTARAGGKF
SAHTDAASTGAGLNGIGAAAAVFISARTDVTVRRAGKTYLQSFGRGYPGV
FEGKDFDPDAPFTRADTQKLRGTGNRKPDVHGTTVRILFDPAVVPDSQID
IGEVLLRAHAAARMSPGVHLSVIDEGWPGDEVAPALLEPFTGPWGTDTLL
DLMCTAAGTPAPGVRAVVEGRGEYTTGRGPTPFRWSLTAGPAEPATVAAF
CNTVRTPGGGSHLTAAMKGLSEALADRASRMRDLGLAKGEEGPEAQDFAA
VTALAVDTRAPDVAWDSQAKTAVSSRSLNVAMAPDVARSVTIWAANPANG
DAVSLWTKLALESARARRSAEGAKARSRAASKAKGLGTNLSLPPKLLPSR
ETGRGSGAELFLCEGDSALGTIKAARDATFQAAFPLKGKPPNVYGFALNK
ARAKDEFDSIERILGCGVRDNCDPELCRYDRILFASDADPDGGNINSSLI
SMFLDFYRPLVEAGMVYVTLPPLFVVKDGTQRIYCQDESERDAAVAKMKA
TSKRKVEVQRNKGLGEMDADDFWNTVLDPQRRTVIRVHPDDSENKLHHTL
FGGPPEGRRTWMADVASRVDTTALDLS
119871453YP_941405.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MVPVEDTALATTDSGGTGVPLVYLNGSYGSQRHWRRVIDELGPGWRHITY
DERARGKSTRSADYSFEATVRDLDAVLRAREVDEPILVGWSYGALIAVQW
AARHPSRVAGVVGVDGPYPDGWTDEAAHEYIRRSFRRYRWVLPMARLIGN
AARMSADQHAEINIEAHKIHAALEPILESVTVPVRYVVASGEYLGSKDNA
QERMRTTLRPVLARNPNLAVSAKVDSNHGTIVRKDFRAIARAVREVAAFG
RQSR
119871451YP_941403.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MYRSVVNEYHAGMARPRKFDEAEVVEASRDLFWDQGYAATSIDDLSAATG
LGRGSFYKAFGDKHSMFLRSLELYCTEALDGIRAELRNPDLSAYDRLVGH
VRGTAAGVASDTDRRGCLLAKSAAELSATDPAVAKLVKRTLDGWLRELTA
TVSAAQADGDVPADTDAKAMASLLLVVLRGMEALRKGGASATTVKMAAEQ
AIAMLAVPAPVAG
119871449YP_941401.1 hypothetical protein Mkms_5425 [Mycobacterium sp. KMS]MGRRRLPKRAMASIALACVALLVNGCEARVSGMPPADVNTPQATVTAPQA
PRPVLPEAPPAQPTAEFNGLDARVRQATANAAESGADINTVVLDRTTGQI
VSDGADDSFPIASVVKLFIADDLLLQESQGETKLSAADRKSLDIMLRSSD
DSAAQMFWDRGGQNAIIARVVARYGLTGTTAPYNAHWDVTQSTAGDLVRY
YRMLLDGTGGLPSEQADVIIGNLAQSTPTGTDGYPQRFGIPEGLYAEPVA
VKQGWFCCWNGANQLHVSTGVIGSDRRYVMAISSLDPDDDASARETMTQA
VKTMFPGGRI
119871447YP_941399.1 hypothetical protein Mkms_5423 [Mycobacterium sp. KMS]MALFRLAGALAVGLMAPWLSVSPAHAETYAQLGAVPVVASPSCAGSVSAE
AQLTPVQVDDRVEDGVRIAIHYDAGVYDGSCALTVTAAWANLDTGASGSG
DITAVSTIDGHYGFIGYANTTFETGRGTVVFTLNSHPDAEMVITV
119871445YP_941397.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. KMS]MYSTMQDVPLTVAAILRYAATVHGDRTVTTATGNGGYRHATYREVGQQAA
RLAHALRRFGIEGDDRVGTFMWNNQEHLEAYVAVPSMGAVLHTLNIRLFP
EQIEFVAYEAEDRVLIADLSLAPVLAPVLRSLETVHTVIAVGEGDLAPFE
ESGKRVVRYHEVTAAESDEYDWPDIDENSAAAMCYTSGTTGHPKGVVYGH
RSSYLHSMAVCGGNGLGMSFSDKALPIVPMFHANAWGLPYAALMAGADLV
LPDRFMDATSLVDLIETQRPTVAGAVPTIWNDVMHHLDQNPGHDISSLRL
VGCGGSAVPVSLMKAFEEKFGVQIRQLWGMTETSPVATIAWPPPDTPAEK
HWQIRSTQGRPLCGVEARIVDDDGAVLPNDGESVGELEVRGPWITGSYYR
NTDDSKFQSGWLRTGDVGRIDPQGYITLTDRAKDVIKSGGEWISSVELEN
HLIAHPAVREAAVVGVPDERWQERPLAAVVVQEGAQVDADELRNFLADKV
VRWWLPERWTFVDEIPRTSVGKYDKKVIRARYADNAYQVADLREHT
119871443YP_941395.1 hypothetical protein Mkms_5419 [Mycobacterium sp. KMS]MVALIDSVRRELAAAADPDRAPAMQAYMKSQMPYYGIRLPDVRRLCGPVF
DAHPLGSETSFEDAVERMFVEATHREERYAAIQLARHRRYRPFQTPDRIP
LYRRLIIAGDWWDTVDEIAGNLIGPILVSHPAEVRPIVLGWATDHNLWLR
RTAIISQLSAKERTDLELLTCAIDANAGDTEFFIRKAIGWALRQYARTDP
TWVLRFVAAREDRLSGLSKREARKHLLPAAE
119871441YP_941393.1 gluconate kinase [Mycobacterium sp. KMS]MAAPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPENIAKMTAGHP
LDDDDRLPWLESIGEWLAAHHDGGVMSCSALKRKYRDQLRRHCADVEFLH
LAGSVETIGRRQASRPGHFMPATLLASQFETLEPLEPDENGVALDIDQSI
DSIIESYVNTTHSHGAEKEDR
119871439YP_941391.1 hypothetical protein Mkms_5415 [Mycobacterium sp. KMS]MKHARRRFGRAHYGHEVHRRTALKLPLYLAAAAALAELPRAAAEASRWSA
DRANAWYAAQGWLVGANYVTSTAANQIEMFQAGTYDPRRIDAELRLAQQV
GFNTVRVFLHDLLWATDRAGFSQRLTQFVGIAARHQIKPLFVLFDSCWDP
MPKPGRQRAPIAGVHNSGWVQSPGAARLQDPGYTRVLQSYVTGVVGLFRN
DPRVLGWDVWNEPDNPARDYRKVEREDKQELVAAFLPHVFQWTRAMNPVQ
PVTSGVWQGHWRDPGSRSTICGLQLEHSDVITFHSYGDPDEFEARIDELA
PLGRPILCTEYLARGMGSTVEGILPVAKRRNVGAYNWGFVAGRTQTYLPW
DSWKKPYTEPPDPWFSDLLHPDGRPYDEDEIRVIQKLTTGAAASAR
119871437YP_941389.1 dehydratase [Mycobacterium sp. KMS]MTAAPEASPLEARVGHYYQMDDTYLVGREKVREYARAVQDYHPAHWDVAA
AADLGYSGLVAPLTFTSAPGMSCNRRMFEQIVVGYDTYLQTEEVFEQHRP
IVAGDELRVDVELTSVRRIAGRDMITVTNTFTDTAGERVHTLHTTVVGVT
AEDLNPEVKTAVQNAMMHDVDFSGVGSLDGHYEKTVRPEGDVRIADGGLT
RTPGTPSFDDVKVGDELPVRHTRLSRGDLVNYAGVAGDANPIHWDEDIAK
LAGLPDVIAHGMLTMGLGAGFASAWTGDPGAVTRYAVRLSAPAIVPAKEG
ADIEFSGRIKSLDPATRSGVIVVAAKSQGKKIFGLATMNVRFR
119871435YP_941387.1 aldo/keto reductase [Mycobacterium sp. KMS]MSTTFPLGPYTVRRVGFGAMQLPGPGVFGPPRDHDQAIAVLRRAVELGVD
HIDTAQFYGPNVANELIREALHPYPESLALVSKVGGRRDDQANWLPAQEP
DDLRRDIEANLRTLGVDRLAAVNLRVFGDDIGGPAQVDRNLFERQLDAMI
AARDEGLIVGIGLSSISREHLEIALERTEIACVQNAFNLADRTSQPVLDL
CVERNIAFVPFFPLGSGFVADNPVLGNPTIKRVAEQLGRTPAQVALAWTL
NVAPNVLLIPGTSSVAHLEENLAVADIDLPAEVAI
119871433YP_941385.1 hypothetical protein Mkms_5409 [Mycobacterium sp. KMS]MHSNKVLVAGAAVALVTAIASCGNSGNDEAASPAPAPVQTSSAAPAASHN
QTDMMFSRHMIPHHQQAIEMSDMVAAKEGIDSRVIDMARQIKAAQDPEIK
QMQGWLDQWGMPGPNAPGGDMGPHHGGTSSGPMMPGMGGMPGMGGMAGMD
GMMSPADMDALRNAQGVDASRLFLTQMIRHHEGAITMAQNEIDNGQFPDT
VALAKSIVTSQKKEIDTMKQILDSL
119871431YP_941383.1 hypothetical protein Mkms_5407 [Mycobacterium sp. KMS]MAATIERMSPRAATKTDSKLAARLAALASLGAAVIHFAVVPTHWQEWPAA
GVFFVSIAVFQLIWAFAAPGRATTEVLVAGVLLNVGAVALWLVSRTAGAP
FGPHAGMPERVQAADLCALLLQIYVVMGAGWVLYRGHFGQQIPALANALI
LLGAVGVVTLASTVGVASGLRHGHHTPAGAEVPHPSAEHAEAHSHHRPEP
PAAPPSDTAPLGTIPQAPAPVDTPPAHDEHGEHAH
119871429YP_941381.1 hypothetical protein Mkms_5405 [Mycobacterium sp. KMS]MPRRAPTKPGLPAERTLLSWERSSFGFLVGGALVLLRNHGPLGPARMLLA
ITAALLALVVLALGYRRTRQIRNSPVIAGRVVTSAPGAEVLVIGGATVGF
ATAVVVVLLLFSI
119871427YP_941379.1 hypothetical protein Mkms_5403 [Mycobacterium sp. KMS]MIGLTIGLAVFVGIALGLLGGGGSILTVPLLAYVAGMDAKQAIATSLLVV
GVTSAIGAISHARAGRVQWRTGLIFGAAGMAGAYGGGLLARFIPGTVLLI
GFAVMMVATAVAMLRGRKNVETAGGAHRLPVPKIIAEGLVVGLVTGLVGA
GGGFLVVPALALLGGLPMPIAVGTSLIVIAMKSFAGLGGYLSSVQIDWSV
ALAVTGAAVVGALVGARLTAMVNPDSLRKAFGWFVLAMSWVILGQEIHLG
VGIAGATLTAIAATMSVACTRYAHCPLRRLTGVSASGGAAA
119871425YP_941377.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MKFTQYYLDCLSHASYLIADETTGRAVVVDPQRDVSEYLADAKESGYTIE
LVIETHFHADFLSGHLELAKATGAKIVYSSVAETEFESTGVADGERYSLG
DVTLEFRHTPGHTPESMSIVVYEHADDEVPYGVLTGDALFIGDVGRPDLL
ASIGFTREELAEKLYDSLHNKLMTLPDATRVYPAHGAGSACGKNLSTDLW
STMGDQKETNYALRAPDKATFMDLVTEGQPPAPSYFVYDAILNRKERELL
DETKMPPAMTYEQVRDAMKAGAILVDGRGPEEFALGHLRGAVNIGLAGRY
AEFAGSVLPSDVDIVLFTEPGQELEGKNRLARIGFDRVIGYVDRPFEVMF
NHQDDVQMASRLTAKAFDQRAAELADLQVVDVRNPGEVAAGTIPNALTIP
VGQLPARLGELDPAKPTVVYCAGGYRSSVAASLLRQNGFGDVSDILGGFN
AWDEARQNA
119871423YP_941375.1 thioredoxin [Mycobacterium sp. KMS]MSTKTLTYDNFEATVTGNPIVLVDFWAPWCGPCRAFAPVFERSSQTHPDV
VHAKVDTQAERDLAATLEISSIPTVMAFRDGVLVYRQAGALPPAALEDLI
TRVKALDMAEVRARIAARKATAQA
119871421YP_941373.1 hypothetical protein Mkms_5397 [Mycobacterium sp. KMS]MSTARRCEARLEEKSHMSEDDVRDPAATAGAAIEQAVAVFMLHPQTYGGS
VAAGYQNPLAGYVAGRGGVLGDATGATVSAVFAVFEPTGLSAMWDEGIAV
RGAAGAAEVYWEQTAEFGRKYLSGAEGLERLAALGEKLIAATPTTALPLF
AGWRAMPLAADAPARALQVMFVLRELRAGLHFNALSLSGITPIEAHMLNK
GPQYAAMFGWPEPFADGADKKDRYAEIEQATNRRMAELCASALDPDEAAE
LARLSTEALAWLKANVPR
119871419YP_941371.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MADPSTRSRILDATAELYRRQGMPATGLKQISAAAQAAFGSIYHHFPGGK
EAISVEVIRREGIRYATFVGAQLAQIDPLDGIPELFEKAGRDLESQDYSE
ACSIETIALEVASTNERLRVEAAEVFQSWLGGLAAWFGQLDLTEAECRRL
AMITLTALEGAFVLCRTLRSVEPIVCAGHGVRAAVHAAVRKPV
119871417YP_941369.1 MOSC domain-containing protein [Mycobacterium sp. KMS]MTNTDVTGKVSALRRYPVKSMLGEQCDALSLGPLGVAGDRRYAYIDEETG
RVATAKNPRLWRRLLQCSSATGADGVVVTLPDGRTVPVAESDGPVSELVG
RTVHLADERSAGAVVERSDPIDVLTHGLDADIEAALLEIAQGTPGGAFVD
YSPVHLVTTATLDAVGLERAEAVRYRPNIVIETPAGCPPFIENDWVDATI
RIGAVELRGTMPTPRCSVPTLEHGALARSPQSVRYPLEHNRVEAGDFGVL
PCAGLYAEVVTIGTVSEGDAVRIG
119871415YP_941367.1 pirin domain-containing protein [Mycobacterium sp. KMS]MGRVSDVEVITSRAVPLGGPRAMTVRRTLPQRARSLIGAWCFVDHYGPDD
VGHTGGMDVPPHPHTGLQTVSWLFDGEIEHRDSSGVRALVRPGELNLMTA
GSGVAHSEVSTAATATLHGVQLWVALPEHARHLPRRFDHAVPAAVRIDGA
TVRVLLGTLAGHSSPVTAHSPLVGAEVVLDPHAELTVDVAPDFEHGVLVD
IGPVVLDGTHLSRAVLGYVAPGADRLTLANPGDRPARVMLLGGTPFPEPV
LMWWNFVGRSHEEIAAFRDEWEAESERFGRVEGYRGHVPRLPAPPMPTVR
LKPRLSPPAGGDPSAWG
119871413YP_941365.1 cutinase [Mycobacterium sp. KMS]MPVDRVTRRRYSAVAAATSTALAALATGAAPTASAAPRCPDIEVIFARGT
DEPPGIGVVGTALVDALRPMVKGKTVGTYAVKYPASWDFSQVGLGATDAS
LRVQSTAAKCRGTEIVLGGYSQGAAVMDIVTTSPIAGLGFAAPMPAAVVP
RIAAVTVFGNRSARVGQPLTRLSPVFGSRTADLCNTNDPICSLGRDFDAH
VRYPQSGLVKLAAQWVTAQVRTRAARAPVSG
119871411YP_941363.1 hypothetical protein Mkms_5387 [Mycobacterium sp. KMS]MQLLRDAVVLFHIVGFAVTFGAWVAEAVARRFRTTRLMDYGVLVSLVTGL
ALAAPWPADVVLNYPKIGVKLAILIVLGGVLGVSNARQRKRNAPVPRPLF
VAVGVLTFAAAAIAVLW
119871409YP_941361.1 NADH:flavin oxidoreductase [Mycobacterium sp. KMS]MAIDDLFQPLTVRSLTVPNRFAMAPMTRQASPDGVPGSDVAEYYRRRAAG
GVGLIITEGVRLPDPAAGYPSSIPTIAGDDVLDGWSRVVRAVHAAGGTIA
AQLWHQGAERSDADGVAPVSPSGVDGLGRPKGRALATHELDDIAALFAQS
ARTAREVGFDAVELHGAHGYLLDEFFWERTNSRADGYGGDLAARTRFPAE
VVAAVRAAVGPDYPIIFRFSQWKGLDYTASIADDPTQLQELLAPLIEAGV
DVLHPSTRRHYVPAFPDHGELSLAGWTKKVTGLPVIAVGSVGLETQFRSE
KQGQVIQPAPVERLVEQFEAGEFDIVAIGRALLADPAWVNRLRDGELGGF
AGYDPAAALATLA
119871407YP_941359.1 RNA polymerase ECF-subfamily sigma factor [Mycobacterium sp. KMS]MAADPLDAARLRDLIPGVLAALVHRGADFATAEDAVQEALIRAVETWPEH
PPDEPKGWLITTAWRRFLDLSRSDTARRRREERVSNEPPPGPTESADDTL
QLCFLCAHPSLTPASAVALTLRAVGGLTTRQIAQAYLVPEATMAQRISRA
KRTVSGVRLDSPGDLRTVCRVLYLIFNEGYSGDVDLAGEAIRLARQLARM
TDDPEVAGLLALFLLHHARRPARIRADGSLVPLADQDRSRWRRDLIAEGV
TILQAALARDRLGEYQAQAAIAALHADARTVEETDWVQIVEWYDELVRLT
DSPVVRLNRAVAVGEADGPRAGLAALAELDPSLPRYSASAAHLHERAGEI
ATAAELYVQAANQAQNLAERNHLTVRAAALRQRLAGDI
119871405YP_941357.1 FdxD protein [Mycobacterium sp. KMS]MRVVVDSDRCEGNALCVRIAPAVFQLDDDEYATVVADPVPVEEEARVAQA
IADCPRAALSRED
119871403YP_941355.1 transcriptional regulator [Mycobacterium sp. KMS]MSTRRQDVLAVLREAGTALSIAQIAGELAVHPNTARFHLEALAGTGQVEA
VEADRAKPGRPPLMFRAVAGMDPAGPRDYRTLAGILADALARQPNAARRA
VTAGRSWGEHTAEPTRTRSRRQAVDRLTDLLAGLGFAPEARPTAGGIGEI
GLRNCPFLDLADTRRDVVCPVHLGLMQGALSRWKAPITVEALIPFAEPDL
CVAHLAPAGRTS
119871401YP_941353.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMCQYCGCRDIPLLRDYIAEHERVVNIGGSAVRALDRGECDRARELLAAMA
DELRSHWRGEEDGLFTVMARDELFAEHITPLVREHRELEEFLDTVDVSDP
GDQELIRKAVFDLYGHIAKEEDGLFPASLTALDGSEWDEAIAAWERAHPG
GR
119871399YP_941351.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MSSSIAEQPQQLRREFSLWSAFAFISPIVALYGIFGLALSAAGPSFWWGF
LLVFAGQFLVALVFATLVSRWPLEGSIYQWSRRLLGTTYGWFAGWVYMWT
LVIAMATVALGAAGFIANIIGLEEPSGGTLALIALVILLAGTAVNLVGRG
ALKIFMIGSIIAEVIGSVVLGTWLLLFHRENSLSVLFEGGGADTGTLAYL
TGPFMLAVAFIGWSFVGFESAGSIAEEVHEPRRDLPKAVLFSLAFIAIVV
AYSSLAIILAIPDLGAVTDGTVADPVYDTLTTALGAGVAKPVEVLFVIGF
LASFLALQTSASRVIWAYARDGALPAAGVLVRLRGKARIPVVAILVTTVV
GAALFLLSIVAGDVYSLMVNFTAGGFYLAFLFPLVGFLVVMLRRAWTPGA
FSLGRATLPIALIAVVWAALQFLNIAWPRVAFEQRYLDWSVWIGVAVLGV
LGALLLAGVRSRILASEVIDDAEVRDELADTHE
119871397YP_941349.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MTTDLTGRVALVTGAAQGMGAAHARRLAAAGATVALNDIRSGAALTTLAQ
ELGGLSLPGDVSDPDECVRLAAAVVEQTGRLDVLVANHAYMTMAPLLEHD
DADWWKVVDTNLGGTFFLVQAVLPHMRAAGAGRIVVISSEWGLTGWPDAT
AYCAAKSGLISLVKTLGRELAPEHIIVNAVAPGVTDTPQLQVDADAAGVD
LATIHRRYAAEIPLGRIGSPGEVSAAVELLSDFTMDAVVGQVISCNGGST
RGRA
119871395YP_941347.1 polysaccharide deacetylase [Mycobacterium sp. KMS]MSELRWPDGKSAAAAFTFDVDAESALLWGPAGNLEAVGARMSVMSHQAYG
PLVGVPRILDLLERHQIASTFFVPGHTADRYPEAIRSIVAAGHEIAHHGY
LHEQPTALTLEEEIDVIDRGLAALADVAGVRPVGYRAPMWDLSWRTPALL
AERGFLYDSSLMDADHPYELAVAGHDPLVEIPIQWALDDWEQYCFLPDIS
GSGLIESPRKARELWQLEFDGLRRAGGCWVLTNHPFLTGRTSRAAELDDL
MRYVLDHDDVWTTNLGTIAEHVRALGLAPRSITPPDVPR
119871393YP_941345.1 ABC transporter-like protein [Mycobacterium sp. KMS]MGEGIEVDGIVFDGVTHAYGDRPVLRDVSLTLSERRIGVVGANGSGKSTL
ARMINGLVLPDRGAVRVHGLDTRRATRKVRRRVGFVFTDPDRQILMPTVA
EDIELSLSRHGLSRGERAARTRRVLDRFGLAGHADHPAHLLSGGQKQLLA
LAAVLVTEPGIVVADEPTTLLDLRNTAMLRGAFATLDTQLIVVTHDLTVV
DDFDRVIVLDEGEVVADDVPAVALSAYRRLMS
119871391YP_941343.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MELDFTRLKYFVAVADELHFKRAADRLRITPPPLSKQIKLLERELGGPLF
ERNYHEVRLTPLGEQLVGPARDILRRVDEFKATAAQAVQGAAALRIGATA
YAPSDLLAQVEAAAADLPNPSVFSVPGSAAEVIAKLVSGHLEIGVIHLPA
KDNRLAHRVIATYPGAIAVRFDDPLAAFDTVTVEQLRDREVVIDFARPNP
VVLAALTRQLSARGVHRIVRTTNQRGGELEMAAQVSHRHLVAILTYAPAS
AIGRIFSPPEFRLIPIDESTWPPAEIALAWSRDRARAMPEIEQAVERLAD
AVERARSH
119871389YP_941341.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTETTPSADELRAEVRAWLEHNWKGLPKSTDPWVASPERVAWLEKVLDAG
YAVPTYPTEWFGREYPNHLASAIEKEFKAVRAPGARRDKYSIPANTVLKF
GSDTLKRELLRDFLTERASTCLLYSEPGAGSDLAGVHATAVRDGDQWVVN
GQKVWTSGAATADYGLLLARTDWDVPKHKGLSFFILPMKQPGIEVRPLVQ
ITGESHFNEVFISDAKVGDDFLVGGTGNGWRVLQTALAYERSIMGDSGRG
SRNSSRADSLVELAREHGRLDDPVIRDSLATVLALRELNRLNNARAKAST
SIGTSSSIMSLGKLAMSDILHTEARVKTDIIGAEALLAGPDHPEADDINF
LTLNAYFTSIGGGTDQIQRNIIGERVLGLPKEPEVDRDIAFRDARRN
119871387YP_941339.1 ABC transporter permease [Mycobacterium sp. KMS]MTDVSRPFPEPPVKTARTYRWRVVDIVVASVLAVAAGLVFVMWNIASNPI
GAPLSALAPGLQALLGGGWLFAGVLTAMVIRKPGAAVYGELVAATVSALV
GNQWGVMTLEFGLVQGLAAEIVFACFLYRAWNLPVAVLAGAAAGLAMAIN
ELLLLYPGSTSAFAAIYVVSGVVSGAVVAGALSWYVVRGLAKTGALSRFP
SGRTGSPSDVRR
119871385YP_941337.1 cobalt transport protein [Mycobacterium sp. KMS]MTSVDAAPAHTGINPVAKLAAAFVIAFGLVASVDWVSALTALTLELLLIL
ALRIPLRAVLIRGALLVLAAGLTGITILLYGERSGTVHWQFLMITVSDGS
ITLAVATFVRVLAIALPSVVLFIDTDPTELADGLGQVLRLPARFVLGALA
GLRTVGLLRQDWRYLGYARRARGVADRNRVRRAAGQSFALLVFAIRRGSM
LATAMEARGFGAYPTRTWARPSRFGAGEAALVLAGFGIAAASIAVSVATG
HWNFIGSR
119871383YP_941335.1 diguanylate cyclase [Mycobacterium sp. KMS]MQWVGRWWRQPDHFDWLSGYLQTRGMATAMRRGLALVAASLALVPVNALW
GPASIDDRLAVSLALVASLAGLSLAVLWLKRWPTRTESVLFAAIGSATIA
GGCLWQAEPLIGLTFCTALAVSGGYIAFFHTARYMLMNFVLAVGVGAWQA
IRVAAEGEPVLALTGYFLVLELNIGVPFAIQVVVRSLGTDLLQSDRDPLT
GLLNRRAFTHAVVGRLVARADRAHLAVALIDLDRFKAINDRHGHASGDAA
LVDVAGALTAAVTETALVCRMGGEEFLIADIVASAAPTEWAQGLCAAVTS
TPFRLTASVGIATVPLRDVKPEQADETFRRLVTEADAAMYAAKRRGGNQI
QHAGDARTPR
119871381YP_941333.1 ferredoxin-dependent glutamate synthase [Mycobacterium sp. KMS]MSRAVRGLATAVASTVAAVGLRDLFQRRHALLRNYPVVGHARYLLEAVGP
ELRQYIVAANDEERPFTRDQRRWVYASAKKENNYFGFGTDNDVEHTSGYP
VIKHRTFGRNGPASAPRAGQEVDLPCAKVMGAARDRPGAFRPASVVNISA
MSFGSLSGNAVEALNRGAAMADCLHNTGEGGISRFHRCGGELIFQIGTAY
FGCRDDQGRFNLEKLKEVVAGAPVRALEIKLSQGAKPSLGGLLPAPKVSA
EIAAARGIPQGRDCVSPSRHAEFSDTDSLLDWVELLAAETGLPVGIKSAV
GDLEFWEQLTDLMRDTDRGVDFVSVDGGEGGTGAAPLIFTDSVSLPFQLG
FARVYRVFAERNLHEQVTFIGGGKLGLPDNAVVAFALGCDMVNVAREAML
AIGCIQALKCHTDTCPTGVATQNAWLARGLVPDVKAERVANYIKTLRRDL
VKVAEACGVHHPGLIGTDSVDILDGRAASVPLHEVYGYTPDMGMPSKADC
EEIIRLMTAEKTRGGSAEPSASAVG
119871379YP_941331.1 putative helicase [Mycobacterium sp. KMS]MPGYEDELRSERTYVSGLYTRLDGERARAKEKYAAALRGDGALVERDAEV
RALAKEMQRLDVADDGLCFGRLDADSGERLYIGRIGIFDRDNDFEPLLLD
WRAPLSRAFYVATAAHPEGMRRRRQFRTRGRQILDFTDEVFGRPRGDERG
GDSALLAAVNAPRGEGMRDIVATIQAEQDAIIRLDHPGVLVIEGGPGTGK
TVVALHRVAYLLYTQRARIERHGVLVIGPNPAFLDHISRVLPSLGETNVV
LMTTGDLVPGISATAEDDAADVKGSLTMLDVLAAAVADRQRVPEQPLVIE
LPDVTVQIDPDTAQWAIEEARGSGLPHNHARKVFRETVEWVLTERAVSRI
GRGWLSRADKGAWEELRADVLEDLADSEQYLAALDELWPVLTPQTLLADL
YESRERLRAAGADERLWRSDGAAWTVSDVPLLDELVDLLGRDMAADIAAA
KEREAETDYAEGVLESMVAHEDLMDDEDLLLATDLLHGEELAERFTERDN
RELAERAAADRDWTYRHVVVDEAQELSAMDWRVLMRRCPSKSFTIVGDLA
QRRSAAGARSWGAMLDTYVPGRWVYRPLSVNYRTPAEIMAVAAAVLAEFA
PDVTPPESVRSTGVQPWRRQVTPDELPSAIGEFVDDESGREGTSVAIGPP
DVPGTVAPSEVKGLEFDAVLVVEPERIFDGPRGAAELYVALTRATQRLGI
AHCGPLPPALAALVDIPVDREAAR
119871377YP_941329.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MVAGVGDVFKALADPTRRTILDELADRNGQTLFEICARLTTKHGLGSSRQ
AISQHLDVLEDAGLVQTRREGRYKFHYLDTTPLEPIIERWLDKTRRDKEE
SP
119871375YP_941327.1 NUDIX hydrolase [Mycobacterium sp. KMS]MTITYDEALRERIRAHLAGHDRRAVTDPTKRHAAVAVVLVDSELGEDRVD
PAPVDDWIAGRPMPDAGLDGRMVDVSGGAAFLLCRRASRLSSHAAQWALP
GGRLDPGETPVEAALRELDEEVGVALPDTSVLGLLDDYPTRSGYVITPVV
VWGGGRLDLRPAPDEVVAAYRVGLHQLQRDDSPRFVTIPESPRPVVQIPL
GNDLIHAPTGAVLLQLRWLALEGRPDRVDDLEQPVFAWK
119871373YP_941325.1 hypothetical protein Mkms_5349 [Mycobacterium sp. KMS]MIRFVHLLTLLGVVAVPAAGWFAAQWSGGTTLAVYWVENVAVCAFIALRI
LVHQKRSPRRGHFRYEAPNTDRRAARSSFLTGFAVTGFAFCAAHGVFLGV
ILLLLDRNGESGFAAIDWRSVAYGCLGVVVLLAVDFVVDLPGLHRMPFRH
LERTADQGVGRVLVVHLTLIFGMVGVALTGAPSAFFGVFVFLKTMFAIST
ALPQWEPEVAPRWFSRLMNRVPNVHPGQTFEQFWADDRAAERARREKNEQ
PWTAARRRG
119871371YP_941323.1 thiocyanate hydrolase [Mycobacterium sp. KMS]MVDEITDFEVLEIALRELCIEKGIFTAEEHRHFTEFAEQIGPTPAARLVA
RAWLDPDFKDLALREPMTASKEVGVDWMEPTGFGTPSDFTAFEILADTPG
LHHVIVCALCSCYPRPILGNSPEWYRTPNYRRRLVRWPRQVLAEFGLYLP
DDVEVRVQDSNQKHRFMVMPMRPEGTDGWTEDQLAEIVTRDCLIGVALPK
PGVTTNVIVDTRPAVHPITD
119871369YP_941321.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MSDGETLSSSTGPTRAPTSTRRAVLNTIRGSAGNLVEWYDVYVYTVFATY
FEAQFFDQDDENSTLYIYAIFAVTFVMRPVGSWFFGRFADRRGRKAALMV
SITVMSSCSFVVAVMPTREVIGYWAAVILIAARLLQGFATGGEYGTSATY
MSEAATPRRRGFLSSFQYVTLVGGHVLAQFTLLIALSVLDVEAVTAWGWR
IGFFIGGIAALVVLWMRRSMDESLSDSHLEAIREGNDREAGSVKALFTTH
WRALLLCFLITAGGTVAFYTYTINAPAIVKSTFGSDRALTGTWINLLGLI
FLMLLQPLGGLLSDKVGRKPLLISFAVGGILYTYVLLTYLPQTTSPLTAF
ALTAVGYIILTGYTSVNAIVKAELFPADVRALGVGLGYALANSAFGGTAP
LLYQGAKSSDQIGWFIVYVTVVIGVSLSVYVFGLKNKGITALDREQGSAW
RVPEPAAR
119871367YP_941319.1 NmrA family protein [Mycobacterium sp. KMS]MTPTNPILVIGATGRHGNTGEHLVTRLREEGRAVRVLARTFGERTDRLAD
LGAEIVRGDLQDRGSLVAALADVDLAYFTYPIADGVVPAAANYASAVREV
GRNPRTVVMSMGPANPNHPSDLGKGQWLAEQVMEWAGLDLLILRIAALFH
ENLLVLHAPSIRKDAVFRNSFGASVIGWISGRDAADLSVAALLHPQRFDG
PVTYPRGSEQFTHADIAALLSEVLGTPVGFTPVCEAAWRDELLELADNDA
DGVVNPAMAQHISAVGAAISRSGAAIPADPATLRDLIGREPVSLREYLVA
NREAFEPIGVHTLVAAKAGE
119871365YP_941317.1 hypothetical protein Mkms_5341 [Mycobacterium sp. KMS]MTEPTTVVDYVARRILVALPDAYDEARARYEQLVPIVDLEACSSAGSWAA
VLAAVEVQAPNGFMRYYRGDVTSVVAGSPSRWKATQYLMGNHTIAETMFR
HDPSVMVYAPLRTLIYEDPAGRTRPDAPGWPSTSPACSSPASVTPGSPRS
ASVSTLSCRG
119871363YP_941315.1 cupin 4 family protein [Mycobacterium sp. KMS]MLSRCIATDPHTFATEYWGRRPLLSRSGALPRDFADLLSPGMVDELIAER
GVRAPFIRLAKEGDVLAKDCYLGPAGFGAEMPDQVDSAKVLTQFSAGATI
VLQGLHRLWPPVIDLVRHLVDDLGHPVQANAYITPPSNRGFDPHYDVHDV
FLLQTAGEKRWVVHEPVHPHPLPSQPWTQHRDAIAERAAGEPVIDTVLAP
GDALYLPRGWVHSAHALDTTSIHLTIGVSAVTGVDVARAVVDALADSAAF
RAPLPMGGDPADRDEIIAAVTKVMAQMVETMRDDATALSGAAADRLTRTH
ASRTRPVAVRPLATLDAAAHADTTTVQWRHGLVATADTAGDRIELRLTDR
VLSFPASCAPAVLALQRGLAADAGSLPGLDRADGTVLIRRLLREAVVTPV
PATA
119871361YP_941313.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MHLRRVNHVVLSVSDLDRSLTFYRDLLGLLPVAELPGSEHWPAMVFLRSP
APSSNHHDLALIANAEAPAPTSAPRPAGMFHVALEVGTLDELAAVQQTLD
SAGVLRGAVDQGMHLSVYTADPDGIEVEIIWRAPDDAWSYDDALTRRPLD
VASARERWGGHLATGSAAGAPA
119871359YP_941311.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. KMS]MLIGVTGGTGYVGAHCVRALLADGHRVRLLVGPDAEGAPVLEHLAELGDV
DVFSGDIRDAMTIDLLLDGCDAVLHGAGVVGTDNRRAALMWEVNAYATEA
LLTQAVRAGLDPVISVSSYSSLFPPPDGIIGPDTPPANGRSAYAKTKGYA
DRVARRLQAEGAPVVVTYPSSVVGPAFHTAPGVTERGWAPIVRFGVAPRL
RGGMQMIDVRDVAAVHAAAMKPGRGPRRYVCGGELITFDGMIDALERGSG
RRFRRIPVSQAVFRGMSRIGDTLAGIVPLGDGLSYEAALLLTAATPTDDS
ATLADFGLTWRSPTDAIIASFA
119871357YP_941309.1 Bcr/CflA subfamily drug resistance transporter [Mycobacterium sp. KMS]MSQKIAAVASPPSAVLIAVLALLNAVTPFSIDMYLSAFPEMASEFGVSPS
TIQLSLTTFLIGLAVGQLIIGTLSDRYGRRRPLIIGTVACVAVSVACAVA
PSIALLIGLRFAQGFCGAAGVVISRAVIADRSRGSRAARLFAVMMLIGVL
APITAPILGGVIVTGFGWRAVFLALAVLNLATLLGVVLTVRESLSEEHRR
PGGLKALGVSARTVLGNRHYLGYTLVMAFAAAAMFGYISASPFVVQNILG
FSPAAYSVTFGSCALAVGAGSLISARLVRTVAPRRVLMGGVTALLVVATL
MLLNVTAGHVIGWATIALMACFMGSIGFVYANATALALGEVPRAAGTGSA
VLGFLQYGMGAITPPLVGLAGQSSAVPMGLVMFGAATLAALSMFVLTRGH
VPFGDEDDDAGDAPVTVSAGGTTSR
119871355YP_941307.1 5-oxoprolinase [Mycobacterium sp. KMS]MNTLTDTPVDVDVITYEVVRNRLTAIVAQQSAVLKNVSGSPLVTEANDCN
TGVYLAGGEVVAMGPHNLFHSGSMETVVNHIIADCTDTVGIEEGDVFITN
DPYKGVLHMPDVTMIEPVFHEGVRIGWVGTCAHVLDIGGMTPSSWSPAAR
EVYQEGLILPPTKIISGGRTRHDVWNLILAASRLPANLGLDLKAMIAANN
HARQGMLRLVDRYGADVVTTVMTTMLDRSEAQVRERLLAVPDGTTRARTY
FDHDGHKSTLARVEVELRKDGDRLVFDYGRTAEQLPGFFNCTMSGLRGGV
FSAILPVLAHDIPWNSGVMRAIEVTAPEGTIVNARHPAPCGASTTGATTI
VESTAGSALSTLVSAHDELRGEARAVTTGGLMVFHIAGRNQYGEPYGGAM
TEVLAGGAGANVNRNGVDYRGPNEILTGQFNNVEGEEAVFPLLYLNRSAN
TDGGGAGRHHGGVSVSSSFVLHDTDALHGVMAGHSMSMPNSLGLHGGLPG
STHQVTIVRGGEPVVYTGSPGEIHLAAGDVVDWSFHGGGGWGDPLDADPD
EVLADVTAGRISTESASRLYGVVLTAGAVDREETTARRNRERARRRLWAR
HRVFGARQLDMVGDARRIGDRLVLTHDGVSAVYACDCGNVIAPADENWKD
YAAHSRLSEHDLGPKVRLHPGLRADAYACAGCGTLLAVEIRAHEDEPLRD
LELAGQSG
119871353YP_941305.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMTDPSRETRVLDAVVTLVDSLLDDFDVVDLLTELTERCADLLDVAAAGFL
LVDPMDRLRLLAATTDQAEALELFQLQSDEGPCVDCYRTGLPVSVADLTG
AGQRWPRFVPAAREAGFASVHAVPMRAAGIVLGALGLFGSRPGALNEADL
LVSQTLAHVACVAILQEHPPTPATVLPQLRSALTSRIVVEQAKGFLREIF
DVPVEEAFTLLRTYARSRGEHLTDVARALMGDRLVRPVMIAALTEMVER
119871351YP_941303.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. KMS]MSTFTETMYSNARSSTKGMVTGEPGDPVRHTWLEVHERALRIAGGLAAAG
VGHGDAIAVLAGAPVEIAPTAQGIWMRGASLTMLHQPTPRTDLQRWADET
TAVIDMIDAKAVIVSEPFMPAAPLLSGLGMLVLTVAELLAHEPGEMVPTG
DDDIALMQLTSGSTGSPKAVQISHANVVANAEAMIVGCEFDIETDVIVSW
LPCFHDMGMTGYLTVPMYFGAELVKVTPMDFLHDTLLWAKLIHKYRGTMT
AAPNFAYTLFAKRLRRLATPGEFDLSSLRWALSGAEQVDPLDVEDLCEAG
VPFGLKPEAIIPAYGMAETTVAVSFSECGRGMVVDEVDADLLSVLHRAVP
ANKGHTRRLVSLGRPLPGLEVRVLDEDGAVLPARGVGVIEVRGRPVSRGY
TTTAGFVPAQDELGWYDTGDLGYLTEAGEVVVCGRLKDVIIMAGRNIYPT
DIERAAARVDGVRPGCAVAIRLDGGHPRETFAVAVESKHFEDVKQVRRIQ
RQVAHEVVAEVDVRPRNVVVLEPGMIPKTPSGKLRRAHALSLID
119871349YP_941301.1 D-amino-acid dehydrogenase [Mycobacterium sp. KMS]MFGGDGVDGGPRSVIVVGAGIVGLSTAWFLQERGVEVTVVDRGGVAAGAS
WGNAGWVSPALTIPLNQPSVLGYGLRSLANPAAPLHVPARADIGLWSFLT
RFAANCRRSSWDRAVAANLPFNAECLEAFDVLTGNGVDVPTTDCPITAVF
TSERQAAHLLDELRALQQAGQDVSYRRLTLDELEDQVPLASRAVTVGVSV
EDQRFVDPGRFTHALARAVVARGATIGEVDVVDLLPHRRGVRVYPRTGAP
LTADAAVIATGAWISALADRWVRTPVRAGRGYSFTVPVDRPVPGPIYLPE
VRVACTPYRGALRVAGTMEFRGPDEPAIPARVEAIVGSTAPLFDGVRWGE
RTDEWVGPRPVTPDGRPLIGNVDRNVYVAGGHGMWGLAHGPVTGRLLAEQ
ITTGKQPEALRAVDPLR
119871347YP_941299.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MADGKSQGRPRDRSIDERVLAVTRDLLVESGWDDLSMRQIAVRSGVSRSS
INRRWPSKSELVFHAILGERPDLAPFAGTDRRGWIDWVVRGSRQLFARPE
VRAAVPGLLLAMAENEAMRRRLWAEFSGPAVELFGSGAGEERDARAVLVM
AAGAALFLSTVAVEDDTDAIHHRIASLLTEAVTG
119871345YP_941297.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MGLATARIVGGDHTVVLCDVRTERLDAAVATLHDLGITPTAVHCDVTERD
AVEALFDTAASLGPIVSVIHTAGVSPSMGDAEYVMRTNAIGTVNVNEVFS
SRAGEGAAIVNLASMAAHLLPEEIVPTGQFPRALDDQDAFMADMLAACAV
VPEEAQSGYAYALSKNFVKWYSSAQAERFNARGLRIVSVSPGSIDTEMGR
LEEQAGAGAMVADAAVPRWGKPEEMAELLAFCAGDRAGYLTGTDILNDGG
VVASMRERARVAADNA
119871343YP_941295.1 hypothetical protein Mkms_5317 [Mycobacterium sp. KMS]MNKLGFATIIAGGLATGFLALATPAQAAPAGPGNAQNTIEKLDDRGYAVR
VNHQGMVKPLDQSSIVSVRYDNDDRVVYVTVR
119871341YP_941293.1 hypothetical protein Mkms_5315 [Mycobacterium sp. KMS]MTSRRRHIARLAVFAALVFGLFYLVAVERVIEVDAVRDAVAATGPVAPLT
YVVVSATLGALFVPGPLLAGGSGLLFGPVLGTFVTLGATVGTAVVASLVG
RRAGRDSARALLGPERAELLDTQIERRGLWAVVGQRFIPGISDALASYAF
GAFGVPLWQMAVGAFIGSVPRAFVYTALGASIGDLSSPLAYTAIGIWVVT
AVVGAFAAHRGYRSWRRRRP
119871339YP_941291.1 hypothetical protein Mkms_5313 [Mycobacterium sp. KMS]MWLGVGARLRRPGVVEWRAMSILRPTPRSLVRWSVAAAAGTALLSFGAHP
AAAAPTSDAQGFIDSTARCASPSTAVAYGRTESSRIAVCKSPDGKYQYRG
VRVRDGAKLITAATATGDGEYVASNNVATYTVTSEALTISIGDEVVREET
MVEFHGPAAATAPASPGAGPAPATPTPTTPLPPPLPAEAGHRGT
119871337YP_941289.1 cutinase [Mycobacterium sp. KMS]MNVVATWNAVRRILGVTGAGMALTWAVVAGGPAPVASAQPCPDVEVIFAR
GTAEPPGVGGTGQAFVDSLRSQLGWRTLGVYAVNYPASGAFTSPDFPRTV
VDGIRDATNRVQVMSVICPNTRLVLGGFSQGAMVSGLVTGDAVPQGATPA
PMPPALAPDVADNVAAVVLLGKPSGPFLQKYAMPPVVTGPLYAARTIELC
AAGDPVCGPGGSTTAHASYPVNGMVNQGAGFAATHL
119871335YP_941287.1 formate dehydrogenase subunit beta [Mycobacterium sp. KMS]MRENSFYGPLEDPAGDAGYSEHPQRVGFFTDTSVCIGCKACEVACKEWNE
VPVSGEGDGFNLLGMSFDNTGELGANSWRHVAFIEQPVPQRETVDLGMPD
IGGAGIDMVGERPDFRWLMSSDVCKHCTHAGCLDVCPTGALFRTEFSTVV
VQQDICNGCGYCVSGCPYGVIERREGDGRAWKCTLCYDRLHDGLEPACAK
ACPTDSIQFGPLDELRERAALRVEQLHERGVSEARLYGHDPNDGVGGDGA
FFLLLDEPEVYGLPPDPVVPTRDAAAMWRYAGMAASALVGIAVSAFTRRS
119871333YP_941285.1 molybdopterin oxidoreductase Fe4S4 region [Mycobacterium sp. KMS]MDFRKRIESWPVYRQLTGDDALGRGKAAQSKRSLTLTPRTADADHVAHSV
CPFCAVGCAQKVYVKDEKVVQIEGNPDSPISRGRLCPKGSASKQLVTGPQ
RLTKVRYRPPYATEWQDLDLDTAMDMVADRLLDAREKGWQQFDADRNTLR
RTMGIASLGGATLDNEENYLIKKLFTALGALQIENQARI
119871331YP_941283.1 PadR family transcriptional regulator [Mycobacterium sp. KMS]MHIDKDLVAATATPLVLGILAEGESYGYAIIKRVHDLSGGRMQWTDGMLY
PLLHRLERLGYVSASWGVSDTGRRRKHYAITDAGREMLAQRQTQWTVVVD
ALNQVWRDARPPLAEGWS
119871329YP_941281.1 selenocysteine synthase [Mycobacterium sp. KMS]MTDPRRRVPRTDALLADPRLAEAARVLGRTLVKTVIADAQQRARAGDITP
EHVADHAVAALPSAAASLRPVINATGVVVHTNLGRAPLSRAAVDAVVTAG
GATDVEFDLATGLRARRGRGALAALARAVPTAGGVHVVNNNAAALLLAAM
TLASGREIVISRGELIEIGDGFRIPELLESTGARIREVGTTNRTHLRDYA
DAIGPDTGFVLKVHPSNYHVTGFTKAVSITELARLDAPLVVDIGSGLLTP
HPVLPDEPDATTALRAGADLVTASGDKLLGGPQAGLLFGTADLIERLRRH
PAARALRVDKLTLAALEATLVGPPTPVERALTADLADLRERAQRLATQLP
DAQAVDCVAAVGGGGAPEVTLPSAGVSLPESFAAALRAGTPPVVGRVESG
RCVLDLRTVDPEEDARLLEAISRCT
119871327YP_941279.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MTSPEGPVGTLASISIDCPDPDRLVPFYRGLLGLEEVFATHDRGVVALSG
AGPMVTLMRADTFVAPNWPDGPQRQQMHFDVAVDDLDAAVAAAVALGATE
AEFQPAAKAWRVLLDPVGHPFCVSTVRPD
119871325YP_941277.1 acyl-CoA dehydrogenase type 2 [Mycobacterium sp. KMS]MKTRHGAVVGLARDMRDLVRSRADDSERLRTLSPHIVDEMWASGLMSAFN
PIPAGGAEPSFTEMIETWIEMAWQDGSFGWIGIANFPSSFAAACYLPDEG
FAEVFTAHDHRVTMGGQFFPNGQGAAVSGGYRLSGSWSFGSGTGHSQYVA
AGFLPMDAGEIRWAGDGVPDMQVAVLPRDEVTFTDGWHVQGLKGTGSYDY
RVDDVFVPAERTFPLFARRPLRGDSPAARMGLMPVTAAGHAAWALGVAKS
MLDDVSDLAATKFRMSDMASLASRPTFQKGLAHHTAAWRAARLLVLDAFT
TAESAVAAGADLTPALRADMRVAAVYATDTARACAEWAHLVAGTDAIREG
SRLERAFRDIYTGTQHAFISEKVAIDAAQIWLGIIEDQPGL
119871323YP_941275.1 hypothetical protein Mkms_5297 [Mycobacterium sp. KMS]MHNGLTPRVGPLCLPTLSIHGYEVISGTAIPAVAGVLTEFFLHPAA
119871321YP_941273.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MDRVSTNDGTRVAPGLAIAATEPPRRGRPRNAELRAAVLRAATDLALAGG
TGAVSIDAIAKRAAVSRTTIYKWWPSAAAIVLEGLLASMQGSIVPPTGSG
TRGALDHQVRALNAILADATTGPLFRRVIAAAGTNGEVATALLDQWLLPR
RSAVTAVLLDGIATGELRGDLDVDVTVDALFSPAYYRLVFGLPPLDETAL
TDLLEMVWRGARPELP
119871319YP_941271.1 hypothetical protein Mkms_5293 [Mycobacterium sp. KMS]MTHPMRRLLVAALSVAAFTAMPVAVTTLVSPAVSSACLPGETGVTNGCAP
FCLPGRALDTNTGLCLPVPPPPPPPPGAPMSVTG
119871317YP_941269.1 hypothetical protein Mkms_5291 [Mycobacterium sp. KMS]MVTHNRKITPVLAAGASALAIAAAPALFFVAAPSGGSTITYTAGGPPGCV
DPYGTGCGAVPPPPPPAPGVYVPPPPGVAGAIPGGPGGVAGPQGAAGAIP
GGPGGVAGPQGAAGAIPGGPGGAAGPQGATGAIPGGSSGTAGPGGATGCI
PGVGCATTP
119871315YP_941267.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMSPPQQRHQRVVVVGAGPCGLAIARQLLHEQRIEPLVLDRATAPASTWRD
RYEGFRLNTCGYWSHLPGQPIPRRYGRWPKRDDMVDYFDSYVRRQRIPLS
LGVTVTRIDRDGDRWLITTDGDTYTADAVVIATGNYHTPALPAWPGMEGY
TGDLLHSADYRNPWPFAGRDVLVVGSGNSATDIALQLSDEVAGRVRLAVR
EPPHLMPRSAAGIPVDAFSAAFSRLPVPVIDHAAALASRLWFGDLTSVGL
PAPRRGIYRALLDDGSIPTLGDELVPQIKAGRIEVVAAVESFEGDSVVLA
DGRTIRPDVVIGATGYRHGLEPLVGHLDVLDEDGAPLVNGLPPAAPGLWF
AGYEEPIIGPLQSFRLQAGPLAAEVAGFAAG
119871313YP_941265.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MSAVTTSSPRSPLSRLTRKPERASDLELLHEVFDTAAVATLSTVLGDEPW
AVPMLVARDGDRLLLHGSTGAGALRHIAEGAKVCVSAFLLDGLVIAERQF
DHSANYRSAVVRGVCRVVPDAEAPALLDRFTETLIPGRAAECPPHSAKEI
AATLLLEVPIVDGSWVAKARTGPASPGAAWTGVVPVRSAYGEPVSDSVQP
VPPSVRRLING
119871311YP_941263.1 hypothetical protein Mkms_5285 [Mycobacterium sp. KMS]MPLNTVALELVPPNVDRGREHALEDAHKVLRCSAEAGIEGRIGHVMIPGM
IEEDSGRPIEMKPKMDVLDFWQIIKPELPGVRGLCTQVTAFLDEPALRQR
LTELSTAGFDGIAFVGVPRTMNDGEGSGVAPTDALSIYEGLVDNRGAILI
PTRDGEQGRFTFKCKQGATYGMTQLLYSDAIVGFLTEFAANNEFRPEILL
SFGFVPKVESRVGLINWLIQDPGNAAVAAEQEFVKSLAASEPADKRRMLL
DLYKRVIDGVGELGFPLSIHLEATYGVSTPAFETFAEMLEYWSPTAV
119871309YP_941261.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMLCSFSTPRSWFRWPDSPSTTLVSNLRTRRRLFDHPASRESVGAMTHEWE
CVVVGGGAAGLSATLVLGRARRRTLLVDAGEQSNRVSTGIGGLLGYDQRP
PAELYETGRRELEAYPTVEYRVGTVVHGAAQDDGFVLSLDDGDRVTTRRV
LLATGMEYCPPELPGLEPLWGKSVFQCPFCHGWEMRDKRIASLAAGEEAV
HSALMLRGWSDDVVLLTDGHPQLDGRDIDQLKAADIIVDDRRIAELIGTD
GQLTAIAFNDGSRLERDGLLVEAPLRQRSKLAEQLGATCTPGPLAQDTIG
IDALHRTSAHTVFAAGDVCTEHPYVAGSIAGGAQAAMIVAQSLLAEQFGM
PYPPE
119871307YP_941259.1 hypothetical protein Mkms_5280 [Mycobacterium sp. KMS]MSSDTPEGAAAALRTTDAVRDRAGRLLQRARAGESAWFTVRDDALDSAAD
VVAEVTRSRYPDLAIPFHSRWRHFEAGNVNRAAGLEGNPRAMIDLAVVSV
LLDAGAGPGWSFEEKATGQRFSRSEGLAVASWHAFADGLFSSDPGDPVRV
DADALRALTADRLGAAFQACADNPLVGLDGRVELLHRLGDALTAEAFGGR
PGGLFDTLTARARTVHAHDILTVLLTELSSIWLSGNDIGDQPLGDCWRHA
AVGGEGLTRGWVPFHKLSQWLTYSLLEPFTRAGVPVEGVDTLTGLPEYRN
GGLLLDAGVLALRTPEHAERTWKVGDELVVEWRALTVALLDELAPRVCAR
LGVDMPLACVLEGGTWAAGRLLAQQLRGGLPPLTIDSDGTVF
119871305YP_941257.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMAEAFVFTEEQRQLRDAVRGFCSDHFDEQTVRRIMESDPAHDPALWARLG
SELGVLGLSVSEADGGAGGDLVDQAVAVEEFGASLVCGPLFGTVYLAIPA
LVAASAGPARDRLLADLVEGTRTAAFAVADRAGAFVPDAVGVTVEGDALT
GTLAQVVDGAVADVLLVAAKGSDGVGLYAVDTGAEGLERTPLVTLDLTRT
QASFTLSGAPATLIAGPDEAARVIQHALHVGSALLAVEQVGAAQHLLDIA
VEYAKSRLQFGRPIGSFQAVKHRLADMLVDAEHARSTAYHAVWALTNGSD
DAALATAIAQAVCSAALSRIAADTIQVLGGIGFTWEHQAHLYFKRATTDA
TLLGTAEEHRARVADLVLDTATPERLPRVAAGVPG
119871303YP_941255.1 hypothetical protein Mkms_5276 [Mycobacterium sp. KMS]MAAAWLVWGPGTGRLWLDTLIADVLATLVVFAFSRAYRNSSFYDAYWSVV
PPLLLAYWWTQTPDADTVRVALVAVAVGYWAVRLTGNWLYAFPGLHHEDW
RYPMFRERAGRWEFVVDLVAIHLIPTLQVFLGMVPVYIAVTTPGEGWMWL
TAVAFVIAVAAVTLELVADVQMHRFVADRRPGEVMDRGLWAWSRHPNYFG
ECAFWVALALFGVAASPADAWWLFAGALAMLAMFLGASIPMMETRSLARR
PGYQDVVDRVSRFVPRPPRKARV
119871301YP_941253.1 anti-sigma-factor antagonist [Mycobacterium sp. KMS]MRGDAVVVRVKGDVDSLSVDALNSHLAKARGNAVCHPSRLVVIDLSEVTY
FGSAALNAVLSCHEEGAAEGTSVAIVADQPYVMQPIQITGLHRVLETHPT
IEQALQRDGQSPDGEGRTPR
119871299YP_941251.1 beta-lactamase [Mycobacterium sp. KMS]MAYPCPVTSTEQQEGRIRVPADLDAVTTIGDEDHAGVDTAAVERVWQAAR
HWYSAGMHPAIQVCVRRHGRVVLNRAIGHGWGNGPDDPDDAEKIPVTPDT
PFCVYSAAKAITTTVVHMLAERGYFSLDDRVCEYLPNYTSHGKDRTTIRH
VMTHSAGVPFPTGQRPNLKRMNDSEYAREMLGDLRPLYRPGLVHIYHALT
WGPLVREIVSAATGRGIREILAEEILEPLGFRWTNFGVAESDVPLVAPSH
ATGRPLPPPIAAAFRTAVGGTLHQIIPFTNTPLFLTGVVPSSSTVSTAQE
LSRFAELLRRGGELDGVRVLAPETLYQATRECRRLRPDLATGLMPLRWGT
GYMLGSKRFGPFGRNAPAAFGHTGLVDIAVWADPARGLAVGVVSSGKPGR
HREANRYPALLDRINAEMAPRSNGIIG
119871297YP_941249.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MSPETSSEATEQVQDEPATGGKLKRKITGPLLFLFILGDVLGAGIYALMG
VLAQDVGGVLWAPLLVALLLALLTAGSYAELVTKYPRAGGAAVFAERAFK
RPVVSFLVGFSMLAAGVTSAAGLALAFAGDYLSTFIDVPAIPAAMVFLGL
VAALNARGINESVKSNVVMTVIELSGLLIVIVAVAMMVGGGRGEVGRVVE
FPDGATPALAILAGAIVAYYSFVGFETSANVAEEIRNPSKVYPTALFGAL
ITAGVVYALVGVASAVALPADQLSESSGPLLDVVSAAGVGVPDWLFSAIA
LVAVANGALLTMIMSSRLTYGMAEHGLLPSVLSRVLPQRRTPWVAIVATT
VVAMCLTLVGELSTLAETVVLLLLFVFISTNVAVLVLRRDHVGHDHFRVW
TAVPVLGVASCVLLMTQQTAKVWAFAAIMLAVGAVLYGLARIATKRQRTA
V
119871295YP_941247.1 hypothetical protein Mkms_5268 [Mycobacterium sp. KMS]MKFSGNAARRGIAGVFAGCVFGGVAAATIAAPTASAAVDCSASGVANTVS
TVTGSARQYLAEHPGANQVVTAAMSQPRPQAEADIRGYFTANPQEYYELR
GILAPIGDTQRQCNVTVLSPQLASAYDQFMAG
119871293YP_941245.1 zinc/iron permease [Mycobacterium sp. KMS]MLTAAYFGVAASSALVFGALAGVRWSPPKRVTGVLLAFASGALISALTFE
LFEEAFAMAGGWHAGLGLLAGAAAFVTADTLLDRYVSGRSGPDAREVAAS
GARRGVGLALLAAVTLDGVPENLALGVSLVGGASLSLLAAIFFSNLPESL
VGAVAMRNSGMSGRTVVLTWLACAALLAVAVVLGRATAGALSEEVLALAL
AFAGGAVLASLADTLMPEAFEHGRPLNAFATAGGFFLSFMLAA
119871291YP_941243.1 hypothetical protein Mkms_5264 [Mycobacterium sp. KMS]MLSVAKKAWIPIVVVVVVLIAGFTVHRIRGFFGADGITVTPRVFADDPEP
FDPKVVRYEITGSGSYANINYLDLDSKPQRLDNTALPWEITLETTEASAA
PNIFAQGDGDSITCRIIVDDEVKDERTATGVNALTYCFVKSA
119871289YP_941241.1 GDSL family lipase [Mycobacterium sp. KMS]MAMKRVLCFGDSLTWGWVPVEDGVPTERYPRDVRWTGVLADELGADYTVI
EEGLSARTTSADDPSDPRLNGAAYLPACLASHLPLDLVVIMLGTNDTKAY
FHREPLDIAMGMGILVTQVLTAAGGVGTVYPAPRTLVVAPPPLAQIPHPW
FDLIFAGGHEKTAALSSAYSALASHMKVDFFDAGSVISTDGVDGIHFTER
NNRDLGAALAAQVRTLLS
119871287YP_941239.1 hypothetical protein Mkms_5260 [Mycobacterium sp. KMS]MTVSMVDNGPGQVSRSVEVDAPVAEVFAVVADPRRHHEFDGSGTVGANID
APANLVAGARFSTKMRMFGVPYRITSTVTALNPDRLVEWRHPFGHHWRFE
FEEISPTRTRVTETFDFRDTGVLKDRIGYYERTGFAKRNATGIEATLRRL
RDRFSGGRVS
119871285YP_941237.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MPTLTLPTATINYRVAGPENSQFPPVVFVHGALVDHRLWDPVADILSAKG
FRCVLPDWPLGSHRIPVDSELSPTSVAAMVHDLLTTLGLDDVTLVGNDTG
GAICQLVVDAYPDLIGRLVLTNCDAFDKFPPFPFNVVFAMLRGQVSIKVL
TELMRVRVLRQSPLGFGLLSRPHPELTASWLEPCRTDAGVRANLATLLRH
IAATDLTVVADRLPQFTKPVRLVWGMRDRCFTPALGRRLTGQFPDATMVE
VPDASTFVALDAPHAVADAVEALSRSATGAQ
119871283YP_941235.1 hypothetical protein Mkms_5256 [Mycobacterium sp. KMS]MVAPPAMAQPSPGVPCLEMVQQFAASPPDFEESFATAATALAEQAAPPAE
SVVEAAPVAEMAAPMAAPAAEAAVAPVVDAPAAVVVESAGAPAPVPAAPA
VPLAAAPPVAVPPLPPVPAVPASAPAPVPAAAPLPPPVAAPVAPPPVEAA
PVVQQAEPVPPPPVEAPPPPPPPVEAPPPPPPPVEAPPPPAVEAPLPPPP
VEAAPPPPEEAAPPPPVAETVEHASAPVVPPVDAAEVVSAAASALTAPPA
PSAPAAAAPPSITLPTVPGFPVQLPSELSMPRDLVCEGTAF
119871281YP_941233.1 ATPase [Mycobacterium sp. KMS]MTAARIRPDQQSLAETQRIVRAVGEAFGAKVVGQRNLRESLLIGLLTGGH
VLIESVPGLAKTTAARVIASAIDGAFQRIQCTPDLLPSDIIGTQIYDSTT
NRFVTQLGPVHANIVLLDEINRSSAKTQSAMLEAMEERQTTIAGQVYPLP
EPFLVVATQNPVDQEGTYPLSEAQTDRFMIKDLLEYPTVDEEVEVMARID
AGVYDAEHHSSPVVGLDDVRRAQHVVRGVHMDPVLVQYSSRLVEVTRQPD
QYLPKQIARFVSYGASPRATIALCQTARARAVLAGRGHVLPEDVAAVTHR
VLRHRLILGFEAANADVTADRVVDAVLQAVRVP
119871279YP_941231.1 hypothetical protein Mkms_5252 [Mycobacterium sp. KMS]MPDELLRHVLGPTPYSPWWLWAAILLVLLVIAWYAVVFVATLPSDRLRGR
PVVGPLHARLLRRRYAGRIAEITTAHEAGRMSAPEACAAISRTLRSFLHQ
ATGVRAQYMQIDTLADSSVGAAAPVLADLGEARFTDESHADVGQLGARAQ
ELVRTWT
119871277YP_941229.1 hypothetical protein Mkms_5250 [Mycobacterium sp. KMS]MTFEPIIPFAIFAVVAVALVGARLVTLRQALAATGAHRRSALARWAAMTL
AVTLLLLATTRPALTASGDDAGERGSGADTNVFVVLDRTVDARSDIDALL
DRYPEARFAVITFAPGPTLMWPLSQDVWSLQPEVDGLTALPPGDPTRSDA
AAPGNILRYQLIQATQQYPGSQNLVVYAGAGAPGASTAQGGIDLPADSIS
GGAVLGHAADGAIDDATLRRIADDLGVPYLDRRAGGDLPPLETRPDATEA
TEPVPAAARTELYWLLCLLAAGLLLGEIWLSVRELRQSRVARRDVLS
119871275YP_941227.1 cobalamin B12-binding domain-containing protein [Mycobacterium sp. KMSMLARYEATLVADDATSARALVEELLADGIDPVTVLTDVVARTQREVGTRW
QRGEWTVAQEHAATAISVAATKAVSRHVRRTPVTRGRILVACSEREWHAL
PAMIIDCALRADGWDSTLLGAATSPMRLNQHLQDLGPEAVAVSCSVLGAL
PTTRRFIEASTAAGVPIVVGGPAFGADDVRARALGATAWAPSAQAAVLAV
NGLPAVVPPAPPLPAGPAGEQALLEVDHRMLVDTLRVRWSVSAAAGPPEA
ASPGDLTDVANDVLHQVLHAVAATLLTGDPRPVSESAWWIADLMRTRGID
VATVYELGDVLTESLSDYPLARGLIDRHFTAGIDWT
119871273YP_941225.1 anti-sigma-factor antagonist [Mycobacterium sp. KMS]MDGQNFGVEQWHGRVAVIRATGAVDMLTAPHLEIAIRAAREKRPTGLIVD
LSDAEFLSSAGMQVLVTTHEELTPGARFAVVAEGPGTSRPLKITGLTDFI
ELFSTLDAALNTFAE
119871271YP_941223.1 hypothetical protein Mkms_5244 [Mycobacterium sp. KMS]MTITPLHGHSRPHVHATHSDRLALSTRSWGRPPHKRICVAVRGEVDAANA
KDFAVAVCEAIDFRHPGRYAVEVDLRSLGFLAVDGIAALHASTRSSSGMT
SPGR
119871269YP_941221.1 hypothetical protein Mkms_5242 [Mycobacterium sp. KMS]MTDAFFELTQTKARYCYTLDTRDWAGFADLMAEDIELDVSEGTGVPVVHG
RDAAVDMIRSSLTNARSAHQVHTPLIEVDGDEARVIWAMQDRVMWENGPA
LTGYGHYHERWVRGADGWKLAALRLTRLIMEFENADHMA
119871267YP_941219.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MDVFADLFRGVRAHGSLFGSSTLSPPWALHFVDGAPLTLCTVLGSGGWIV
PSDAAPQPLRAYETVVVRGPSTFTFVDELDTGAEPIACGQFCATPELGGT
RHRLGWNDNGDKGFGTTTLIVGAYPMHGEINNRLLEALPVALRVEAGGTG
DAVLDHLAAEVALDIPGQQIVLDRLLDWMLVCTLREWFDRPNGEPPPWWA
AQRDPVVGDALRLMHTDPAEPWTVASLGRRIGVSRSTLAKRFNDLLGEPP
LTYLTRWRMTVAADLLVDESATIAQIAERVGYSDPFGFSAAFKRIRGVNP
SEFRRTATVGRPS
119871265YP_941217.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MAVKLDLLTPGIEVGLVTTNLDAMVAFYEGFLELPPQGVVEFPGGSQRRY
TLGGGVLKLVTYSPPPDQPVAPGGGRAQAGLRYFTVGVKNLRAIAAAFEA
SEYEVVEPVTEFAPVPGMGWMFVADPDGNWVELFGTLDGAETAQ
119871263YP_941215.1 hypothetical protein Mkms_5236 [Mycobacterium sp. KMS]MYDLTRVWPTAHPGYARRMSNVFADESIDVVAPGDIIAVDRGSGPQPYKV
VHKNHGDDSYLVTLEGDDGETFEQEFAAGTKVTRSLESKWESEQSPTPNT
119871261YP_941213.1 hypothetical protein Mkms_5234 [Mycobacterium sp. KMS]MLTIIRNPGGAIDPICTARTPPMFIADRTPHPRSYGMLAPMALPQQSGRV
SAAGRTLTLADTRITVDRRTARWSDDEVTATEAMDFWSFAAGAANVIMQL
SWPEVGYGVVESKVDSGNLLKHPWKRARTTFSYLAVALFGNDADRAAYRA
AVDGAHRHVKSTDASPVRYNAFDRDQQMWVAACLFVGLEDAYQMLRGEMT
AAQAEQFYRSAWPLGTTLQVTEDQWPPTRAEFDSYWIGACGRVSMDDTVR
AYLTDLIDLRMIPAPLRWSSRHLLQFLTVGFLAPIFREALGVTWSAREQR
WFERLFLFVAFVNRFLPPFVRQGGSHLLLADVRRRVRRHRRLV
119871259YP_941211.1 hypothetical protein Mkms_5232 [Mycobacterium sp. KMS]MGGMADDPLDQLYAVAPEEFTALRTRLAAEAKKRGDAAEVKRIGAARKPT
VSAAVVNRLVHHDAEVVDRLAELGEELRDAHTAMDGERIRELSGRQRKLI
EQLTRAALEVSGVGSPSAALRDDVTDTLHAAIADPDVRSRLGRLAKAEHW
SGFGDAEMVFAEPPKKTSPKKTEQKKPDRKPEKPAADSGGQERRRRRDKA
KAVLAAAEHAKAGADDTMADRQSDLATARLRVEDAKERLAKAEHALAEAD
AAYEDAKRASREAGEVVKAAKERLRDEA
119871257YP_941209.1 phosphoglycerate mutase [Mycobacterium sp. KMS]MTGIRRLLAASLLAAAVIAAPPAAAGGPAEITLTFVRHAQSEGNASGLID
TSTPGPSITELGRTQAAESAAALAGNDYDGVYASTMVRTQQTAAPMAAAL
AEPVVVLPGLREVEAGQFEGRPEASAADYFDAPAQWLSGDRAARIPGSID
GNEFDARFDASVQQIYDSGDVNAVAYSHGAAIMLWVTMNVDNSHPELLRQ
HPLPNTGRVVVTGSPTAGWTLIDWNGTPPTV
119871255YP_941207.1 hypothetical protein Mkms_5228 [Mycobacterium sp. KMS]MLSVVSIGPVCKGVSGLVGHGFAVFFALLAAIFMAIGIVVRQRATMDVPP
EKGVSTVMLMTLLRRPVWWAGTGAAVAGFVFQALALGYGSLLLVQPVLVS
ALLFALPLSARLAGRRVTRGEWLWALLLTAALTVFVALAKSSAGDYDIPV
ALTVIVVAVCLGVVLACVLIAIRATNWRRAVMLAAAVGVLFGLVAVLTKI
VMHMITEGHVRTALTTPALYLLVLLGVGATLLQQSAFHAGSLQTSVPTML
VLEPVIAVVLGAIVLNEHMQISGLEPIALAAAAAAMIAATVALGRDEGAY
EEKLEAELAERVG
119871253YP_941205.1 alkylhydroperoxidase [Mycobacterium sp. KMS]MKLTPLPEEEWDDRTRAALESVAPPERRDPASVGNALATLARHPDLTARF
LPFSTYLTEQSTLPARLRELVILRVAHHHGCAYQWVHHSAIGRAAGLTDA
DVEAARTGAPADAFDRLVLTAVDELHHGSQISAPTWEALGDRLDERARMD
LIFTAGGYGVMATALNTFGVEPEPWAGRPEFYEAD
119871251YP_941203.1 lysophospholipase-like protein [Mycobacterium sp. KMS]MNHDEYAAYLPARWRAPIEPESTWWTWRGRRVHIARAVRPESPVRMLVLH
GGGGHAGALWPLAAMAARQGVDVFVPDLPLYGRTVEPHPRDVRYADWVDL
LCDLVRAERRRDPRPLIVFGASMGGLLGYEVAARTGEVAHVVATCLLDPA
DPAARRAAARVPLVGAVGPAVLRALDPVVGRIRVPLRLVVNMAAMSGDRG
LARLCARDPRGGGVSVPLGFLISWLRFVHTRPERFDAAPVTLVHPAADTW
TPPALSLSFLERLRVPTRVVMLANCGHYPVEEPGIGQLAAALREVCDDVA
QSASNRSTSATN
119871249YP_941201.1 dihydroxyacetone kinase [Mycobacterium sp. KMS]MQRYFLDSADSFLPGALRGFVAANPEVVWHRDPGFLARRTPTPSGRVAVI
SGGGSGHEPMHSGLIGTGLLDAVCPGPVFTSPNALQIAGATRHVDSGAGV
LHIVKNYTGDVMNFCIARDIVQDEGIETDVVVVADDVASHSEDGGPGRRG
TGATIIVEKVCCAAAEAGATLAEVTALGRRVADRARSMSVALDPCTVPGS
DQPSFDLGPDEMELGIGIHSESGTERTQWRPAAEIVRMLLERIVGSLEAP
AGEQVIVVVNGLGSTHPLELNLVFGHVLEQLRAADVRVVRSLVGTMVTAL
DMRGASVTVAPVDDEMVRLWDAPTDAPAWPRLAASEPGELTDATVAEPDN
AVDSGPECAWLSVFVERVQGAVDELTALDRQVGDGDFGVNMSAALGGFDL
PLRGSDAEVLDAIARSFFVRSGGTSGAVFGTLFRELSKAFSDTDEFGEAL
AAGTRDGLESVVELGGAEVGDHTVVDALHPANEALQQGVSLAEAARAAAE
GAESTRDQIARKGRASYVGDAARGAVDPGALVISWLFEAAADRR
119871247YP_941199.1 hypothetical protein Mkms_5220 [Mycobacterium sp. KMS]MNGDTRGPGMNLKKIAATATMTGALGFAAIGLGAGAAQADPHCWWVPNTP
GPGCLPPPGHLNQAGFGPPGHWDVWGHKINPGKVNHW
119871245YP_941197.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MAEFDAVEMFAAAPAATLATVNPDGAPHLVPVVFAVHRETVYTAVDAKRK
STQRLRRLANIEADPRVCLIVDHYSDDWGQLWWVRADGVAAVHHSGDEMA
AGYAMLRQKYPQYERLALDGPVVTVEVRRWSSWQA
119871243YP_941195.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MTTSRLLAACTSALLLSGLVACAPPEKESGGGETDSGVQVGEATSAADFG
GMDKLVEAAKAEGELNVIALPPDWANYGTIIDTFSKKYGIKVNSAQPDAA
SQDEINAANQQRGKSTAPDVFDLGQSVALANTGMFAPYKVETFDDIPAEF
KDPDGTWVNDYGGYMSIGYDSAKVPPIANVDDLLKPEYRGKVALNGDPTQ
AGAAFSGVMMVALSQGGSADDIAPGVEFFRKLKDAGNFLPVDPTPATIES
GQTPVVIDWDYLNAAETKKLPSWKVVVPPGQAVAGYYYQAINKDAPHPAA
ARLWQEFLYSDEGQNLYLGGGARPVRAEPMQQAGTIDKAAWDALPPVSGE
PVIVSVEQNKKATDYLAGNWASAIG
119871241YP_941193.1 binding-protein-dependent transport systems inner membrane component [MKKVVRVVLWLVFALFFLFPLYAMADFSTRDLINGGRTLQAWQNLVADRA
LYQAIIISLLLAVFTVIAMLAVLVPTMIWVRLRAPWARRPVEFLCLLPLT
IPALVIVVGLKNVYLWVTYFLGESALTLTFVYVVLVLPFAYRSIDAALSA
IDLQTLSEAARSLGAGWTATILRVVVPNIWSGILSAAFISIAVVLGEYTI
ASLSGFQTLQVQIVALGKTDGPTSVAASLAVLLFGFALLLVLSLVTRGRR
RPTTLGAA
119871239YP_941191.1 orotate phosphoribosyltransferase [Mycobacterium sp. KMS]MSAQSDRPESWQAAFELIRTRGYEHREEPFRLASGQLSHDYIDGKYAVDN
GERLTIVSRAVADLAARTGIEFDAVGGLTMGADPLAHGVAMVTGAAWFSV
RKEQKQRGREQWIEGTRIEPGMRVLLVDDVISTGGSTALAFDRVVAAGAV
VTGVIPMVDRGDVAATLFAERGVPFAALVTYRDLGIEPIKAV
119871237YP_941189.1 trehalose synthase [Mycobacterium sp. KMS]MDHSSGSPAHPDHDPAEGSHIEDGVVEHPTAGDFGHARMVPEDRTWFKRA
VFYEVLVRAFHDSDADGSGDLRGLTERLDYLQWLGVDCLWLPPFYDSPLR
DGGYDIRDFYKVLPEFGTVEDFVTLLDAAHRRGIRVITDLVMNHTSDSHP
WFQESRRDPDGPYGDFYVWSDTSDRYADARIIFVDTEESNWTFDPVRRQF
YWHRFFSHQPDLNYDNPAVQEAMLDVLRFWLDLGIDGFRLDAVPYLFERE
GTNCENLPETHAFLRHCRKVIDDEYPGRVLLAEANQWPADVVAYFGDPDT
GGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPEIPDMAQWGIFLR
NHDELTLEMVTDEERDYMYSEYAKDPRMKANVGIRRRLAPLLENDRNQIE
LFTALLLSLPGSPVLYYGDEIGMGDIIWLGDRDGVRTPMQWTPDRNAGFS
KATPGRLYLPPNQDAIYGYQAVNVEAQRDSSNSLLNWTKTMLGVRRRHDA
FAIGAFRELGGSNPSVLAFVRETATDTVLCVNNLSRFPQPIELNLQQWNG
FTPVEMTGYVDFPSIGALPYLLTLPGHGFYWFQLRAPDPEPEGVQP
119871235YP_941187.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDFDFTDEQELLRDTSREVLSRTYDIETRLKVVDSELGWSREVWNQLAEI
GILGLGFEEDAGGQLEIMVVATEIGRRLAPEPVLSAALGPGALIAEVGSD
EQKQVLDEVAAGQRLLAFAHTEPGMRGAGAKLSTTAAQQGDSWTLTGRKN
PVIAGDSADTLIVSAALPDGGAGLFLADAAAVSRKPYRTFDGHRGAEIDL
DGVAATPLGAGGDAGEAISRAVVRLQSALCAEALGAMEEALRLTTDYLKN
RKQFGVTLSKFQTLTQRAADMYVSLELARSMTFYAAMSIADGNFDPAIAA
RAKLQIGRSGRHIAQEAIQLHGGIGVTAEYPVGHYAARLTAIENTLGSAQ
DQLHVLMGGLGDYEVVTV
119871233YP_941185.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MGTKPDATAATPGRTRRTCTNRRMLPVMATARDRPTSLDDWIDAGFALLA
EGGTNALRIGRLCDRLHVTKGSFYWHFSDIQAYRAALVEAWGDVRDRERR
RFATMQDVPPRQRMRVMMEALVNPSHWAVERVMRTWAIADDEVADKVRQS
DRRVLAALQQAFLDEGFPDDEAALRSTIMFSAGVGLLHAADPGQTAPPEV
REHFLAFMLRR
119871231YP_941183.1 glycogen debranching protein GlgX [Mycobacterium sp. KMS]MAAAPKPNVTPEVWPGKAYPLGATYDGFGTNFALFSEAAERVELCLFDAD
GEQTACVTLPEVDGFVWHGFIPNIEPGQRYGYRVHGPYDPPNGQRCNPNK
LLLDPYAKAIDGTFDWGQPLFSYNFGDPDSRNDDDSADCMPKSVVINPYF
DWGTDRPPNHEYADTVIYEAHVKGLTQTHPDIPEQIRGTYSAVAHPVIID
HLKALGVNAIELMPVHHFANDSTLLDKGLSNYWGYNTIGFLAPDPKYSSS
LTPGGQVQEFKAMVRTLHEAGIEVILDVVYNHTAEGNHMGPTLSFRGIDN
AAYYRLVDDDKRYYMDYTGTGNSLNAGHPHALQLIMDSLRYWVTEMHVDG
FRFDLASTLAREFYDVDRLATFFELVQQDPTVSQVKLIAEPWDVGPGGYQ
VGNFPPQWTEWNGKYRDTVRDYWRGESATLDEFASRLTGSSDLYEHTSRR
PVASINFVIAHDGFTLRDLVSYNEKHNEDNGEDNNDGESHNRSWNCGVEG
PTDDPQVNALRSRQQRNFLTTLLLSQGVPMIAHGDELGRTQHGNNNVYCQ
DNELSWIDWSTVDTELMAFTQKVSELRAAHPVFRRRRFFSGRPVRQRGAP
GLPDIAWFAPDGSEMTDEDWDSGFAKSIAVYLNGQGIPDLDVRGQRVTDD
SFLLCFNAHHEPLEFAMPAAEFARAWLPVINTADDDDARESVTAGAKIEV
AERSVLVLQAVNEP
119871229YP_941181.1 putative PAS/PAC sensor protein [Mycobacterium sp. KMS]MPPEETLERALAGGSPQNVGWFRYHFADGRWEWSDQVHLMHGYQPGTVTP
TTELVLAHKHPDDYVSVAATLDDIRRTRRTFSTRHRIIDTQKRIHDVVVI
ADRMFDDTGDIVGTQGFYVDVTPSRLDASTREMAAATAAAMVEHRASIER
AKGMLMLVYRVDAVAAFELLKWRAAEAGVKLRTFAERLLADFTALYYEDT
LPPRSVFDHLLLTVHHRVRAAGV
119871227YP_941179.1 hypothetical protein Mkms_5200 [Mycobacterium sp. KMS]MTRTARRSGSALIVTAAALLVAACGGSPDSEEASGPGPSASTISPSEMTD
QQRPTDRLTIDISIEGGNVTPTNARLQGKVGEPIVLRVNSDAADELHVHS
VPEHTFRVEPKAGQMFQFTVDVPGNVEIELHDLNRVIAGVQVQ
119871225YP_941177.1 hypothetical protein Mkms_5198 [Mycobacterium sp. KMS]MEFFSEVSGVSVLAQGEEGGGTAIHEVIGLSVAAVIVTAVLLYIGYLHRN
HKISWLTSLADWSGRRFKRPPWVALPVAMFTASIICALFGFIWDVSLHIG
NGRDDGALANPAHYFILIGLFGIFVAGCTAVVLPFDRPGPAAVRITDHWH
APVGGLVMAGCGLYALMGFPLDDVWHRIFGQDVTLWGPTHLMMIGGAGFS
TLAAAYLEYEGKRAVGPDAPRDGLGLKFVLYLAFAGVLIGASVYQIEFDF
GVPQFRQVFQPMLIAAAAALALVMARIFLGRGAALIAALIAIGLRGIVAF
LVAPVLDAPVNWFPLYLGAAVVVELVALTPLLKRPIVFGLVSGLGIATVG
LWLESLWINAVYPLTWPTSIWPEALAMSVPVAMLVGACGAMAGMVITGQR
LPKRAVGVGLVALTVVAIGGAAANGLQYKVPENATAAVTLTEAPAVNGAR
YVTADVRFNPPDVIGEDPNWVAVLGWQGGLENQRGQFVDNLEKVGSGHYV
STQPLPVSGTWKTLLRVHDGKTLAAVPIYLAGDPGIGAEEVPADPQFTRP
FVSEVTILQRERSPDIPQSLWLIGCLVVLVCTLAMVAGITWGGGRINNSE
PSGSEAELQPSAQA
119871223YP_941175.1 hypothetical protein Mkms_5196 [Mycobacterium sp. KMS]MAQQMSGIVHAAFDTLRYEPTAKRIRVTLAGEPVAETDRARLVWEPRRIV
PTYAVPLDALIAHLVPAGAESGAEEATRSTLDPTVPFTNHTCEGTEYDVV
AGEETGGAAAFRPDDADLADYVVLDFAAFHWHEESEPLVSHPRDPFHRID
VLRSTRRVRVEYEGRLLAESSRPLLLFETNLPMRCYLPPGDVTELAPSNT
VSYCAYKGRAAYYSLADGPRDIAWTYRDPLHDGEPVRDHICFFDERVDVI
VDGVRAERPMTQWSEPGV
119871221YP_941173.1 hypothetical protein Mkms_5194 [Mycobacterium sp. KMS]MNKLGFATIIAGGLATAFLGLATPAQAAPAGPGNAQNTIEKLDDRGYAVR
VNHQGMVKPLDESSIVSIRYDNDDRVVYVTVR
119871219YP_941171.1 hypothetical protein Mkms_5192 [Mycobacterium sp. KMS]MSSTRDQIMDAMDAVEALSARLATLPVTGMSRAEAQAALMRLGRLREQLQ
EVERRLTGRLVASGSPSQFGARTWADVLAQRLRISPGEAQRRIAEAVSEG
PSAA
119871217YP_941169.1 group 1 glycosyl transferase [Mycobacterium sp. KMS]MRIALLSYRSKTHCGGQGVYVRHLSRGLVELGHDVEVFSGQPYPEGLDPR
VRLTKVPSLDLYREPDPFRVPRPSEIRDRIDLQELLTTWTAGFPEPKTFT
MRVARILAGRRGDFDVVHDNQSLGTGLLKIAATGLPVVATVHHPITRDKV
LDVAAARWWRKPLVRRWYGFAEMQKQVARQIPELLTVSSSSATDIADDFG
VSPEQLHVVPLGVDTALFRPVENRVSGRIIAIASADVPLKGISHLLHAVA
RLRVERNLDVQLVSKLEPNGPTEKLIAELGISDIVHSSSGLSDEELAALL
ASAEVACIPSLYEGFSLPAVEAMASGTPIVASRAGALPEVVGADGECARL
VRPGDVDELTRALGELLDSPAQRQRLGAAGRRRALEVFSWESVAAQTVSV
YERAMATC
119871215YP_941167.1 hypothetical protein Mkms_5188 [Mycobacterium sp. KMS]MPAADLPGIPGVFTPDQCRQTAESIAAEQESSGAIPWFTGGHTDPWDHVE
SAMALTVAGLLEPARAAYEWCRITQRPDGSWPIQFRNGVIEDANSDSNFC
AYIAAGVWHHLLITRDRSFAETMWPVVAKAIDFVLGLQRPNGEISWAQSE
DGPIPEALLTGCASIHHSIRCALALADYIGEPQPEWEVAVGRLGHAIIAH
PGSFVPKDRHAMEWYYPVLCGALRGAAAHDRIHERWDDFVVPGLGIRCVD
DRPWVTGAETCELVMALDAIGDSARAHQQFAAMHHLREGDGSYWTGLVFA
DGKRWPEERTTWTGAAVILAADALTGTTPGSGIFRGADLPRGLEDEFDCA
CAVSDR
119871213YP_941165.1 integral membrane protein TerC [Mycobacterium sp. KMS]MTDPVIVPLWGWVALTAAIAVMLAVDLFLHRDNHVIGFREAAVWSAIWIA
AGLGFGAIVWWAYGGDVAGTYYAGYLIEKALSVDNVFVFALIFTYFAVPD
EYQHKVLFYGVIGALLFRLVFIFVGAELLAAFFWTAYLFGAFLIYTAYKM
AFQHDKDLEPDKNLMVRLVRRLVPIDTRYHGDRLFTRVDGKRVATLLFVV
LIAVEATDLIFAIDSVAAVLAITTSTFIVWTANAFAVLGLRSLYFCLSGL
LRRFTHLHYGLAILLAFAGVKLILSETPVGKLPIPLTLSVIVVTLTASVV
WSLVATRASDAPRQSPSPKPNT
119871211YP_941163.1 hypothetical protein Mkms_5184 [Mycobacterium sp. KMS]MSVTDTDLPPRAARLFALADKAVGFMPADEGRTLYDTAVRYLGDGIGVEI
GTYCGKSTLMLGAAAQETGGVVYTVDHHHGSEEHQPGWEYHDTTMVDPVT
GRFDTLPTMRHTLDAADLDDHVVAVVGRSPVVARGWRTPLRLLFIDGGHT
EEAAQRDFDGWARWVEPGGALIIHDVFPNPDEGGQAPFHIYQRALATGAF
REVAATGSMRVLERTSGEAGESA
119871209YP_941161.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSVVVQDDVYRGRLLDGLAASIAERGYRDTTVADIVRHAHTSKRTFYGRF
ETKEECFIELLRANNDALIARVNAAVDPDADWDEQIRQAVGAYVDHIAAR
PAITLSWIRELPALGARATPMHRWAIDRLTDMLIGLTGSAGFRRAGKAPL
SRPVAVVLLGGLRELTALFFEDGRDVRGILEPAVTASTALLGG
119871207YP_941159.1 methionine sulfoxide reductase A [Mycobacterium sp. KMS]MSDHKKAILAGGCFWGMQDLIRKQPGVVSTRVGYTGGQNDHPTYRNHPGH
AESIEITYDPAQTDYRALLEFFFQIHDPTTKNRQGNDVGTSYRSAIFYVD
DEQKRVALDTIADVDASGLWPGKVVTEVTPAGEFWEAEPEHQDYLERMPW
GYTCHFPRPDWKLPKRADAKA
119871205YP_941157.1 hypothetical protein Mkms_5178 [Mycobacterium sp. KMS]MTNTAPARFTRAELTAAFATFEETVAHAAQTRDWDPWVEQYTPDVLYVEH
AAGTMRGRDEVRTWIWKTMTSFPGSYMTAFPSLWSVADEESGRIICELDN
PMRDPGDGTIISATNISIVTYAGDGQWSRQEDVYNPLRFVKATMKWCRKA
AELGTLTDEAAAWMEQYGAHARSNDEGAHARSTESGAGDR
119871203YP_941155.1 O-methyltransferase domain-containing protein [Mycobacterium sp. KMS]MTRVDLRGAPETMLATLYAKALDADAPRSILNDGFARDIVARIDYDWSRT
GIKPQNAPSVTLRAKHFDTWTKQFLAVHRDAVVVHLGCGLDGRYLRLDPG
PGVEWFDVDYPDVAALREQFYPRREHCHVVAASVTDPEWLTSVPSDRPTL
IVAEGLTMYLTEADGVALLRRLVGRFPSGELQFDSFNRLGISLQWTNTPV
RRSGARLYWAIDGPSDVLDAVPGTRLLAWVPVFESDAFSRLSAGYRAMAA
VMNRVPGLRTMAQFHRYAF
119871201YP_941153.1 FAD dependent oxidoreductase [Mycobacterium sp. KMS]MLTVNGQVSHWFDGQPAYRAPLPGDRDADVCIVGAGYTGLWTAYYLKRAD
PSLRIAILEARFAGFGASGRNGGWLSGLVPGNRNAMAERYGREPVVAWQR
ALNETVDEVSAVAAAEGIDAGIVKGGTMEIARNAAQAKRLADELHEDRRW
GVDGIAPLTKGEAADRIRFDGVVSAYHTPHCARIQPAHLARGLADAVERL
GVPIYEQSPVTAIGRGRAVTPHGTVRAPIVLRATEGFTPTLPGLRRRWLP
MNSSMIATAPIPDERWAAIGWDGCETVGDTAHGFFYAQRTVDNRIAIGGR
SVPYRYASRIDDDGRVPPRTITRLTAVLHSLLPQIRDVPIAHGWCGVLAV
PRDWESTVTLDRASGLGWAGGYVGHGVTATNLAGRTLADLVLGRSTPLTE
LPWVGHHSRGWEPEPLRWLGVRGLYLAYRLADRHEARGRSTTSPIARVAD
LITGRP
119871199YP_941151.1 hypothetical protein Mkms_5172 [Mycobacterium sp. KMS]MSGRPVLEPTAAHPITVSPTGRHVTVTVNGTVIAETDEALTLQEADYPAV
QYIPLHDVNDSALVCSDTTSYCPYKGDAAYYHVNAAGETVEDVIWTYGQP
YPAVGAIAGHVAFYPDKADVTVG
119871197YP_941149.1 diacylglycerol O-acyltransferase [Mycobacterium sp. KMS]MKQLSGWDVLLLNSETPNVHQHTLKVAVVDTSAFEGEPSFEAFCETLRGR
MYLLEPLRYELVDVPLHLHRPMWRENADVDLGYHVRQVRVSAPGGRRELD
ALIGEIAGTALDRSRPLWELYYAEGLANGRVAVIGKVHHALADGVASANL
MARAMEWPDLVPGSGAVAGGTRGEPSAVELIRGAARDHARKLTELPDVLK
DGALGIHRLRRRSRQRRDNPDLAHQFHPPPTFLNHKLSPARSFAGATLSL
AEAKETSRRLGVTINDLVLATAAGGLRELLLAYDGRADEPIIASVPAATD
ISRDRITGNALSTMLVSLPVHVDDPLEQVRLTSLAAGIAKEDHDLLGPAT
VGRWLEYVPPTVLRTVFGWTSRRRAPNQLFNVIVSNVPGPRQRGRIAGAV
VSEIYSVGPLAAGSAMNVTVWSYVDQLSFSVLSDGETLADTHEATDAMVR
AFGRIRTAAGLSVG
119871195YP_941147.1 amine oxidase [Mycobacterium sp. KMS]MKDPRRVVHPASPGLPDATSLTTRPRAVVVGGGIAGLTAATGLAERGVEV
DVVEREPYLGGRVGGWADDVDGVGAAAMNRGFHAFFRQYYNLRDLLRRVD
PQLSMLFPVEDYPLIDGQGRRDTFRGLPQTPPFNAVAFALRSPTFRLRDL
ARLNARAAAPLATVSVPDIYDRLDHVDADQFLRDINFPEAARHLAFEVFS
RSFFAQPPDLSAAELATMFHIYFLGSSEGLVFDVANDNFDVALWNPLRRY
LEGRGVRFHTGVSVTAVEPGFTVHCDSGQPLSADGVVLATDVTGLRGIVS
GSAELGDDAWRTAVDGLGTAPPFLVHRIWLDRPVAPDRPAFLGTGGLTPL
DNVSVLERYERQAADWARRTNGSVVELHSYAVTDTSEELPRQLLARLHAI
FPETAQADIVGERLLLRGDCPRFAPGDFAVRPTVGTPVDGLALAGDGIRI
DLPVALMERAATTGWAAANRLLAHFGVAGHAVTTVPTTGRSATLRRLAER
GRQLQS
119871193YP_941145.1 hypothetical protein Mkms_5166 [Mycobacterium sp. KMS]MIGLGYTLPAIVAVVVVVAWEVLWLRTGLFRRPAYWISMVIVVGFQIPVD
GWLTKLSDPIVIYNEEHTSGIRFPWDIPVEDFLFGFALVTGVLLLWERQR
TRGVKVGERVHDE
119871191YP_941143.1 phytoene synthase [Mycobacterium sp. KMS]MIGSELDAAGVRDPALRNAYRCCRVLNAEHGRTFYLATRLLAPEQRPAVH
ALYGFARRADDILDDLDSAATTAERADRLHRLATQLFDGLVQGNATGGDP
ALAAVVHTARRYGIPWELFDDFLASMRMDLTVTDYPDRASIDRYMYGSAE
VIGLQLLPVLGTVVPREEAAPYAAALGKAFQLTNFLRDVDEDLDRGRVYL
PADELAAHGVDRDLLMWCHTTKRTDTRVRNALAEQHAVTRRVYDYARHGV
DLLHPRSRACVGAAAVLYSEILDRIEAIDFDIFNQRATVGNGRRLRVAGA
GLLRAWRARIAHPAKV
119871189YP_941141.1 polyprenyl synthetase [Mycobacterium sp. KMS]MSGVDDRLLAAALRPAPARLTADSFDTWRRDVRRAAIDAVTEFVTDRCAD
DLRLTGVDVTLDVLSDFVSDGKCLRSTFAYLGWLAGAAPDDAALRAAASF
DLLHVFALLQDDVMDDSPLRRGRPAAHVRFAQWHRDNGLNGSAERFGASA
AVLLGDLCLVWAGQMMRESGLGDRALARAWPRYDAMRTELAVGQFADLVN
DAGGRPTLEDVLDVARRKSGNYTVRRPLEIGGALAGCPDATLGLLGRYGA
AVGEAFQLRDDLLGIFGAPTVTGKPAGGDLSEHKATSVVVAAHRLAEPSV
RNQLTELMSRRDLDAGDITRWQHLIAATGAVQWIEQLIDRRLSHALERIH
TSPLDDTVRTALVNMAAVCTRRAA
119871187YP_941139.1 Ferritin- Dps family protein [Mycobacterium sp. KMS]MAYTVPGMTDKEGAQVAELLQKQLSRYNDLHLTLKHVHWNVVGPNFIGVH
EMIDPQVELVRGYADEVAERIATLGGSPKGTPGAIISDRTWDDYSLERDT
VQAHLAALDLVYDGIIEDTRKNIEETEEPDPVTNDMLIGHAAELEKFQWF
VRAHLENAGGDLKHGGKSTEKGAAKAAKS
119871185YP_941137.1 hypothetical protein Mkms_5158 [Mycobacterium sp. KMS]MTGRLKVLWTGAISAAMAMGVLAAPAVGSADATDDYPIPNRIMRTTCTVE
QYMAAARDTSPVYYERYMIDYNNRPVDIQNMARDRIYWFFSLDYTARRQY
SENTATNVYYEQVATRWGNWAKLFFNNKGVVAHATDVCMTYPPADPSVWH
WGHNAR
119871183YP_941135.1 MIP family channel protein [Mycobacterium sp. KMS]MREPTMMHRVAAEFIGTFWLVFGGCGSAVFAAKYTSADGYAFGIGFLGVS
LAFGLTVLTGVYAFGTISGGHFNPAVTLGAALARRVEWRVLPAYWLTQVI
AGVAAGLVIYVIAKGREGWTATGNMAANGYANHSPAGYSLLAVVIAEVLL
TGIFLLVILGATDTRAPKGFAGLAIGLTLTLIHLISIPISNTSVNPARST
GVAFFNGNEAPAQLWVFWIAPLLGAAIAGAAYPYLFGRHEELADRPVRDE
TLDAQVRAEDVADARLRRGPDPEVR
119871181YP_941133.1 glutamate synthase (NADH) large subunit [Mycobacterium sp. KMS]MGPVPSGLYNPAYEHDSCGVAMVADMHGRRSRDIVDKAITALLNLEHRGA
QGAEPNTGDGAGILLQVPDEFFRAVVDFDLPEPGSYATGIAFLPQSSKDA
ATACEQVQKIAEAEGLTVLGWRDVPTDDSSLGALARDAMPTFRQVFMAGA
SGMDLERRAYVVRKRAEHELGTKGPGQDGPGRETVYFPSLSGQTFVYKGM
LTTPQLRAFYLDLQDERLTSALGIVHSRFSTNTFPSWPLAHPFRRVAHNG
EINTVTGNENWMRAREALIRTDVFGTQADLDKIVPVCTPGASDTARFDEV
LELLHLGGRSLPHAVLMMIPEAWERHESMDPARRDFYRYHASLMEPWDGP
AAVCFTDGTVIGAVLDRNGLRPSRIWVTEDGLVVMASEAGVLDLDPSTVV
QKMRLQPGRMFLVDTAQGRIVSDEEIKAELAAEHPYGEWLEAGLFQLEEL
PPGDYVRMPHHRVVLRQQAFGYTYEELNLLVAPMARTGAEPIGSMGTDTP
VAVLSQRPRMLFDYFQQLFAQVTNPPLDAIREEVVTSLQGVIGPEGDLLN
PTAESCRQIVLPQPILRNAELSKLICVDPDHEIRGHKHGMRAAVIRCLYP
VNRGGQGLKEALNNVRAKVSAAIRDGARIIVLSDRESDEQMAPIPSLLSV
SAVHHHLVRERTRTQVGLVVEAGDAREVHHMAALCGFGAAAINPYMAFES
IEDMVDRGVITGISSDQAKANYVKAAGKGVLKVMSKMGISTLASYTGAQL
FQAIGIDQKVLDEYFTGLNCPVGGIDLDDIAAEVAARHALAYLDRPDERA
HRELEVGGEYQWRREGEYHLFNPDTVFKLQHSTRTGQYSVFKEYTQLVDD
QSERMASLRGLLKFKDGVRQPIPIDEVEPASEIVKRFSTGAMSYGSISAE
AHETLAIAMNRLGGRSNSGEGGEAVTRFDRDDNGDWRRSAIKQVASGRFG
VTSHYLSNCTDIQIKMAQGAKPGEGGQLPGHKVYPWVAEVRHSTPGVGLI
SPPPHHDIYSIEDLAQLIHDLKNANPQARVHVKLVSENGVGTVAAGVSKA
HADVVLISGHDGGTGATPLTSMKHAGAPWELGLAETQQTLLLNGLRDRIV
VQVDGQLKTGRDVVIAALLGAEEFGFATAPLVVSGCIMMRVCHLDTCPVG
VATQNPVLRERFNGKPEFVENFFMFIAEEVRETMAQLGFRTVNEMVGQVG
VLDTTEAAEHWKAHKLDLSPVLHEPESAFMNQDLYCSSRQDHGLDKALDQ
QLIVMCREALDAGTPVKFSTTIANVNRTVGTMLGHEVTKAYGGQGLPDGT
IDITFDGSAGNSFGAFVPQGITLRVYGDANDYVGKGLSGGRVVVRPAENA
PADYVAEDNIIAGNVILFGATSGEMFLRGQVGERFAVRNSGAVAVVEGVG
DHGCEYMTGGKVVILGPTGRNFAAGMSGGMAFVYDPAGELPDNLNAEMVE
LDALDDENVSWLHGMLQAHVNATDSAVGQRILNNWEEELKHFVKVMPRDF
KRVLAAIAEAERTGADKNEAIMAAASG
119871179YP_941131.1 hypothetical protein Mkms_5152 [Mycobacterium sp. KMS]MYINPISRSRVGRIAWSLFRHPVKSREFPAKHERLITAAELVRYGV
119871177YP_941129.1 hypothetical protein Mkms_5150 [Mycobacterium sp. KMS]MEDLSEACRRTAAVLAAVTDDALDAPTPCSEMPLRALVAHIGGLAQAFRA
AADKEFGPLTDTPPEPDTPLSPGWRTEYPRFLAELAESWRDPAAWTGMTR
AGGIDLPGEVAGSVALAEVVIHGWDVALATGQNYDCDAATAHACLQHLSQ
FDTGGTEGMFGPAVPVPDDAPAIDRIAGLSGRDPEWSPR
119871175YP_941127.1 catalase [Mycobacterium sp. KMS]MAQDRGAKETIKSVVKDAKDKVVEAAERLQQHSPSYIPGAPGPEKPTFEE
PTAPREPLPPKPDQGGPDLRTATGLSVGGGQTARGQQGEYLTTAQGARLH
DTDHSLKAGERGPTLLQDHHLREKIMHFDHERIPERAVHARGAAAHGVFR
GNGAAEKICKAGFLKSGAETDVFVRFSTVLGSRGSADTVRDTRGFATKFY
TDEGTFDLVGNNIPVFFIQDGIKFPDVVHAAKPHPDREIPQAQSAHDTFW
DFVSLHTEAQAHTMWNMSDRGIPRSYRMMEGFGVHTFRLTGPDGSTSLVK
FHWKPRLGVHSLVWEEAQIAAGMDPDLHRRDLADAIEKGAYPEWDLGVQV
MPDNPDQMFEGIDLLDPTKIVPEELAPVQVIGTMQLNRNPTNFFAETEQV
AFHPGHLVPGIDVTDDPLLQARLFSYLDTQLTRLGGPNFGQIPINRPHAP
VNDMLRDGFHQHGVHPGAAPYRPNSLDGGCPFLAGADTGAFIEAPAVVAE
STKVRAAPASYDDHFSQAALFYRSLSPVEQTHVAEAYTFELGKCYEQTIK
ERQLAVLANIDAELCATVAAGLGLEPPAPTVTPAEPAVLSPAVSQVGKTW
PVEGRNIGILTGPDSDNGVVAAVVEALGAAKLVPLVIAAHGGTLDHEGGS
IPISRTYATARSIEFDGLVLAGSPATVQAKILVDEAFRHFKALGVLPQGT
DLLASSGVNTDSEGVLSASDPAGLTSALLESLGEHRVWGRVVPA
119871173YP_941125.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTTASQARAPRGRRSARPSGDDREQAILATAEQLLEARPFAEISVDDLAK
GAGISRPTFYFYFGSKEAVLLTLWERVIREADAALENAASNATSEDVWRP
GIKVFFDTFGAHRGVTVAASGSDNAEVRDVFARFMQKWIDFTAATIEAER
RRGAAPQTLPARDIATALNLMNERTLLAAFAAETPGIPPDRVLDSLVHVW
TCAVYGECR
119871171YP_941123.1 ribonuclease activity regulator protein RraA [Mycobacterium sp. KMS]MTIEPRATADLVDDIGPDVRSCDLQLRQFGRRPEFAGRVTTVRCFQDNAL
LKSVLSEPGDGGVLVIDGDGSLHTALVGDVIAALGRDNGWSGLIINGAVR
DASTLRTLDIGIKALGTNPRKSTKTGAGERDVPVDFGGVTFTPGDVAYSD
DDGIVVVTP
119871169YP_941121.1 hypothetical protein Mkms_5142 [Mycobacterium sp. KMS]MADRPDGSDEQSDTPAEPTPPAAATPPPVKKAPAKKAPAKKAPAKKAAAK
KAPAKAVKKAPAKKNTAPPKKQPPPSPADLVTADGDLTAAAEEAAAQAKA
AVATASNPVAGPAPVPVDGPDQSRLPLAAAVATAVLVLLAVLVARRR
119871167YP_941119.1 copper resistance protein CopC [Mycobacterium sp. KMS]MQTLVRRWAVAVTTVLLVALPLMGAGVASAHAAVIATDPADGTTLTEAPP
RVSATFNEAMQPAFAAMTVVGPDGNLWSTGGPEVQDTVVSVDLRPLGPSG
TYTVNYRATSADGHVVTGSWAFELTVSGTGTPGPSAAAPVPPTAPADDPP
VWPFIVGACVAVGAAALWAARRRT
119871165YP_941117.1 hypothetical protein Mkms_5138 [Mycobacterium sp. KMS]MGSRVRVAASAAMVAAGMSLAGMGGAMAIAEPEDGGAAPVGAGTAADSPG
DVDRLPLDPERTKPAASQSNPDEGQSGTPGTGQSGSSIPERTTPSTKPTE
TSTPTETTESTTSTSPTTSTPTTSTPTTTSTVVPAPGDTGSDHDGPEGMP
PKLDEPGPIAPSVIDAAPGLPVVVPMAPIAVPVLAVPPVGLPSVLGVGAA
GGGGGSGGGAAAAPRGPAPEVPARVAPPQQPSVRQPEVPVRSGDPAAVPA
SFRAGYGEYLRTAGVMQVAAVAVPGAAGILMLTGLGGLVGYRQARAGLAL
RTESIARFMN
119871163YP_941115.1 hypothetical protein Mkms_5136 [Mycobacterium sp. KMS]MIVWGIAGLLGLATGLRIGWALVNKQSLVSTAMILALGNLAAVAALNWQP
LTLLVDTVLKWPNIAVALSQVALIMCAAGSCVMITTVASARTPSATRSIA
VAQYVLAGIVAALSLVLFFAAGKQPEMAPQEYLRRTLGASGTSADISWLL
PLIYVLLAMSLVMWSGLRHSSRSRRGRALFVFTVGIALILVVAALFLLRM
FGVVDSIGVGAGATLLGCAMVTVAVGALLPSVEDWFGARRELRIIDPLLI
ELGRRHPDVGIGVRPHGPLVFRVAERMSLISDALFLEATSARTPVDARRT
PGDQGEQEVPDDGLPAPGVTPAEQARAIAEWIYASREGSADSGRRRFPGF
EWLRQPESYSDREWILAIARQYRALDRENPGTAL
119871161YP_941113.1 hypothetical protein Mkms_5134 [Mycobacterium sp. KMS]MLGAVLVSLAVVFVAELGDKSQIITMTYALRHRWWVVLSGVGIAAVLVHG
LSVAIGHFLGLTLPEKPIAFAAAIAFLLFAAWTWREGRNAGGDDDVRVAE
PRFVVPAIVSSFVLAELGDKTMLATVALASDRDAIGVWIGATVGMVLADG
VAIVVGAILHKRLPEGFLHAMASVLFLLFGLWMLFDAALGWRVVALAATG
GVTAVVLLIAVVRTIRARRLRAASATPHESTSETV
119871159YP_941111.1 superoxide dismutase [Mycobacterium sp. KMS]MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGANDALSKLAEA
RESGDHSAIFLNEKNLAFHLGGHVNHTIWWKNLSPNGGDKPTGELAAALD
DAFGSFDNFRAQFTAAANGLQGSGWAVLGYDTLGQRLLTFQLFDQQANVP
LGIIPLLQVDMWEHAYYLQYKNVKADYVKAFWNVVNWEDVQNRFAKATSS
ASGIIVG
119871157YP_941109.1 rhodanese domain-containing protein [Mycobacterium sp. KMS]MGRMDDVEVTQAEVAELPTAFDGSALLLDVREDDEWQQGHAVGALHIPMG
DVPSRLAEVDPEATVYVMCHAGGRSQRVAQYLVRNGYRAINVSGGILAWS
AAGRPIVTDGGGAGNA
119871155YP_941107.1 glycerophosphodiester phosphodiesterase [Mycobacterium sp. KMS]MNPDDGALGGHPFVVAHRGASADRPEHTLAAYELALKEGADGVECDVRLT
RDGHLVCVHDRRVDRTSSGTGVVSEMTLAELRELDFGSWHASSRPDAGPD
TTDLLTLERLVELVLDWHRPVKLFIETKHPVRYGALVESKVLALLHRFGI
ATPASADLSRAVVMSFSAAAVWRIRRAAPMLPTVLLGDTSRYLGGGAATT
VGATAVGPSIMTLREHPELVDRAAAQGRAMYCWTVDHYEDVRYCRDLGVA
WVATNHPRRTKDWLQNGLTGAAGTDR
119871153YP_941105.1 cell envelope-related transcriptional attenuator [Mycobacterium sp. KMMAVLLVMVVSLVGLTVWVDTSLQRIPALAAYPDRPAAGRGTTWLLVGSDS
RAGLDAEQQAQLATGGDVGNGRTDTIMLVHLPGLTSSAPATMVSIPRDSY
VPIPGYGEDKINAAFALGGAPLLAQTVEQATGMRLDHYAEVGFDGFASVV
DAVGGVTMCPAEPINDPLAGIDLPAGCQELDGRNALGFVRTRATPRADLD
RMTHQREFMSALLHRAASPAVLLNPLRWYPMASAAGGALTVDTGAHVWDL
ARLGWALRGDLTTTTVPIGEFTDGGAGAVVVWDSEAAGRLFDALSTDTPI
PADVLDTTPGG
119871151YP_941103.1 abortive infection protein [Mycobacterium sp. KMS]MSRPSDELPDLLDHGQRRAIRIEIAIVLAVTFGLSAYTALLRLLEAVLLG
LSGQVVALNPRRSTYDLLDLGLNLAGVFQLLAWGALGVYLLWRSGFRLPD
IGLARPRMRPDLLGGLGLAVLIGLPGLAFYQLARVLGINASVEPAELYDT
WWRIPVLLAMSFANGWAEEIIVVGFLLTRLRQLRVNPVVAIVAASLLRGA
YHLYQGFGAGLGNAAMGLVFGYYWHRTGRLWPLIIAHTLIDAVAFVGYAL
LAGHLGWLQ
119871149YP_941101.1 prephenate dehydratase [Mycobacterium sp. KMS]MPRIAYLGPQGTFTESALLQMISGAMVPGGDADDTAVTPVPTDSTPAGLE
AVRSGAADYACVPIENSIEGSVLPTLDSLAVGAPLQIFAELTLAVSFSIV
VRPDHDGDVGTVAAFPVAAAQVRRWLAEHLPAAQLVPAHSNAAAAADVAG
GRADAGISTALAAERYGLRSLAAGVVDEPNARTRFVLVGRPAPPPARTGA
DRTSVALRLPNTPGALVAAMTELSIRDIDLTRIESRPTRTELGTYVFFLD
CVGHLEDDAVAEALKALHRRCEDVRYLGSWPTGTAAGAPPPSSDEATRWL
TRLREGLPTPPEGGR
119871147YP_941099.1 hypothetical protein Mkms_5120 [Mycobacterium sp. KMS]MNEVMSIQCRECRSGLDHCHGTVIHHVRYRSECTEDDCTTPEVVHTFSVD
CEAVGCQCGQSAAQAVI
119871145YP_941097.1 hypothetical protein Mkms_5118 [Mycobacterium sp. KMS]MERMLEAPERDRPAGDARDKAPWWHSLQATPTRRALLLTALGGLLIAGFV
TALPRSEGTNGPGLSASAITLGPRGNDTFNHAKAGDCLNWPERNPDGAQI
VDCKDEHRFEVAESVDMRTFPGSEYGPDAEPPSPARIQQISQEQCQAAVR
RYLGPRFDPNSRFTISMMWSGDKAWRQAGERRMLCGLQLPGPNNQQLAFT
GKVAEIDQSKVWPAGTCLGIDPATNQPTDIPVDCAAPHAMEVTGAVNLKE
KFPGALPPEPEQDTFIKDACTRMTDAYLAPIKLRNTTLTLIYSTISLPSW
AAGSHQVSCSIGATLGNGGWSTLLNSAKGPLQINGQPPVPPPDIPEERLN
LPPIPMPDDVDSSSQQSEPDYSQTEQTQQTQTEQTQHGPQPAAAPPSEAP
APPPGDGNTFLNGPPPPPGAPAPPPPAPEAAPPPPPAPAPPPPPPPAPAP
PVEPVPPPPPPPPGP
119871143YP_941095.1 hypothetical protein Mkms_5116 [Mycobacterium sp. KMS]MDMRLDELRSWFGFGVAGNFAGHLEQAGEAADFVNVEVGTDAGDQAPKGI
FPWYAPGVDGQLGEFPLSHDRIVLPDSAVPLNLQIEPEVGLACRVVWYGD
TVVRLDPFALGAFNDCSIRRPGAAKISDKKNWGASSKGVAPQFFDIGDLT
PDGPTATLRLVCFLRDRDGHEHAYGVDSPLLGYSYYGEVLLDWVVERLAN
QKGSAGTPLEDVGALMAAAGHPEHVLIGIGATRYTELGESTFLQPGDEAV
VRVYDTESDEFSELRQTVVTR
119871141YP_941093.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MQVTSVGHAGFRIDTKAGSILCDPWVNPAYFASWVPFPDNTGLDWDALGD
VDYLYVSHLHKDHFDPKNLRDHVNKDAVVLLPDYPVPDLRRELETLGFHR
FFETTNSVKHRVSGPKGDLDVMIIALRAPADGPIGDSGLVVDDGDTVAFN
MNDARPVDLDVLAADFGRVDVHMLQFSGAIWYPMVYDMPARAKEAFGTQK
RQRQMDRCRQYIAQVGATWVIPSAGPPCFLDPELRHLNDDHGDPSNIFPD
QMVFLDQMRRHGHDGGLLMIPGSTAEFTGSVLDSLTHPLPDDEVEAIFTT
GKADYLEAFAQRMAPVLAAEKATWAPAHGDPLLEPLRAKFEPIMVQSDQI
CDGIGYPVELRLGAETVVLDFPKRVVREPIPDEKFRYGFEIAPELVRTVL
RDGEPDWVNTIFLSTRFRAWRVGGYNEYLYTFFKCLTDERVAYADGWFAE
AHDDSASITMGGYEFQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWNLES
GRCLTTKGHELRTGPL
119871139YP_941091.1 phospholipid/glycerol acyltransferase [Mycobacterium sp. KMS]MEPVFRTLEIAAEAATRVTGTRITYHGLDNIPARGGAVVAINHTGYIDFL
PAALAAKRRRRRMRFMIKAEMEQVKIVGYLIRHTGTIPVDRRAGAGAYAV
AVQALRAGELVGVYPEATISRSFELKEFKTGAGRMAIEADVPILPLIVWG
AHRLWTKDHPRALGRNRIPVTVVVGEPIPPAGPVSELSTTLRASMNALLE
RAQADYPAPAGQYWVPRRLGGGAPTLEEARRLEEVELAERARKRAEGRR
119871137YP_941089.1 LGFP repeat-containing protein [Mycobacterium sp. KMS]MLSRRPAPSLFFTAIAATLVLLPWAVNGLPGDDDESAAAGAPTLTEQPLA
GLGGGETIREIHQDTPFSMVALTAEDLTGTSARVRAKKDDGSWGPWYEAE
PLEGVGEETAARRGTDPVFVGRTTTVQIAVTRPADAPPSAPAPAEHRGPD
LGYLPATVEQPFAQNINAVLISPPQAPGDTLPLPNAVMAPGVPPRIITRG
QWGADESMRCGGPRYDAAVRAGVVHHTAGSNDYAPEDSAGMVRSIYEYHT
RTLGWCDLGYNALVDKFGQVFEGRAGGMDRPVEASHTGGFNTDTWGVAMM
GNFEVVPPTPIQLRTTGRLLGWRLGLDRVNPMGTTVLTSAGGSFTHFPAG
ATPTLPSIFTHRDVGNTECPGNAAYAAMGELRAIAARFNAPPGPEDLAES
LRGGAIFDRWAKMGGMASALGAPTSPEAAGEGTARYVRFQRGAMYWSPES
GAAPVMGAIYDAWGSLGFERGALGLPTSGEIHEPLWIKQNFQHGTLNFDR
EKATVTRVIDGVPLELPPASSHTPPVQLERFTAPINP
119871135YP_941087.1 UDP-galactopyranose mutase [Mycobacterium sp. KMS]MRSQYDLFVVGSGFFGLTIAERVATQLDKRVLVLERRPHLGGNAYSEPEP
QTGIEVHRYGAHLFHTSNQRVWDYVRQFTEFTGYQHRVFALHNGQAYQFP
MGLGLVSQFFGRYFTPDEARALIAEQAAEIDTEDAQNLEEKAISLIGRPL
YEAFVKHYTAKQWQTDPKELPASTINRLPVRYTFDNRYFNDTYEGLPVEG
YTKWLENMAADDRIEVRLDTDWFDVRDELRAANPDAPVVYTGPVDRYFDY
DEGRLGWRTLDFELEVLETGDFQGTPVMNYNDADVPYTRIHEFRHFHPER
AYPTDKTVIMREFSRFADEDDEPYYPINTESDRALLAAYRAKAKAETASA
KVLFGGRLGTYQYLDMHMAIASALNMYDNTLAPHLRDGAALTQSESTNP
119871133YP_941085.1 PA-phosphatase-like phosphoesterase [Mycobacterium sp. KMS]MADEPRGEDAALVAVQAALAGRPGVLPGARALSHFGEHSAGWLAVAGLGA
VLQPERRRDWLVAGAGAFAAHAAAVLIKRVVRRERPHHPAIAVNVGTPSR
LSFPSAHATSTTAAAVLLGRVTGLPLPAVLVPPMALSRLVLGVHYPSDVM
TGVAVGAVVAEVSARVAERTGARG
119871131YP_941083.1 hypothetical protein Mkms_5104 [Mycobacterium sp. KMS]MRQSSSADTVRPPHQSGTVRRATGSVVARRLVRGPAFPFDVTVRVSLWVS
VAVVAVLFSWGAWERRWIADDGLIVLRTVRNLLAGNGPVFNAGERVEANT
STLWTYLITAGAWVGGSVQLEYIAFVFAFVLSVAGVVMAMLGTARLYAPS
LQGRRALLLPAGVLVYIAVPPARDFATSGLENGLVLAYLGLLWWMLVCWS
QGLRSPSGPGRDAVSRPFTAALAFLAGLSVLVRPELALIGVGALLMMLVA
ARSWRRRLLIVVAGGLLPVAYQIFRMGYYALVVPGTAVAKDATGAKWPQG
FTYLTNFAEPYLLWVPAVLLILTGVVLVSTRSRPWWIRHQPPRGYGRLAR
MVQSPPTVVLFIVCSGLLQGIYWIRQGGDFMHGRVLLTPLFCLLLPVSVI
PVVLPDGSRFSRETGYLLAGATSVLWLAIAGWSLWAANSPGMGPDATRVT
DTGIVDERRFYAQATGHAHPMTAADYLDYPRMRAVLTALENTPDGALLLP
AGNYDMWDVVPALPPLPDAPDDYIGPHTVFFTNLGMLGMNVGLDVRVIDQ
IGLANPLAAHTERLEDGRIGHDKNLFPDWAIAEGPFLKIPPYLPVYIDRD
WVAQAEVALKCPATESVLNSIRAPLTPRRFLSNVVHAYEFTQYRIDRVPR
YELIRCGMAIPEPHEPPYTGMPAAGP
119871129YP_941081.1 putative esterase [Mycobacterium sp. KMS]MMRGLLRVVAAVVLAAGLWTATETASGTRAGADAVEYLMVPSAAMGRAIP
VAFQGGGPHAVFLLDAFNAAPDVSNWVTAGNAMNTLAGKGISVAAPAGGA
WSLYTNWEQDGSRQWETFLATELPDWLAANKGLAPGGHGIVGAAQGGTGA
MTMAAFHPDRFRYAGSMSGFMTPSATTLNGAITAGLAQYGGVDTRNMWGL
PQLGRWKWHDPDVHIQLLANNNTRLWVYSPTTLTCADPAAMIGYCDQAQG
SNRVFYQHYRAVGGSNGHFDFPSGGEHGWGSWAPQLGAMSGDLVAAIR
119871127YP_941079.1 cutinase [Mycobacterium sp. KMS]MPKTSRRKRHRILALAAAGAMALVVVLVVAIIVVVMRKPDTPDTALPPTA
VPPTSVPSTGKPRPEFQDASCPDVQLLAIPGTWESSPQMDPFNPTQFPIA
LLLNVTNPLRAEFGNDRLEIYTVPYTAQFHNPFSADKQMSYNDSRAEGTQ
AAVKALVDMNNRCPLTSYVIVGFSQGAVIAGDIASDVGNGRGPIDQDLVL
GVTAIADGRRESGVGQTVGPTPPGVGAEITLQEVPTLSALGLSMTGPRPG
GFGQLNDRTFEICAPGDLICAAPESAFSIVNLPRTLETLAGGAGQPVHAM
YATPQFWQVDGQPATGWTLNWARNLIESAPQPKHG
119871125YP_941077.1 mycolic acid condensase [Mycobacterium sp. KMS]MNMSETPNNSPSAENQPIVAQGEGGPLRPAQVDMTVAEMREWLRNWIANA
TGQNADNIDEQTAMVELGLSSRDAVAMASDIEDLTGVTLTATVAFRHPTI
ESLATVIIEGEPEVEHDDDGTDWSRERDVDDIAIVGLATRFPGDMNTPDE
MWEALLEGRDAITDLPEGRWEEFLGEPRIAERVAKAATRGGYLSDIKGFD
AEFFALSKMEADNIDPQQRMALELTWEALEHARIPASSLRGERVGVYIGA
SNNDYSFMSVADPGVAHPYAITGTTSSIIANRVSYFYDFRGPSMAIDTAC
SSSLVAAHQGVAALRAGEADVAVVGGVNALITPLVTIGFDEVGGVLAPDG
RIKSFSQDANGYARSEGAGMLVLKRLSDARRDGDEIYAVIAGSAVNHDGR
SNGLLAPNPDAQAEVLRKAYKDAGINPRDVDYIEAHGTGTILGDPIEADA
LGRVIGRSRPADQPALLGAVKSNVGHLESAAGAASLAKVALSLRNDKLPP
SINYTGPNPYIDFDAVRLKVNDTVSDWPRYSGHAIAGVSGFGFGGANAHM
VLREVLPSDLVEPEPEQVVEVTAEPNQPAVYVGGVRMDEYGEFVDEPLAR
RESGFDEDSDDDGLDRPAAAVEDDYELPGLTDEAKRLLEVAREELEAAEQ
PVPLVPLAVSAFLTSRKKSAAAELADWMDSEEGRASSLESIGRALSRRNH
GRSRAVVMARDHDEAIKGLRALAEGKQSPNVYSADGPVTNGPVWVLAGFG
AQHRKMGKSLYLRNEVFADWINKVDSHVQDERGHSILELILDDAVDYTDE
TTELPIEKVQLVIFAIQVALGELLKHHGAKPGAVIGQSLGEAAAAYFSGG
LSLEDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIKTVFSDYP
DLEVCVYAAPTQTVIGGPPEQVDAIIARAEQEGKFARKFQTKGASHTSQM
DPLLGELAAELVGITPHPLQIGYYSTVHEGKFLRAGSEPIHDVDYWKKGL
RHSVYFTHGIRNAVDNGHTTFLELAPNPVALMQVGLTTMSAGLHDGQLIA
TLARKQDEVDSMTAAMAQLFVHGHDLDMRTLFPRRSRGLAGALDYANIPP
TRFRRKPHWLDVRFSGDNAGVMPGSHVATPDGRHVWEYSPRGAVDAQALA
ALVKSAASQVFPEAAVTAAEQRAVPGDGARLVTTLTRHPGGASVQVHARM
DNGGESSFALVYDAIVTRGGQAVALPAAVATGTVAPQADSLTPAAEPEGG
DAAILSDNLTQGANLGAGLGKWSPDSGETIHDRLGTIVGGAMGYEPEDLP
WEVPLIELGLDSLMAVRIKNRVEYDFDLPPIQLTAVRDANLYAVEQLITY
AIEHRDEVDQLAESQKGKTAEEIAAEQAELMGGASTVAELEEKLAAAGHP
LGEAASEQAAVMSGANLTTVTTPAPDPQAEPSTQQDSAIPAPPTDPSGPN
IPPPPTNPAGPDTTAKSSAAKAAAQVLTQEAVTEALGADVPPRDAAERVT
FATWAIVTGKSPGGIFNELPKVDDATAAKMAERLTERAEGTITADDVKAA
TTIEDLATTVREHLEAGKVDGFVRVLRAPQEGSDRIPVFVFHPAGGSTVV
YEPLMKRLPPDTPIYGIERVEGSVEERAAEYVPKLLEMNGWTEGRSGVPF
ILAGWSLGGVLAYACAIGLKQAGADVRFVGLIDAVRAGEEVPQTKEETRA
RWERYARFAERTFNVQIPEIPYEELENLDDEGQVRFVMEAVAASGVQIPG
GIIEHQRTSYLDNRMIDTAEIKPYDGHVTLYMADRYHDDAIYFEPRYATR
QPDGGWGEYVSELEVIPIGGEHIQAIDEPYIAKVGAHMSEAINRIEAQGK
119871123YP_941075.1 hypothetical protein Mkms_5096 [Mycobacterium sp. KMS]MRPHVCGSECGVIAARPDGLCFVVTLRLWRLRSSSLRGATDGGGLRADDH
TRGPRLAVVPHPPAPQPHVPHLLRGEARVRVVAAERACQHLRVGHAEPGA
GGSADQRPPRVLAAFTTEQRGHLRPGRDVADGPRRRRRRGVEAPVVHDEP
QRNRESHPLRRAGGEDHDVGVLERRADRRGGQLGQRAGGRRGTPLRRLCV
RVVTQRAVIPRDGPAGRHPVGVVTGGRRHTPHGQRAQPEPLRAVIGDDDD
VAAGQIRGARRNRDDTWRRGGVSALECGSHRHQHDVAVDDGGQGGTRRGR
RQVGHRARRHVAGDHIREGQIGIKPCLRWTR
119871121YP_941073.1 hypothetical protein Mkms_5094 [Mycobacterium sp. KMS]MPSSAPAFVPSVPRAARLEACFEELAELTGQRNAIDGRIVEIVAEIDGDG
RWGATGARSVAALVAWKTGVSPANAKTIATIAHRLTEFPRCTRALREGRL
SLDQVGAIAERAATGSDDHYAELATHASVSQLRTAIKLEPPPQPEPEPEP
DAVSDADVEPKPLPGPADLQPSITTTSDEQYTYWHIKVPHVDAAKVDAVL
RSRLDGLIAQWKRDHGDTDDTSGPGRPPMPRLADAFMDLIDTGWDAEAAR
RPHGDRTTVVMHLDINDRIAALHLGPLLSDADRRFLGCDATCEVWFERDG
QPIGAGRTTRLINRRLRRALEHRDRTCAVPGCAATRGLHAHHIQHWEDGG
PTDLDNLVLVCPYHHRLHHRGIITITGPASKLTVTDATGRRLESGSLARQ
PNQPPPQVPPYRGPSGERADWWWYTPFQPPPPTTN
119871119YP_941071.1 cell wall arabinan synthesis protein [Mycobacterium sp. KMS]MPAHRFVRLIAVIAGLAGVVLCALSPLLPVRQTTATILWPQAPAEDGFVG
DLTAPLVSGAPLALDVTIPCRAIATMPADGGLVFSTIPPGGIAAGRNGLF
VRANADDVVVAFRDTVAAVAPRPAIAAGACSELRVWANVGSVGADFVGIP
GAAGTLSLDKRPQVAGIFTELEVAPQPGAAPAATSEPRLTARIDVDTRFI
TSPTLLKLAVMTLGVLCVIASIIALAVLDRRAGRGVPGAWRRRRVGLSTW
LADIGVVGALLVWHVVGAQSSDDGYNLTIARVSDEAGYTANYFRYFGATE
APFDWYQSVLAHLASISTAGVWMRIPATAAAIATWLIISRCVLPRLGRRL
AANRVAVWTTAAVFLAAWLPFNNGLRPEPLIAFAVIAVWMLVENTIGTRR
LWPAAVAVVIAMFSVTLAPQGLIALAPLLVGARGIARIVSARRAVDGVAV
AVAPLAAAASLLFVIVFRDQTLATVAESVRIKYVVGPTLPWYQEFLRYYF
LTVEESVDGSLTRRFSVLILLLCLFGLIVLLLRRGRLPGTFGGPVWRLAG
TTAIGLLLLTLTPTKWAVQFGAFAGLAGALGGVTAFAFARVGVNSRRNLA
LYVTALLFVLAWATSGINGWFYVANYGVPWFDKQPVIVGYPVTTIFLVLA
IAGGILAGWLHFRIDYAGHTEVADTGRNRALASTPLLVVATIMVVLELGS
MVKATVGRYPVYTIGSANAAALRSGLSDSSCAMADHVLVEADTNAGMLQP
VPGQRFGEYGPLGGEDPVGFTPNGVSDTLEPAEPVAANPGTVNSDGPVDK
PNIGVGYAAGTGGGYGPEGVNGSRVFLPFGLDPDRTPVMGSYNEPGSDQA
GVAAEATSAWYQLPPRTPDRPLVTVAAAGAIWYYEEDGSFNYGQSLKLQW
GVHRPDGSYQALGEVQPIDIVQQKAWRNLRFPLAWAPPEANVARIVADDP
NLSEDQWFGFTPPRVPVLQTASEFLGSQTPVLMDIATAANFPCQRPFAEH
LGVAELPEYRILPNFKQVVTSSNQWQSAEDGGPFLFIQALLRTATIPTYL
SDDWYRDWGSIERFIRVVPRDEAPNAVIEEGSKRVFGWNRGGPIRALP
119871117YP_941069.1 hypothetical protein Mkms_5090 [Mycobacterium sp. KMS]MVVAALIAAAVAVVSLAAIARVEWPAYNSSNQLHALTTVGQFGCLAGLFA
AGWIHRRGRRLLAHAASMVFLAAFAVVTLAMPLGATRLYLFGISVDQQFR
TEYLTRFADTAALHDMTYYGLPPFYPPGWFWLGGRLAALTGTPAWEMFKP
WSIISIAVAVVLAFVLWAAMIRFSYALIVTTATTAVMLAYSPAEPYAAII
AVLLPPVFVLAWSGLRAEGRGWGAIVGVGLFLGVAALFYTLLLAYAAFTL
VIMAVVAAVAHRSAGPLLRLLVIAVISGAIALIGWAPYLLAALRGTPADT
GTAQHYLPADGAQLSFPMLSFTLLGALCLVGTVWLVVRARNSTRAGALAV
AVLAVYAWSLLSMLTTLAGTTLLSFRLQPTLVVLLSAAGVFGFVEAARGL
ADSFSSRRLLVAAGAIGAIGALTFSQDIPDVLRPDIAVAYTDTDGYGQRA
DRRPPGAERYYREVDAAILEATGRPRNETIVLTADYSFLSYYPYYGFQGL
TSHYANPLAQFDQRAKAIESWQTLGDADRFVAALDELPWDPPTVFLMRRG
SEDSYTLRLASDVYPNHPNVRRYQVKLDAALFDDPRFEVSEIGPFVLAIR
QPVDG
119871115YP_941067.1 FAD linked oxidase domain-containing protein [Mycobacterium sp. KMS]MLQTTTRRLTGWARTAPSVAEVLSTPDPEEIAKAVARVADDPQRGVIARG
LGRSYGDNAQNGGGLVVDMTALNRIHTINTDTALVDVDAGVNLDQLMRAA
LPLGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRSMELLTAD
GTVRTLKPRGKDADLFWATVGGNGLTGIILRATIAMTPTETAYFIADGDV
TADLDETIAIHSDGSEANYTYSSAWFDAISPPPKLGRAAISRGSLATLDQ
LPKKLRRNPLKFDAPQLLTFPDVFPNGLANKWTFGPIGELWYRKSGTYRG
KIQNLTQFYHPLDMFGEWNRAYGSNGFLQYQFVVPTEAVDEFKAILVDIQ
RSGHYSFLNVFKLFGPGNKAPLSFPIPGWNVCVDFPIKPGLGEFVSGLDH
RVLQFGGRLYTAKDSRTTAETFHAMYPRIDEWIAVRRRVDPDGVFASDMA
RRLELL
119871113YP_941065.1 GntR family transcriptional regulator [Mycobacterium sp. KMS]MIRPGARGVRELLVNALREAVRSGRLAAGTVLPPSRTLAADLGIARNTVA
ESYAELVAEGWLASRQGAGTWVVNSQAGHQIARPRRVRSTARHNLMPGSP
DVSEFPRSAWLASARRALTNAPSEAFWMGDPRGRPELREALADYLARVRG
VRTSPETIVICAGVRHAVELLTRALGAQRPIAVEAYGLFIFRDAIRALGG
STVPIGLDGHGAVIGDLDGHDVPAVLLTPAHHNPHGMPLHPTRRTAAVEW
AQRRGAYVLEDDYDGEFRYDRQPVGAMQSLDPERVVYLGSASKSLAPALR
LGWMALPDALVEPVLAAAGGNQFFVDALAQLTMADFITAGHYDRHIRRMR
MRYRRRRDRLVDALAPFDVEIRGLAAGLNALLTLPDGAEREVLQRAGNAG
IALVGLSAMRHPAAGPAVADPDGVIVGFGAPADHAFAAAVEALCDVLEAT
LR
119871111YP_941063.1 hypothetical protein Mkms_5084 [Mycobacterium sp. KMS]MQTGSGAEITFDGDVVAKLHRPGTDPRALRIRLGVAQELRGILLAPLTVV
PGQVGHRWQSRWPRVETVAPQPDQLPWAEAGALLARLHAQPVTARLPHGW
PARLRRVVERHRTAEVAEPVRTALTGLPPAVWRAGSPDRPRTYVHGDFHL
GQLGRRAPGLPWVLMDVDDLGVGDPAWDLARPAGFWAAGHVPDGDWAAFV
GAYRHGGGAALVDAPDDPWPVLDPFARAAVVAAAAHHPDDELLAAACERM
V
119871109YP_941061.1 hypothetical protein Mkms_5082 [Mycobacterium sp. KMS]MELRLRPYATAGVALVGASAIAMAPLAPPLPDVKIASPSVNLSADIDPFT
PWVNVFENAETNIADLIDDWAEAPFPVLQQVIVNQLGYFSELPDFELIAG
QVIANFEAAAAVLYEQDLSTLNAEHAGIYQLLLNGAPPVLPPFLPPELAP
LIAFTTTSLSGVLLGLVGPVIAPVLALSASIQAIVGNLTSAEPDLGAAFN
TLINIPAGMADAFLNGGQTLDITPLVSLLGSDLLPAGTEVGITFGGLLSP
GGSIFNALDLAVPLDDILGIPLTLQIPGQGPGAIGSLINLSQAIAKALGW
DGTGNPLHEEEDAPAPLSEPNAADDLSLLRASTTTITVPETTDVDAGKTG
DVTPSTDGAAAVDTTVGSGAPTEVEQVKVEDNLPAVLDEETDTTPEKPAT
KRVNPGTKIAGALKSAGDQLNSAVNDLGKKLTKRPSKKAPAADNEKASAP
EKDTSTDKAPAASE
119871107YP_941059.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MTDRIYVVVVTHRRPESLAQSLDALCAQTRRPDGLIVVDNDSESRVRELV
ASQPIPSTYLGSRRNLGGAGGFALGMLHALAEGADWVWLADDDGRPLDPS
VLGVLLDCATRYGLAEVSPMVCNIDDPERLAFPLRRGLVWRRRVSELGEG
ELLRGYASLFNGALFRASTIEAVGVPDLRLFVRGDEVELHRRLVRSGLPF
GTCLRATYLHPCGTDEFKPILGGRMHTQYPDDATKRFFTYRNRGYLLSQP
GLRKLLPQEWVRFGWYFLVSRRDPAGLREWIRLRRLGREERFGRPGT
119871105YP_941057.1 hypothetical protein Mkms_5078 [Mycobacterium sp. KMS]MTLNNDDDNIEIIGGDAHADDPADGGDGKSLTDLVEQPAKVMRIGTMIKQ
LLEEVRAAPLDDASRNRLREIHHTSIQELEEGLAPELREELERLTLPFTE
DSVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGAL
PPGIAVQGQRGGPAHPGTGQYL
119871103YP_941055.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MQAIVAESPAKLIWTEVPERPLQSGDVRIDVVAAGINRADLLQAAGKYPP
PKGASDIMGLEVSGVISDVADDVSGWAVGQPVCALLAGGGYAENVTVPAG
QVMPVPESVDLAHAAALPEVACTVWSNVVMTAALAAGEVLLIHGGASGIG
THAIQVANALGCRVAVTAGSANKLDLCRELGAEVAINYRDEDFVERLRAE
TDGAGADVILDIMGAAYLDRNVDALATGGRLAIIGMQGGVKAELNIGKLL
AKRASVTATALRSRPVSGPGSKSDIVAEVVANVWPMVADGRVRPIIGAEF
PVQEAQAAQEMLDSGEVSGKVLLRVRD
119871101YP_941053.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MGDTYESVTIETDGHVAQVTLIGPGKGNAMGPAFWAELPDVFTSLDADPD
VRAIVLTGSGRNFSYGLDLAAMGGTLPGLDAGARSRADFHKTLQKMQGAI
SAVADCRTPTVASVHGWCIGGGVDLISAVDIRYASADAKFSVREVKLAIV
ADVGSLARLPLILTDGHLRELALTGKDIDAARAEKIGLVNDVYDDPEASL
AAAHATAKEIAANPPLTVHGVKDVLDQQRIARVSESLRYVAAWNSAFLPS
KDLGEAVTAMFQKRPPNFTGE
119871099YP_941051.1 hypothetical protein Mkms_5072 [Mycobacterium sp. KMS]MRSDLPQGPDSPPTDELRSAELSLGVLHQVVRSIAEDDLGKQTPCSEFDV
AGLTEHLVRSITILGGAAGAEMPERDPSDSVERQVILAARPALDAWHRRG
IDGAVDVGGTTMPATVLVGILSLEFLVHAWDYATAIGHTVPAPDSLSDYV
LAMAEKIVTPQGRARAGFDDPVEVPDDAPPLQRLLAFTGRRAEV
119871097YP_941049.1 putative aminotransferase [Mycobacterium sp. KMS]MTARLRPELADIPAYTPGKTVPGAIKIASNETVHGPLPSVRAAIEKATDQ
LNRYPDNGYLELREHLASHLDKNLGAGAFTPEQIAVGCGSVSLCQQLIQI
TSSVGDEVIFAWRSFEIYPLQVRTAGATPVQVPLRDHTHDLDAMLAAITD
RTRLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVIDEAYVEYIRGDQ
VPDSFGLVRAHPNVVVLRTFSKAYGLAGLRIGYAVADADIVTALGKVYVP
FSATSISQAAAIASIDAADELLARTDQVVAERDRVTAALREAGFTLPPSQ
SNFVWLPLAERTLDFVRRAAENRLVVRPYGEDGVRVTIAAPHENDAFLEF
ARNWIGQP
119871095YP_941047.1 cutinase [Mycobacterium sp. KMS]MRVRQFGRVLGAVAVTTWASLVGVATPSASAQACPDVEIVFARGTGEAVG
VGGVGQAFVDAVRAQAAPRTVNVYAVNYAASSNFDARDELARTVVEGIRD
AGNRVQTIATTCPDTRIVLGGFSQGAVVAGFVTSSTVPDAVPASYRNAVP
QPLAAEVAEHVAAVTLFGLPSPQWLGTYGSPPVVIGPLYAPKTLQLCAEG
DTICDGTPGGGPSIAHALYGINGMTQQGATYAVDRL
119871093YP_941045.1 phosphodiesterase [Mycobacterium sp. KMS]MRLLLISDTHVPKRARDLPAAVWDEVARADVVIHAGDWVEPGLLDALEER
ATRLVACWGNNDGDELRRRLPERADVTLDGVRFTVVHETGASGGRDARMA
KLYPDTDVLVFGHSHIPWDTTAATGLRLLNPGSPTDRRRQPHCTYMTATI
ADGALGDVVLHNLVPTSVDRRG
119871091YP_941043.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium sp. KMS]MTSSPGWPPRPRSPSPTPHPVRIRTGSRRKNSIPTSSCCSGRPAIWRNAN
SCPGWPTWSSPRWRPRSGWSARHWRTSAATSSGRWREAVDAFGSHELSDE
EWEGFACRISYVPQSAGPEALADAVKAAKAELGPDTRRLHYLSVPPKAAK
AVITMLKESGLVDRSRVVMEKPFGTDLASACELNAFVHDTFDESQIFRID
HFLGKEAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPEKLGLDERADFY
ESTGAYKDMVVTHLFQVMAFVVMEPPTALEPRAISEEKNKVFRSMLPVDP
AKVIRGQYVGYRREDGVAPDSETETFIALQVGIDNWRWAGVPIYLRTGKK
MAEGQRIISIAFREAPRSMFPAGSGVGSQGPDHLTFDLADNSKVSLSFYG
KRPGPGMKLDKLSMQFSTQETGRVGDVLEAYERLILDAMRGDHTLFTTAA
GIESLWDRSTPLLEDPPPVKVYQPGTWGPNAIHQLIAPNAWRLPFEREWR
EKTPE
119871089YP_941041.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. KMS]MGSALTRAAAGAGHRVIAWNRTPHRATALRSAGVSVAGSVAEAVESAEIV
VVCLFDHESVRRVLDPVADRLAGRRLVNVTTTTPDAARELADWSADRGAD
YLDGGIMAVPSMIGTPGSSVYYSGSRAVFDGCGELLETWGAAEYFGDDPG
LASLHDLALLSAMYVMFAGFFHGAAMVATAGTSATEFAGRAAAWLQALLP
ALAEYAEFIDGGDYRRPGQQSLEFSDISEIVEASGAAGISTEVVDTVQRL
IRRQIDTGHGAEGFARVIESIRNPLGAA
119871087YP_941039.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MDSKPPSDAIQAAHRHHLSTLPFTDRADFDDADRGFIAALEPCVVAAADG
RVVWDNDVYAFLDGEAPASVHPSLWRQSQLAAKQGLYEVVEGIYQVRGLD
LSNITFVEGDTGVIVIDPLISTETAAAALALYRQHRGDRAVTAVIYTHSH
VDHFGGVLGVTSQADVDAGKVAVLAPEGFVEHAVQENVYAGTAMARRATY
MYGTLLARGPRGQVGCGLGQQTSTGEVALVVPTLDIRETGEAHTIDGVEI
EFQMAPGTEAPAEMHFYFPRYRALCMAENATHNLHNLLTLRGALVRDPHA
WSGYLTEAIDTFADKADVVFASHHWPTWGRDRITEYLSLQRDMYAYLHDQ
TLRMLNQGHTGIEIAEQFQMPPALERAWHTHGYYGSVSHNVKAVYQRYMG
WFDGNPGRLWAHPPEALAARYAEVLGGVDRVVELARKACDEGDFRWAATL
LDHAVFADQNHTEARQLYADTLEQLAYGAENGVWRNFFLSGAAELRDGNF
GTAVQSTSPTLLSELTPAQMFDSLAISINGPRAWDLDVAVDVTFLDTGDN
YRLTLRNGVLVHRKVSADESSVQATIRLANKVRLLAYAAGDTTSPGVEIT
GDEAALANIVGVLDRPDPAFDIVMP
119871085YP_941037.1 phosphoglycerate mutase [Mycobacterium sp. KMS]MQLLLIRHALPLRSEPGQGSDPDLSEDGIEQAKRLPDALTRFPIARLVSS
PQRRAVQTAQPVAETLGLTVEVDERLAEYDRDLPHYIPIEQIAKENPQEL
ERLMSGRLPSGVDEDAFMARIFAAVDDLVASAEREDTVAVFSHGGVINAL
LHRVLRTERLLSFNVDYASVTRLLWSSRANQLAVASVNGTEHVWDLLPRN
LRW
119871083YP_941035.1 hypothetical protein Mkms_5056 [Mycobacterium sp. KMS]MTTDPYGPSAGREPEPYDQPNPGPPVPGDYEVADRQPPDLKKVHFTRAAA
VWTSVIVGLLILIVLLIFIAQNTESAAMAFLGWRWNLPLGVAILLAAVCG
GLIASLAGAARLFQLRRAAKKNYKAAMR
119871081YP_941033.1 ABC transporter-like protein [Mycobacterium sp. KMS]MITFEHITKRYPDGTVAVDDLSLEVPEGTLTVFVGPSGCGKTTSMRMINR
MIEPTSGTLTVDGNDVTKVDAVKLRLGIGYVIQSAGLMPHLRVVDNVATV
PVLRGESRRSARKAALAVMERVGLDPKLGDRYPAQLSGGQQQRVGVARAL
AADPPILLMDEPFSAVDPVVREELQTEIVRLQNELRKTIVFVTHDIDEAI
KLGDKVAVFGRGGVLLQYDAPARLLSNPADDAVAGFVGADRGYRGLQFYP
ATGTAGLPLHDLRHVRESEIDALQLAPGDWVLVTRPDGTPYAWINADGVA
LHRNGSSLYDSTIAGGSLFRPDGTLRLALDAALSSPSGLGVAVDEHGQVI
GGVRADDVLAALDRQRQEA
119871079YP_941031.1 binding-protein-dependent transport system inner membrane protein [MycMNFLSEALSFIFTAANWAGPAGLGARIVEHLEYTVIAVVFSALIAVPLGM
IIGHTGKGTFLVVTGVNALRALPTLGVLLLGVLLWGLGLVGPTVALMLLG
IPPLLAGTYSGIANVDPAVVDAARSMGMTERRVLLRVEVPIALPLILGGL
RTATLQIVATATVAAYASLGGLGRYLIDGIKVREFYLALVGALMVTALAL
ILDGLLAFAVWLSVPGTGRWRRAARMPQPLLGDEVALESRSRGGSRSTSV
AGYEPASASPTVEG
119871077YP_941029.1 prephenate dehydrogenase [Mycobacterium sp. KMS]MASGPGAVCQPGTVTKPPVCVLGLGLIGGSVMRAAAAAGREVFGYNRSVE
GVQGARFDGFDASEHLDEVLGRAAETSALVVLAVPVPALGLMLGHIRDAA
PQCPLTDVTSVKGAVLEHVRSFGLQERFVGGHPMAGTAHSGWAAGDAALF
VGAPWVISVDDHVDPDVWAHVMTLALDCHAVVVPARSDEHDAAAAGISHL
PHLLAEALAVTAGEVPLAFALAAGSFRDGTRVAGTAPDLVRAMCEANSSQ
LVPALDRSIELLTAAREALARHGSVADLVESGHAARMRYDSFSRPEIITT
VIGEENWRDELAAAGRAGGVIRSALPTRDSRR
119871075YP_941027.1 tRNA-adenosine deaminase [Mycobacterium sp. KMS]MTSDESLIRAALDAAALAGPRDVPIGAVVFGPDGTELARAANAREALGDP
TAHAEVLALRAAAAVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARVV
FGAWEPKTGAVGSLWDVVRDRRLNHRPGVRGGVLADECAKPLEAFFARQR
119871073YP_941025.1 hypothetical protein Mkms_5046 [Mycobacterium sp. KMS]MFKSTSSKLSGVNYAAALLGAFAVFALAPATAAALPPGNTTGNTGCHYTD
KDGYDIPIDDGQSVVVDGKTVTCSGGTITVSQANTGGVRPQRIPNLQVFE
AQKPVLAQAR
119871071YP_941023.1 hypothetical protein Mkms_5044 [Mycobacterium sp. KMS]MKLVAVLALAGGVLAAPLVTASPAAAVPCNSADCVQYVDRNINPSESCVS
GGSRYLFGLDASGNTYLCNAQRAWVPQPPLVGVRTQGAPCDGSTGVAQSP
DGLPLGCQRGGWLPDFTAFYY
119871069YP_941021.1 glycerol dehydratase [Mycobacterium sp. KMS]MRILDAKPVNLDGFSVTDPALGLVAMHSPHDPQPSLVVRDGRVVELDGRP
AADFDVIDEFIARYGIDLTVAEEAMALDDAVLARMAVDVNVPRAEVVRLI
GGTTPAKLARVMAVMTPVEMQMAMHKMRARRTPSNQAHVTNQLDDPLLIA
ADAASAVAYGFREVETTVPVFGDAPSNAIALLIGSQVGVPGAMAQCSIEE
AMELRLGLRGLTSYAETISIYGTEQVFVDGDDTPFSKAILTAAYASRGLK
MRVTSGGGAEVLMGAAEKCSILYLESRCVSLARALGSQGVQNGGIDGVGV
VASVPEGMKELLAENLMVMMRDLESCAGNDNLISESDIRRSAHTLPVLLA
GADFIFSGFGSIPRYDNAFALSNFNADDMDDFLVLQRDWGADGGLRTVSR
EHLARVRRRAATAVQAVYRDLGLADFDDTRIDAVVVANDSRDLPAGDPKA
VAEAATAIEARQLTVFDVVAALHRTGYAPEAEAIMRLTRERLRGDQLQTS
AIFDDQFQVLSKITDPNDYAGPGSGYTPTEKRRAEIDGIRQARTSAELTA
DQAEHRGHVVFSDVEPAHQGSDPREVCIGLSPALGRSVWLTLCGLTVGEV
LRQLSAGLEEEGCVPRLVRVRSTIDVGLIGLTAARLSGSGIGIGLQGKGT
ALIHRRDLAPLANLELFSVAPLLTAKMYRELGRNAARHAKGMAPLPILAG
GTDESISARYHARAVALVALERQACEPGQAPITVEAKRV
119871067YP_941019.1 hypothetical protein Mkms_5040 [Mycobacterium sp. KMS]MSRDSVVVAGCDVGNHTTEIVLARVAADGVVEPLTHGQAPTRGRKGSTES
LEGAAALLNRLEVEARVRVDEVVLATIRPVDTATAPLAPAVSPRAPVRSL
RRPDASTPAGAGHGVGTHVPLADLSGPVHPGPVIVSVSAATDFEVAAQAI
GDGVASGWKIAGVLVAQDDAVLIRNRIPIDVPVVDEVELDGLRRGALVAV
EVVAEGRAYRALADPIALSAALQLGHDRLLDVAEFTRELADAPAIAVTAR
TEPPDPPAVDDDYVDCRIGGEIVRYAPAAAHTVLRLEPPGCAVEVRLSAL
PAAENGIAVDDAFFTDLASIDNGAWLRRGVADARGTVVALLAAEPVTDAA
ATLSGLTGRPARTVAGEPAAAARGAQTTPGLPPGSVVCDIGGGTVDLIGQ
GRTVTAAGAGETITTAVSRVLGIPRALAERVKRTPALRVEGPHVAHEEDG
RRVFLDSPASADAIGRLCTRGSAGLVPFSHRLAAEEWRSLRLAIKQQTVA
ANIARCLATFDEPPSALVLAGGGALDDELLRTVGESLRPARVVVGRADID
GVHGPRFAVASGLVHLYAEDRVGSTSPA
119871065YP_941017.1 hypothetical protein Mkms_5038 [Mycobacterium sp. KMS]MSVGGAAIVIAGLAGCSSDSGSSESTTSAESSDTATASASAEATSAPGAA
KVVIDGQDQNIQGTVACTSMGGNLNIAIGQATTGIGAVVTEADPPTVQSV
GLGNVNGVTLGFQQGTGQGNAEVEKDDKTYNIKGNATGVDMANPLQPVTK
PFEIEVTCP
119871063YP_941015.1 queuine tRNA-ribosyltransferase [Mycobacterium sp. KMS]MDQQFFTVEAELPGRRGRAGVIRTPHGEIRTPAFIAVGTQATVKAVLPET
MRELGAQAVLANAYHLYLQPGPDVVAAAGGLGAFMNWPGPTFTDSGGFQV
LSLGAGFRKVLAMDANRVQADDVIAKGKERLAVVDDDGVTFRSHLNGTTH
RFTPEVSIGIQHQLGADIIFAFDELTTLVNTRGYQEDSVRRTHRWAERCL
AEHRKLSLENHEKPPQALFGVVQGAQYEDLRRQAARELTEILDEDGRGFD
GYGIGGALEKQNLATIVGWVTSELPDDKPRHLLGISEPDDLFAAVEAGAD
TFDCVSPSRVARNAAVYSATGRYNITGSRYRRDFTPIDAECDCYTCAHYT
RGYIHHLFKAKEMLASTLCTIHNERFVVRLVDQIRASIVAGNFDELREHV
LGRYYAARGQ
119871061YP_941013.1 saccharopine dehydrogenase [Mycobacterium sp. KMS]MRILLVGAGGVGSAFCAIAARREFFEQIVVCDYDEARARRAAEAVGDARF
VAAQVDATSADAVAALVREHAITHVMNAVDPRFVMPIFNGALAGGADYLD
MAMSLSRRHPEQPYELTGVKLGDEQFAAEADWSAAGRLALVGIGVEPGLS
DVFARYAADHLFSDIDELGTRDGSNLTVDGHDFAPSFSIWTTIEECLNPP
VIWEDGRGWFVTEPFSEPEVFDFPDGIGPVECVNVEHEEVLLMPRWVKCR
RATFKYGLGAEFIDVLKTLHKLGLDRTDTVTVGSGKGPVEVSPRDVVAAC
LPNPATLGPNMRGKTCAGLWVTGTGRDGNPRSTYLYHVVDNEWSMAEYGH
QCVVWQTAINPVVALELLANGTWSGAGVLGPEAFDAVPFLELLTAYGSPW
GVKELTP
119871059YP_941011.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTHTPRRRMSGADRRAQLLDIARDIVAADGFTALSIDRIAHTAGVTRTVV
YQQFTDLAGVMTALLDRESAIAFAGLRSVDWERAEPDADRLGRGILAYLQ
AAPVSWRIFLRPPDGAPPQVRARIELGRAYARGVAARHMSRALGTAVDPD
GPTQRILLAAIEELALLHLEDPAGCPDETVVSYLRSLLWWAERAEITAG
119871057YP_941009.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMRFLRALLLLLAVLTVASCASADDGSDEPIKSAGVLRVGTEGVYAPFSYH
DASGQLVGYDVDVARAVADKIGVRAEFVETPWDAMFAALEAGRFDVVANE
VTINAERRAKYDLSQPYSVGEGVIVTRADDDSITTLDDLAGKVAAENATS
NWSEVAREAGARVEAVEGFTQAITLLNQGRVDVVVNDSIAVYAYLAETGD
TSVKIAGTVGEKSEQGFAARKDSGLLPELNRALDELRADGTLAEISQRYL
KANASGAPESDQADTAGAPRSTWQLILDNLWPLARAALTMTIPLTVISFA
IGLVIALGVALARLSPNVVLTNVARFYISIIRGTPLLVQLFIVFFALPEF
GIRIDPFPAAVIAFSLNVGGYAAEIIRSAILSIPKGQWEAAETIGMNYPT
SLRRIVLPQAARVAVPPLSNTLISLVKDTSLASTILVTELLRQAQIVAAP
TFEFFALYGTAAVYYWVICLVLSFGQGRIERRLERYVAR
119871055YP_941007.1 fatty acid desaturase- type 2 [Mycobacterium sp. KMS]MAKDLTQVQLLTELEPVVEANLNRHLRMRKDWNPHDFIPWSDGKNYYALG
GQDWEPEQSQLSEVARTAMVQNLLTEDNLPSYHREIAMNFSLDGAWGQWV
NRWTAEENRHGIALRDYLTVTRAVDPVELEELRVEQMTRGFSPGQNGQGE
EALFARSLFDSVIYVSFQELATRVSHRNTGKACNDPIADQLLQRISADEN
LHMIFYRDVSEAGFDIAPDQAMHSLHHVLRNFKMPGYTVPDFRRKAVVIA
VGGVYDPRIHLDDVVMPVLKKWRIFEREDFTGEAARMRDDLGVLVEELEE
TCEKFETAKQRRLEREAKMAENRAAKQAAKQAVSV
119871053YP_941005.1 glucose-methanol-choline oxidoreductase [Mycobacterium sp. KMS]MASYDYIITGAGSAGCVLANRLSEDPRLNVLLLEAGGGDRNLWFHIPKGS
GKLFESEKHMWHYETTPFGPDQHVEQWMRGKALGGSSSINGLLYNRGNRA
DYDGLERLGNKGWGWDEILPIFKGFENNEFGPSATRGTGGPLNISVPRDP
DPLCEEMIDAATRIGMSRVEDINESDAERIGYATSTIRKGRRVSAATAFL
KPAMRRPNLTVRTGALVHRVIIEGGRAAGVEVTTPSGVERLRATREVIVS
MGSLNSPKLLQLSGIGPREVLSAAGVEVRLERDNVGRGLREHRCATLRYG
LNEDLGYNRYLATSMGQALTGMKYLATRKGPLAAPSFDVVGFVKTRPDEE
RPDGQVMMGPYTLPPYNVGEPVSIQREPGVSCLGMVLRPTSEGYIEITSA
DPAAALRINPNYLGTDYDRETTAGLLRRMRAIFEQSPIAGRISHETYPGP
GVQSDDQLVDAALDGGYCGYHAVGTCAMGPSDHDVVDHQLRLRGVDGLRV
VDCSVMPTIVAGNLNGPIMAMAWRAADFILHGC
119871051YP_941003.1 cytochrome P450 [Mycobacterium sp. KMS]MSTRPDQAVSYHFDRHSQDYRERFLDITHEMHRKCPLAWTDTYDGHWVAA
GSAEVFELARCPHVSNDHDVHHERRGYKGISIPTMIEAENFRGGMLEMDD
PEHRHYRTVLNPYLSPAAVKRWEPFVDELVRACLDDHIESGRIDFVDDLA
NVVPAVLTLAMLGVSLEKWSIYNEPAHASVYTPPDSPDAERVRELFMAMG
VDLFANLMEIRANPRPGIIDALATIRIDGEPPPDIELIGMLNLLIGGGFD
TTTALTAHALEWLSEHPDERTRLSRERDTLLNPATEEFLRYFTPAPGDGR
TIAEDMALGDAELREGQRLWLSWAMANRDPAVFTEPDRIVLDRKGNRHFS
FGLGVHRCIGSNVARTVFKSMVTAVLDRMPDYRCDPHGTVHYDSIGVIQG
MRHLHATFTPREPKGPGVAETLARLQRICDEQGLARPITELKGAARIEES
E
119871049YP_941001.1 luciferase family protein [Mycobacterium sp. KMS]MRIGLTGGGSSVDKIVAHAQRAEADGFSSLWYASAVGGDPLVAMAIAGRA
TGSIELGTAVLQTYPCHPLLQANRVAAAANAMGRPGLTLGLGPSHEPIVR
DVLGLSYDHPARNTREYLRIVSGLLAGVEVDFDGTDWSTHSAGRMAALDH
RVPVLLSALSPRMLRIAAEFADGVVLWMASASAIAGRIAPVLREAANAQG
KPAPRIVAGLPVAVHDDADEARAAISATASSYERMTNYQNIIRAGGGERA
ADVGIVGDEGAVARQLAELIDAGATDVWAQPVAVGADRAQLSASLKRTRG
LLSELARAG
119871047YP_940999.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MSDRFSMEGRVAVITGGGTGIGRASALVLAERGADVVLAGRREEPLKATA
ADVEALGRRAIAVPTDVTKADQCQALVDAALGEFGRLDVLLNNAGGGETK
SLMKWTDEEWHEVLELNLSSAWYLSRAAAKPMIAQGKGAIVNISSGASLL
AMPQAPVYAAAKAGLNNLTGSMAAAWTRKGVRVNCIACGAIRTPGLEADA
KRQGFDIDMIGQTNGSGRIAEADEIGYGVLFFASDASSYCSGQTLYMHGG
PGPAGV
119871045YP_940997.1 luciferase-like protein [Mycobacterium sp. KMS]MDIGFVSLNTPHDLAPGVLAKELEQRGFESLWLGEHPQIPVSAAGAMPAA
LLHSQQRMWDPLLSLLVAAQATSTLRLGTAVALPLEHELFTFAKQVATLD
RFSGGRVLLGVGVGVRAELAMTNSIAWADRYRALSDMVAALRVLWTEDEA
CHHGEFYDFDPVWSHPKPQQQPGPPLLAAATGPKAIGECLSWADGWLPGD
AAYRDLSAAVHDFRVRAEDAGRDPATLDLTVMAWGDPSANRLARYRDLGF
TRVVVGGGRRDGDDPSTTLPFLDRYAALVSELR
119871043YP_940995.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MTTHDPRTLKEKDMSVLRDELVPSRYAVQIGDIEVLVISDGVLPITASTL
ATNVDSADLTGWLDDMFLPPDVLDWPLNVVVVRSGDRTILVDAGLGVEFP
DFPRAGQTATRLEAAGIDLESVTDVVLTHLHMDHVGGLLTEGLQARLRPD
LRVHLAAREAEFWTAPDFSRTCMPQPVPGVLRSVAARFLDEYHGRLRTFE
TEYEVAPGVLVTRTGGHTPGHSVVRLASRGEGLTFAGDAVFAPGFDNPQW
HNGFEHDPEEAARVRIRLLRELAATGESLVATHLPFPSVCRVATAGDVFR
CVPAVWDY
119871041YP_940993.1 NmrA family protein [Mycobacterium sp. KMS]MRIVVIGGTGRIGSKVVQGLIEHGHDAVAAAPSTGVNAFTGEGLADVLAG
ARVVVDVTNSPSFEEAAAQEFFNVATTNLLTAEAEAGVAHHVALSVVGTE
LLARESGYFKAKLAQETLIAGGPVPYTIVRATQFFEFLTTIADSATVDGV
VRLPDAPIQPMASANVAEAVVIAAVNAPVNGITEVGGPHRFRLPDLIRTA
LTARGDGREVATDPHARYWGVAIDEHTLVPGDGATLFDIHFEDWILAAAA
RS
119871039YP_940991.1 regulatory protein LuxR [Mycobacterium sp. KMS]MASQERGRLLYGRAVETAALRRVIAAVRTGRSQVLVLRGEPGAGKTALLG
YLLDEAPGWRCVHVAGVESDMELAYAGLHQLCGPLMDYLDDLPPPQRDAL
TVAFGRGVGPPPERFLVGLAVLSLVAAAVHEQPLLCVVDDAQWLDQVSVQ
TLGFVARRLMAEPVALVFAARNEGADALTGLPELPVRGLSDADARELLER
AMIGGIDPSVRDRVVAETRGNPLALLEVPRSYSSAELAGGFWTVGAMTSR
TRIEESFVQRIQVLPDRTRLLLLLAAAEPVGDSSLFLRAAAMLGIAVDAL
APAESAGVIEFGPRMRFHHPLMRAAAYRAADLADRRAVHAALAAATDAES
DPDRRAWHAANAVAGTDDAVAAELEASASRAQSRGGIAAAAAFMERAAVL
TADPELRGNRALAAAQAKRDSAATAKAYELLTIAETAPLSALQRARAARL
RAQMAFVRSRVGESGAPAVGDTAPALLDAAKQFEGLDDFASRESYLEAFA
ALMYAGRLAQPGALLHTAEAARSATVRISELPRAVDLFFRGITDWIIGGI
RGGEYLRGALDTMRALASDDPGQLLRWLVPAFPILQEAAAHELWDEDLVD
ALSAAVAGQAREVGALAGLPQALVYRAGVHVLFGEFNTAATLIAEANSIT
AATTHNGPVRYHSLLVAAWRGEPAEAMRQIDAAAADGAARGEGRAIGLTG
YATAVLYNGLGRYEEAFTAARRACEFEDRGFYSWCLHELVEAAAHLGETD
AARRAVSLIEERAGASGTPWGLGALASAQAMLADNDEADRLFTEALDHLG
RSRVAVHRARTHLGYGEWLRRMNRRGDARRQLNEAHELFVRMGAQAYAER
ARKELIAVGEKVRKQRLTSGDELTAQEAQIARLAADGLTNQEIGAQLFIS
VHTVEWHLRKVFVKVGITSRRQLRTVAWSHQGVTTDH
119871037YP_940989.1 hypothetical protein Mkms_5010 [Mycobacterium sp. KMS]MDRHVIHYSDANNRSDARSRFLVTMFCVPGQEMLVLVDDDDLAARADLRV
SGPSPAR
119871035YP_940987.1 hypothetical protein Mkms_5008 [Mycobacterium sp. KMS]MTGSDELEQLRKRVQYLEDRTAILDCVMNQARGHDRHDAELMGSVYFEDG
VDEHGPTVKTGPEYGDWANEAHTAVFEDHLHNITTHTCEIDGDEAHAESY
VMGAMRVKGGKIVSLMGGRYLDRLERRDGVWKIALRRCTIEWMISGDSSI
LGKGAVAGFIKGKWDKTDASYIRPLKLDSEPVERW
119871033YP_940985.1 hypothetical protein Mkms_5006 [Mycobacterium sp. KMS]MFDQVFAGLEESALLAAIEQSAREEAQAGARKLAAIAELVHLTVTCDEEC
DGWVYDSWAAAASEVGAVLNIGHKRASGQMRIAVALRDRLPKVAALYLQG
RLSARLISEISWRTRLVDDEQVLALVDAALAEAALRWGPLSEARLARAID
AVIHRYDRDAVIRAKETIKTRDFHIGSGDDPDELVLVWGQLLGCDAAALS
ARITALLKGICDNDPRSVGERRSCAVGAIVQGHDHLPCRCGSPACAAAAP
EKSNVVISVIADPAAIEAAQKLIAAEDEQPAEQGEPEPAACPQDSGVALL
PGVKLLPIAALAEAIRGGAAIKPLWLPGPDPEPHYRPSATLAAFVRARDL
FCRFPGCDVPAERCDIDHVIPWPYGPTHASNLNCKCRTHHLGKTFWDGWH
DEQSPDGTVTWTTPTGKRHTTVPGSRLFFPEWDTTTAELPPLEQPPPDPG
RTAKMPKRRRTRAADNAARVKAEREHNAAARAMADHAANADPPPPAPHPD
YGDDPPPF
119871031YP_940983.1 hypothetical protein Mkms_5004 [Mycobacterium sp. KMS]MASAATEIDVDGVKVRLTNPDKPYFPKLGKDGTKGKLVDYYLAVADRMVA
LLRDRPVHLQRFPDGIEGEEIYQKRVPQKRPDYLETCTVTFPSGRTADAL
KITHPSAIAWAAQMGTVTLHPWQVRCPDTEHPDELRIDLDPQPGTGFAEA
RSVAVDVLKPLLDELGLVGYPKTSGGRGVHVFLRIATDWDFIAVRRAGIA
LAREVERRAPNAVTTSWWKEERGRRLFIDYNQNARDRTFASAYSARKTPI
ATVSTPLTWEELRVAEPDDYTIATVPDFVAGRPDPWADIDKKAQSIDTLL
KMVEADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEDGNRR
119871029YP_940981.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MGDERRARGRPARISREQIVAAARRAPGPELTMQAVADELGVSRKALHYY
VGNRQGLLTLVVVDRFEAELKRVHLPDDGDWRVVLRAYAHAYRDGIVQVG
AQISSAADHTPFRGVGAVEVLALAERVLAALLAAGFGVDDARRGVTAVAN
IAQSAAQNAMSTSMRDVHQAETRAALERTQEADYPALRLVLDSAPRPDEG
QFEFELDLAIAGLEQLLRGGRP
119871027YP_940979.1 hypothetical protein Mkms_5000 [Mycobacterium sp. KMS]MRRSVAVIWHASFSVIAAVLYFFFVLPRWFELMGSTSPTLGTVLRIVTAA
LIGLAALPVVFTLLRTRRPEFGTPQLALRLRTVSIALHVLAGVLILGAAI
SEIWLDLDSAGPWLFGIYGAAAAIALLGIFAFYLAFVAELPPPPPKPLKP
KAQTRRGRRKAQEAAPEDTADSEDTEETTEEAERSESDDPVTESVDTESG
DTDAADETEETEAADEEPVASSGGLRNRRPSGKGDSSRRRRRLRGGIAVE
D
119871025YP_940977.1 DNA polymerase III subunits gamma and tau [Mycobacterium sp. KMS]MALYRKYRPATFAEVVGQEHVTEPLSTALSAGRINHAYLFSGPRGCGKTS
SARILARSLNCEQGPTPTPCGTCDSCVALAPNGPGNMDVTELDAASHGGV
DDTRELRDRAFYAPAQSRYRIFIVDEAHMVTTAGFNALLKIVEEPPEHLI
FVFATTEPEKVLPTIRSRTHHYPFRLLAPKTMRTLLERICADEGVSVDDA
VYPLVIRAGGGSPRDTLSVLDQLLAGAAGNRVEYGRALALLGATDVALID
DAVDALAAGDAAALFGAVESVIDAGHDPRRFAVDLLERFRDLIVLQAVPD
AAARGVVDAPGDVLERMRDQAARLGSATLTRYAEVVHAGLGEMRGATAPR
LLLEVVCARLLLPSASDTESALLQRVERIETRLEMSIPASDMPAAARPVE
PAKTFTRRSQVADAPAPAPAPVEIRPEPPAPPVAPPPAPAPPPSPPPVRP
PAEPVVEAPAAAPPPAAGAPNAAAVRSMWTTVREKVRQRSRTIDVMLAGA
IVRTVEGDTLVLSHESAPLAKRLVEQRNSDVIREALKDALGVDWKIRCEA
GGGPAPAVVAEPARPAPVADPPPPEDDEESMLAEAVREEAGPRRDPEEAA
LELLQNELGARRIDGS
119871023YP_940975.1 FAD linked oxidase domain-containing protein [Mycobacterium sp. KMS]MSVAPTDARAAHAEGVERLLASYRAIPQTAAVRLAKPTSNLFRARAKSTV
KGLDVSGLTGVIAVDPDARTADVAGMCTYETLVAATLPYGLAPLVVPQLK
TITLGGAVTGLGIESTSFRNGLPHESVLEMDILTGSGEVLTASRDRHPDL
FHAFPNSYGTLGYSVRLKIELEPVKPFVALRHLRFHSLTELVDAMDRIVE
TGGLDGEPVDYLDGVVFSAEESYLCVGVRTATPGPVSDYTGRQIYYRSIQ
HPAGEKHDRLTIHDYLWRWDTDWFWCSRAFGAQNPKIRRFWPHRYRRSSF
YWKLIGYDQRFDIADRIEIRNGRPPRERVVQDVEVPICRTAEFLAWFLEN
VPIEPIWLCPLRLRDESSWPLYPIRPGHTYVNVGFWSSVPVGPDEGFTNR
LIERKVSELDGHKSLYSDAYYPREEFDELYGGETYKTVKKAYDPDSRLLD
LYAKAVQRR
119871021YP_940973.1 cell wall hydrolase/autolysin [Mycobacterium sp. KMS]MPASLRVGAAIATSLLVAASTFATTTFAAPASAAPANIAGKIVFLDPGHN
GANDASISRQVPTGRGGTKDCQASGTSTEDGYPEHTFAWDTTLRIRQALT
ALGVRTAMSRGNDNALGPCVDERAALANSVRPNAIVSVHADGGPPTGRGF
HVLYSSPPLNEAQAGPAVQFAQVMRDQLSGSGFVPSTYIGSGGLNPRSDI
AGLNLAQYPSILVELGNMKNPADSAVMKTAEGRQRYADAVVRGIAAFLAL
S
119871019YP_940971.1 recombination protein RecR [Mycobacterium sp. KMS]MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRIR
DGVKFCEVCGNVSDADRCRICSDPRRDASLVCVVEEPKDVQAVERTREFR
GRYHVLGGALDPLSGVGPDQLRIRELLNRIGERVDGVDVAEVIIATDPNT
EGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRR
AMA
119871017YP_940969.1 hypothetical protein Mkms_4990 [Mycobacterium sp. KMS]MVTPRGRAALTAGAAARWASRVTGRGAGAMIGGLVAMTLDRSILAQLGKG
RRTVVITGTNGKSTTTRMTAAALGTLGAVATNAEGANMDAGLVAALAADR
DATLAALEVDEMHVPHVSDAVDPSVVVLLNLSRDQLDRVGEINHIERTLR
AGLARHPKAVVVANCDDVLMTSAAYDHPSVVWVAAGGSWANDSVSCPRSG
EVIVRDGADWYSTGIDFKRPTPQWWYDDTHLHGPDGLSLPMTLALPGAVN
RGNAAQAVAAAVTLGVDPRAAVEAVSGVDEVAGRYRTVRLGDHTARVLLA
KNPAGWQEALSMVDKHGAGVVIAVNGQVPDGEDLSWLWDVRFEHFEQVQV
VAAGERGTDLAVRLGYAGVEHTLLHDTLAAIKSCPPGHVEVIANYTAFLQ
LNRRLPHA
119871015YP_940967.1 NADPH-dependent FMN reductase [Mycobacterium sp. KMS]MGNPKPESRTRAAAELVAERLTGSPAEHVIDVVDLGAGLLGWGDPKVAEA
KDIVKSADSLVVASPTFKATYTGLLKLFLDQFGQGELGQVPTFPLMLGGS
LAHALAPELTLRPVLVEIGASCPAPSLYLLDSEYETSPELDRWLEVARRF
VPS
119871013YP_940965.1 XRE family transcriptional regulator [Mycobacterium sp. KMS]MSPSEDSAPLLRNKSGTARERDPQEPVDDTEFEAAIGRNVRQLRQQHGLT
VAEMAERVGISKAMMSKIENAQTSCSLSTLALLAKGFDVPVTTLFRGADV
ERPAAFVKAGTGARIVRNGTKEGHDYQLLGSLRGEHKRLECLEVTLSEKS
RTYPLFQHPGTEFIYMLEGVMDYSHSRSVYRLHPGDSLQIDGEGAHGPVD
LVELPIRFLSVIAFPDSAV
119871011YP_940963.1 glutamate synthase (NADPH) GltB2 subunit [Mycobacterium sp. KMS]MSTWALRESATFDRATIAGIQRAADTGIYDIRGWGAKRALPHFDDLLFLG
ASMSRYPLEGYRERCATDVVLGGRHAKYPLHLDIPVTIAGMSFGALSGQA
KEALGRGASEVGTSTTTGDGGMTPEERGQSKHLVYQYLPSRYGMNPDDLR
KADAIEVVLGQGAKPGGGGMLLGQKISERVASMRTLPEGIDQRSACRHPD
WTGPDDLTIKINELREITDWEKPIYVKVGATRTYYDVKLAVHAGADVVVV
DGMQGGTAATQEVFIEHVGVPTLAAIPQAVQALQELGVHRKAGASGATGD
GSVQLIVSGGIRTGADVAKALALGADAVAIGTAALIALGDNHPRYAAEYE
KIGSAAGFYDDFQDGRDPAGITTQDPELAARLDPVEAGRRLANYLRVLTM
EAQTIARACGKAHVCHLEPEDLVAVSIEAAAMARVPLAGTDWIPGR
119871009YP_940961.1 glutamine amidotransferase- class-II [Mycobacterium sp. KMS]MCGIVGLHLRNPELQPRLGELLTGMLCEMSDRGSDSAGAAVYGDPTWTPP
GHSCVSLLEIGASPESVTDAVGSALGVPVSVTVLDATYLVTAQAESDALL
AAARATFPDALVAGFGEDLAVLKGVGDPYTLTEAWGLSTAQGWQGVGHTR
MATESAVTPSGAHPYAVGSDQCLVHNGSFANHATIRRELRAAGVQFDSEN
DTEVGARFVANELAAGRDVGTALKELCATFDGFYTLLVSNRDSFAVVRDA
IACKPAVIAETSDWVAMASEYRALSGLPGVENAAIWEPEPEVVYAWQR
119871007YP_940959.1 ammonium transporter [Mycobacterium sp. KMS]MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAAV
GLLWVLFGFSMVFGTSYGGFVGSFTEFAGMTDLLEPMTTVDGLPISLFAV
FQALFAAITVALISGAVADRMKFGAWMGFATLWAVLVYFPVAHWVFAFDG
VVTENSVGGWIANTLGAVDFAGGTAVHINAGAAALAVAIVLGKSAMFGQL
RKPHNVPLTLLGAGLLWAGWYAFNGGSALAARNSAAIVMVTTFVATCAAV
LAWLAVEKIKDGHVTGVGAASGAITGLVAITPACGAVTPIGAIFVGGIAG
AVCVYAVGLKTRFGYDDSLDVVGVHLVGGVIGTLLIGFFASEGMPNGVNG
LFYGGGIDQLWKQAVAAGAVMLYSFVVAYVIAFALKKTVGIRVSPDEEEQ
GIDAKFHRESSYDWQPA
119871005YP_940957.1 aspartate kinase [Mycobacterium sp. KMS]MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDL
LDLAKQVCPAPPARELDMLLTAGERISNALVAMAIESLGAQARSFTGSQA
GVVTTGTHGNAKIIDVTPTRLRSALDEGQIVLVAGFQGVSQDTKDVTTLG
RGGSDTTAVAVAAALNADVCEIYTDVDGVYTADPRIVPNARKLDTVSFEE
MLEMAACGAKVLMLRCVEYARRYDLPIHVRSSYSDKPGTIVKGSIEDIAM
EDAILTGVAHDRSESKVTVVGLPDVPGYAAKVFRAVADADVNIDMVLQNI
SKIEDGKTDITFTCARDNAPGAVEKLTSLQDEIGFTRVLYDDHIGKVSLI
GAGMRSHPGVTATFCEALAEVGVNIDLISTSEIRISVLVKDTELDKAVAA
LHEAFGLGGDEEAVVYAGTGR
119871003YP_940955.1 hypothetical protein Mkms_4976 [Mycobacterium sp. KMS]MIAAAVLAAALCVPAAQAQPPTPVPGPVLPPLAPGQVVRLGPTAGTGTPT
RDYGIGATDLCEFMEFPSGILQVCGDSFAGQGVGFGGWYSPVALHVETDS
ILDPAGVRYDRVTGVDAPLLADPTPAGSSQLPAGVVQINRENYMLVTTTR
DLRPQSSRLVKAEAGQGGWRTVPGSERDAGHAEGRQSQISGYYDPIPTVD
SPSGWVYIVADNFDRSGPVVLYRVAPQMFTDRDEWQGWSVERGWGHEPTP
LWVDRVGEMSVRQIDGKTVLSYFNASTGNMEIRVADNPIGLGDAPVTTVV
VAEDWPDQAEFLPPPEVNRLAQPYGGYISPGSTLDEVRVFVSQWNTTPLG
DNAPYRVIQFAVNPFKPGQPVPWPPR
119871001YP_940953.1 ferric uptake regulator family protein [Mycobacterium sp. KMS]MREALGKVSTQAIYDVLRACVSAGLVRRIEPAGSSARYETRIGDNHHHLV
CRRCGRVADVDCIVGAAPCLDHAPLEDGFTVDEAEVVFWGTCADCRAEPP
AAGASCRL
119870999YP_940951.1 hypothetical protein Mkms_4972 [Mycobacterium sp. KMS]MRLLVGVAAAGLVLAAAPLAQARPSDPGVVNYAVLGKGSVGNIVGATLRW
ESFFTNPVQAFYVDNPVCNNWADIGLPEVYNDPDLASFNGAVAQESPTDA
THLVKQAIGVYATTDAAERAYRRVVDRTAGCAGQTTAMHLDNFTTQVWTF
TGGPAGVADADWVKQEAGTDRRCFTTTRKRENVLLQAKVCQSGNGGPAVN
VLAGAMQNTLGQ
119870997YP_940949.1 hypothetical protein Mkms_4970 [Mycobacterium sp. KMS]MTARDTLADELGRARDRTLRLVDFDDMELRRQYDPLMSPLVWDLAHIGQQ
EEFWLLRDGNADRPGMLAPGVERLYDAFVNSRATRVNLPLLPPTDARAYC
RTVRDKVLDSLDALPDDDAENAFRFALVISHENQHDETMLQALNLRTGAP
LLEAGAALPAGRSGVAGTAVSVPGGPFVLGVDAVTEPHSLDNERPAHIVD
VPGFRIGRVPVTNGEWQQFVDDGGYSQRQWWSAAGWAHRQEAGLTAPQFW
NGDGTRTRFGHVEQIPADEPVQHVTFFEAEAYARWAGARLPTEIEWEKAC
AWDPAAGQRRRYPWGSSAPTAHLANLGGDALRPAPVGAYPAGASAYGAEQ
MLGDVWEWTTSTLRPWPGFTPMIYDRYSQPFFDGTGSGDYRVLRGGSWAV
APEILRPSFRNWDHPIRRQIFSGVRLAWSDEQVGVA
119870995YP_940947.1 hypothetical protein Mkms_4968 [Mycobacterium sp. KMS]MTFTLATYLADDAAAQALRRDVRDGLTANPKTLPPKWFYDSVGSDLFDQI
TRLPEYYPTRAEAAILRDRSGEIAAVTGADTLVELGSGTSEKTRMLLSAL
REHGTLRRFVPFDVDASVLQNAGAALAEEYAGLEIEAVCGDFEEHLGKIP
QGGRRVIAFLGSTIGNLTAAPRASFLAALADTMAPGDALLLGTDLIKDTD
RLVSAYDDSQGVTARFNRNVLAVVNRELDADFDIGAFAHVARWNAGEQRI
EMWLRATDPQQVRVGALDLSVEFAGGEEMLTEVSCKFAPDDVAAELAAAG
LRRTHFWTDPAGDFGLSLAVK
119870993YP_940945.1 type 12 methyltransferase [Mycobacterium sp. KMS]MTSDVMNWDDAYRSAGSFEGPPPWNIGEPQPELAALHREGRFRSPVLDAG
CGHAELSLALAADGYTVVGMDISPTAIAAADRAAQERSLATASFVQVDIT
SFTGYDGRFNTVVDSTLFHSLPVEGRDGYLSSVHRAAAPGAQLFILVFAK
GAFPPDLEVKPHEVDEDELRAAVSRYWEIDDVRPAFIHANALAMPDLPAE
LPHGPDEKNRVKFPAFLLTAHKPEHDS
119870991YP_940943.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MTIADPPIAPGPDATDDRRVRTALLSSLVGTTIEWYDFFLYATAASLVFN
QAFFPDQSSFVGTMLSFATFAVGFVVRPIGGFVFGHIGDRIGRKRTLALT
MFLMGGATALMGVLPTAAQIGVLAPILLLLLRIAQGFALGGEWAGAVLLA
VEHSSAKRRGFSGSVPQIGLALGLALGTGVFALLQVVLPDDAFLSYGWRI
AFLVSVVLVIFGVVVRLKAEETPAFEKVRDDDQRSAVPVKEIFRPPVLKS
TVLGMLSRWGEGAAFNTWGVFAISYATATLHFEKVPVLIVVTASALLMAV
LLPVSGLLVDRFGAKRVYGTGIAAYAVAVFPVFALFNTGSMVTYTVGMVV
VFGVIHAWFYGAQGTLYASLFPTRIRYTGLSTVYQLSGVYSSGLTPLILT
ALIAAAGNTPWLACGYLVVTAVISVVATALLRPRALAEL
119870989YP_940941.1 glycerol kinase [Mycobacterium sp. KMS]MRESALAEFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWVE
HNPVEIWERTASVLMSALNRTDLSAGDLCALGITNQRETALVWNRRTGRP
YYNAIVWQDTRTDRIATALDRDGRGDVIRRKAGLPPATYFSAGKVQWILD
NVDGVREAADKGDAIFGTADSWVVWNLTGGPRGGVHVTDVTNASRTMLMD
LETLDWDDELLSFFGIPRQMMPEIKPSSCPDCHGVTREDGPLGGEVPIAG
ILGDQQAAMVGQVCLSAGEAKNTYGTGNFLLLNTGEKIVRSENGLLTTVC
YQFGDAKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNG
GVYFVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHVARATLEAICYQSRD
VVDAMEADSGVHLEVLKVDGGITVNDLCMQIQADVLGVDVVRPVVAETTA
LGAGYAAGLAVGFWDGADDLRRNWQEDKRWTPQWSDDQRAEGYAGWQKAV
QRTLDWVDVE
119870987YP_940939.1 PadR family transcriptional regulator [Mycobacterium sp. KMS]MSNPFTPPGPFGFGPVDRRRQARREFRDHLREHSASGPGFGRGPGRGPGF
EFGFDPRGGFGFGPGPRGRRGGGRGRGRRGDVRAAILTLLGERPMHGYEM
IQEIAERSDGLWKPSPGSVYPTLQLLVDEGLIVGTESEGSKKLFELTDDG
RAAAAKIETPPWEQITDDAGPGHADLRSAVGQLVGAVAQSSYAASEEQQA
RILEIVNNARREIYGVLGEE
119870985YP_940937.1 cytosine/purines uracil thiamine allantoin permease [Mycobacterium sp.MTDTRDLPPSAVVGAGDIVEAAGHPVGSGVIKDSYDPRLTNEDLAPLGKQ
TWSSYNIFAFWMSDVHSVGGYVTAGSLFALGLASWQVLIALLVGIVIVNL
LCNLVAKPSQQAGVPYPVVCRSSFGVLGANIPAIIRGLIAVAWYGIQTYL
ASAALDVVLLKLFPGLAPYADADQYGFTGLSLLGWCSFMLLWVLQACVFW
RGMESIRKFIDFCGPAVYVVMFILCGYLLWKSGWHVSLSLGGEKQGNTLV
VMLGAIALVVSYFSGPMLNFGDFARYGKSFEAVKKGNFLGLPINFLMFSI
LVVVTAAATVPVFGELLTDPVETVARIDSVTAIVLGALTFSIATIGINIV
ANFISPAFDFSNVSPQRISWRMGGMIAAVGSVLLTPWNLYSNPEVIHYTL
ETLGAFIGPLFGVLIADFYLVRKQKIVVDDLFTMSETANYWYRRGYNPAA
VTATLVGAVLAMAPVLLGGVVLGMAGAAQYSWFIGCGVAFALYYVLATRG
PWRMTALRVAEGATLVSN
119870983YP_940935.1 carotenoid oxygenase [Mycobacterium sp. KMS]MTETDHARDAVSADNLPSGGEFFHKGNYAPVADELTAFDLPVEGQIPADL
QGWYLRNGPNPRQPSAHWFTGDGMIHGVRIENGRAAWYRNRWVRTESFEQ
HFPVYNSDGSRNLHSSVANTHVVNHAGKTLALVESSLPYEITNDLQTVGA
YDFGGKLVDSMTAHPKICPTTGELHFFGYGNLFEPYVTYHRAAADGELTV
NRPLDVKALTMMHDFAMTSGHVVFMDLPIVFDMGIALEGKGDMPYRWDDD
YGARLGVLRRDDPFGEVRWFDIDPCYVFHVANAYEDGNTLVLQAVRYPEL
WRGTGGFEAEGVLWSWTLDLVTGTVRERQLDDRAVEFPRIDDRLAGLAAR
YAVSVGDQRLVRYDLTSGTAVEHAFGTADAPGGPGEAVFVPATSGPVDEQ
NGWYMAYVYDPQRDGSDLVILDAADFAGQPVARIKLPQRVPYGFHGNWIT
G
119870981YP_940933.1 pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing proteiMTRTTVDGNEAVASVAYRLNEVCCIYPITPSSPMAELADEWSGHRRPNVW
GTVPTVVEMQSEGGAAGALHGALQGGALATTFTSSQGLLLMIPNMYKIAG
ELTSAVIHVAARSLAAQGLSIFGDHSDVMAVRQTGFAMLAAASVQEAHDL
ALIAQAVTLRTRVPVLHFFDGFRTSHELNTVELLDDDDLRALVPEGLIRE
HRRRGLSPEHPVIRGTAQNPDIYFQARETVNPFYARVPAVVADLMAELGG
RTGRPLRIADYTGHPEAERVLVLMGSGAQTAAETAGVLTARGERVGVLQL
RMYRPFPVEALAAALPETVRTVGVLDRTKEPGSVGEPLYLDVLGALAEAH
ADGVLRTMPRVCGGRYGLSSKEFTPAMVVGVFDELARQRPRTHFTVGIDD
DVSHTSIGYDPAFDIESPDTVRAVFFGVGSDGTVGANKNTIKILGSDPGV
HAQGYFVYDSKKSGSQTVSHLRFGPHPIRAPYLVTRAGFIGCHHWRFLET
ADVLGRAAHGAALLLNTRHGPDAVWDRLPRAVQQQILDKDIALYVVDAGR
VAREVGLPGRINVVLQTCFFAISGVLPRDQAIAKIKEAVTKTYAGQGADV
VAREVAAVDRAVDDLHRVPIADRAPSGHEPAPIVPADAPEFVRTVTAEMI
AGRGDALPVSALPADGTYPSGTAAYEKRNISDLAAVWDPDTCIQCGNCAF
VCPHSVIRTKLYDADRLDGAPGAFASAPLNAVGLPESRYTLQVYVEDCTG
CGLCVEACPAVAPGIPLTKAINLGPREPLVAEQRENVAFFEALPDADRAR
VDFGTVRGAQFLEPLFEFPGACAGCGETPYLKLLSQLFGDRMMIANATGC
SSIYGGNLPTTPWTTDGDGRGPAWSNSLFEDNAEFGLGFRLAADTHTRQA
RRMLGESREVLGADLVEDILTAPQFRESELHAQRRRVAELHTRLDRLEPA
RADELRSVLDHLVRRSVWIVGGDGWAYDIGAGGLDHVLASGRNVNVLVLD
TEVYSNTGGQMSKSTPLGAVAKFAATGKTTPRKDIALQAIAYGSVYVARV
AMGADPQQTLQAFREAEAYDGPSIVIAYSHCIAHGFDLRHGLDQQYRAVN
SGHWPLMRYDPLLRAAGRAPFLLDSHRPRIPLGDYRYRELRFQSLANADP
DEAERLLGLAQQSVARRWDTYEQMAAASPHEFPSDARKGGD
119870979YP_940931.1 RDD domain-containing protein [Mycobacterium sp. KMS]MVSQPEPVVTGDAVVLDVQIAQLPIRALSAMVDILVIFVGYTLGLVLWAL
TLSDFDTALSAAVLIIFTVLTLVGYPLVFETATRGRTLGKMALGLRVVSD
DGGPERFRQALFRALAGFIELWMLAGGPAAVCSLLSPKGKRIGDIFAGTV
VISERAPRMSPPPVMPPALAWWAGTLELSGLNGEQAERARQFLSRAHQLE
PRLRDEMAYRIAGEVVSRISPPPPPGTPPQYVLAAVLAERHRRALARLVP
TPPAYPGLTPPR
119870977YP_940929.1 hypothetical protein Mkms_4950 [Mycobacterium sp. KMS]MVLTGRAALIALLCVLPIAVAPAPGVAFVALFGALVLAIVADIALAASPR
RLQVTRSGDTAARLGQSVDSVLDVHNPVRRRIRGSLRDAWPPSAHGAPRT
HELDVPAGQRVTLRTSLRPTRRGDLRSALVTARSIGPLGLAGRQASHRVS
GQIRVLPPFLSRKHLPSRLARLRELDGSTPALIRGQGTEFDSLREYVVGD
DVRSIDWRATARRADVVVRTWRPERDQRIVIVLDTGRTSAGRVGVDPTAA
RSPAPPAAQHPGGWPRLDWSMDAALLLAALAARAGDHVDFLAHDRVTRAG
VFNASRSELLAQLVSAMAPLQPALVESDPAAMASAIQRRVRRRALVVLLT
DLNASALEEGLITVLPRLAARHHVLIAAVTDPRVDLLAAGRDDAAAVYDA
AAAERSRNDRNRIAGTLRQAGVDVVDAPPEELAPALADRYLHMKATGRL
119870975YP_940927.1 hypothetical protein Mkms_4948 [Mycobacterium sp. KMS]MVLALLVIIAVATVGTLLTASRPGAPMDPQSTSPDGVRALVTLLRDRGVE
VVEADSVADVEGAARGSQPGDTLIVFAETFRLTDDEQLRRLADLPADRLL
LEPVSRVREALAPQLRSDGVSSFAPQPDCDLREANRAGDAQLGLAPSYRA
AEPGLALTRCYDGALVRYTEAGRTNTVVGTSGFMTNAGLLKQGNAALAMN
LAGSAPRVIWFVPQEREGAGGTASLSDLIPDQVGWIVLQLSLAVALLAIW
QGRRLGPLVAEQLPVVIRASETVEGRGRLYRSRRARDRAADALRTATRTR
LLPRLGLPANAQPPAVVQAVAQRTGADPQGVAHALYGPAPTTDADLVTIA
HQLDDIERQVTHS
119870973YP_940925.1 hypothetical protein Mkms_4946 [Mycobacterium sp. KMS]MVPMSNDAGGPGRGYPPPGYQQGYPPPGYQQGYPPPGYQQGYPPPGYQHG
YPPPGYQHGYPPPGYPPQQGYAPPDVIKPGVIPLRPLGLSDIFNGAVNYI
RRNPKATLGLTAIVVVAAQLISLVLQILGPLIATGDLDPTLSGEAGAGDV
AVLSGSSLAGSITTALASVVLSGMLTVIVGRAVFGADITIGEAWQRVKGR
LLALLGFTALEAVAVLLLIVVVVVAIIAAEAIGGGVAAFLVGAPLVIAAF
LLIVYVATSLVFTPALIVLERLGIVEAAGRSFTLVKRDFWRVLGIWILAA
LAAAVIAGAVGVPFSLGGQLLAGSGSDGGVLVGLILIAVGAAIGQILTAP
FSAGVIVLLYTDRRIRAEAFDLVLHTGAAAGPGVPADSTDHLWLTRRP
119870971YP_940923.1 luciferase family protein [Mycobacterium sp. KMS]MTLTRFGYALMTEQSGPKDLVRYAAAAENVGFDFEVSSDHYSPWLAAQGH
APSAWTTLGAVAHVTERVELFTYVTCPTMRYHPAIVAQQAATLQILADGR
FTLGLGTGENLNEHVVGKGWPTVARRQDMLREAIQIIRELFTGEVVDWRG
EYFEIDSARLWDLPETPVDIAAAVSGDRSVEAFAQLADHLIAVEPNKDLV
HAWHDARRATGLPGHVRVIGQIPICWDPDREAAVARAHEQFRWFAGGWAV
NADLPTTAGFAGATQFVRPEDTAGSIPCGPDLDAIVEAVSEYWKAGFTDI
ALVQVGDEGQDRFLDEAAGPLLEKLRAAAG
119870969YP_940921.1 hypothetical protein Mkms_4942 [Mycobacterium sp. KMS]MPCIAVVKPAHPVCARVRAGTRSGVNVSDLLALPVEVGAAVRRRRLFHPA
GVLARGRIERVAPPGQGLPIETGDVIGRVSKAVGLPGSVPDIAGVAWRMT
KDSGPWDILLATTAINRFMLLPTTSWDNTTYSSLMPLRYEGVWWVRAHLT
TKLDGPGLSLDTVTDQLARGDLDFSVDQAAGTGEFGPLARLTLSEVIPPD
KDLSFDPTLNTAPGVSLAPGWLTDFRRAAYRRSREGRDAQ
119870967YP_940919.1 zinc finger CDGSH-type domain-containing protein [Mycobacterium sp. KMMTEPRTVRVVQGGPIMVEGPVRIEMPDGSIVESDRFMVAICACKRSKTYP
LCDTSHRRRRRGDADAAESSGQRSA
119870965YP_940917.1 acyl-CoA thioesterase [Mycobacterium sp. KMS]MMTALRDTSWPHDASWIARLLEFDRDGDTFLAPQVTSGPAHRLFGGLIAA
QALGAAGATVDPDKRAQSLHAYFVRGGKYGIDVELEVERTRDGRSFDTRR
VTAIQEGKAILEMIASFHRPEDSADWHPARPPALAFEDAVPKAPDLEAVD
RLEVRCHPDDLSPFAIPPFWIRSRDVIEDDPLIRACMLTYMSDLGPVPAA
RPAGAPDEPGAGMAASLDHSVWFHRPFDPHRWHRYEVTGVNNSDARGLAV
GSLYDDAGALIASTTQEALWRF
119870963YP_940915.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVSTAERDDSAGPRRAYGGQSADVRRRQRRARLLDAAMDAMARNEWRTAT
VGKVCAAAGLNKRYFYESFADLDALAAAVVDDVAESVRTATVHAADSVTQ
DSVDALAFAAVAAACTHWSTTLAAPGSCWAVCPPRRNCTPTGRR
119870961YP_940913.1 transposase- mutator type [Mycobacterium sp. KMS]MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWG
QPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAE
SALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQ
FRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVL
GMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGA
AWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAERLNKEIRRR
TDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITN
DNPEIGADDMPALTA
119870959YP_940911.1 protein kinase [Mycobacterium sp. KMS]MPSEPNIPSLERSRPLRLAFECLQTLPEGSNPVRVWWDENLQCEQVGKRV
DLSNLDDVLPEPAILRQIRHDHVVPILAAPVVDGFPQPMRVIEIVTPYYK
RGSLTDAFIRGERFGPTETVRIVQAALRGLGHLHEVHGILHRDIKSPNIL
LTEDEFLARVGDLGCAGRIGEDGRTPALDIPTLYSPPELVGTGILTRASD
LYPMGLVLLELLKGGFDYDAYPKSDVVRRLLRGVSPLSMAERSHPIWASR
SLRRILNKSLHSVPGQRFQTASEMDNALSRARVIDWAETDTLRWEAPFRH
HRGRRVRVEAVQRRKGGFRLSTQINSGNGWRRYGLADLDVEALDSSRARS
LFDQATDRAIVR
119870957YP_940909.1 hypothetical protein Mkms_4930 [Mycobacterium sp. KMS]MALTTSLAGRVRNTSLPKSHALLPLLEAIVNSIQSIDARPKDPNRPGRVD
VKVHRDAQAEFDFGAAGPGRAPMKPIVGFTVKDDGVGFTSANLSSFETLD
SDYKSDLGCRGVGRLLWLKAFDRVSVRSTYEDETGTLRGRQFRFSIDREV
EDDGDTDGFTQPGAEVHLDGFKKTFQQYAPKGVDAIAREVLEHCIWYFLR
PGGAPVVVVADDDEAVSLADLMDEFVDSKMSSSTIEVEGQRFDMLNLRLK
PSARTSVPRLHWCAASRVVIEENLNGKVPGLHGRLKDGESGEFVYACYLT
SGYLDERVRSDRTAFDIADRIEGDQLGDDLALDDIRAAVLQEIGNMLKEP
LDSARTQGKQRVHDFVSTRAPRYRPVLARIEERGITVDPSVKDQDLELQL
HGHLQKIEAEAFVQGQQISAEADSEPAEDYAERLAAYLSTVSEINQSDLA
AYVSRRRTVLDLLARLIRADTDGKYSREDAIHSLIIPMRTESNDIATDAS
NLWIIDERLAFHDYLASDKTLKSMPITGDESTKEPDILATRLVDSPVLAA
EGERLPLPSIVVVEIKRPMRKDATEDKNPIQQCLDYVKRVRAGGVLTATG
RPIPPTQDPPAFCYIVADLTDKMIERCEVSNLRPTHDGLGYFGFNDNAKA
YIEVMSFDGLVNAATERNRAFFDKLGLPSS
119870955YP_940907.1 hypothetical protein Mkms_4928 [Mycobacterium sp. KMS]MYTQWIEDCVVQRVSVRDGLVLDLDDYNEVVISRPLLLTLPAAGRFPTEA
VLINPLRISVHERPLLNLAGAVCTQAWSGDDGGLHLAFSRGHRIDVDPDE
QVTAWELYGKRHGYMACLPQGRVRVVRHDIPDDDDANIVNRR
119870953YP_940905.1 thioesterase superfamily protein [Mycobacterium sp. KMS]MPETAVPSERLPSHTPTCMGCGPANPHGLHLEVHRSADSVYADVTFDERH
IGAPGLAHGGAVAAACDDVLGFTLWIASTPAVTRTLTVEYLQPVPLHQPH
RITAHISAREGRALHIAATGTCEGVTRFTASAVFVVVDTAHFAAHGDVSG
FGEIFEQLSRRSGVNGQTP
119870951YP_940903.1 hypothetical protein Mkms_4924 [Mycobacterium sp. KMS]MGPMPHQLGAPRSLAEQRLPIVGDMASRPSNESRPVAVHPAAPDEHLLDA
KYADFAATFNADVADAERHAARDNYTGRREGAPSVDD
119870949YP_940901.1 hypothetical protein Mkms_4922 [Mycobacterium sp. KMS]MERLDLQPATAWGEIAAAGVAGADASVVEPAGPVATGRLSIIDAAAGLAD
FTSVAAQRGHAAGLLLRVEALSATAAAAVNSLVVIDKSNAAQLRAVVE
119870947YP_940899.1 hypothetical protein Mkms_4920 [Mycobacterium sp. KMS]MAASLPARTYSRFIVAPDVWPTTREESEGRAAAQRHLATATAAAVDAHRV
ALHGLQAAGVAQSSGFEAMHAAYRRIQVRADDKAEADGAAADLMQSVAAI
QMSAELMIDTIDAEAHQQLVHVPSRSPIAIGIITGAAARTRATAVGAADE
IRALTVQFGQRFAPLPEGPPSGDPVGAGDDDRSTDKRSDESPERPPDAVV
ETGGTQTRHSAPDPPDANLSSGNNAPRVSTGPTPGSSSVSSQLSAQGTGP
AYGAAVADIGSSGACLTGTGPWSSAGSMAALGGSASSLSGSGAGGMSHAG
SVRPSASASSPSAVALQGVMHASAPAPLSSVAGTQTTTPAPFPAAASAAM
QAPSPSGTSQPPIAATTGAVPVSIAGPQAVSSGGPHSPVAASLLPPGPLG
PPPSASAAIAPATGAGPSVGGAHASMTPATASIAAAALTTPAATLPSRVA
AAAARDLERQRNESSDLQMVKRLAWELLYATETCRSFALWAVGLMYSATG
DRLIVALTHHGAGYVPAGVEIRRGVRMLWSDQAIGEGFRSRWTGNLDPAA
TLAAYAELKAAEPAGWRLAAAATTWSEVAALMTAAQRWGTEWATCSGMSM
PASIEKLAAISDEDAPHRLEREFPELFERVAQLRARGLTHRAARLITEAI
VSDARLAIVTADAPRIPSNFDSVWPVAADGRIDAADRAQFAEAVQQQWFS
IGMVQPGWDDEPTGSACTEYRAQWLICRALEVVLGWIADGNSGAVPADLP
MEDMIYAAAHAYLDGRGTGWITDLFDAAGA
119870945YP_940897.1 putative ATP-binding protein [Mycobacterium sp. KMS]MDEILSTDGVRRYTSRANHLSADSLSSDPFMEQLRSRTREPLVGQSGGDL
LTLLTPVDDNWRRPRDWPKNGRDVSGLLRRHAPALRTLGWVVEDDGARNH
RNVLQWTIYPPYKDLVAHRTSQSSRAALTQIGGNANATGNFQKAPEAGTT
AGDGVTAEAS
119870943YP_940895.1 putative ATP-binding protein [Mycobacterium sp. KMS]MSGRGESDKKSVAARLVDMARERYLLGVSEDGEPFGAERNRPHLAMLLRG
GRAGLRADLAARYFTETGAVAGGQALTDATLILEGLAATQAPEKLYLRVA
DHNGTSYIDTGDPDGHVIKIRDGRWSIASAAPVRFLRNKKLTGAMTAPHS
DGDVTRLWEFVNVAVEDRPVLLAFLVAALVQCDVPHPVLALFAEQGSAKT
TTTRNLVELIDPSPAPFRQAPRDADSWATAASGSWVVALDNLSGIPPWLS
DSLCRAATGDATVKRSLYTDADLAVIKFRRCVIINGIDVGAIRPDLAERL
AIVELRRIDRSMRQSEAEMRQRWEAALPGIFGGLLNLAATVHYLLETISV
EDPPRMADFCRTLAAVGSSPGKWCSAA
119870941YP_940893.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium spMTGRSSIATHSQPRAWVDNAVRLIEADARRSADTHLLRYPLPSAWGEDCD
VALYLKDESTHITGSLKHRLARSLFLYGLCNGWICEGTTVIEASSGSTAV
SEAYFAALLGLPFIAVMTSSTSASKVALIESQGGRCHFVEESSQVYAEAE
RLAQETGGHYLDQFTNAERATDWRGNNNIAESIYHQMAAEQHPIPEWIVV
GAGTGGTSATIGRYIRYRRYATRLCVVDPENSAFFPAYAQQDPTIVTGAS
SRIEGIGRPRVEPSFLPEVVDRMVAVLDGASVAAARHASRVLGRRVGPST
GTNLWGAFGLLAEMKAQGRSGSVVTLIADSGDRYADTYFCDEWLSSQGID
PSESAEVLADFERSGVWR
119870939YP_940891.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MPERPPTAVTVVKLAWCCLLASVLAAALMFPVVGGIGLMSNRASDVVANG
SAALVEGEIPQVSTMVDAKGNTIAWLYSQRRFEVPSEQIANTMKLAIVSI
EDKRFAEHNGVDWQGTLTGLAGYLRGDTDTRGGSTLEQQYVKNYQLLVVA
QTDSEKRAAIETTPARKLREIRMALTLDKTFTKPEILTRYLNLVSFGNGA
FGIQDAAQTYFGVNASELNWQQSALLAGLVQSTSTLNPYTNPDGALARRN
LVLDTMIENLPNEAEALRAAKNEPLGVLPVPNELPRGCIAAGDRAFFCDY
ALEYLARAGISKEQVAKGGYLIKTTLDPDVQGPVKSAVDNFADPTTPGVA
SVMSVIRPGKESHPVLAMASNRTYGLNLDAYETMQPQPFTLAGNGAGSVF
KIFTTAAAMEMGMGINTQLQVPGSFQAKGLGSSDRPGCPAATWCVSNAGG
YRGSMNVTDALATSPNTAFAKLISQVGVPRAVDMSVRLGLRSYALPGTAR
DYDPESNESLADFVKRQNIGSFTLGPIEVNGLELSNVAATLASGGVWCPP
NPIAQVLDRKGEEVSVTTETCEQAVPEGLANTLANAMSKDDTGAGTAAGA
AGSVGWDLPMSGKTGTTESNRSSAFLGFTNQLAAANYIYDDSPTPGELCS
FPLRQCGSGNLFGGNEPARTWFTAMKPIATNFGPVALPPTDPRYVDGGPG
SQVPSVSGLTVDAARQRIKDAGFQVADGTSSVNSGSRAGTVVGTNPSGQT
IPGSIVTIQVSNGIAPAPPPPTYSVPSLPGLPGGPPPPIGQTVVEIPGLP
PITVPVLGPPPPPPPP
119870937YP_940889.1 anion-transporting ATPase [Mycobacterium sp. KMS]MSTTPPALDMAAILNDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRTV
VVLTIDPAKRLAQALGIKDLGNTPQRVPLAPEVTGELHAMMLDMRRTFDE
MVIQYSGPDRADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLAQDKWDL
IVVDTPPSRNALDFLDAPKRLGSFMDSRLWRMLLAPGRGIGKLVTGAVGL
AMKAMSTILGSQMLSDAAGFVQSLDATFGGFREKADRTYDLLKRRGTQFV
VVSAAEPDALREASFFVDRLSSERMPLAGLILNRTHPTLCSLHAEKASEV
ADALAEKDPESLTVAALRIHADRTQTAKREVRLLSRFTGANPHVAIVGVP
SLPFDVSDLDALRAIADQITGTASAA
119870935YP_940887.1 hypothetical protein Mkms_4907 [Mycobacterium sp. KMS]MLAVGPPPPDKLSAMSQPTQWEYATVPLLTHATKQILDQWGADGWELVAV
LPGPTGEQHVAYLKRPK
119870933YP_940885.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MSAPEHPAYGLLRPVTETASVLLCNNPGLMTLDGTNTWVLRAPGSDELVI
VDPGPDDDEHIAKVAELGRIALVLISHKHEDHTGGIDKIVDRTGAVVRSV
GSGFLRGLGGPLTDGEVIDAAGLRIVVMATPGHTADSLSFVLDDAVLTAD
TVLGRGTTVIDTEDGSLRDYLESLHRLQGLGRRTVLPGHGPDLPDLEAVT
AMYLTHREERLEQVRAALRELGDDATARQVVEHVYTDVDEKLWDAAEKSV
EAQLDYLRT
119870931YP_940883.1 hypothetical protein Mkms_4903 [Mycobacterium sp. KMS]MSWLFVGFIPWLLMVATFGLERLESGLARNTVSASDVDDFLLRAEAEREH
RQQTRLEPVETLPTRTTGAEVPARVYIPHRPNPQFQPTRHANRV
119870929YP_940881.1 redoxin domain-containing protein [Mycobacterium sp. KMS]MSTSTRWTVAVLAVVLALVVALSMQLAEDPAPTRRDGPAPARDHRDADTP
EALAGPRAEADLPPCPPPGVGAGPESLRGITLECAGDGQMVDVARSLAGR
TVVLNLWAYWCGPCADELPAMAEYQRRVGDAVTVVTVHQDENETAGLLRL
AELGVRLPTLQDGRRLIAAAVKAPNVMPATVVLRADGSVAGIVPRSFATA
DEIEEAVDQTMGESG
119870927YP_940879.1 colicin V production protein [Mycobacterium sp. KMS]MTPSQWLDFLVLAVAFVAAVSGWRSGALGSLMSFIGVVLGAVAGVLLAPH
VVTHISGPRTKLFAALFLILALVVIGEIAGVVLGRAVRGAIRNRTLRLFD
SVVGVGLQIGAVLLASWLLATPLTSSDQPSLAAAVKGSRVLAEVDDVAPP
WLKSVPTRLSGLLDTSGLPEVLEPFGRTPIATVDAPDAALATDAVVGATR
GSVVKIRGVAPGCQKVLEGTGFVVSPNRVMSNAHVVAGSESVTVEVDGQT
YDAFVVSYDPNADISILDVPDLPAAPLPFVDELAPPGTDAIVMGYPGGGD
FTATPARIRETIELNGPDIYRKTTVTREVYTIRGTVRQGNSGGPMINRGG
KVLGVVFGAAVDDADTGFVLTSDEVGAQLAKVGNTARVPTGVCVS
119870925YP_940877.1 hypothetical protein Mkms_4897 [Mycobacterium sp. KMS]MSRGDRKNGVPTTVTSIPLVDPHAPKPDPSIGDLVKDATSQVSTLVRAEV
ELAKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFAAELLDTWLWRW
ASFLIVFGVMVLVTALLALLGYLKVRRIRGPQKTIESVKETREALTPGHD
KAPKAVAITDGQKTGDPSGW
119870923YP_940875.1 acetyl-CoA synthetase [Mycobacterium sp. KMS]MTTLTPMSDVHTEVPSSYPPPAEFAEQANAKAEMYREAEEDRLAFWAKQA
ERLSWDTPFTEVLDWSDAPFAKWFVGGKINVAYNCVDRHVEAGNGDRVAI
HWEGEPVGDSRSLTYAELKDEVCKAANALTDLGLTAGDRAAIYMPMVPEA
IVAMLACARLGVLHSVVFAGFSASALKARIEDAEAKLVITTDGQYRRGKA
ASLKDAVDEAVDGQPSIEHVLVVRRTGIDVKWTDGRDLWWHETVDGASTE
HTPEAFDSEHPLFLLYTSGTTGKPKGIVHTTGGYLVQSSYTHHNVFDVKP
DTDVYWCTADIGWVTGHTYITYGPLSNGVTQVVYEGTPTSPSEHRHFEVI
EKYGVTIYYTAPTLVRTFMKLGRAVPDAHDLSSLRLLGSVGEPINPEAWR
WYRNVFGDNNIPVVDTWWQTETGAIMISPLPGVTAAKPGSAMTPLPGISA
KIVDDDGNQLPPGSDHGEQANGYLVLDQPWPAMLRGIWGDPQRFKETYWS
RFAEQGWYFAGDGARYDADGNIWVLGRIDDVMNISGHRISTAEVESALVG
HSHVAEAAVVGATDDHTGQAICAFVILESSAADKPHEHMVEELRAEVAKE
ISPIARPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPGVF
EAIRASKAEV
119870921YP_940873.1 HAD family hydrolase [Mycobacterium sp. KMS]MSASEQDAASPSEQSAASPADHPVRTAAFFDLDKTVIAKSSTLAFSKPFF
DQGLLNRRAVLKSTYAQFFFLMSGADHDQMDRMRSYVTNMCTGWDVEQIK
SIVNETLHDIVDPLVFAEAADLIADHKLCGRDVVVVSASGEEIVAPIARG
LGATHAMATRMVVEDGRYTGEIAFYCYGEGKVEAIRALAAREGYALEHCY
AYSDSITDLPMLEAVGHPTVVNPDRALRKEATARGWPVLTFTRPVSLRDR
IPAPSGAAVATTAAVGMSALAAGALTYSLLRRFAL
119870919YP_940871.1 type II secretion system protein E [Mycobacterium sp. KMS]MTSSLIDRVRERLAAESSPLHPAVVAAAIRAESGGVLGDTEVLTNLRALQ
TELTGAGPLEPLLCADGTTDVLVTAPDAVWIDDGKGLRRTTVRFADEGAV
RRLAQRLALAAGRRLDEAQPWVDGQLHGLGAGGFTVRLHAVLPPVAAAGT
CLSLRVLRPATQDLPALVAAGTIVEDASALLRDVIDARLAFLVSGGTGAG
KTTLLAAALGAVAGDERIVCVEDAAELAPQHPHVVKLVARGANVEGVGEV
TVRDLVRQALRMRPDRIVVGEVRGAEVVDLLAALNTGHDGGAGTVHANNP
AEVPARMEALGAVGGLNRGALHSQLAAAVQVLLHVARDRTGARRLTQIAV
LQPHDDGCVRVVPAWQIDRGFDAGAADLRRLVSSRRAR
119870917YP_940869.1 type II secretion system protein [Mycobacterium sp. KMS]MSVAAALLALALLLTGRDGGVRMARLRTAGRRTPGPTERGGADPLAAAST
FDVLAACLTSGMAVSSAASAAAASAPPGLAAILARAADMLALGADAATAW
SDPGTPLDDHARALMRLARRSAESGTALAQGVADLAAESRSDAADAARAT
AERAGVLIAAPLGVCYLPAFLCLGIVPVVVGLAGDVLQSGLW
119870915YP_940867.1 hypothetical protein Mkms_4887 [Mycobacterium sp. KMS]MAVLIAVTGGLTQVGSAVVARHRAQAAADLAALAAAARVASGARSACAQA
ALVARAMDTTVTDCAADGLEVVVHVEAGVGSGAWRLGPAHAAARGGPVLL
R
119870913YP_940865.1 DEAD/DEAH box helicase [Mycobacterium sp. KMS]MSDFGRELLSCAVAGVVADEHPLRHVADLPARPGQPESWPQWAHPDVVRA
FVDRGVRTPWSHQRAAADLAHDGRHVVLSTGTASGKSLAYQLPILSAMAS
EPRTRALYLSPTKALGHDQLRTAQALTDAVPALHDVAPSSYDGDSPVDVR
RFARERSRWIFSNPDMIHLSLLRNHARWAVFLRHLKFIVVDECHYYRGIF
GSNVALVLRRLLRLCARYSADPGGPTVVFASATTAAPSATAAELIGQTVT
EVTEDGSPQGARTVALWEPALLTDLVGENGAPVRRSAGAEAARVMADLIA
EGARTLTFVRSRRGAELTALGARARLEEVAPELVEQVASYRAGYLAEDRR
ELERALADGRLRGLATTNALELGVDIAGLDAVVLAGFPGTVTSFWQQAGR
SGRRGQGALIVLVARDDPLDTYLVHHPEALLDRPIERVVIDPANPYVLAP
QLLCAATELPLTDSEVRMWDAETVAESLVDDGLLRRRAHGYFPVPGLDPH
PAVDIRGSTGGQIAILEADTGRMLGSANAGQAAASVHPGAVYLHQGESYV
VDSLSFEDGVAFVHAEDPGYTTFAREVTEIAVTGAGERESYGAVTVGLVP
VSVSNTVVGYLRRRLDGEVIDFVELDMPTRTLDTMAAMCTITPEALLDNG
IDPLRFPGSLHAAEHAAIGLLPLVASCDRGDIGGVSTAVGPEDGLPTIFV
YDGYPGGAGFAARGFGQIRTWWTATADAIEACECPGGCPSCVQSPKCGNG
NDPLDKVGAVRVLRLVLRALDDRRR
119870911YP_940863.1 hypothetical protein Mkms_4883 [Mycobacterium sp. KMS]MFSFSVPAVAPAAGHSTTGAPLAYCRFVSQLSFFSAEAVPPAVADLTGLL
AAPGQVVLVGSGREQGARLSVVVEDLWRAEALAEMITDAGLGAEISRTDE
NTPLVRTAVEPRLVAIAAEWTRGAVKTVPPQWLPGPRELRAWTLASGTRE
PNGYLLGLDPHAPDTHSPLASAMMRIGIAPTLIGTRGSRPALRISGRRRL
TRLVETVGEPPQDVAALSHWPSTP
119870909YP_940861.1 putative adenylate/guanylate cyclase [Mycobacterium sp. KMS]MASEAIPIGRISAFVRWVARTPWPVFTLGMLQADIIGALFVLGFLRFGLP
PEDRVQLQDLPAFNLAIFLGYLFVSFTVGAYLSLRLLIPVIRWQRRDTLL
ADGDTSTTDLARARALRMPFYRTVISVANWCLGSIVFIVASWPVASKSAP
VVAVATALGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVVLRQ
VLTWVLSTGVPVLAIVLALVASQFDILEAPADRLTMPILLLAIAALVIGL
AGTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLSERQRLRDLFGRYVGEDVARRALERGTELGGQERDVAVLFVDLVG
STQLASTIPAADVVNLLNDFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDACGAALAASRELHDELIKVLGQTEFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEPGHVLASAIAVSGALDAEALCWNVGETV
ELRGRIAPTQLARPVNLMSPREISDLSR
119870907YP_940859.1 carboxymuconolactone decarboxylase [Mycobacterium sp. KMS]MTDTREQGLQVLRELLGGSIPEGTDFTQDSRFGAELIEIGVDSIFGRLWT
RECLSRRDRSLVTMGILIALRATDEFKAHVKIGLNNGLTEDEIAEVIYHA
SGYAGFPNANSALTAARDVLEGP
119870905YP_940857.1 hypothetical protein Mkms_4877 [Mycobacterium sp. KMS]MPVSALDGFYTTWDNARQTFGQGTPQPGADFDKSPQLTDLGSGVTAAAPG
SKWSGAAATNYDKANTDHQAVFTRLAELDRRIAQQVDQSAQVVATGRQNL
DQVRQWVTDAANSVPPGKQRDMFLMQIANRGLGQLSEVVQKTNAESNTVA
QNLAKLGPEFDAIKNEQKFGNGEKDEKKDDAEALGNEEMHAVPEKERAEQ
DVQAALAGDQGAAARVDEVLGKIQPGQQLTSEQASYLSQMQAQQHGMSID
DLHKAEQRLGDHKDIIGDSWQLMSNDDVWMPHTELEQGALDDPSWRVRGG
FEQLPTSVQDALRDADKSAPLGEGIAGLTHDRDLQKISEIVTDGNDKFQT
GTALDREMMTAADKIMDTNLGTLQPMGDPEIVQGLFEAAGSDHQVVHDHL
LGDGGDDFLHDVNAVEWTDDGKSAASLFSWTHDAAAGHEAGIAGNTAEKY
ASYIGSHKDELMNIDGQTLGELNPELVKGYAHGLTPYMSDLSGLASADPN
NTFDFIDKENAVEKPVAKGIFAVMSTEESAFKEFHSVADAHILKNSYEWA
NDVKNGVQVPANDERLLDCASLQALEKVGITEAANALGLNREQVEAQRAE
AYDMGLKMLSGTGSVVPGIGTAVGPAIDNFGGAMKDSIFGDPRDFQEMTV
RNMDAGESARFALNALIAQDVPLNYGRYSLDDSWYEYASVDPARPELGEA
RFIKNIEGLQNASISDSSMEQNLTTILKQTLGESSPTDAVKDQYDDVVAN
PDPREAIRPGQ
119870903YP_940855.1 UDP-galactose 4-epimerase [Mycobacterium sp. KMS]MTWLVTGGAGYIGSHVVRALTEADLPVVVIDDLSTGLEQFVPESVPFVRG
TLLDGALVEQTLREHAVAGVIHIAGFKYAGVSVQRPLHTYEQNVSAMVTL
LQAMETVGVDKIVFSSSAATFGTPDVDQVDESTPTAPESPYGETKLIGEW
LLRDMGRASGLRHTSLRYFNVVGSGSTALFDTSPHNLFPLVFDMLYRGDT
PRINGDDYPTPDGTCVRDYVDVGDVALAHVAAARRLTRGEPVEPVYNLGS
GAGTSVREIMTAIRTVTGVDFEPQIMPRRPGDPARIVANGDLAARDLDWK
MRHSLEDMVASAWAARQAAGAAYPGAGQS
119870901YP_940853.1 peptidase M1- membrane alanine aminopeptidase [Mycobacterium sp. KMS]MTRSKKGKNTPAVIDPYLPETGNFGYRVSRYELDLEYKVAINRLSGSASI
TAVTLAALRTFTLDLADTLRVTKVAVNGRRPARFSCANDKLRVELSSALP
AGAALVVEVRYGGTPEPIETLWGDVGFEELTNGALVAGQPNGASSWFPCD
DHPSAKASYRIQISTDSPYRAIANGELVSRRARAGHTVWTYEQAEPTSTY
LITLQIGMYDVHKLAKSPVPIQAALPARLRSNFDHSFGRQPQMMKLFEKL
FGPYPLASGYTVVVTDDALEIPLEAQGISIFGANHCDGTRRAERLIAHEL
AHQWFGNSVTVRRWRDIWLHEGFACYAEWLWSENSGGRSADEWAHHYHGR
LTDLPQDLLLADPGPKDMFDDRVYKRGALTLHVLRTRIGDEKFFALLRDW
TARHRHSTAFTDDFTGLAANYADESLRPLWDAWLYAEDLPKL
119870899YP_940851.1 integral membrane protein TerC [Mycobacterium sp. KMS]MNVSALEWGITIAVTVAVLLFDVVAIARRPHEPSMKECSIALSVYVSLAI
AFGVWVWVFHGGDYGLEFFAGWLTEYSLSVDNLFIFIIIMASFNVPRKYQ
QEALMVGIILALIFRGIFIALGAVAINQFSWVFYIFGLFLVYTAWNLARD
TDHEDDGDNAVVKFARNHLTLTDKWDGLKLWIKQDGKRLMTPMFLVIVAL
GTTDLIFALDSIPAIFGLTQEPYLVFTANVFALMGLRQLFFLLGGLLKRL
VYLSQGLAFILLFIGVKLFLHALHENELPFINGGEHVKVPEIPTLLSLGV
IVVTLVITTVLSLMKTRRQSTDEITEVDPKAEDKIEDDGEKSFDSR
119870897YP_940849.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MTPASQTELTGQMLIAGAAVRGVGPEIRGFDPTAGTELGPGYRYGDASHV
DAACAAAAAAFGPYRSTPAEARARLLEAIADGLVAITDDLVARAHAESGL
PRARLTGELGRTAGQLRLFAAVLREGSWNGVRIDTAQPDRTPLPRPDLRQ
RAVPLGPVAVFGASNFPLAFSVAGGDTASALAAGCPVVVKAHDAHPGTSE
LVGRVITDAVAAAGLPPGTFSLLNLAQEGGITLVTDPRVKAVGFTGSRAG
GLALVDAAARRREPIPVYAEMSAVNPVFLLDGALAAGGADLGRAFVDSLT
LGSGQFCTNPGLIVAVDGPGLDTFVDAARDALAGSAPTAMLTPGIAENYR
AGVEALAGRATLIARGSADGTAAVSCRAALFGTDAVSLLGSVSLQAEVFG
ASSLIVRCADFEEMTTVAANVEGQLTATLHADESDHDRAAALLPILELKA
GRILFNGWPTGVEVTHAMVHGGPFPATSDSRTTSVGSRAIERFLRPVCYQ
NAPGVLLPAAVADGNPECLWRRVDGELTRD
119870895YP_940847.1 allantoicase [Mycobacterium sp. KMS]MSTAHSHFLALPDLASRAAGAAVVWANDELFAEKENLIIPAAAQHRPATF
GHKGQVYDGWETRRSRGADRESCDSAIIRLGAPGVVRGVVVDTAWFTGNY
PPEVSVEAAYVPGHPSIEELLGRHWTTIVERSPVDGDTRNPFEVASGRRW
SHVRLSMYPDGGVARLRVHGEGLLDPQFAELPLDLAALEHGGRITGCSNM
FYSSPNNLLLPGTARTMGDGWETSRRRDAGNDWVQVRLAARGVLSFAELD
TSYFIGNAPGSARLRGRDGDGEWFDLLDEVALQPDTRHRFLIASERPVTE
ARLDVFPDGGMARLRLFGRLTDDGLRAVAERWSLTG
119870893YP_940845.1 inorganic diphosphatase [Mycobacterium sp. KMS]MEFEVVIEIPKGSRNKYEVDHETGRLKLDRYLYTSMAYPTDYGFIENSLG
EDGDPLDALVLLPESVFPGCIVDARPVAMFQMTDEAGGDDKVLCVPAGDK
RWDHIQDLADVPEQVLEEVKHFFVHYKDLEPNKYVKAADWTGREAAEAEV
QRSFERFEAEGH
119870891YP_940843.1 hypothetical protein Mkms_4863 [Mycobacterium sp. KMS]MSASSADLTVGRTVDWRFAATVGAKLVRPGPPATDYTRRQAVEQLATASR
EAELPVREVTGLTEGNAVTEARIIDRPGWIQAAAQSMRTMTGGTDRPSNF
LTGRVTGAQTGAVLAFVSSGILGQYDPFATAGGQERSDPGNGPSGELLLV
WPNVIAVERQLRVSPTDFRLWVCLHEVTHRVQFGANPWLADHMSSALAVL
TKDAGEDVTEVAGRLADYVRNRRAHTDAHSTGVLGLMRAMQAEPQRRALD
QLLVLGTLLEGHADHVMDAVGPAVVPSVATIRARFNQRRERKQPPVQRIL
RALLGVDAKISQYTRGKAFVDHVVAKVGMERFNTVWSGPETLPLPTEVDE
PQRWIDRVL
119870889YP_940841.1 hypoxanthine phosphoribosyltransferase [Mycobacterium sp. KMS]MRAAALVPVPTAWHAVGVPAHTPDLYEGDIKSVLLSEEQIQSRTAELAAQ
IADTYRAAIGDSGQDLLLVTVLKGAVMFVTDLARSIPLPTQLEFMAVSSY
GSSTSSSGVVRILKDLDRDINDRDVLIVEDIVDSGLTLSWLLRNLATRQP
RSLRVCTLLRKPDAVRADVDIEYVGFDIPNEFVVGYGLDYAERYRDLPYI
GTLEPKVYTHD
119870887YP_940839.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MRASVLRGGRMVLRDDVPEPVPGPGQVLVAVKACGICGSDLHFAAHGDDA
LAAGAQMEGMPQLGDTVDLSADVFMGHEIAAEVLEAGPDTDAPPPGTVVT
SIPALISQTGVAPIVYSNSVIGGYAERMLLSAPLLLPVPNGLDPRHAALT
EPMAVGLHAVNRSAITPAESALVIGCGPIGMAIIAALRLRGVEHVVAADF
SQTRRRLAQTMGAHETVDPAQRSPFEVAAPAVVFEAVGAPGILNDVMRRA
PAHTRVVVAGVCMEPDTVMPFYGAPKELSIQFVFAYDVGEFAETLRAIAE
GAIDVAPLITGEVGLDGVGDAFATLSRPAEQCKILVTP
119870885YP_940837.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MCLGETVITPTERLVGTNGVRLRVVEAGERGAPVVVLAHGFPELAYSWRH
QIPVLAEAGYHVIAPDQRGYGGSTRPDAVEDYDIVALTGDLAGLLDDVGA
QRAVVVGHDWGSPVVTNFALLYPDRVAGMVNLSVPPVPRASDPPTQIWRK
TFGDHFFYILYFQEPGVADADLGRDPRQSLQRMLALEGFSAPAPDLADNP
LPPLPEWMSQEEFDHYADVFTRTGFTGGLNWYRNFDRNWELTATTPAATI
TVPTLFIAGSADPVLSFTPRHRVTDLVTGEYREVLLDGAGHWLQQERPDE
VNALLLEHLAGLELT
119870883YP_940835.1 GTP cyclohydrolase I [Mycobacterium sp. KMS]MTRSYDSATVKIADFDQPRAEAAVRELLIAIGEDPDRHGLVDTPARVARA
YREMFAGLYTDPDDVLNTTFDEQHDEMVLVKDIPMYSTCEHHLVAFHGVA
HVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERLTAQVADALMRKLDPR
GVIVVMEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKASRAEALDLILR
K
119870881YP_940833.1 dihydroneopterin aldolase [Mycobacterium sp. KMS]MSDRIELRGLTVRGNHGVFDHERRDGQDFVIDLTVWLDLAPAAASDDLAD
TVDYGGLAQRAAGIVAGPPRDLIETVAAEIADDVMKDQRIEAVEVVVHKP
EAPIPLTFADVAVVARRTRAREERK
119870879YP_940831.1 hypothetical protein Mkms_4851 [Mycobacterium sp. KMS]MGPTRKRDLAAAVLIAGIVGYLAALLAYPRYFPPISLWTGLSLLGVAVAI
AAWGVNVRNKIRDGEIGDGPGRLHPLAVARSVVIAKASAWVGAPVLGWWA
GVLVQILPQRGALRAAGEDVPGVVIAAASALALTIAGLWLQNCCKSPPEP
PEDPDPSSD
119870877YP_940829.1 NAD-dependent glycerol-3-phosphate dehydrogenase domain-containing proMEQPPAPSWGPPGDLRPARLSVGIISAGRVGTALGVALERAGHVVVACSA
ISQASRRRAQRRLPDSAVMPIHDVADRAELLVLAVPDAELSAVVSGLAAT
GTVRPGAIVAHTSGANGVGILAPLSERGCIPLAIHPAMTFTGADEDIARL
SDACFGITAADDVGYAIAQSLVLEIGGEPFRVREDARPLYHAALAHAGNH
VTTVILDAVEALRSALWGQELLGQELVGDAPGGIAERVIAPLARASLENA
LQRGQAALTGPVARGDAPAISAHLRALAEVNPELAEAYRTTSLRTAQRAH
ASEDVFAALAAQS
119870875YP_940827.1 aspartate alpha-decarboxylase [Mycobacterium sp. KMS]MLRTMLKSKIHRATVTQSDLHYVGSVTIDADLMDAADLIEGEQVTIVDID
NGNRLVTYAITGARGSGVIGINGAAAHLVHPGDLVILIAYGTMEDAEARA
YQPRVVFVDADNRQVHLGADPAMVPDTAVDLMSPR
119870873YP_940825.1 hypothetical protein Mkms_4845 [Mycobacterium sp. KMS]MRSPIDHGAVAALADQPLDWRYKGLPAEWWGATPAQICGDSPELFSAGVL
GPVCVLRASALTHNLVTMARWCRRRGVELAPHAKTHLAPQLLARQFDAGA
VAVTAATVSQVRILRAFGVRDVLLANEVVDRAGLVWLAREMAADPEFRMV
CWVDSLRGVELMSAALADAGRPLDVCVEVGMAGGRTGCRTTADVDAVARA
VTASPRLRLVGVAGYEAACGQDVNAEALAVVTGYLTDVRTAVERLATAFE
TDDVLVTAGGSTYFDLVTDVLTGGWPAGLTVRTVLRSGCYLTHDDGLYAR
TSPLQRAGAGGLTAAMSVWAQVISRPEEELALVGMGRRDVSFDQGLPVPR
LLPGSEVTRLNDQHAYLRLGADDTGVRVGDWLEFGVSHPCTTFDKWPMIP
VLDDGNRVVDLIRTYF
119870871YP_940823.1 DNA-bridging protein Lsr2 [Mycobacterium sp. KMS]MAKKVTVTLVDDFDGEGTADETVEFGLDGVSYEIDLSSKNAKKLREDLKQ
WVEAGRRVGGRRRGRATGPTRGRGAIDREQSAAIREWARRNGHNVSTRGR
IPADVIDAFHAAT
119870869YP_940821.1 hypothetical protein Mkms_4841 [Mycobacterium sp. KMS]MTSQQARKTRVPAIDLSATRAAVWLSATAFLALLVLYFLGFDQGATSVFG
ADNTAIHEFVHDARHLLGFPCH
119870867YP_940819.1 phosphoglycerate mutase [Mycobacterium sp. KMS]MSEVVRLTLVSHAMTDAVSAGRFPTDEPLNAQGHRQADACVELGPTDAAY
CGPEKRTRQTAELLGLHAVVDPLLADLDHGRWRGDVLGGVEPAELAIWLT
EPAQAPHGGETVVQVIERVRRWMDSMAGRRGRFVAVTHPAVVRAAILVAL
DAPARSFWRIDVAPVSRTVLHFRGHAWTLRSSP
119870865YP_940817.1 antibiotic biosynthesis monooxygenase [Mycobacterium sp. KMS]MPSQNPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVK
GENRYFVVTQWETEEAFQAWATGPAIEAHKGQAANPVATGASLLEFEVVL
DVAGSGDKA
119870863YP_940815.1 hypothetical protein Mkms_4835 [Mycobacterium sp. KMS]MSTALISLAVLSPFALTAVLIWTARRAGVLRWDLDQFRVWAPMAGRFDSR
YDEDRDSYRVQHDLDAIRTRFEEHPVWPTSGALGERR
119870861YP_940813.1 GAF sensor-containing diguanylate cyclase/phosphodiesterase [MycobacteMTRTLDQVVTAAAAELMAATATNVVESCTRVLADVVAHLGVDFSFLRHND
HTIKATKLVAEWPIRDYIPDPDPIGTIYFAEADPVFRQAEYLKTPLIVRP
EPDNDDYQRRIEEGRGVPSVSMACVPLLSGEMTSGILGFIKIGDREWTTE
EQNALQAIATLFAQLQARIAAEEQLQYLAEHDDLSGLLNRRALMAHLGLR
LAEGQPGPVSVLFLDLDRLKTVNDYLGHSAGDQFIKMFAERLRAGTEKPA
VIARVGGDEFVVVPDEPMDVVAVESFARRLQTWLQRRVVIDGEMLARTVS
IGVAVGTPGDDTTSDLLRRADQAALSAKSTGGSKTAVFTTEMASQHAIRN
DIELHLEGVIDEASSALVLHYLPEIDMRTGKVLGTEALVRWRHPTRGLLL
PESFIGVAESINLAGKLGRLVMRSACADFARWRSRRTAGDAILRINVSPV
QLVSDGFAATVAGTLDEFGVDGSAVCLEITESVVVQDIEATRHTLAALKE
VGVRIAIDDFGTGYSVLTHLKSLPVDTVKIDRSFVRDLGASPGDLAIVRA
ILALADAFELEVVAEGVETVAAAKTLLELGCPRAQGFMLSRPVDAAAMEA
LFREGRIAVDAWRDDAATVNGRQ
119870859YP_940811.1 carbonic anhydrase [Mycobacterium sp. KMS]MPNSSPVTAWKALKEGNERFVAGRPEHPSQSIDYRASLAEGQRPTTVVFG
CGDSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEFAVTVLEVPLIV
VLGHDSCGAVKATLAALDEGVVPGGYVRDIVERVTPSILLGRRDGLSRVD
EFEERHVNETAVQLRDRSSAIASRIEAGKVAIAGVTYHLADGRAQLRAHL
GDIGEA
119870857YP_940809.1 DNA integrity scanning protein DisA [Mycobacterium sp. KMS]MAVKNARTSSNVVQLARPTLRETLGRLAPGTPLRDGLERILRGRTGALIV
LGYDDSVETICDGGFELDVRYAPTRLRELSKMDGAVVLSSDGTRILRANV
QLVPDPSIPTDESGTRHRSAERTAIQTGYPVISVSHSMSIVTVYVAGERH
VVPDTPTILSRANQTIATLERYKSRLDEVSRQLSTAEIEDFVTLRDVMTV
VQRLEMVRRISLEIDADVVELGTDGRQLKLQLEELVGDNDTARELIVRDY
HANPDPPTPAQVSATLEELDSLSDNELLDFTTLARVFGYPSTLEAQDSAM
SSRGYRAMAGIPRLQFAHVDLLVRSFGSLQGLLAASADDLQSVEGIGSMW
ARHIREGLSLLAESTIADRLA
119870855YP_940807.1 hypothetical protein Mkms_4827 [Mycobacterium sp. KMS]MNRIHPRASAVTAGLAACGLAFALTACGSGQISQTATQAPAVNGVNAGTG
DVSLRNVHLRAPQTSDYVRPGSDVELLFVATNDSPDQPDKLVSIRSDIGS
VPVRGKADIAPGGVLVAGEPDGQTAALESVEPAEPLTVDVKLTKPITNGL
TYPFTFAFERSGEVTVQVPISAGEAPRRDDSGGGGSEHSGGH
119870853YP_940805.1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [MycobacteriuMTTVAVVPAAGSGQRLAAGAPKAFVNLAGRPMLERAIAGLRNSGVVDSIV
VAVPPSRTDEAKLVFGGEALIVAGGADRTESVRAALAAVGDADYVLVHDA
ARALTPPSLVARVVRALEAGHSAVVPGLPVADTIKAVDANGAVLGTPERA
GLRAIQTPQGFHIDVLRRAYARAGDGGFTDDASMVEQAGGQVQVVEGDPL
AFKITTPLDLVLAEAILAGAR
119870851YP_940803.1 cysteinyl-tRNA synthetase [Mycobacterium sp. KMS]MTDRADADRPATSPTGLRLYDTMTGAVRDFVPLRDGHVSIYLCGATVQGL
PHIGHVRSGVAFDVLRRWLTAKGLDVAFIRNVTDIDDKILNKAADAGRPW
WEWAATYERAFSAAYDALGVLPPSAEPRATGHITQMVELIERLIDRGHAY
TGDGDVYFNVATLPDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAK
PGEPSWPTPWGRGRPGWHTECVAMCEAYLGAEFDIHAGGMDLVFPHHENE
IAQAEAAGDGFARFWLHNGWVTMGGEKMSKSLGNVLSIPAVLQRVRAAEL
RYYLGSAHYRSMLEFSETALQDAVKAYAGVEDFLHRVRTRVGTVVPGDWT
PKFAAALDDDLSVPIALAEVHAARAVGNRALDSGDHETAMTQARSIRAMM
GILGCDPLDERWESRDETSAALAAIDVLVRWALDSRADARNRKDWATADQ
IRDRLKEAGIEVTDTADGPQWSLLDGDSKDV
119870849YP_940801.1 arsenical pump membrane protein [Mycobacterium sp. KMS]MLLALLLLVVVLAFALARPRGWPEAVAAVPAAGLLVATGALSVDEAVAEI
TRLAPVVGFLAAVLVLAQLCDDEGLFHAAGVLMARRGAGDPRRLLTVVFV
VASATTAILSLDATVVLLTPVVLATARTLSIPAAPHVYATAHLANSASLL
LPVSNLTNLLAFTAAGLSFTHFAALMTLPWLAAIVGEYILLRALFRNDLA
AVPAPDKTVPAPELPLFVLVVLGLTLGGFAVTSLLGLSPAWAALAGAVVL
GVRSLAQRRSTVAGIVRSANVPFLAFVLCLGVVVEAVMVHGLDDAMRQAL
PAGDGLVALLGIAAVAAVLSNVVNNVPAVLLLLPLVAGAGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSIVRGENIPAGVLQFSRVGLCTVPLTLVASV
FGLWAGLALFT
119870847YP_940799.1 hypothetical protein Mkms_4819 [Mycobacterium sp. KMS]MQRFDVPAAGPDSALTVTWAGVTTLLVDDGSSALMTDGFFSRPGLASVGL
RRIGPSAARVDGCLARLRVDRLDAVLPVHTHFDHALDSALVADRAGAVLI
GGASAALLGRGHGLPESRISTVTSGATITAGAYDLTLVESGHCPPDRFPG
AITTPVTPPARASAYRCGEAWSVLVRHRPTAHTVLIVGSAGFVPGALHGT
RADVVYLGVGQLGRQPEAYLRDYWEQTVRAVGARRVVLIHWDDFFRPLHR
PLRALPYVADDLDATMRGLSRLAEIDGVPLHLPQLWQRADPWR
119870845YP_940797.1 50S ribosomal protein L28 [Mycobacterium sp. KMS]MSAHCQVTGRSPGFGNRVSHSHRRTRRRWRPNIQTKTYYVPSEGRRVTLR
VSAKGIKVIDRDGIDAVLARIRRQGGKI
119870843YP_940795.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MVAFDRSTGDDTQRWAYPLLLVLSGVALGVSGLPAPLYGMYEANWHLSPL
ATTIIFAVYAIAALGAVLVSGRISDVVGRKPVLIAALAALVIGLGVFLVA
DNMALLLLARAIHGAAVGSIVVAGAAALLDLRPHHGVRSGQLSGVSFNIG
MTVAILGSALLAQYAPHPLRTPYAVVAVLCLIVGAGLLALREPHIARTRG
RIRVAKPAVPQEIRGDFWFSALGAMASWSVLGVLLSLYPSLAARQTHIDN
LVFGGAVVGTTAFAAALAQLASTRVPARRAAIVGDIGMALSLLLTIPVLL
SHQWPLVFVAAALLGATFGLGFGGSLRHLSDVVPAGRRGETMSAFYLAAY
TAMAVPTLLAGWAATTWELVVVFPWFAVAVATACVGAAVAGMRSARAAAA
EAY
119870841YP_940793.1 LamB/YcsF family protein [Mycobacterium sp. KMS]MSASSVDLNADLGEGYGVWTLGDDDAMLDIVTSANVACGFHAGDPARLVR
VCRAAAARGVRIGAQVSYRDLEGFGRRFIDAAAEELAADVMYQIGALSAL
ATAAGTTVSYVKPHGALYNAIVTHRDQARAVATAVHAVDPGLLVLGLPGS
AFLDEARELGLQTVTEAFADRAYQPDGQLVSRREPGAVIHDLDEVADRVI
SMVTAGRVTAIDGSTVEIAVKSICVHGDSPGAVHIAAAVRDRLTAEGVTL
APFS
119870839YP_940791.1 ABC-3 protein [Mycobacterium sp. KMS]MAAGVVAACLCAPVGCWVVLRGNVFLGDAMTHGMLPGVALSALLGFDVLV
GGFVAAVAMAVGVAAIGRSSKLSSDTSIGLLLVGMLALGVVIVSRSQSFA
VDLTGFLFGDVLAVQTADLVTLGVALIVTLSAVVVGHRAFVAVTFDARKA
ATLGLRPDIAVPTLTVLVAIAMVASFHVVGTLLVLGLLIAPPATALLWVR
SIPRVMTVSAVLGSLAVYVGLLISWHADTAGGATIAGVAVLMFFASTVAR
RIVAKWKPAVRSMGSVAASVCLVTACSGGAAPPAAPSAEGPGDEVVVEGA
RELDGPLTRLVLVDPGSGATAVYDAVDETETPIGEFGPVAVSAVTAASHI
WRRATARRSWTPVHGPSTTATTTTTSPPIPRSSGPSTGRWLR
119870837YP_940789.1 periplasmic solute binding protein [Mycobacterium sp. KMS]MARHVQTAADAGVPTLTLGDHLDPIRYAQGDTAGAPDPHFWMDPQRMITA
VDVIEQAVSRAVDGVDVAVVARNAERYRAELRALDGSMSLKFNAITEGRR
KLVTNHHVLGYLADRFGFQVIGAIVPSGTTLAAPSPSDLQSLAGAIRSAR
VPAVFVDSSQPERLAHVLAEQAGVHVRIVALYTESLGPPGTSGATYLDMI
RANADAIVNGLS
119870835YP_940787.1 cob(II)yrinic acid a-c-diamide reductase [Mycobacterium sp. KMS]MTDHAFTDAERHAVYRAITERRDMRRFVPGEKVPDEVLARLLAAAHAAPS
VGLMQPWRFIRITDPALRRDIHALVDEERHHTAEALGPRGEEFLALKVEG
VLDCAELLVVALRDGRERHVFGRRTLPHMDLASVSCAIQNMWLAARAEGL
GMGWVSIFDPRRLAGLLGMPDGAEPVAVLCLGPVPDFPDRPVLELDRWAL
GRPLAEFVTENRWD
119870833YP_940785.1 periplasmic solute binding protein [Mycobacterium sp. KMS]MTACSGGGDSAAPSAQPGGECPTEPVSVVVSVDQWGGIVSQLGGQCATVS
TVVASSSVDPHDFEPAPKDAALFEGAQLIVVNGGHYDEWASKLAEGSAPD
APVIDAAEVSAEAADVGADMHAANPHIWYSPAAVTAVADAVTAELGRLAP
DAADYFTERQAEFGDALAPYHQVIGSIKATAAGKTYAATENVFDDMAAAV
GLTNRTPPGYQATAANESDPSPADLDAFLRLLGDRGVDVLIYNVQTEGSV
PQQIRAAAERAGVPVVEVTESVPPGAASFQAWQVDQLSALAEALGVGG
119870831YP_940783.1 ABC-3 protein [Mycobacterium sp. KMS]MTTSLMALSYQDNWWQILTSAFMRNALLGGTIVALAAGLIGYFVVVRNTA
FAAHALAHIGLPGATGAALLGLPVALGLGVFCIGGALVIGALGRRAADRE
VATGTVLAMATGLGLLFNSLATRNSSTMTNVLFGNLLAITGEQIVSFAVL
LGVLAAGIGVIYRPLLFTSVNAQVADAKGVPVRGLSVVFMVLLGLTVTMA
VQAVGTLLLFALVVTPAAAAIMLTARPAAAIALSTAVNLVAVWFGLALSA
MFNAPPSFIIVTIACGVWAVVWAVERGLRSSADRVLVT
119870829YP_940781.1 hypothetical protein Mkms_4801 [Mycobacterium sp. KMS]MLTPDELTARTARAVAAAASAGRDLGLHVDEPRVLYDVFSVIVHLAPAPV
AVRVPTVLPPSLRARPDRQTAQQHAELAVAGWLADRGFPVVPPSPLVPRE
PVVHDGFSMTFWRYLDAVSDAEPDWPQRCASTARLHAALRDHPGEGLGFW
TQFDTYIPAALAELEHHPDLLDRADLHRAQRDWDRIAPILTSRAAFESAF
PGVDVQPIHGDAPFHNMIVTPTGEYWSDFESVTLGAVESDLAMVGPEGRA
AYDAAATELGLRTLDDRVVALTESAGLLAAVACLAMAPQLPMLVDALAPT
VDLWRARSG
119870827YP_940779.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSSPASSSGSRPREVMNVAVLAESELGSEAQRERRKRILDATLAIASKGG
YEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALGREFERIDAKTDRAA
LAGGTPYQRLNFMVGKLNRAMQRNPLLTEAMTRAFVFADASAAGEVDHVG
KLMDSMFARAMSDGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSK
RLDLAVRLLIGDGDRPKI
119870825YP_940777.1 hypothetical protein Mkms_4797 [Mycobacterium sp. KMS]MNRLAAAGAAALLTALLTHPATAAAAANSAMTSIAVDPATKIEMHVNANC
VGNRCMFDTTANLMTPGGPTGFPGDAWSRQTITLRSNDRNVWQEAEYSAP
AGTPREVKGANHNNVLSKMYKSLRDVEISVTSFGGGPIERYRIDGASMPT
EWATGQLATRAAFIVCSHIQVVYGGVNLTTPDACAQTTFG
119870823YP_940775.1 acyl-CoA dehydrogenase type 2 [Mycobacterium sp. KMS]MTSIEQRDAQAVLSGIDDLLPTLRQRAQEAEDLRRLPDETVKDLDEIGFF
KLLQPQQWGGMQCDPSLFYEAVRRLGSACGSTGWVASIIGVHNWHLALFD
QKAQDEVWGDDPSVRVSSSYAPMGAGTVVDGGYRVSGAWQWSSGCDHATW
AFLGGPVIKDGKPVDFGSFLIPRSEYRIDDVWNVVGLKGTGSNTVVVEDV
FVPRHRFLSYKAMNDGTAGGFENNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYEAHVEHQGKRVRAAFAGEKSKDDPFAKIRIAEAASDIDAGWRQLIGN
VGEEYALLAAGKEIPFELRARARRDQVRATARAIASIDLLFEASGATALG
IDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
119870821YP_940773.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSIRSLGYLRIESTDVAAWREYGLNVLGMVEGKGTVDGALYLRMDEFPAR
LVIVPGERDRLLQSGWETANAEGLQEIRNRLDVEGTPYKEATAAELADRR
VDGMITFDDPSGNTLEIFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAESTHFYRDVLGFKLRDSMRLPPQLVGRPADGAPAWLRFFGVNPRHH
SLAFMPGETPSGIVHLMIEVENSDDVGLCLDRALRRKVPMSATLGRHVND
KMLSFYMKTPGGFDVEFGCEGLEVEDENWIARESTAVSLWGHDFSVGFK
119870819YP_940771.1 hypothetical protein Mkms_4791 [Mycobacterium sp. KMS]MEPSPAAESSGEMTVVYEDAATPEAVNGRRVLTENRLLESLAADVNDSFV
LPEDVRLVGAQCDEANAFWSSDDRTVTICYEDADLSLTTFEQAGDPDPVA
ATIGAERATFYHELGHATLDLYDLPFTGREEDVADQLAAVMLLEPDDTGA
IDPTDVRAAAAYARMFEANSEQDGGAAQDFPFWDVHEYDLARMYNFQCWI
YGADPAGNAFIVDEGLVPEDRADSCEGEFDRMSRAWWDMLDPHLRSE
119870817YP_940769.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MANRAPSICKTADMPISSPRRPSADDLLVLLAVGRTGRYTTAAEELGLNH
TTISRRIAALEQSIGGRLVARVAGGWELTDLGREALAAAEAVESAVRSLS
VDPAGRRALEGVVRISATDGFSAYIVAPAAALVQRDHPGVAVEIVATTRR
ASQQRSGLDVEVVVGEPQVHRAEAIRLGDYCLGLYGSRDYLAEHGTPSDV
DDLARYPLVYFIDSMLQVDDLDSATGFAPAMRESVTSTNVFVHVEATRAA
AGLGLLPCFMADRHDDLVRVLPNAVSVRLTYWLVTRAETLRRPEVDAVVE
AIRARVHEQRDVLLGAP
119870815YP_940767.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MRDLAGRTALVTGGASGIGEACARELAARGATVTVADRDETAATALADEI
GGSAWVVDLLDVSALEGLALDTDILVNNAGVQRIDPIVDFAPENFRMLMT
LMVEAPFLLIRAALPYMYAQKFGRVINISSVHGLRASEYKVGYVTAKHAL
EGLSKVTALEGGPHQVTSNCVNPGYVRTPLVTKQIADQAKVHGIGEDDVV
TQILLKESAIKRLVEPSEVGSLVGWLASPQSGMVTGAAYTMDGGWSAR
119870813YP_940765.1 hypothetical protein Mkms_4785 [Mycobacterium sp. KMS]MGAATVGAMFESVFDVDPDAGEAELRAQVEQLERLKSSAAAAQARATALW
AAKRRATEAASGMPKRKRGRGLATEVALARKDAPVCGNTHLGMARALVHE
MPHTLAALECGALSEWRATLIVKQSACLSVEHRRHLDAELCADVSKLDGW
GNRRIEAEAKKITTRLDAAAVVARSAKAAGDRCVTIRPAPGTMAYVTALL
PVAQGVAVYAALKREADTTFDDRSRGQVMADTLVERVTGRPAEKPVPVSL
NLALADTTLVGDDDEPGWCEGYGPVPAGVVRALVSDAVADEAAKATLRRL
YRHPASGQLVAMESKARTFPKGLAAFIDIRDQTCRTPYCNAPIRHHDHAE
PHRQGGPTSARNGLGECEGCNYAKEAPGWTVTTSDDGGEHRAEFRTPTGA
TYRSTAPPLPGPPVYARSIIEGGLSIDIVRFAAA
119870811YP_940763.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMSEERELLRETVAALVDKHASPAAVREAMTSERGYDESLWTLLCEQVGAA
ALVVPEELGGAGGELGDAAVVLEELGRNLVPTPLLGTTLAELALLSSDEP
DADALAGLAAGEQVGAVVFDPGYVVNGDIADVVIGVSDGQLSRWTSFEAH
PLDAMDLTRRLARVEPGDTVAIGADPGLADTAALLTAAEQIGAATRCLEL
TVAYTKDRVQFGRPIGSFQALKHRMADLYVKVQSAKAVVDEALAEPSPVS
AALARFSASEAFTAVAAEAVQMHGGIAITWESDIQLYFKRAHASAQLLGP
PREQLRRLETQVF
119870809YP_940761.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDLTFDDATEDFRAEVREFLAAHRDDFPTKSYDCAEGFEQHRRWDKVLFD
AGLSVISWPERYGGRDATLLQWIAFEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQLDRVLPKMASGEEIWAQAWSEPESGSDLASLRSTATRTDGGW
LLNGQKIWSSRAVFGDRAFGLFRSDPEAQRHKGLTYVMFDLKAEGVTVRP
IAQLGGDTGFGEIFLDDVFVPDADVIGEVNDGWRAAMSTSSNERGMSLRS
PARFLAPAERLVAEWKKDRDPAYAERVADAWIKAQAYRLHTFGTVTRVAA
GGELGAESSVTKVFWSDLDVALHQTALDLRGADGELADLPAREEDPYNWT
DGLLFALGGPIYAGTNEIQRNIIAERLLGLPREPKGQAK
119870807YP_940759.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMIEVQEFRAEVRQWLADNLVGEYAALKGLGGPGREHEAFEERLAWNRHLA
AAGLTCLGWPVEHGGRGLSVAHRVAFYEEYAIANAPAKVNHFGEELLGPT
LIAYGTPEQQQRFLPKIVEVTELWCQGYSEPGAGSDLANVATTAVLDEEG
EHWLINGQKVWTSLAHWAQWCFVVARTEKGSKRHAGLSYLLVPLDQPGVE
VRPIIQLTGDSEFNEVFFDDARTDASLVVGEPGDGWRVAMGTLTFERGVS
TLGQQIEYARELSGIAELAKRTGAADDPLIRERLTRSWVGLRTMRSYALA
TMDVEQPGQDNISKLLWANWHRELGEIAMDIEGMAGLTLKDGDFDEWQRL
YLFSRADTIYGGSNEVQRNIIAERVLGLPRESKG
119870805YP_940757.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSTSAAGQPPTRRDELLELAATMFAERGLRATTVRDIADSAGILSGSLYH
HFSSKEEMIDELLRGFLDWLFERYHQIVATEPNPLERLKGLFMASFEAIA
TRHAQVVIYQDEAKRLSSQPRFSYVEERNREQRKMWVEVLNQGIAEGYFR
PDIDVDLIYRFIRDTTWVSVRWYQPGGPLTAEEVGRQYLSIVLGGITAGD
ERLLE
119870803YP_940755.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGPGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHVRGQDVGVMALVGTFSQYGTVPEASI
VKIDDDLPLARACLLGCGVTTGWGSAVNTADVSPGDTVVIIGLGGIGSGA
VQGARLAGAEKIVVIEPVESKRELAFRFGATHFVTTMEEANALVADLTRG
VMADSAILTVGLLEGSMLEDAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMRAGRNIRGVILHDH
119870801YP_940753.1 hypothetical protein Mkms_4773 [Mycobacterium sp. KMS]MAEVKPEPSITAAVIGDVVASRSAPDRRALHRDLSGALRDAGFAFTVGDE
FQGTHPSVGAAIDAALTVRLAVAPDIDIRFGIGWGQVTVLDTETGIQDGP
GWWAAREAIEWTASAQRQPGLAAVRTSYRRAADVTGPNVDAVNAALLCRD
HLLGSLDDRSLRILKGLLSNHTKKDIAAAEHVSASAVSQRAGRDGLDLLV
LTSTYLRGVR
119870799YP_940751.1 putative CoA transferase subunit beta [Mycobacterium sp. KMS]MTEPTRAEVCAVACAELFRDAGEIMVSPMANMVSIGARLARLTFSPDILL
TDGEARLLADTPALGATGAIEGWMPFGRVFETLTWGRRHVVMGANQIDRY
GNQNLSAFGAIQHPKRQMFGVRGAPGNTINHATSYWVGGHSTRVFGESVD
IVSGVGWDKVDPDNPAYRFLDVYRVVSNLGVFDFNGPDHQMRALSLHPGV
EAEQVAENTSFEVHGLDTAEVTRLPSDEELRLIREVIDPKSLRDREIRS
119870797YP_940749.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MPITTKTVEPGIVSVTVDYPPVNAIPSRGWFELGDTITAAGRDRSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCFHAFRAVYECEVPVIAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRMFFTAATVSAETLHHFGSVHEVVPREDLDESALRVARDIASKDTRV
IRAAKEALNFIDVQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTSKGE
TK
119870795YP_940747.1 short chain dehydrogenase [Mycobacterium sp. KMS]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQSVVDEITAAGGEAVTSGANVADWAQAEGLIQTAVDSFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVIAVHLKGHFATMKHAAAYWRAQSKAGKTVD
ARIVNTSSGAGLQGSVGQANYSAAKAGIAAMTLVAAAEMGRYGVTVNAIA
PSARTRMTETVFAEMMSTQGNDFDAMAPENVSPLVVWLGSTESRDITGQV
FEVEGGKIRVAEGWAHGPQVDKGARWDPAELGPVVADLLAKARPPVPVYG
A
119870793YP_940745.1 hypothetical protein Mkms_4765 [Mycobacterium sp. KMS]MDTVSDSDRIAAAEAYVDALATHRADAVPFAPGCVRIEVGLKTGFSGKHL
RRSLTGGPQYRIIVATTDRTFRVVGDEVHATFTVVTKARAAGRRVVAHVD
ETFLIPASDGLIHHIRARIRPAIVPA
119870791YP_940743.1 cytochrome P450 [Mycobacterium sp. KMS]MPGPNSCPIAPDFDFLDANLNLERLPVAELAELRKSEPVHWVDVPGGTGG
FGDKGYWLVTKHADVKDVSKRNDVFGSSPDGAIPVWPQDMTRDAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAVGRLEDELRARAQKIAETAAAEGAG
DFVEQVSCELPLQAIAELLGVPQDDRDKLFRWSNEMTAGEDPEYADVDPA
MSSFELITYAMKMAEERAKNPTEDIVTKLIEADIDGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSQNPDQWELYKKERPETAADEIVRWATPVS
AFQRTALEDTELGGVQIKKGQRVVMSYRSANFDEEVFENPYQFDILRNPN
PHVGFGGTGAHYCIGANLAKMTINLIFNAIADKMPDLKPIGQPERLKSGW
LNGIKHWQVDYTGAGGPAIEQKCPVAH
119870789YP_940741.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMFIDLTPEQRRLQAELREYFSTLISPGERDAMETDRHNEAYRAVIKRMGA
DGKLGVGWPKEFGGLGFGPVEQSIFVNEAARADVPLPAVTLQTVGPTLQV
YGTEAQKKKFLPAILAGEVHFAIGYSEPEAGTDLASLRTSAVRHGDEYIV
NGQKMWTTGAHDADYIWLAARTDPEAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVHVPADMLVGEENAGWKLITTQLNHERVMLGPAGK
VAGIYDRVHAWASKPGSNGVTPLENDNVRRALGEIRAVWRINELLNWQVA
AAGETIAVADAAATKVFSTERIQRIGRLAEEIVGAYGNPAEPDTAELLRW
LDSQTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
119870787YP_940739.1 dehydratase [Mycobacterium sp. KMS]MSAPSVEVGTKLPELQIYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRYLTDWAGPSARIRSIGLRLGVPWYAYDTITFTGEV
TAVDDGVTTVKVVGANSLGNHVIATATIVLGDH
119870785YP_940737.1 PPE family protein [Mycobacterium sp. KMS]MGIMPDTSPYGSQTVTGPGWPNVDEETLAAAAASYEALAAKLSGSVVPQQ
QGQLMKLSDAWEGGGAVAAAGEASTIIGGHEANAAHAAAIAAKLREMEVA
VVRTKTMVNTMAQETQHECEAIQALPFSNTQQLVQARVKMGLSQNIAQVT
ASSTELANSFGVPPSIPTPGVPPTVPGQQAAQGAAKEAGQAGGQGSQQGM
QQMMQMASMAGQLPQQIGQMVSQVPQQMMQPLQQLSQPLQQLTSMFGQGG
KADSLGAAGLPFSSFSNHPLAGGSGAGGGGGMMRAASLPGSGGVSAQTPL
MAGLVGTNAVSVAPAEPVVAGSATVGGVAPVAAGAMGGMGGMGAPMGMMG
GRGSGGGGGTRAGLAAPEPLEYDVGEDVDDEW
119870783YP_940735.1 hypothetical protein Mkms_4754 [Mycobacterium sp. KMS]MSPPASIDKEIAEDIVRACVAHQLSLLQINGKFVYAHKHLAPSEISTGYN
LLRHCGTVWFMCKAIRSLAIDTTSHDKQKLRAAVAYILARMKEPAWIQRP
LPALCLTAKDVVKLGGSGLAAVMLREHALLADHDGHGSWPLTDERSHDET
SDDNYEPYCTGLENYLLSQLKGTDFIHKRAFSTGHIYSFRSEYYTGEALL
ALMRSPRHIPRVRVTMENLLDRGYGLAQQSHWMAYAACASLTTGYCDETK
TVVYLGRLVESILFDRSYRKRRESTPIACRTEALVEILNTRLEVGRLRNH
LSRGMIDAATTTVFENLSLQLEYYRDGQFRKGDTSDKVQIDYIQHNAASL
LGWWHLISHSSA
119870781YP_940733.1 hypothetical protein Mkms_4752 [Mycobacterium sp. KMS]MTVNTHSEGNRASWDELSTVIKTYLVAQRIRDVDTAVATFTPDAEVTDEG
NTYRGRDEITAWLSEAGSEYTYTTEFDHASMVGAAYADVVQHLEGNFPGG
VADLHYRFTLDGSRISRLAIEP
119870778YP_940730.1 4-oxalocrotonate decarboxylase [Mycobacterium sp. KMS]MLSSEVREQLAADLAQAERSRVPMKPLTDGHPDIDVVDAYEIQLINIRQK
VAEGARVIGHKVGLSSEAMQKMMGVDEPDYGHLLDDMQVYEDKPVKSSNY
LYPRVEVEVGFILADDLPGAGCTEEDVLAATAAFAPAIELIDTRITDWKI
KLCDTIADNASSAGWVLGEARVSPKDIDIKSIDAVLTNNGETVAEGRSDA
VLGNPVTAVAWLARKVESFGVRLKAGDIVLPGSCTRAIDAPPGSHFVADF
AGLGSVQLAFE
119870776YP_940728.1 4-hydroxy-2-ketovalerate aldolase [Mycobacterium sp. KMS]MSTKDIFFNPIWDVRMTDTSLRDGSHHKRHQFTKDEVGAIVAALDTAGVP
VIEVTHGDGLGGSSFNYGFSKTPEQELIKLAAETAKEAKIAFLMLPGVGT
KEDIKEAQNNGGSICRIATHCTEADVSIQHFGLARELGLETVGFLMMSHT
IPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRDRVAALVAELGDDA
QVGFHGHENLGLGVANSVEAVRAGAKQIDGSCRRFGAGAGNAPVEALIGV
FDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFL
KHAIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQDSGAT
AAH
119870774YP_940726.1 ATP-dependent DNA helicase RecQ [Mycobacterium sp. KMS]MPTRDDAQALLEQLAGPQATLRDDQWTAIEALVVHRRQALVVQRTGWGKS
AVYFISAKLLRAAGRGPTVIVSPLLALMRNQVAAAERAGVRAATINSGNV
AEWEDIHARVQGGDLDVLLVSPERLNNPDFRDNVLPALAADAGLVVVDEA
HCVSDWGHDFRPDYRRIRTLIAELGQDIPVLATTATANDRVVDDVATQLG
VGGRDTLVLRGGLDRESLRLSVVHAGNPAQRAAWIAAHLGDLPGSGIVYT
LTVAQAHDIAALLREHGHPVAAYTGSTDPTEREQLEADLLANRVKALVAT
SALGMGFDKPDLGFVVHLGAPSSPIAYYQQVGRAGRATSSAEVVLLPGRE
DQEVWRYFASVAFPSEAMVRNVIDALETDRPQSTPALEPLVDLNRSRLEM
VLKVLDVDGAVRRVKGGWLSTGAPWSYDEPRYRKLDEARRREQQAMLDYQ
STDGCRMAFLRRQLDDPELREGDRCGRCDNCTGNRLPAEVDATAAEDTRQ
RLMRPGVELSPRKQWPSGLTKLGLDLSGRIHDGPATGRVIGRLTDLGWGA
RLRKVLDEPDGEVSDDMVRAATDVLAAWTWQQRPVAVLAMDSETHPILIR
SLARRLAELGRLIDLGTLQYRPGRRPVTAANSAYRVAALRDSWETPDLDV
NGPVLLVDDLTDTGWTLTMAARVVRSAGAPEVLPFALAAIS
119870772YP_940724.1 hypothetical protein Mkms_4743 [Mycobacterium sp. KMS]MHITVDYDLCEGHGQCLMAAPDVFDLPDGSDQVVVLDPDPPQSERGAVVR
AAAMCPAQALRVDP
119870770YP_940722.1 integral membrane sensor signal transduction histidine kinase [MycobacMNGSRRLRSLVVPAGDTYGLARVVVAVRAAVVLSVVLLSATGPDWMRRNP
VVLTIVLAAALVYAAVLMAHPRYEVRRTRFAWLVAALDATFTLTLIALTG
GASSPVVAVLALVVIASAARLTFLECLSLAILLGLGYLAVVSFVTAGGAA
LAPLTLGLWWALYMVFIAVLSGGLAVLIEREHRSRVDALVEAEAEHAAAA
EERDLRARLLRSYEAQQEGLQVLLHEFRTPVASLDALAGALTDTTPMPDA
DRDAAIRLAGRHARHLTDMLDALSDVNLSRQPAFSSGRVRRVDVAELVSE
AGHAVDLGPPRLRVSTTGDVSAVSIDAQGLRRVLTNLLENAARHGRDRPI
DVECERLDDRLRVSVSDRGPGVPQAALGELTGKFVSLSDRRGTAGLGLWI
VQQIIDALGGTLQFTARAEGGLTASFTVPVG
119870768YP_940720.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKTKAAVLWGLHQKWEVTELDLDAPKAQEVLVKLTASGLCHSDDHLVTGD
MPMNLPVVGGHEGAGVVAEVGPGVTEVEVGDHVVLSFIPACGRCTECARG
RSNLCVYGAAIVAGPQLDGTYRFHSGGQDVGQMCVLGTFSEYTVVPIASV
VKVDKDIPLDKAALVGCGVTTGYGAAVRTGEARDGDTVVVMGVGGLGINA
VQGARLAGARYVVALDPVAYKRERSFEFGATHAAATVEEAQALITDLTRG
TMADVCVVTTDSAEGAYVAQGLSLVGKRGRVVMTAIPHPTDTTVDMSLFD
LTLYEKQVRGCLFGSSNPRLDIPRMLELFGSGRLMLDELITREYTLDEIN
QGYEDMHDGRNLRGLIRF
119870766YP_940718.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MYPGTHAQIAPDRPAVIVAETGEQVSYRQLDDDSAALARVLYDAGLRTGD
VVALLSDNSPEALVVLWAALRSGLYITAINHHLTAPEADYIVGDSGARVL
VASAALDGLAAKVGADLPLRLSFGGEIDGFGSFEAALAGAGPRLTEQPCG
AVMLYSSGTTGFPKGIQPDLPGRDVDAPGDPIVAIARAFYDISESDIYYS
SAPIYHAAPLRWCSMVHALGGTVVLAKRFDAQATLGHVERYRITVTQMVP
TMFVRLLKLDADVRTRYDVPSLRAVIHAAAPCPVDVKHAMIDWLGPIVYE
YYSSTEAHGMTFIDSPDWLAHPGSVGRSVLGDLHICDDDGNELPAGRIGT
VYFERDRLPFRYLNDPEKTAAAQHPAHPFWTTVGDLGSVDEDGYLYLADR
KSFMIISGGVNIYPQETENALTMHPAVHDVAVIGVPDPEMGEQVKAVIQL
VEGIRGSDELARELIDYTRSRIAHYKAPRSVEFVDELPRTPTGKLVKGLL
R
119870764YP_940716.1 hypothetical protein Mkms_4735 [Mycobacterium sp. KMS]MYTQPLADAIAEAEKLVAAAPFIDSEADLLEGLQYLAGCIAACTHVAFDY
DRDHPFLHSGTGPFTKMGLDNPDTLYFGTRVQPGYDYVVTGRRGTTTDVS
FQLLGGEYTDEVVPDSATAFDDRRLDIAADGSFEWRFTPEVPSQLVIREV
YNDWSAQRGTFAIARTDTAGTAPPPLTRELIEKRYAVAGKQLVQRVKTWL
QFPQWFYNDSPPNTMVAPRLTPGGLATQYSSAGQFDLAEDQALIITLPVT
DAPYLGFQLGSLWYISLDYINHQTSLNGTQAQADPDGKIRIVVSEQNPGV
TNWCETLGHRKGFLQFRWQRVSRELTPADGPSVEVVDIGDVSAALPYYAS
NKISGEDWRARIALRQKQIGERMVG
119870762YP_940714.1 hypothetical protein Mkms_4733 [Mycobacterium sp. KMS]MSPGGRTDVGTVEDLHASAVKACGLDDFGSDDDNYREALGVLLESYRRDA
DLTEFGSKMQRFFVRNALVARLVSEAAFKQYPEHAAVAIERPIFVTGLPR
TGTTAVHRLLAADPRHQGLELWLAEFPQPRPPRETWSDNPVFRQLDAQFT
KAHEENPDYTGLHFMTADEVEECWQLLRQSLHSVSYETLAHVPTYSQWLA
RQDWTKPYQRHRRNLQLIGLNDREKRWVLKNPSHLFALDALFATYPDALV
VQCHRPAETIMASMCSLAQHTTEGWSNTFVGDVIGADSMETWSRGLELFN
AERAKHDPAQFYDLDYFALIKDPISVVEDIYRTFGIEFTDGAREAMARTH
EESQRGPRAPKHTYSLADYGLTAEQVKERFAGL
119870760YP_940712.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MSTADTLAPPSVREPRSLAFAGWLDSRPAEVRRGLRRVLVLIGLMPLIVL
LAVQAPLLSHGALLLGYGMLVLTATVSMMYLGFARYEDPSVHRSTDAGAR
DQCDFPALPPLPRVSLLVAVRDEVDGIEECVRTMVGSAYPDLEVIVIDDA
STDGTPDVLRRLAAELDVTVIFKEINQGKKHALTDGVRVASGEVLAFTDS
DCVLAPDALSRCVRALVENPRLGAVSGHARALNAADTVLTRAQDTWYDGQ
FRVAKAAEATFGNVTCVSGPLAVFRRDAIVNYLPAWANDTFLGREFRFAT
DRQLTGYVLGQVWKGQALKRRYADDPLVADHDHPERRWLVGYVRSAHVWT
TVPARFRPFLKQQVRWKKSFIRNLCFTGSFMWRRGFGAAALFYGHVLFVA
VAPLMAVRHLVWAPANGLYFLTLLYLCGVVTKGFAWALAFKISNPGNPLW
RYRLLMAVLGSMLLSWLLPYSLATIRKGTWARGAQ
119870758YP_940710.1 hypothetical protein Mkms_4729 [Mycobacterium sp. KMS]MTSPEEQDAEVDRLARSMLLLHGGHDDDHDHPAPSTGGRKSWSKAPSFAD
DEERAAAVREATRRDRERYLNSGLVAVDCRFCHVSVKVKKLGRGHTSVQW
SSEASQRCAYFSEVREAGGQPARTKACPRLADSIKHAVAEGCLEESSTAP
SPGDG
119870756YP_940708.1 MOSC domain-containing protein [Mycobacterium sp. KMS]MWRYPVKSLGGEALEQAEFGPRGVHGDRLWAVRDVERDITATARRVPALL
KATARYCAPPPPHAGPGRVPEVEITFPDGAVLRSDDAGVHAKLSELAGRE
MRLTALPPASDTSLHRLGLTDPDNSPIASMRSDFGIAEGERLPDLSMMRI
SDLTLLARYSTPPGMLVDLAPVHVMTTASLATIGAAIGEADVDVRRFRPN
VLIAADDPDDGLPESHWTGGHLTLGGVKLEVTMPTIRCVVPSRAQPGLEV
DRRITRAVAEKADRCLGSYCWVDSGGVVGVGDEVALEPHRHSRFGDATRR
GKRAVFGLATAAVDRLTR
119870754YP_940706.1 luciferase family protein [Mycobacterium sp. KMS]MKYTVSIAMGPVDELTELARCAEEVGFDAIALPDSLFYMEKQAADYPYTP
DGSRMWNADTPWVDPLIAAAAMGAVTSTLRFYTNVMKLGSRNPLLLARQV
GSVANLTHNRFGFGVGIGWAPEEFEWCGVPFARRGKRVDEMIEILKLVLA
GGMVEFHGEFFDFDRLQMSPAPSEPVPFYVGGHTDVALKRAARVGDGWTS
AMMTGEQLAETIRKLNDLRAEFGREAEPFEFQAVCIDKFGVDGHRELAEA
GVTDNIVIPWVFDGLSFDAPLEKKKDSMKRFADTYIHSGWQKY
119870752YP_940704.1 lipid-transfer protein [Mycobacterium sp. KMS]MTEIAVVGFAHAPHVRRTWGTTNGVEMLMPCFAELYEDLGITKADIGFWC
SGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKILTG
EVETALVYGFGKSSAGTLRRVLALQTDPYTVAPLWPDSVSIAGLQARLGL
DAGKWTAEQMAQVALDSFAVSERTDREKPAKSIDELLDRPYFAEPLRRHD
IAPITDGASAIVLAAGDRARELRENPAWITGFEHRIETPILGARDLTTSP
STAASAQAATGGDAGSIDVAEIYAPFTHQHLILKEAIGLSDSTKINPSGG
TLAANPMFSAGLERIGFAARHIFDGSAQRVLAHATSGPALQQNLVAVLEG
RDGKN
119870750YP_940702.1 luciferase family protein [Mycobacterium sp. KMS]MKLGLQLGYWGAQPPTNHAELVAAAEEAGFDTVFTAEAWGSDAYTPLAWL
GSSTQRMRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQRFPKPLARTREYVNILRQVWAREAPVTSDGPHYPLPLTGEGTT
GLGKPLKPITHPLRSDIPIMLGAEGPKNVALAAEICDGWLPIFYTPRMAD
TYNSWLDEGFARPGARRRREDFEICATAQVVITDDRPATFEMMKPFLALY
MGGMGAEDTNFHADVYRRMGYGEVVDDVTKLFRSNRKDEAAKVIPDELVD
DAAIVGDVDHVREQIKLWEAAGVTMMVVSARSAEQVRELAALV
119870748YP_940700.1 cytochrome P450 [Mycobacterium sp. KMS]MTQVLPSTKPDVDLTDGTFYADGPAAREAYRWMRANQPVFRDRNGLAAAT
TYQAVLDAERNPELFSSTGGIRPDQPGMPYMIDMDDPAHLLRRKLVNSGF
TRKRVMDKVPSIERLCDTLIDAVCERGEADFVRDIAAPLPMAVIGDMLGV
LPQERDMLLTWSDDLVSGLSSHVDEAAIQKLMDTFAAYTAFTMDVIAKRR
AEPTDDLFSVLVNAEVEGSRMTDDEIVFETLLILIGGDETTRHTLSGGTE
QILRHRDQWEQLVADVDLLPGAIEEMLRWTSPVKNMCRTLTADTEFHGTE
LKSGEKIMLMFESANFDESVFDNPDAFRIDRNPNSHLAFGFGTHFCLGNQ
LARLELRLMLTKVLDRLPDLRLADDATVPLRPANFVSGPESMPVVFTPTR
RVLD
119870746YP_940698.1 hypothetical protein Mkms_4717 [Mycobacterium sp. KMS]MGEPFIGSEAVTSGALTPYALRSRFRAVHPDVYVPTHAEMTATQRAKAAW
LWSRRHGVVAGQSAAALHGAKWVDASTAEVLWSNRRPPPGVRTWSDRFAD
DEVQILGGIRVTTPARTALDPAARYPLDRAVAAIDALARATHLKVADVTQ
LAERYPGRRGIRNAHNVLPLVDPGAESPRETWLRLLAIRNGFPPPTTQIP
VYDGYGVLVAVLDMGWEDIKVALDYEGAHHRGPDRFHKDIHRHDDVTELG
WIDIRVSSRDTEGGIVRRLQAAWARRT
119870744YP_940696.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MALNIADLAEHAIDAVPDRVALISGDETLTYGELEERANRLAHYLIDRGV
KKDDKVGLYCRNRIEIVIGMVGIVKAGAIAVNVNFRYVEGELRYLFENSD
MVALIHERQYSPRVANVLPDMPGLKTVLVVEDGSSEDFSSYGGVEFYAAL
GQGSPERDFGPRSEDDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFA
TGEPIADEYGLAKQAAENAPMVRYPIPPMIHGATQSATWMALFAGQTVVL
VPEFDPEEVWRTCAQHKVNLLFFTGDAMARPLLDALVAHQANGDEFDLSN
LFLLASTAALFSPALKDQLLELLPNRIITDSIGSSETGFGGSSVVAKGQT
HTGGPRVTIDKNVVVLDDDGNEVKPGSGVRGMIAKRGHIPVGYYKDEEKT
RQTFRVINGVRYAIPGDYATVEEDGSVTMLGRGSQSINSGGEKIYPEEVE
GALKGHPDVFDALVVGVPDERYGQCVAAVIARREGATLSLAELDSFIRNE
IAGYKVPRKIWWADEIQRTPAGKPDYRWAKEQTESRPADETHANHVGAK
119870742YP_940694.1 hypothetical protein Mkms_4713 [Mycobacterium sp. KMS]MLTRWTPGLALSMVVFTALLWVVPLVEAFRAGDDRGERISFGVASALLAI
PFLWVCLRIPKTLRGMGIEVDEDGVHPFDGARTDTIAWHEIAAVGFGARI
GTFRRASTRRLTGLEIYLTDAAHASRHPRLEHDWQDLAPPARGLSAGCYR
FTVSPYGAAAQQVERAVRRFRPHLWRGPFVHEGAGQRVIG
119870740YP_940692.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDFSSTEAANDLGGLVRTITESVCTPEHQRELDTLEHRFDRDLWRKLIDA
DVLSTTAPEALGGGGFGVLEEVAVLVALGRQLSAVPYLESVVLAAGAIST
FGSEQLQQDWAAPAVAGEKVLTVALEGEMGQGPVQAQSDGAGHRLTGSRT
LVPFGPVADAFLVPAESDGGVQVFLVSTADAGVAVDTLDTTGHGSVGHLE
LSGAEVDAARVVGGADVLAWLTARHALARAAFQLGVLERALELTATYARE
REQFERPIGSFQAVSQRLADGYIDIKGLRLTLTQAAWRTSEGLPADIDVS
SAAFWAAEAGHRVAHTAVHVHGGVGIDTDHPIHRYFLSAKQTEFAVGGAT
GQLLRIGRELADTPV
119870738YP_940690.1 FdxD protein [Mycobacterium sp. KMS]MRVEVDRDRCEGNAVCVGIAPDLFDLDDDDYAVVKHDPVPADMEDVAEQS
IAECPRAALNRRD
119870736YP_940688.1 hypothetical protein Mkms_4707 [Mycobacterium sp. KMS]MKEQLAAPARAVGGFVEMSIDTFVKTFRRPFQFREFLDQTWMIARVSLIP
TLLVAIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTFVALLL
NGLVCAIGLAGGYVFSVFLQGVNPGAFINGLTVLTGLGELVLAEIKALLF
GVVAGLVGCYRGLTVQGGPKGVGIAVNETVVYAFICLFVINVIMTAVGVR
VLVR
119870734YP_940686.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MAAIVAAAAVFTYLSYTAAFTSTDTVTVVSPRAGLVMETEAKVKYRGIQI
GEVKEIEYAGDRAKLTLAIRSDEMKYIPANAPVRIAGTTVFGAKSVEFIP
PENAQQTSLRPGAEVQASNVQLEVNTLFQTLTDVLGKIDPINLNATLSAL
GEGLRGNGDDMGALLEGLNYYVGQLNPKLPTLQEDLRKAGVVANIYGDAG
PGIARILDNAPTISNTIVDQQHNLNTTLLAATGLANNGTATLEPAADNYI
AAIQRLRAPLKVAGEYSPEYGCMLKGTARAIERFAPIIGGIRPGLFVSSN
FLPGSPAYTFPESLPIVNATGGPNCRGLPDLPSKQYGGSWYHTPFVVTDN
AYVPYQPNTEVQFDAPSTAQFLFNGAFAEKDEY
119870732YP_940684.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MARPDSANPLRTGIFGIVLVTCLVLVSFGYTGLPFFPQGKSYEAYFTDAG
GIIPGNDVNVSGITVGKVDGVELAGDVAKVNFTVDRKVRVGDQSMVAIKT
DTVLGEKSLAVTPQGAGSSTVIPLGRTTTPYTLNTALQDLGNNVGELDKP
RFEQALATLTDSLREATPQLRGALDGITNLSRSINARDEALEQLLGHAKR
VSDTLAQRAGQVNQLIVDGNLLFAALDERRQALSNLIAGIDDVAEQLSGF
VNDNRREFGPALEKLNLVMDNLLERREHIKEALRRLPPYATTLGEVVGSG
PGFQVNLYGLPPAPLAEVLLDTYFQPGKLPDSLSDYLRGYISERMIIRPK
SP
119870730YP_940682.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MTLRRNVSRVGYRSIVLGSGALLLAGCQFGGLNSLNMPGTAGHGAGSYKI
TVQLPDVATLPQNSPVMIDDVTVGSVSGINAVQRSDGTFYAAVELALDGN
VNLPENSTAKVAQTSLLGSQHIELAPPQGEPEIGKLREGSQIPLERTGRY
PTTEEVLSSLGVVVNKGNLGALQDITDEAYAAVAGRQDSFTDLVPRLAEL
TTSLDRQTGDIIAAAEGLNRFAGILARSRDSLGRTLDTLPAALDVLNKNR
ANIVDAFAALRSFAIVGSRILSQTKDDFAADFKDLYPVIKSLNDNVDDFI
KSLEFLPTFPFHYTYLRNAVRGDYLNVFTTFDLTLRRIGESVFTTSLGLD
PNMKRISEVVNPPDFLTGAMANLSGQAADPFKIPPGTATQHEAAP
119870728YP_940680.1 hypothetical protein Mkms_4699 [Mycobacterium sp. KMS]MTEQSASTAKPVRRRASRAAGPARGSATEPVGLRVEAPATVRVRSPLPAA
PPPRRQPHRKLVAAVALGVLALALAAVTTLVGVWSAQQRDADATQAREQR
FVDTASQTVVNMFSYTQDTVDESVNRFVDGTSGPLRDMLSQGENVDNLKA
LFRETEASSEAVINGAALEKLDPIADNASVLVAVRVTITDIDGNNQPSQP
YRLRVIVHEDDNGHMTGYDLKYPDGGN
119870726YP_940678.1 alpha-alpha-trehalose-phosphate synthase [Mycobacterium sp. KMS]MASEGDPGVGSGDSDFVVVANRLPIDMERLPDGSTSFKRSPGGLVTALEP
LLRKRHGAWIGWAGIPDSAEDPIEDDGLQLYPVSLSADDVADYYEGFSNA
TLWPLYHDLIVKPIYHRKWWDRYVEVNRRFAEATARAAAEGATVWVQDYQ
LQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPWRTEIIEGLLGADLV
GFHLPGGAQNFLYLARRLTGANTSRATVGVRSRFGEVQVGFRTVKVGAFP
ISIDSDELDGKARNRAVRQRAREIRNELGNPRKILLGVDRLDYTKGINVR
LEALSELLEDGRVDSHDTVFVQLATPSRERVQSYIEMREDIERQVGHING
EFGDVGHPIVHYLHRPIPRDELIAFFVAADVMLVTPLRDGMNLVAKEYVA
CRSDLGGALVLSEFTGAAAELRQAYLANPHHLEGVKDAIEAALNQDPEEG
RRRMRALRRQVLAHDVDRWARAFLDALADTRAGAKPVRD
119870724YP_940676.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MADAEQVTYETLDDGRIARIWLNRPHTQNAQSRTLLVQLDEAFGRAEADD
QVRVVILAARGKNFSAGHDLGSEEAIAERGPGPAQHPTFRINGATRPAIA
EKIYLQEWHYFFENTRRWRDLRKITIAQVQGNAISAGLMLIWACDLIVAS
DDAKFSDVVAVRLGMPGVEYYAHPWEFGPRKAKELLLTGDSIDADEAHRL
GMVSKIFPRAELEDKTVEFARRIAALPTMAALLVKDSVNAAADAMGFTEA
LRHGFHIHELGHAHWAAHNENRVAVGMPPDVPDWRELGAPKLARRDEP
119870722YP_940674.1 hypothetical protein Mkms_4693 [Mycobacterium sp. KMS]MGPSTSYRLLQIALAVFGTVALLLYPLAVVWPSGWAWHQGAPHQSDYFMM
IVGLYATLGVFLWIAARRPEAHLSLIWFTVCSSVVHAVIMAVQSFGSGHH
MGHLLGDVPALLLMAVVLSALVQVSGVGQRSDHPA
119870720YP_940672.1 2Fe-2S iron-sulfur cluster binding domain-containing protein [MycobactMHELPVELTVNGRNHRGVVEPRITLADFLRETCGLTGTHLGCEHGACGAC
TVLLDGQAVRSCLVFAVQADGQEVTTVEGIAGPDGELSPVQAAMKECHGL
QCGFCTPGFVTSITALLADNPDPSDEEIREGLSGNFCRCTGYQGIVNAVR
LAAERTRNGQTVSP
119870718YP_940670.1 carbon monoxide dehydrogenase subunit G [Mycobacterium sp. KMS]MELNNEFRVAVPAAKTWEVLTDVERVAPCLPGATLLSVDGDEFTGAVKVK
VGPITVSYQGVAAFQEKDAAAQRVVLRASGKETRGNGNAAAVVTAQLKDE
GDATHVVINTDLTISGKAAQFGRGVLADVASNLIGQFAKALEADVLGDAP
KATTAPTTEAATAAAQPAAGDSVDLLKVVAVPLAKRFAPVVAGVAAGAAV
GFLIGRRRRRAHPAAVLAEDLQAALARLLGPLSPADRLRP
119870716YP_940668.1 hypothetical protein Mkms_4687 [Mycobacterium sp. KMS]MTVWEFVLGVAVGLALTWLALVVVLLIARPRDGMLREALRILPDVLRLIR
RLAADKSLPAGVRVRLALLLAYLAMPFDVIPDFIPVLGYADDAIVVTIVL
RGVVRRAGRDAVRAHWPGSDDGFEALARLTGWSSGTAA
119870714YP_940666.1 dehydrogenase [Mycobacterium sp. KMS]MTVIGFHCSHEQIDPAQLLKDVQHAEQAGFTAGMSSDHFSPWSERQGESG
FAWAFLGAALATTDLPFGVVNAPGQRYHPAIIAQAIATLAQMFPGRFWAA
LGSGEASNERITGQAWPRKEVRDARLVECVDVIRRLLRGEEVSHEGLVEV
NRARLWTLPEVTPDLVGPAVTPQTAARHAAWADGLITVNQPPEKLRAVLD
AYRQAGGRGPARLQIHLSWAASDDEAMAIAHDQWRNNVFDPPVSWDIETV
DAFDVIGSAVSTEKVSGAVRVSADLGRHAEWLAEYVEQGWDELYLHFVGQ
QQAGFIDAFGEHVLPQLSPTAPTSSAAIA
119870712YP_940664.1 hypothetical protein Mkms_4683 [Mycobacterium sp. KMS]MMLPSQHFGHRAVIGAIGAGAVAGAVFFGGAAVASAQPPVPPPPNCSPAD
WAGVRAGVAAALSTYLFTHPPVNEFFATLKGQSRDQMRPQVQEYLDANPQ
VRAELQGIKQPADDFLNRCNQQPNPSDTPLP
119870710YP_940662.1 hypothetical protein Mkms_4681 [Mycobacterium sp. KMS]MPVKAIGLPSGFVPRRPLLVISHREVTGARWAMNRSATWSSAPAAGGAQT
PGMEPSVGIELVITHNVVDDGGAGHGQDSSIRFLVGRTRCLPTGCESSGD
LEDR
119870708YP_940660.1 hypothetical protein Mkms_4679 [Mycobacterium sp. KMS]MLRVGCEISVSRRLHCPYTGGMDFGKNLMQLATAPARIGLAAAETSLGIA
TSAIGVAKATLGEGDPRVTGNPGAFAQMLGINDAVERANRLARLMDEDQP
LGRALAPDGPVDRLLKPGGVVDRLTAPGGVLDRLTQDDGGLMRAIEPGGL
VDQLLDEDGLVERLLAEDGIADRLLADGGLIDKLTARNGPLEQLADVADT
LNRLTPGLEALAPTVEALREAVIALSQVVNPLSNIADRIPLPGRRLGRRT
PTTPTTAVRSQRVIDVEE
119870706YP_940658.1 integral membrane sensor signal transduction histidine kinase [MycobacMRGGVPLRLGLVAATLVLVAFGLLASGIAVTSIMRHSLESRVDQTLLDAS
RSWAQAPRQLPVAPLAGPNPARPPSDFYVRGTGPDGRMWTAVNDREAEPV
LPSSNDVGPVPVTVRSVNHSDVEWRAMTVRGPGGALTTVAIDLSEVQSTV
RALVWSQIGIGAAVLLVLGVAGYAVVQRSLRPLTEVEETAAAIAAGQLDR
RVPQRDPRTEVGRLSLALNGMLAQIQRAVASSESSADAARTSEERMRRFI
TDASHELRTPLTTIRGFAELYRQGAARDVEMLMNRIESESRRMGLLVEDL
LLLARLDAQRPLERHRVDLLALATDAVHDAQSIAPERTITLQVLDGPGTP
EVVGDEARLRQVLGNLVANALQHTPKHAGITVRVGTDETNAVLEVCDEGP
GMTEEDARRVFERFYRTDSSRARESGGTGLGLSIVDSLVLAHGGTVRVTT
APGQGCRFTVHLPRFSDVPVETA
119870704YP_940656.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MAELLSAQGAGVVVSGRNPDAVEQAAQRVSGVGCAGSPADPEIADALIER
CVSEFGRIDILINCAGTPEPPGSSILNVSSAQFRELLDAHLGTVFETCRA
AAPRMVAQGGGAIVNTSSFAFVGDYGGTGYPAGKGAVNGLTSAIAAELKE
HGVRANVVCPGAKTRLSSGDEYEQHVTELNRRGLLDDVSLQGALDAAPPE
YVAPTYAYLVSDRAHGVTGRIFIAAGGFVGEFARQSPGFLGYRDHHDSPP
WTVEELHELIGG
119870702YP_940654.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKTKGALIWEFNQPWSIEEIEIGDPVKDEVKIRMEASGMCHSDHHLVTGG
IPMAGFPVLGGHEGAGVVTEVGPGVEDLAPGDHVVLSFIPSCGRCPSCQA
GLRNLCDLGAGLLGGTAVSDGTHRIHAKGQPVFPMTLLGTFSPYMVVHKS
SVVKIDPSVPFEVACLVGCGVTTGYGSAVRAGDIRPGDDVAVVGVGGVGM
SALQGAVNAGARNIFVIEPVEWKRDAALKFGGTHAYPDLESAFAGIAEVT
QGLMAKKVIVTVGELHGNDVDNYVNLTSKGGTCVLTAIGSMLDTQVTLNL
AMLTLLQKNLQGTIFGGGNPHFDIPQLLSMYKAGKLNLDDMITRQYKLEQ
INEGYSDMLEGKNIRGVIRYTDNDW
119870700YP_940652.1 hypothetical protein Mkms_4671 [Mycobacterium sp. KMS]MGSYRIELDADLCQGHAMCELEAPDVFSVPKRGIVEITDPEPPDDLREDV
ERAVDMCPTRALSIVEK
119870698YP_940650.1 short chain dehydrogenase [Mycobacterium sp. KMS]MPRFEPLPDRRPALVAGASSGIGAATAIELAAHGFPVALGARRVEKCQEI
VDTIRAEGGEAIAVHLDVTDPDSVKAAVEQTTSELGDIEVLVAGAGDTYF
GKLADISTEQFESQIQIHLIGANRVAGAVLPGMIERQRGDLIFVGSDVAL
RQRPHMGAYGAAKAALVAMVTNYQMELEGTGVRASIVHPGPTKTSMGWSL
PAELIGPALEDWAKWGQARHDYFLRAADLARAITFVAETPRGGFIANMEL
QPEAPLAHTKERQQLKVDEEALSGASEATRE
119870696YP_940648.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSSDAVAALPERPRNRRQEETFRKVLSAGVEMLRESSYADLTVRAVAARA
RVAPATAYTYFSSKNHLIAEVYLDLIRQVPYFTDVNDSMPTRVDKALRSM
TLILADEPEVAAACTTALLSNSDAAVRTARDRIGAEIHKRITSAIGPGAD
PRKVSALEMTFFGALVNAGSGVFTYHEIADRLTYVVGLVLGEDQMNKSSG
DTQ
119870694YP_940646.1 short chain dehydrogenase [Mycobacterium sp. KMS]MVNYGDEFKDKVAIVTGAGGGIGQAYAEALAREGAAVVVADINVDGAQKV
ADGIKGEGGNALAVRVDVSDPDSAKEMAAQTLSEFGGIDYLVNNAAIFGG
MKLDFLITVDWDYYKKFMSVNLDGALVCTRAVYRKMAKRGGGAIVNQSST
AAWLYSNFYGLAKVGINGLTQQLATELGGQNIRVNAIAPGPIDTEANRTT
TPQEMVADIVKGIPLSRMGQPEDLVGMCLFLLSDQAKWITGQIFNVDGGQ
IIR
119870692YP_940644.1 carboxymuconolactone decarboxylase [Mycobacterium sp. KMS]MDELRRKGLAKMNEVYGWEMPDMPGDYFALTADHLFGTIWSRPGLSMREK
RMMTLTCVTALGITDLAEIQVNAALANGELSEEELKEMAIFLTHYLGFPL
GSKLDGVVTKVAGQRKKAAAKGAGEDKKANVNAALNMHSGSSLDDE
119870690YP_940642.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MRTHGWSGSAPASDEEAVERILAAAGRAIDERGADLSIADVARTLGVTRQ
TVYRYFPSTEALLVEAAVHAAADFLDRLAEHVRGITEPADAVTEAIATAL
EWLPEDKHIGLLVTPGRADAHSESVTSDVALQFAKAMVRRFDVDWTGLGF
SDQDLDELAEYLLRIIQSFVVDPGRPPRTGEALRGFLRRWVGAAVRR
119870688YP_940640.1 phosphoribosylamine--glycine ligase [Mycobacterium sp. KMS]MRVLVIGSGAREHALLLALRRDPEVEALAVAPGNPGTAAVADQHDVDITS
GEAVAELARRIGADLVVIGPEVPLVLGVADAVRAAGVACFGPSRSAARIE
GSKAFAKDVMNAAGVRTAASEIVDNPAHLDAALDRFGPPAGEAAWVVKDD
GLAAGKGVVVTADRDAARAHAASLLDSGHPVLLESFLDGPEVSLFCVVDG
ETVVPLLPAQDFKRVGDGDTGPNTGGMGAYAPLPWLPADITTSIVDDIVK
PVAAELVQRGSSFSGLLYAGLAITSRGPAVVEFNCRFGDPETQSVLALLD
SPLGQLLHAAATGRLAEFPELQWRDGAAVTVVVAAENYPGRPRVGDVITG
ADAEGVLHAGTARRDDGAIVSSGGRVLSVVGTGADLDAARTAAYSTLASI
RLPGSHFRSDIGLAAAEGKITL
119870686YP_940638.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MLIVTAAVTPKGERRRYALVSAAADLLCEGGFDAVRHRAVARRAGLPLAS
TTYYFSSLDDLIVKAVEYEGSREAERLQQRVAALSRRRRGAEATADVLVD
LLLGDAPGTRGGEELISRYERYIACARQPALRDAQRRILRQRTDAVVAVM
ERSGRTVRADFLTALVCAVDGAVVAALVGDGDGPRATARATLIDVIDVLA
PVG
119870684YP_940636.1 hypothetical protein Mkms_4655 [Mycobacterium sp. KMS]MYFVGIDLAWGERSPTGVAVADSDGSLVHLAAATTDADIVAQLMPYTAEQ
CLLAIDAPLVVTNPSGNRPCEAALNRDFRAFEAGCHPSNTGHPWFASGSR
GARLAEALGAPAVEVYPHAATVALFGLPKTLKYKQKPGRDVAQLRGELLR
LIGLVETLIRADPSLNVGQHAGWVALRDAVRTATRKAELRRAEDPVDAVV
CAYVALFATRRPADVTSYGDDATGRIVTPALRRAATPGAWGR
119870682YP_940634.1 cytochrome P450 [Mycobacterium sp. KMS]MRLSQIDFTDLDNFANGFPHDLFAIHRRDAPVFWHEPTEHTPDGEGFWSV
ATYAETLAVLRDPDTYSSVTGGERPFGGTLLQDLPIAGQVLNMMDDPRHA
QIRRLVNSGLTPRMIARVEDDLRQRARILLDEVGDGEAFDFLPQVAAELP
MQMICILLGVPEDDRHWLFEAVEPGFDFRGSRKASIDRLSVEDAGSRMYT
YGSELVARKRAEPGDDMLSVVAAESWLSDAELYLFFYLLFSAGAETTRNS
IAGGLLALIENPAAFDALQADPSSLPGAIEEMVRWTSPSPSKRRTATRDT
ELGGHRISAGQKVLVWEGSANRDAAVFADADVFDVARKPNPHLGFGQGVH
YCLGANLARLELRVLFEELLARFASVRLVEPVEWARSNRHTGIRHMVVRL
QA
119870680YP_940632.1 hypothetical protein Mkms_4651 [Mycobacterium sp. KMS]MTGPGETPHLPATNPLATTAPPPHHRRRARRWAPRGALAFLTLSVVLVVV
FVVARPDWFDGENGESVPPELLFATTLADLGHRDGIRLSDDNTTSATVTT
AVPVDSRLEDARLVLGGRTQAPTSGVTFLRVLADGEAVYVTELRSGDNDL
TADIPLPATVTDDGSVTVQIRLTGSLDQRWCNPDHEIGALVMLDPEATRI
RGRLDQRLRTVRDVARGLDNVVTLVLSATRNDREWYETAAELGVALRHTG
RQVRYVDGVSENPGEGTRILLGPPESLEEAGWTPVDDQAGAVRVGYLDDT
SVLAVTEAGGPPAEALDSLLTTDVVTTADSAANAPRRDEREPVGGDAVPL
AALGLDTSAQQLTDSRNWRLRYSTADLPGGRVPSEVRLDLQVPVVAADAP
WLVQVRLNGQLLDSVRLPADLDAHSVTARIPEGIEALRNQLIVTVLRERV
TGGCAVRPTVYQAQLLPTSTLLLGGRGVGLAAVPSDLAPGFEVHLPASSV
DDPEVSLAALVPTLAEFTGVGDRAPFVWDGAPGVRPFLLFGDAPAGVDVP
VRVVGGRLVGAGFDLQAFRDGLVVQRAAAGPTPGVVVTPVGRPPDVLPGY
GRESARLVTGDGVGVAVDDAGRLDGPLPVRDP
119870678YP_940630.1 hypothetical protein Mkms_4649 [Mycobacterium sp. KMS]MTSRFVPYATTPGRLLGQLISDIVIAVWVLIWLFVGMAVHSAVATIAQVG
RQVETGANGIADNLESAGDQTKDVPLLGNALRGPLNAAGEAALDIANAGH
SLDTTASWLAWVLALAVASPPILAVAMPWVFLRVRFVRRKWTAITLAATP
AGQQLLALRALANRPLAKLVSVDADPVGAWRNQDVAAISGLAALELRSAG
VARLRR
119870676YP_940628.1 oligopeptidase B [Mycobacterium sp. KMS]MTVPPPQAKRVEQRREHHGDVFIDPYEWLRDKSDPEVLAHLEAENAYTEA
QTAHLAPLRQKIFDEIKARTKETDLSVPTRRGNWWYYGRSFEGKQYGVHC
RCPVADPEDWTPPVLDENTTIDGEQVLLDENVEAEGHEFFALGAATVSID
GNVLAYSVDTVGDERYTLRFKDLRTGEQYDDTIVGIGAGATWAADNRTIY
YSTVDDAWRPDTVWRHRLGAGLPAERVYHEPDERYWLGVGRTRSDKYLII
AAGSAVTSEVRYADASDPEAEFAVVWPRRDGVEYSVEHAVVGGEDRFLIM
HNDGAENFALVDAPVADPGAARTLIEHREDVRLDAVDAFAGHLVLSYREE
ALPKIQLWPLGADGSYGRAEDITFDTELTSAGLGGNPNWDAPKMRIAATS
FVTPVRIYDLDLATGERTLLREQPVLGGYRPEDYVERRDWAIAPDGARVP
ISIVHRAGLQFPAPTLLYGYGAYESCEDPRFSIARLSLLDRGMVFAVAHV
RGGGELGRPWYEQGKMLEKGNTFTDFIAVARHLIATDTTRPQNLVALGGS
AGGLLIGAVANLAPELFAGFLAQVPFVDPLTTILDPSLPLTVTEWDEWGN
PLEHEHVYHYMKSYSPYENVVAKDYPPILAMTSLNDTRVYYVEPAKWIAA
LRHTKTDGNPVLLKTEMSAGHGGISGRYERWKEAAFQYAWVLATADPETY
DNRSPN
119870674YP_940626.1 glutathione peroxidase [Mycobacterium sp. KMS]MTESYLLDIELNTLDGTSTSLRELADGAVLVVNVASKCGLTPQYSALEKL
AQDYGDRGLTVIGVPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTDV
NGADRHPLYAELTQTPDAGGEAGDVQWNFEKFLLAPGGEVVNRFRPRTEP
DAPEVISAIEAVLPK
119870672YP_940624.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MQLTHFGHSCLLASFSDGSASETTVLFDPGTFSHGFEGITGLSAILITHQ
HPDHADVNRLPALLDANPQAALYCDPQTAQQLGGSWRAVHAGDAFTVGHL
TVRGVGGHHAIIHPELPEIDNISYLIGDGDHPARLMHPGDALFEPGEPVD
VLAAPAAAPWMKISEAVEYLRAVAPAHAVPIHQGIIDPSARGIFYGRLSE
MTDTDFRVPDEENGTEF
119870670YP_940622.1 phosphoribosylformylglycinamidine synthase subunit PurS [MycobacteriumMAKVVVHVMPKAEILDPQGQAIVGALGRLGVTGVSDVRQGKRFELEFDGD
VTDETVAEIAESLLANTVIEDWSVSREGA
119870668YP_940620.1 sodium:dicarboxylate symporter [Mycobacterium sp. KMS]MKVLAHPAVQIGIAAIAGLAFGLSVGEWAANLKFIGDMFIRLIQMSIVPL
VMASVIVATGSMNGAGTGRIALRTFKWMLGFSAVAAVLAWLLGELIRPGA
GMVFDGELDSELAGSADEALGWQETLLNFVSTNIFDAMSTASMVPIIVFS
LLFGLALRTQINKTGDTRVLTLIDQIQQVVLTMIRLVMYIAPIGVFCLLA
ALAGDVGFAVVTSALKYLGATLLGVLILFALFVVVVTLRTRLNPAKLPGK
LAEQTAIAITTTSSAVTFPTVLKNTVEKFGVSQKIANFTLSIGLTMGSYG
AVLNYVIVVLFLAQAGGVDLSFGQIAFGMGLAILLNMGTITVPGGFPVVA
MFLATSLDLPFEAVGLLIAVDWFAGIFRTFLNVNGDTFVAMLVANADDEI
DRDVYNGTKTMIADEIDLEELEGAMARADDAD
119870666YP_940618.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MAMTVEMITFDCTDPDALAQWWAEAVGGEVTALEPGEFVVVIREGGPRLG
FQKVPDVTPGKNRVHVDFTAADVDAEVSRLVGLGASETARHSFGDEFSWV
VLTDPAGNAFCIGSA
119870664YP_940616.1 hypothetical protein Mkms_4635 [Mycobacterium sp. KMS]MGLTAPSAGALALPGIGEVPGTEALDLNLALPGAGEFDPAAVPNLGFLLD
ALGVDLSGLIPGLLGDLPITGAGLNIITTGPPFGALALLGANPFWVPAYP
PLIANEINETPYGIVATIPNIFVPGGPPLSIPLGNVRLPIVIAFGLGSLA
TGMAYPDVVADLPNQPGGSESTLPGPSLTVLPLILLRNPGRADGGIAARF
APVLDPILGLFGFNSVVTPDVDVETDGSAILVPIKVDATVEYDPLSDFAA
WPNPFTLANNAAAFAFPTYILRGADLAGFLPQLTEPVLGTAESAILNFLL
GPILTELPPQVLLPNVLTEDALNTFLTLESDALPLLEPFRYPTDFANLFT
GGAFGFTNPFADAVEPALKILVNLGYTNVTQDMSNPLDPYPRDFTGDFGS
DYAPFFTFPENVDWGQVPGDLATAFAAGVQNAFFTGIPGVKGPLAGPNPL
AIIAGLLGLPTGPAELPELLTAFPDLADIIGGNLGLPGLNSTSTLAAAAA
PAVGGSDDPLTRLGETLARTLNIAFEREAPVDYTPPSGPVDSAFDVTEGL
SASALRLLAATVLGPTRLAALAEGGPEALADLIENTVDAPLWIADPALYG
LRDALPEDAADTVTEFRDSLWTLTERINEALLGALEDLPNAPADVTITSE
QAKGGVDDEDIEATLKVAGTEQPGQPAGEVKSDLPPAEADVDPGAVLEGE
ESATPKGDKKVTGGGQIKGGQLSKTIERSIDRVGDRLNDAADDLRDGVKK
ALTPPSRSTTVSDNDTETDKEPAA
119870662YP_940614.1 phosphoribosylformylglycinamidine synthase II [Mycobacterium sp. KMS]MTQELAPTLDTVERAAATPDQPQPFRELGLKDDEYQRIREILGRRPTDAE
LAMYSVMWSEHCSYKSSKVHLRYFGETTTEKMRSTMLAGIGENAGVVDIG
DGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLR
FGAADAPDTKRVLDGVVRGVGGYGNSLGLPNIGGETVFDPSYAGNPLVNA
LCVGAMRKEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFSGDE
SGAGRKKLPSVQVGDPFMEKVLIECCLELYAADLVVGIQDLGGAGLSCAT
SELASAGDGGMRVELDQVPLRAANMTPAEILSSESQERMCAVVTPDNVEA
FLAVCRKWEVLATVIGEVTDGDRLVITWHGDTVVDVPPRTVAHEGPVYQR
PVTRPDTQDALNADTSADLPRPATGDELRATLLAMIGSPHLCSRGYITEQ
YDRYVRGNTVLAEHADGGVLRIDEATGRGIAVSTDASGRYTALDPYTGAQ
LALAEAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGCA
ALGIPVTGGNVSFYNQTGSTAILPTPVVGVLGVLDDVKRRIPTGLGTEPG
ETLMLLGDTRDEFDGSIWAQVTAGHLGGLPPKVDLEREKLLADVLTAASR
DGLISAAHDLSEGGLIQAVVEAALAGETGCRVLIPENFENGTGPFTFLFS
ESAGRVLVAVPRTEESRFRAMCEARGLPITRIGVVDPGSDAVEVQGHFTV
PLAELRTTSEGVLPGLFG
119870660YP_940612.1 abortive infection protein [Mycobacterium sp. KMS]MRRNEVAALTLATALVALSGLVSPRLPERWAAVVHAVFGASLAAATRAPL
GLRPPALRGGLGAGATAAAVVTTGVAAASAVPGVRSAMKARDLPAAPTRW
LILRIPLGTVWAEELAYRGALGYLGASAFGPTRGRLLQSVAFGLSHIADA
RAAGEPVVGTVVTTGIAGWVFAWLAERSGSLVAPMLAHLAVNEAGALAAL
AVQRPLRSAVRD
119870658YP_940610.1 hypothetical protein Mkms_4629 [Mycobacterium sp. KMS]MAARRTADPAQTRAAVSAVVDWLRDDTAAPPGRTEIAEAVRLTARTVAAL
APGASVEVRVPPFVAVQCIAGPTHTRGNPPNVVETDPRTWLLIATGLLSF
DEAAASGGLHLSGSRAGELANWLPVVTPGM
119870656YP_940608.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. KMS]MVDNIRCLVTGATGYIGGRLVPALLDRGLQVRAMARTPGKLDDAPWRAQV
EVAKGDLMDRESLAAAFEGMDVVYYLVHSMGTSKNFVAEEAESAHNVVAA
AKQAGVRRVVYLSGLHPEGVELSRHLASRTEVGEILIDSGIETMVLQAGI
VVGSGSASFEMIRHLTDRLPIMTAPKWVHNKIQPISIDDALYYLVEAATA
VVPSSRTWDIGGPDVLEYGDAMQVYADLAGLRPRRFVVLPWLTPTLASHW
VGLVTPISSGLARPLVESLECDAVTHENDIDAVIPHPPGGLTGYRKSVAA
ALRENGTAATGGRRHLLRINPAVAQ
119870654YP_940606.1 phosphoribosylaminoimidazole synthetase [Mycobacterium sp. KMS]MTERAEQHGISYASAGVDIEAGDRAVELFKPLAAKATRPEVRGGLGGFAG
LFALRGGYREPVLASSTDGVGTKLAVAQAMDKHDTVGLDLVAMVVDDLVV
CGAEPLFLQDYIAVGRTVPERVSQLVAGIAEGCVIAGCALLGGETAEHPG
LMAPDHYDISATGIGIVEADDVLGPDRVRPGDVIIAMGSSGLHSNGYSLA
RKVLLEIDRMNLAGHVEEFGRTLGEELLEPTRIYAKDCLALAAETQVRTF
CHVTGGGLAGNLERVVPNGLMAELDRGTWTPAPVFQMIAQRGRIERTEME
KTFNMGIGMVAVVAPEDTDRALAILTARHIDCWTLGTVKKGGKDEPRALL
VGQHPRF
119870652YP_940604.1 glycine cleavage T-protein [Mycobacterium sp. KMS]MSAVPVPEGPDVGAVWHYGDPLGEQRAAADGAVVVDRSHRATLALSGAER
RSWLHTISSQHISDQADGTVTQNLSLDGQGRVEDHWWQTELDGVLYLDTE
PWRGEPLLNYLRRMVFWADVTIEPADLAVLSLLGPALADTPVLDALGLGS
LPAESTAVALPGGGFIRRLPADGLELDLLVPRAQVADWRDRLTAAGVRPA
GVWAYEAHRVAALQPRLGVDTDERTIPHEVGWIGSAVHLDKGCYRGQETV
ARVHNLGKPPRMLVRLHLDGTTDRPSTGDPVLAGGRTVGRVGTVVEHIDD
GPVALALVKRGLPADTPLTTGGDVEATAIIDADSLPDNDHVGAGRLAVER
LRGGGR
119870650YP_940602.1 hypothetical protein Mkms_4621 [Mycobacterium sp. KMS]MGWRKITAALAAAGLVVACASPESPSESGPSSSSPSGHGSYAECLNEHGV
PAAPGPNTGPPAGVDRAAWDQALKSCASLAPGPG
119870648YP_940600.1 hypothetical protein Mkms_4619 [Mycobacterium sp. KMS]MVLFYEILLVVCTLVITWFALYALYRLITDES
119870646YP_940598.1 hypothetical protein Mkms_4617 [Mycobacterium sp. KMS]MCAPPKQGLTLPASVDLEKETVITGRVVDGSGQAVGGAFVRLLDASDEFT
AEVVASATGDFRFFAAPGTWTLRALSKVGNGDATVAPSGAGIHEVDVKVA
119870644YP_940596.1 hypothetical protein Mkms_4615 [Mycobacterium sp. KMS]MSTSTDTASDPRVDVRGPRFAAWVTTGVLVATLVLSAVSPLAAAVLLGAQ
TVVFAIGARRGPRRHPYGIVFGRVIAPRLGPVTDREPAGPLKFAQLVGFV
FAAVGTIGFAAEWSAVGLIATAFALFAAFLNAAFGICLGCKLYPLAARLR
RVPTPA
119870642YP_940594.1 hypothetical protein Mkms_4613 [Mycobacterium sp. KMS]MRKVLIGLVATVTAVVVGAVGADFGTAIYAEYRWSRTLRDVANLDSDPWV
GIIGFPFVTQAMDHEFGEMEIRASGVDHPVVGKASLEATLHDVDLSETSW
LVRPDAPMAVGKVESRIIINSTHVGRFIGIPDLLVEAPTGETNDATGGTT
ESGISSNKGVVFTGTPEAAGFDERVSVAVDLSVSGPDQTTLVMTATDVLT
GAGTAEQAVPEDKTAAVLDAFSASMPGQKLPFAIAPTAQGARGSDVIIEG
IADDMTITLDGFRQS
119870640YP_940592.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MTSIDWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQVLRELPADRTRHL
VAVDPDAGAVVGYLNLAPASDTAPPMAELVVHPDFRRRGTGAAMARAGLA
EGGTHARIWAHGNLEAARATARTLGLQVVRELLQMRRPLTDLPPVTVADG
VRLATYSGPGDDPELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAG
LFMAFDDASGKLLGFHWTKVHGPDLGEVYVVGVDPAAQGRGLGATLTLTG
LHHLAERLSNSPQPTVMLYVEADNGAAVKTYRRLGFDVSSVDAAYAAVAD
119870638YP_940590.1 arsenical-resistance protein [Mycobacterium sp. KMS]MTRPVASTETPQVVAKLSTLDRLLPLWIGIAMAAGLLLGRWVPGLNTVVE
SIAVDGVSLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLVSSLLLNWV
LGPALMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAA
AVLVALNSIFQVVMFAVLGWFYLSVLPGWIGLAQTTIATSPWDIAKSVLI
FLGIPLLAGYLSRRFGEKARGREWYESRFLPTVGPWALYGLLFTIVILFA
LQGDQITNRPLDVVRIALPLLAYFAIMWGGGYLLGALLGLGYERTTTLAF
TAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVALVYVSLALR
RRFSRPVGVVRPPE
119870636YP_940588.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MVIEQDAVRRRAAVHAALADPGRLTIVDRLRLGDASPSELQVALDMPSNL
LAHHLKALEGAGLIRRVKSEADRRRTYLKLDHDALAVMVPATTRTADRVV
FVCTRNSARSQMAAAIWNGRSRIPAASAGTHPADSIHPGALAAARRHRVP
IEPQTPRRLDDVLADGDLLIAVCDNAHEELPPELDRIHWSVADPARSPQR
DAFDTALRELTDRVQHFLAALTPT
119870634YP_940586.1 phosphate ABC transporter permease [Mycobacterium sp. KMS]MAVTPDSTAVGSSAQSTSPQGVGNTPGRDTKSGKGSALKQGDGRWGDKVF
KSIAVAAGATIIGAIALMALFLIVKAIPSLQANQANFLFSTEFLTSDSDN
LRFGIRDLFMVTVLSSVFALVIAVPIAIGIAAFLTNYAPKRLARPFGMLV
DLLAAVPSIVFGLWGIFVLAPWLTPVATFLNDKLGWFFLFSEGNVSLAGG
GTIFTAGIVLAVMILPIITSVTREVFALTPRGHVEAAQALGATKWEVVRM
TVFPYGRSGMIAASMLGLGRALGETIAILIILRTAAQAGHWSLFDGGYTF
ASKIASAAAEFSAPLPTGAYIAAGFVLFALTFVVNALARAAAGGRVSGG
119870632YP_940584.1 phosphate transporter ATP-binding protein [Mycobacterium sp. KMS]MAKRLDLKDLNIYYGSFHAVADVGLAVLPRSVTAFIGPSGCGKSTVLRTL
NRMHEVIPGARVEGSVLLDGEDIYGPGIDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRNRKTLDEVAEQSLKGANLWKEVKDRLDQPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIDELKQDYTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLVEVDDTEKIFSNPTQKATE
DYISGRFG
119870630YP_940582.1 phosphate uptake regulator PhoU [Mycobacterium sp. KMS]MRTAYHEQLGALTDQLGEMCGLAGGAMERATQALLQADLVLAEQVISDHD
QIATMSARAEEAAFVLLALQAPVAGDLRAVVSSIQIVADVDRMGALALHV
AKIARRRHPQHVLPEEVNGYFAEMGRVAVELGNAAQEVLETRDPEKAARI
QEEDDAMDDLHRHLFTVLMDREWKHGVTAAVDVTLLSRFYERFADHAVEV
ARRVIFQVTGAYPTEEVIPTPR
119870628YP_940580.1 nifR3 family TIM-barrel protein [Mycobacterium sp. KMS]MPSPVVLAPMAGVTNVAFRTLCRELEVARAGTVSGLYVCEMVTARALVER
HPVTMHMTAFASDESPRSLQLYTVDPATTYAAAKMIADENMADHIDMNFG
CPVPKVTKRGGGAALPYKRKLFGQIVRAAVTATEGTDIPVTVKFRIGIDD
AHHTHLDAGRIAAEEGAAAVALHARTAAQRYSGTADWDQIAALKAHVTAV
PVLGNGDIFDADDALAMMAATGCDGVVIGRGCLGRPWLFAELSAKFTGRP
LPVPPTLGEVADIIRRHGELLTDHFGEDKAMRDIRKHIAWYLHGFPAGSD
LRRALALVKTRAELSELLARLDPDVPFPPAATGPRGRQGSAASVSLPEGW
LTDPDDCTVPAGADVMHSGG
119870626YP_940578.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSSGQRRGRWSGVPLQDRQALRRDELVTAGVKLLGGEGGPALTVRAVCRE
AGLTERYFYESFVDRDEFVRAAYDDVCSRAMSALMTAETPRDAVERFVKL
MVDDPTRGRVLLLAPASEPVLTQSGAAWMPNFIELVQHKLTRITDPAIQA
MVATGLIGALTALFTAYLDGRLSATREQFIDYCVDMLLSRVASH
119870624YP_940576.1 globin [Mycobacterium sp. KMS]MTTIYEQIGGAEALEGVVEDFYGRVLADEQLSGFFTGTNMARLKGRQVEF
FAAALGGPEPYTGAPMRQVHQGRGITMHHFNLVAGHLTDALHAAGVPEAL
VGQIIGAVAPLADEIATARTA
119870622YP_940574.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVRPAQTARSERTREALRQAALVRFLAQGVEDTSAEQIAADAGVSLRTFY
RHFTSKHDLLFADYDAGLQWFRAALAGRSPDESIIESVHSAILEFPYDAD
AVTKIAALRAEELDQGRIVRHIRQVEADFAEAVEEHLTRDRAPAAGSDER
LRATVMARCIAAAVFGAMEMWMEDDPRSLPELSRLCRTALESLEFRQY
119870620YP_940572.1 diacylglycerol O-acyltransferase [Mycobacterium sp. KMS]MKLISPTDSMFLLVESREHPMHVGGLQLFEPPDGISGADFLREIHQAMVE
QTDFQETFRKHPGTVLGGVANLAWAVDEDVDLDYHLRRSALPSPGRVREL
LELTSRLHGTLLDRHRPLWEAHLVEGLSDGRFAVYVKFHHALIDGVSALK
LTQRTLSTDPDDPEVRVPWNLPPKRRTREPESKSLLRSVTDRVGSVAALA
PSTFGLARAALLEQQLQLPFGAPKTMFNVPIGGARRVAAQSWPLERIRSV
KRATGATVNDVILAMCAGALRFYLTEQNALPDAPLIAMVPVSLRTEAEAD
SGGNMTGVVLCNLATDDDDPARRLDTISLSMRRNKQVFSQLPRVQQLALS
ASMIAPLGLGAVPGFVSTAPPPFNIVISNVPGNQEPMYWRGARLDGNYPF
SIALDGQALNITMANNGDNLDFGLVGARGSVPHLQRLLGHLEDSLKELEV
AVGV
119870618YP_940570.1 hypothetical protein Mkms_4589 [Mycobacterium sp. KMS]MTDAIDPAAPPSGSGCVECEANDGWWVHLRRCAACGHIGCCDDSLARHAS
AHWSQTGHPIIRSFEPGEDWFWNYETGTYYDGPVLADPQSHPADQPAPGP
RDRVPPDWVAQLRAR
119870616YP_940568.1 cyclase/dehydrase [Mycobacterium sp. KMS]MAVSDSREVVIEATPAQILDVIADVEATPSWSPQYQSAEILDTYADGRPR
QVKMKVKSAGITDEQVIEYTWTDSKVSWTLVSAGQLKAQDASYTLTPDGE
KTKVRFDIKVDLSVPLPGFVLKRAMKGAMETATDGLRKQVLKVAKGGN
119870614YP_940566.1 cyclase/dehydrase [Mycobacterium sp. KMS]MAVRASREVVFDASPEAILDVLADIEALPAWSSVYKKVTVLDRHPDGRPR
RVKATLRLMGITDNEILEYHWGRHWVVWDAEDTFQQRGQHVEYNLTPEGD
RTRVRFDIIVDPSAPIPQFLVKRAKKIVLHSATEGLRARVMAKTHAE
119870612YP_940564.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTTARPLRADAARNRELLLAAAEEEFAERGLDASVADIARRAGIAKGTVF
RHFATKEDLIASIVSAHIAALAAAARGLADAADPGAALLEFLTVAADQRQ
QRDLTFLQSASDDDPRVIEVRDELHAALETLVGRARDAGAIRSDITETDV
FLLMCAPIHVVENLAAPTPLLWQRYLAIIFDGLRPEGAHPLPQPAPNLP
119870610YP_940562.1 NADH:flavin oxidoreductase [Mycobacterium sp. KMS]MAFTFDDDATLLTPLQMGETFAPNRVFMAPLTRSRAQADGTPSYLAAQYY
AQRASAGIVITEATAVSQSANGAYLNTPGIYTDRHQEKWARIASAVHAEG
GRIFMQLWHVGRMGHPDISGVHPVAPSAVAADLTAHTPGGKKPLVVPRAL
EVEDIPRIVADFRAAARRAVDAGMDGVEIHGANGYLLHQFASDVVNRRAD
AYGGSAENRARLTAEVVEAVADEIGAGRVGLRISPGNGAGDVREDEPIAV
YEALLDRIAPLGIAYLHVLIDPTHTTFGVIRALWPGVLVLNTGRETDTDF
CQLESFAQWGAVSAVAVGRAFLANPDLIERLVVGAELNDPDVATFYSPGP
VGYIDYPTLAELETRESA
119870608YP_940560.1 3-hydroxyacyl-CoA dehydrogenase [Mycobacterium sp. KMS]MAENTITWEQDSDGIVTLTLDDPTGSANVMNDHYKESMHNAVERLVAEKD
SITGVVITSAKKTFFAGGDLKSMINTGPDDAEAVFENVESIKADLRKLET
LGKPVVAAINGAALGGGLEIALACHHRIAADVKGSVIGLPEVTLGLLPGG
GGVTRTVRMFGIQKAFMEVLSQGTRFKPGKAVEIGLVDRLVQSVDELIPA
AKAWIKANPEAHTQPWDVKGYKMPGGTPSSPGLASILPSFPALLKKQLKG
APMPAPRAILDAAVEGAQVDFDSASRIESRYFVSLVTGQVAKNMIQAFFL
DLQTINGGGSRPDGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKD
VSLENAQKGKAYSEKIEAKALERGRTTKEKSDALLARITPAADPADLKGV
DFVIEAVFENQELKHKVFQEIEDIVEPNALLGSNTSTLPITGLATGVKRQ
EDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTPIVVND
SRGFFTSRVIGTFVNEALAMLGEGVEPASIERAGSMAGYPAPPLQLSDEL
NLELMQKIATETRKATEAAGGTHDPHPAEAVVNKMIEIGRPSRLKGAGFY
EYVDGKRTGLWPGLRETFGVGSADIPLQDMIDRMLFAEAIETQKCLDEGV
LTSTADANIGSIMGIGYPPYTGGSAQYIVGYEGALGTGKEAFVARARELA
ERYGDRFTPPDSLTK
119870606YP_940558.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MRQASVVVITLANMALSKNDREQFLAEPHVAALSVSAGPDRGPLTVPVWY
QYSPGGQPWVLTGAGSRKHRLIEAAGHFSLMVERIEPSVRYVAVDGPVSR
IEPGTDEHLVEVATRYLPPAAVEPYLEMARREHGESVVIHLDPRHWLSSD
LGSF
119870604YP_940556.1 hypothetical protein Mkms_4575 [Mycobacterium sp. KMS]MEKISLTALAREQLELARSHNSGRSARTVYGGHEHSLRQTLIALTGGNGL
DEHDAPEEATLYVVTGRVRLGDGTSHWEGSAGDLIVIPKTRHDLAALEDS
VVLLTVLQSVGPYA
119870602YP_940554.1 ethanolamine transporter [Mycobacterium sp. KMS]MDTTHSESSDYLAKRTLKQGTAGWLLLAGLGVGYVISGDYSGWNFGLAEG
GFGGLLIAGVIIAGMYLAMVLGMAEMSSALPAAGGGYTFARRALGPWGGF
ATGTAILIEYAIAPAAIATFIGAYVESLGLFGITDGWWVYLAVYLLFIGI
HLSGVGEALKVMFVITAIALAGLIVFAIGAVGRFDAANLTDIAPTDAAGA
SSFLPFGYLGIWAAVPFAIWFFLAIEGVPLAAEEAKDPSRNVPRGILAAM
GVLLVTGSTVLVLAAGSGGAELISASGNPLVEALGDTTTSKVVNYIGLAG
LVASFFSIIYAYSRQLFALSRAGYLPRRLSVVNSRKAPTLALVVPGIIGF
ILSLTGQGAMLLNMAVFGAALSYVLMMVSHIALRVREPDMPRPYRTPGGV
VTTGFALVIAALAVVATFLVDSTAATWCLVVFAAFMAYFGLYSRHHLVAN
SPDEEFAALADAEKDIL
119870600YP_940552.1 hypothetical protein Mkms_4571 [Mycobacterium sp. KMS]MTAHTPPTGRSEATRGTTGVPLGAWLAQLPDERLIRLLELRPDLTQPPPG
TIAALAARATSRQSVKAATDGLDFLRLAVLDALLVLHADTTAVPLTKLFE
LIGGRADEGAIVVAVDDLRARALVWGDDDQVRVAAEAASGLPWYPGQAVV
ETAEHGADDIAEKLAGLDTAQRELLERLLEGSPVGRTRDAAPGTPADRPV
QRLLAAGLLRQVDDDTVILPRLVGQVLRGEAPGPTELNPPDPVTTSTKPS
DVDAVAAGAAIDVLREVDVVLEALSAAPVPELRSGGLGVRDLKRLVKATG
IDERRLGLILEVALGAGLIAAGMPEPDPGDGTSTFWAPTVAADRFIESPT
AVRWHLLASTWLDLPARPGLTGSRGPDGKPYASLSDALYSTAAPLDRRLL
LAVLADLPAGSGVDAASASRAMIWRRPRWAVRLQPEPVGGLLTEAHALGM
VGRGAIATPTRRLLAGEPPEDVVAAKAKVLPAPIDHFLVQADLTVVVPGP
LERDLAEQLAAVAAVESAGAAMVYRVSEASIRRALDTGKTASELHSFFGR
HSKTPVPQGLTYLIDDVARRHGQLRVGMAASFVRCEDPALLAQAVAAPAT
GAVELRLLAPTVAVSQAPIADVLAALRNAGLAPAAEDSSGAIVDIRSRGA
RVPAPGRRRVFRPAPTPTGQTLGAIVAVLRKVAAAPSGNMRLDPGVAITQ
LQEAALQQTSVVIGYVDPAGVATQRVVAPVNVRGGQLTAYDPASGRVREF
AIHRVTSVVSAENE
119870598YP_940550.1 molybdenum cofactor biosynthesis protein MoaC [Mycobacterium sp. KMS]MAASSQHGLSHVDESGAAHMVDVSGKDVTKRTAVAAGTLHTRPDVVALIA
SGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFEIGESHV
RVTATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDPAARIDDIAVLRK
EGGKTGTWTRP
119870596YP_940548.1 molybdopterin synthase subunit MoaE [Mycobacterium sp. KMS]MTAVVHRAAVTEDPIDLTEHEDLVSHESAGAVVSFAGVVRDHDGGRGVAR
LEYSAHPSAAQVLAEVAAEIAAESDGVRAIAVSHRVGPLEIGDAALVAAV
AADHRRAAFDTCSRLVDAVKDRIPVWKHQFFGDGSDEWVNSA
119870594YP_940546.1 sulfur transfer protein ThiS [Mycobacterium sp. KMS]MSTTTTVRVAVRYFAAARAAAGTESEDLTVPAGTTVQALVDELSSRSAEL
GRVLARCSYLCDGVAVRDTTMALANAQTLDVLPPFAGG
119870592YP_940544.1 hypothetical protein Mkms_4563 [Mycobacterium sp. KMS]MRVLLNIIWLIFGGLWLALGYAVAGILCFVLIITIPFGFAAFRIASYALW
PFGRTIVEKPGPRPGALIGNVIWVLLFGIWLAIGHLVSAAAMAITIIGIP
LALANLKLIPVSLVPLGKEIVPVDPPVPAMRAAA
119870590YP_940542.1 putative glutathione S-transferase [Mycobacterium sp. KMS]MSYVASGGEFNRDTDYITDRITADGRDGYPVEPGRYRLIVARACPWANRT
IIVRRLLGLEDALSIGFCGPTHDERSWTFDLDPDGVDPVLKIPRLQDAYF
KRFTDYPKGITVPAVVEVSTGQVVTNDFPQITLDFSTEWTAHHRDGAPDL
YPEKHRDEIDEVAQRIYTEVNNGVYRCGFAGSQRAYEKAYDRLFTALDWL
EDRLAGQRYLVGDTITEADVRLFTTLARFDPVYHGHFKCNRAKLSEMPAL
WGYARDLFQTPGFGDTVDFVQIKQHYYIVHSDINPTQVVPKGPDLANWLT
SHGREALGGRPFGDGTPPGPAREGERVAAGHTPL
119870588YP_940540.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MVDNRGVAGGRDESDGDPEDFRRDARYYPPRPPAGHDHPGMANYPSDGGT
YRRPRRQPTPSANRWLPPLDEPTPSGYQYDPPPGVGAGAGRVTVTRAAAQ
RSREMGSKMYGLVHRAATADGADKSGLTALTWPVVANFAVDAAMAVALAN
TLFFAAASGESKSKVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALAA
SFLARTALVVLLIANYDGETGSYQSWVLYPCALGMMVLSKSFSVLRSAVT
PRVLPPSIDLVRVNSRLTTFGLLGGTVVGGAFAAGAEYLLNLFHLPGALY
VIVAATIAGAALSMHIPKWVEVTAGEVPATLSYHGGSGGLRRERPSERSG
KARQPLGRNTITALWGNCTIKVMVGFLFLYPAFVAKSHDATGWEQLRILG
LIGAAAAVGNFAGNMTAARLELGHPARLVVRAATAVTAVALLTAVTGNLL
VAAVATLITSGASAIAKASLDASLQDDLPEESRASAFGRSESLLQLAWVA
GGATGVLIYTDLWIGFTTITAVLILGLAQTVVSYRGESLIPGLGGNRPVL
AEQEGRRSDAAGVGYE
119870586YP_940538.1 cyclase/dehydrase [Mycobacterium sp. KMS]MAAPLLHAEIEIDAPVATVWSLVSDLSRMPQWSPQCRVMKPLGPVRPGTK
TINLNRRNRLVWPTTCTITEVVPEKKVAFRVDANKTVWSYELEPTATGTR
LVETRNAENGVTAVSNMAVNKLMGGVPSFEEELVAGMNESLAKIKAAAES
119870584YP_940536.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MIDLESRLASDLSLAVVRLARQLRFRRAESPISLSQLSALSTLAKEGAMT
PGALAVRERVRPPSMTRVIASLAEMGLVSRNAHPVDGRQVLVSVSPAGAD
LVEAEKRASQEWLQRRLASLEPEQRKTLLMAADLMSAMVEASA
119870582YP_940534.1 hypothetical protein Mkms_4553 [Mycobacterium sp. KMS]MAAGVAAVIATAVIVLSLGLLRVHPLLAVGLNMVAVGGLAPTVWGWRNRP
VWRWFAFGAAVGVAAGWTALLAMTLSGTTPS
119870580YP_940532.1 phosphoserine aminotransferase [Mycobacterium sp. KMS]MAELTIPADLKPRDGRFGSGPSKVRPEQLQALAAAGDLFGTSHRQAPVKN
LVGRVRDGIKQLFSVPEGYDVILGNGGSTAFWDAAAFGLIDKRSLHLTYG
EFSAKFASAVAKNPFVGDPIVVKADPGSAPEPQSDPSVDVIAWAHNETST
GVAVPVQRPADSGDALIVIDATSGAGGLPVDIAQADAYYFAPQKNFAGDG
GLWLAVVSPAALARIEAIGQSGRWVPDFLSLPIAVENSLKNQTYNTPAIG
TLVLLADQLDWLNGNGGLDWAVKRTADSSQRLYSWAEASSYATPFVTDPA
LRSQVVGTIDFADDVDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFAA
VDPEDVSALTRCVDWVVERL
119870578YP_940530.1 4Fe-4S ferredoxin [Mycobacterium sp. KMS]MPHVITQSCCSDGSCVFACPVNCIHPTPDEPGFATAEMLYIDPAACVDCG
ACVSACPVGAIAPEATLTDSQLPFVELNAAFYPPRPPDEKVPPTSKLAPV
PDAPVVRSRPDGPLRVAIVGSGPAAMYAADELLTQRGVRVTMFERLPTPY
GLVRAGVAPDHQSTKRVTRLFDRVAARRELRLYLNVEVGTHLTHEDLLAH
HHAVLYAVGAPNDRRLDVDGMGLPGTATATEVVAWYNGHPDYAALPVALD
HRRAVVIGNGNVALDVARILTTDPDRLAATDIADHALAALRASRIDEVVV
AARRGPAQSAFTLPELIGLTAACDVVLDAADHELVRRDLCDETDPLTRNK
LEILAKLPDASAPATRPRIRLAYRLTPRRVTGATRADGVEFTVTGTDEVR
RLDAGLVLSSIGYRGRPVAGLPFDEADGVVPNESGRVVDPASGRSVPGSY
VAGWIKRGPTGFIGTNKSCAAQTVHTLVADYNAGALAVPSAGYGDLDRFV
RERRPDVVDSQGWRAIDAAEIARGGDRRPRVKFTSVADMLQAAAAAPEPP
LARRLLAGLLR
119870576YP_940528.1 hypothetical protein Mkms_4547 [Mycobacterium sp. KMS]MTTDPAVVFASAARSFADLVGRLPATGWDGPGLGEWDLRALVGHTSRSLI
TVSTYLQSTAAREDVTSAAEYYVKVTPAALGIDPAAVAERGRQAGRDLGE
DQAAAVASLAAKALADVDAADDPLIEVIGGLGIRLSNYLPTRTFELAVHG
LDIARAAQIDYAPPSDVLADAVRLAGDVAVVSGRGVEVLLALTGRAGLPP
AFSIV
119870574YP_940526.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium sp. KMS]MKKADNEHLARMRVEYGSVEKDGSADLDVDWLADGWVALLRRWLADAEAA
GIAEPNAIVLGTVDAGGRPVTRTVLCKSVDDTGITFFTNYGSAKGEDLAS
TPYASATFPWFALGRQVHVRGPVTKVSAEETADYWSKRPRGSQLGAWASQ
QSRPIASRAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQGR
ESRVHNRIRVHDGRIERLQP
119870572YP_940524.1 type II citrate synthase [Mycobacterium sp. KMS]MADNPSSATEHAKLSYPGGELELDIVPATDGADGIALGSLLAKTGYTTFD
GGFVNTASTKSAITYIDGDAGILRYRGYPIEQLAEKSTFIEVSYLLIYGE
LPTADQLEDFTTKIQRHTLLHEDLKRFFDGFPRNAHPMPVLSSAVNALSA
YYQDSLDPMDKNQVELSTIRLLAKLPTIAAYAYKKSEGQPFLYPDNSLTL
VENFLRMTFGFPAEPYEVDPEIVRALDMLLILHADHEQNCSTSTVRLVGS
SQANLFTSISGGINALWGPLHGGANQAVLEMLTKIQKSDGDVREFVRKVK
DREDGVKLMGFGHRVYKNYDPRARIVKEQADKILGKMGVEDELLDIAKSL
EEVALTDDFFVERKLYPNVDFYTGVIYRAMGFPTRMFTVLFALGRLPGWI
AHWREMHSEPGKIGRPRQIYTGYTERDYIDTDKR
119870570YP_940522.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MPRNPLADEVWGALTALVFDNRDSWRRAVVEETGLPFSRVRVLRRLGRQP
MTVKQVAQAATLDAPAATVAVNDLEDRGLVVREVDPANRRCKTVSLTDDG
RAVLATIEAIDDPAPEGLAALDDGELEALRATLRKLTGR
119870568YP_940520.1 hypothetical protein Mkms_4539 [Mycobacterium sp. KMS]MVAAAYLARAGRRVQMLERLDHVGGAAVSAHAFDGVDARLSRYSYLVSLL
PRRIVDDLGARIRLVKRRYSSYTPDPATGGHTGLLIGPTSTFDAVGAAAD
EAGFTDFYHRFRTVTERLWPTLTAPLMTREQIRRHVLSGADDQAWRAVTE
TPIGAAITAAAHSDLVRGVMATDALIGTFARTDDPSLVQNICFLYHLLGG
GTGDWDVPVGGMGAVSGALAAAAAGFGAEITTGAEVTAITPDGEVTYSAG
GREHRVGARFVLANVTPTVLAALLDEPAPPSAPGSQVKVNLMLRRLPKLR
DPTVTAEQAFGGTFHINETLSQLDAAHDRAAAGEVPQPLPCEIYCHSLND
PTILSDELRAAGAQTLTVFGLHTPHSLLAHGDDDRMRNTLTSAVLTSLNS
VLAEPIHDVVMEDAAGRLCIETKTTTDLEHSLNMTGGNIFHGGLQWPFAE
ADDPLDTAAQRWGVATRHPRILLCGSGSRRGGGVSGIGGHNAAMAVLDS
119870566YP_940518.1 FKBP-type peptidylprolyl isomerase [Mycobacterium sp. KMS]MNPGQKPEIDFPDGPAPTELVIEDLVVGEGPEAVPGANVEVHYVGVEYDT
GEEFDSSWNRGQSIEFPLQGLIQGWQDGIPGMRVGGRRKLTIPPAQAYGP
AGGGHRLSGKTLIFVIDLLATR
119870564YP_940516.1 two component transcriptional regulator [Mycobacterium sp. KMS]MDSGVGSPRVLVVDDDPDVLASLERGLRLSGFDVSTAVDGAEALRSATET
RPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEA
GADDYLVKPFVLAELVARVKALLRRRGSSATFSSETIQVGPLEVDIPGRR
ARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVV
DVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ
119870562YP_940514.1 ABC transporter-like protein [Mycobacterium sp. KMS]MSIETVARQTLYRQAHARGGDLHSLADRALLRRIWRFAGRHHRRLAAFVA
VSVVSATLAVATPVLAGRVVDEITRGGAASVVIGLAAVIATVALAEAGVS
LLTRWLSSNIGEGLIFDLRTAVFEHVQKMPVAFFMRTRTGALVSRLGNDV
LGAQRAFSDTLSGVVSNLVTLTLTLGVMLAISWQITVVALVLVPVFVLPA
RRIGARMAHLSRESAIHNATMNTQMTERFSAPGATLVKLFGRPESESHEF
AVRAGRVRDIGVRSAMLQSTFMNSLTLMSALALALVYGLGGVIALGGHLQ
AGAIVSLALLLTRLYAPLTALANARVEIASALVSFERVFEVLDLEPIIRE
EPDAVAVPDGPVRVEFDHVRFSYPTADKVSLASLEEVAVLDDRDDGEVLH
DISFTAEPGQMVALVGSSGAGKSTIAALLARLYDVDSGAVRLAGMDVRDV
TFESLRDTVGMVTQDGHLFHESIRANLLLAAPETESDDRLWEVLRRARLA
DVVAAMPDGLDTVVGERGYRLSGGQRQRLTIARLLLGRSRVVVLDEATAS
LDSASEAAVQQALGEALAGRTSLVIAHRLSTVRAADLILVVEDGRIVERG
THRQLIGRGGRYAELYETQFAEPEAVA
119870560YP_940512.1 ABC transporter-like protein [Mycobacterium sp. KMS]MSVTDWRGRVKENRDGDDGNLPIDGSVPRRREARALLGNLLKPYRMTVFL
LALVVVVENLARLSVPLLVQRGIDHGIPPLLEGGPARELMLIVGALCAVV
LVQAASRMFFLRRSGRIGQKVLLELRRRVFRHFQRLDLAFHDRYTSGRVV
SRSTNDVEAIQDMLETGFDSLITAVLTLVGTSILLVTLDVKLGLMCLAAF
PILVALVWWFRNESAKTYRKVRESAALVIVQFVETMTGIKAVQAYRREPR
NQEIFEDIADEYREINERTFRLLAIFMPGVKLVGNITTGVVLLYGGYRTL
NGEMTIGTLTAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAER
PGIKDPTDPVRLESVRGEISFDDVTFGYSPDRPVLPGLTVTVPAGQTVAL
VGTTGAGKTTIAKLIARFYDPTSGAVTLDGTDLRRLSQSELRRHVVMLTQ
ENFMFEGTVADNIRFGKPEATDDEVRAAAQAVGADRFIDLLPEGYDTDVA
KRGGRLSAGQRQLVAFARAFLADPAVLILDEATSSLDIPSERMVQRALET
VLSDRTALVIAHRLSTVAIADRVLVVEGGRIVEDGAPSELIGRDGGRYAA
LHQAWEQSLA
119870558YP_940510.1 diguanylate cyclase [Mycobacterium sp. KMS]MAAALSRGWWSHAHHYEWMSDYLVARGMTAAVRVMMAGIAASLSVCLLVL
LRFDGPQDTVPVAMTWTAVAGGVFGVALWARRWPTHTESVAFAVVSNAAI
ALSCLAYPNPTGALTGCISFATIAAYIAFFHSTALVVYNFAVTTAVAVIA
ALRIALSGHPAMAVVDLFIVVQINIAMPVAIHVLVRALGVDLARADRDPL
TGLLNRRAFYAHSAKLLTGGPSHGGTHLVMVVVDLDDFKRINDTYGHQVG
DEALISVGQALSRAVVGFPAEIGRSGGEEFVVAAVLETDDPAPLAEQICG
EIAALPEPVTASVGTACIALDASRGNHESTLDRMVRAADAAMYEAKRAGG
NKCHHLGEPYW
119870556YP_940508.1 epocide hydrolase domain-containing protein [Mycobacterium sp. KMS]MSAITPFRIDVPDAVLTDLKDRLANTRWPEAECVDDWSQGIPLAYTRELA
DYWANGYDWRAREAALNRFDQFTTDIDGLDIHFIHQRSSRPDAFPLIITH
GWPGSVVEFDKVIEPLTAAGFDVVCPSLPGYGFSGKPTSAGWGIERIAKA
WDELMVRLGYDRYGAQGGDWGAVITTQIGRNERGCVAIHTNMPIGRPPKD
LANPTDEEQQTLAAMAERKRWGTGYFQQQATRPQTLGYGLVDSPVGQLAW
IVEKFREWSDCDGHPENVFTRDELLDNVTLYWVTASAASSARLYWESGVG
GRGSGPVRVPTGVASFPKEIVRMPRHWCEDSYHLTHWTDMPRGGHFAAFE
QPELFADDVTAFFDSVR
119870554YP_940506.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MSTNTDLYRSARDQLVAVIGDYDKALQSFEWPRLEGAFNWATDWFDVIAR
DPITADRRALWIVEEDGREEQITFAQMADRSDRVATWLERRGIGKGDRVI
LMLGNQVELWEAMLAVAKLGAVIMPTTGALGPADLADRITRGGATAVIAN
AADTAKFTEVPGDYLRIAVGAPVAGWHTYGEAYDTVSAGPFTARTTVDDT
MLIYFTSGTTSKPKLVEHSQVSYPVGHLSTMGWIGVRPGDVHLAISSPGW
AKHAWSCFFAPWIAEATIFVYNYRRFDAAALLRQLNRAQVNTFCAPPTVW
RMLIQSDLGTKPAGLREILGAGEPLNPDVIAQVEKAWGLTIRDGFGQTET
TLQIGNTPGQPVKPGSMGRPMPGVPVVLVDPLTGRPAEEGEICLDLSRQP
VNLMTGYLDDPARNAAVTEGGYYHTGDVAQRDSDGYITYIGRTDDVFKSS
DYKVSPFELESVLIEHPAVVEAAVVPQPDDTRLSVPKAYVALAEGWQADA
DTAKSIMEYARDHLAPYLKVRRVEFYELPKTISGKIRRVELRRREEDSAG
RAIPTEYRYEDLVAG
119870552YP_940504.1 hypothetical protein Mkms_4523 [Mycobacterium sp. KMS]MSAAHRSAVLARRGCALLAVASAGLHVTSLGHAANPVAGGLLLVMIGGCL
YCAHDLWVAGSVRAWLVVALMNIAMIALHLPAPAHHHGGSAPPMPTAMSV
ATVLAMVEVTVAAAVLYIRTRHHGVALTARRDFPG
119870550YP_940502.1 hypothetical protein Mkms_4521 [Mycobacterium sp. KMS]MSENAGVAPQENPQKDQSQWVTGDEPMTGPQRSYLNTLAQEAGEQIPEDL
TKAQASETIDRLQQQTGRGTS
119870548YP_940500.1 carboxyl transferase [Mycobacterium sp. KMS]MSRIGALQLRDTVLDEGSFRSWDSAPLAVATTDSYRAELAAASEKTGLDE
AVLTGEGRVFGRRVAVVACEFDFLAGSIGVAAAERITAAVQRATAERLPL
VASPSSGGTRMQEGTVAFLQMVKIAAAVQLHKQAHLPYLVYLRHPTTGGV
FASWGSLGHVTAAEPGALIGFLGPRVYEHLYGEPFPAGIQTAENLHRHGV
IDGVVPLELLRATLDRALTVLADPPGAPPSAPPAEPPADVPAWTSVEASR
RPDRPGVGYLLRHGATDRVLLSGTGRGEAATTLLALARFGGQPAVVLGQQ
RVLGGPDPIPGRSAPALRVGPAALREARRGMALAAGLHLPLVLVIDTAGP
ALTVEAEQGGLAGEIARCLADLVTLDTPTVSVLLGQGSGGPALAMVPADR
VLAALHGWLAPLPPEGASAIVYRDLDHAAELAAAQGVRSADLLRNGIVDT
VVGEHPDAADEPLEFTHRLSATIAAELHALRDVPSQTRLQRRMDRYRRIG
LP
119870546YP_940498.1 hypothetical protein Mkms_4517 [Mycobacterium sp. KMS]MLGAALRYGFGTASVLAGGWVLRALQGTPASLGATPAEIHPVARRSGNYR
EGVFVNLEPADTISMDAEARRMLVRELFLGREKGRPGAPIPVVAPAPVTA
EAAGLAAYWHGHSTTVVEVDGYRVLTDPIWSDRCSPSRTVGPQRMHEPPT
PLEQLPAVDAVLISHDHYDHLDIDTILGLARTQRAPFVVPLGVGAHLRKW
GISDARIVELDWNESHRIGELTLVCTPARHFSGRLFSRNTTLWASWVIAG
PEHRVFFGGDTGYTASFSEIGSQHGPFDLTLLPVGAYHPAWPDIHMNPEE
AVRAHQDMTDAGGGVLLPIHWGTFRLAPHPWAEPVQRLLAAADPAGVSVV
VPKPGQRVERGASPAIEPWWQL
119870544YP_940496.1 P-type HAD superfamily ATPase [Mycobacterium sp. KMS]MTAGPAVVTAGLTEDEVARRVAAGQSNDVPTRAARTTGEIVRANVFTRIN
AILGVLFAIVLSTGSLINGAFGLLIVANSAIGIIQELRAKRTLDKLAIVG
QAKPLVRRRSGTRALAPSEVVLDDIIELGPGDQIVVDGEVVEDNNLEVDE
SLLTGEADPIAKDAGDPVMSGSFVVAGSGAYRATKVGREAYAAKLAEEAS
KFTLVKSELRSGINQILRFITYLLVPAGLLTIYTQLFTTDTGWRRAVLAM
VGALVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVNELPAIEGLARVDVVC
ADKTGTLTENGMRLSELQTLTADHVEDVLASMAADDSRPNASMQAIAEAY
PHAPGWTATAVAPFKSATKWSGVSYGAHGNWLIGAPDVLLDPSSPVAEQA
EDIGSHGLRVLLVGSSDVPVDDPAAPGTVTPVALVVLEQRVRPDARDTLD
YFATQQVSIKVISGDNALSVGAVAGSLGLHGECMDARNLPDTTEELAEEI
ESHTTFGRVRPDQKRAMVHALQSRGHTVAMTGDGVNDVLALKDADIGVAM
GSGSPATRAVAQIVLLDNKFATLPYVVGEGRRVIGNIERVSNLFLTKTVY
SVLLAVLVGLAGLASEIFGTDPLLFPFQPIHVTIAAWFTIGIPAFVLSLA
PNNERAHTGFVRRVMSSALPSGLVVGTATFTSYLLAYQGRAASETEQTQA
STAALITLLVTAIWVLAVVARPYEWWRVALVAVSALAYVVIFSIPWAQEL
FILDPTNPAITSMALGVGLVGVAAIEALWWGQGRLLGERRRLWHER
119870542YP_940494.1 hypothetical protein Mkms_4513 [Mycobacterium sp. KMS]MAKLSVSVDVPLPPEKAWECASDLSRYKEWLSIHRVWRSKLPETLDKGAR
IDSIVEVMGMPNRVNWTIVHYKPPQAMTLNGDGKGGVKVKLIGKVKPSGD
GSTVTFDIHLGGPALFGPIGMVVAGALKSDIRESLDRFKTVFA
119870540YP_940492.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. KMS]MRVVIAGGHGKIAMQVEQLLAQRGDTAVGLIRNPDHAGDLEAIGAEPLVL
DLEKATVGEVIDALRGADAVVFAAGAGPGSGAARKETVDRDAAILLADAA
EAAGVKRYVVISSMGANTEAPDDAGDPVFVTYLRAKGAADDAVRSRRALD
TTIVRPGRLTDDPGTGRVHIADSTGYGAIPREDVAAVLLAVLDTPGTVGR
TFELVGGDTPIDEAVAAGG
119870538YP_940490.1 cytochrome P450 [Mycobacterium sp. KMS]MTPTHDGLGLPHVQYGDLPMAQDRGAGWAALRGLGPVAYGDGWFYLTERE
DVLAALRNPEEFSSRIAYDDMISPVPLVPLGFDPPEHTRYRRILHQFFSP
QTLGELLPSLQAQAIEIIEAIAVHDECEVMADLATPYPSQVFLTLFGLPL
ADRERLIAWKDAIIAFSLTTDPGSVDLTPAVELYSYLTEAVAEQRNRPRD
GILSQLLHGDDPLTDNEATGLSLVFVLAGLDTVTASIGTALLELTRRPEL
RKALRDNLDNVPAFVEEMIRLEPAAPVVGRVTTRPVTVAGVDLPAGAEVR
LCLGAINRDGSDALSGDDVVLDGRLHKHWGFGGGPHRCLGAHLARMELRL
VVTEWLTRISDFELAPGFVPEITWPSATCSLPRLPLRIRAREIS
119870536YP_940488.1 hypothetical protein Mkms_4507 [Mycobacterium sp. KMS]MTTTDEKTEDLPPGTTPYYARMHKWIKRAVLVCLVALVIEGAFTLPFMAV
YYGYPTLSLTEICSELLKVRYSDDALECQVPYPAFGPPEGAEGKDTAQDE
WGIQPVPKYNRIGFRELVRIHEEREARQAAEQQQGP
119870534YP_940486.1 ATPase [Mycobacterium sp. KMS]MTTDTYYANGTEVQLFEQAFHQRLPVMLTGPTGCGKTRLVEHMGSLLGRP
VVTISCHDDLTSSDLVGRFMVTGGDVVWTDGPLTRAVKAGAICYLDEVVE
ARHDSLAILHSLTDHRRALYLDRAGEVVEAPDGFMLVCSYNPAYRSSLKE
LKPSFRQRFVTLPMRYLPPEQESAVIVAETGVDRQTAHRLVRCATAIRTA
DDVFHFEPPSTRVLVTAAALIAAGATALEAAEACILAPLSSDGAITEGLR
EVAVASLADADDSSTTL
119870532YP_940484.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTPPVKRSARQLRSRQTRERILGAAIAEFTSSGMAGADVGAIVAAAGVAH
GTFFFHFPSKEHVLLELERREEARMAADFTRFLGGAHDLATALTHLVGLV
SALEQRFGPRLFKELLALHFSPTRPTRDEWTDHPVIVSLVREIERASGDG
EVHPEVDAFYSATFFLLGLYGALTTTEHGEARDTMLAKLVTTALRGLTNK
EN
119870530YP_940482.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MALEQFDLTGQVAIVTGAGKGVGQGIAQVLAEAGAAVVGTARTESDIAAT
ISGIERAGGKGVAVVADAMSRPDGERVVAAAMENFGRVDILVNNVGGSTY
ARFLDITDEDFRHTFDWCVTSAFIMSQLTARHMIEAGRGSIINISSGSAR
FGIRALAAYCTAKGGLEALTRAMAQELAPKIRVNAIALGSFATEGLQGSL
DMMPGSLEKMNAATPLRRLGDVADLGRLCVYLSTRDCYATNAIFHVDGGI
ESNNSPLPIPDY
119870528YP_940480.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MNLFALLDQTAARHADRGAVYHGERQVHTWSSLRERALRLAGSFTGFGPG
ARIAVASENAPEIVELMFGIWAAEAVIVPVNYKLHPREMEQIVADAGVSR
IFASPKIGAELAQLVDVPVEVIGGAEYENRCAASPVDPPRTTDPASLAWL
FYTSGTTGRSKGAMLSHRNLMAMTVSHLADFDSPDENCSLVHGAPMSHGS
GLYVPPYVARGARQVVPASGAFEPAEFLDLCEHHPGCSAFLAPTMVARLV
ATGRAKPANLNTIVYGGGPMYVDSLKKALAAFGPIFVQLYGQGEAPMTIT
GLRRSDHLAGGVPASDAVLGSVGYARSGVDVAVLGEDDRPAGIGEIGEIV
CRGDVVMSGYWNNPAATAATLQDGWLRTGDMGSFDADGYLTLRDRSKDVV
ISGGSNIYPREVEEILLEHPAVVEAGVVGAPDEEWGEIVVAFIVGRVSPT
DLDAHLLERIARFKRPKRYEFIDELPKNSYGKVLKRELRERLTT
119870526YP_940478.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MGTTLADALRDAARDTPDRVLVRDGDDELTCGALQERAMALASALMRRMP
VGSVVSFMLPNWHEAAVVYLGATLAGMVVNPILPSLRDHELTFILADADS
RAIFIPHTFNGHDYAAMLKRVAAGLPSPPEVVVVRAEPAGHSSFADLLAE
AGGGDLPELSSDSTRMIMYTSGTTGRPKGVLHSHDSLHALLAQLGRYWNI
DPGDTFLVPSPIAHIGGSIYAFEAPLLLGSRAVLMERWDPDGAVALMLEH
GCTHMAGATPFLDGLLAAAQRADTRLPDLEVFICGGASVPPSLIRRAAAY
FERALVTRVYGSTEVPVTTVGSLDDVDHAAETDGRPGIADVTLVDGEIRA
RGPQMFTGYLHPQDNTGAFDTAGYFRTGDLGRWTDDGYLMVTGRAKDIII
RNGENISPKEVEDLLVTHPQIAEIAIVGIPDARTGERACAAVVAAGDPGP
DVAALREFLLGRGVAKFKVPEQVVLVEALPKNDAGKVLKHKIRASLTEGG
119870524YP_940476.1 SMP-30/gluconolaconase/LRE domain-containing protein [Mycobacterium spMTSPTESLQATRYPGAQPTVTDGWRLERLTAPSRLFGANGLRTGPDGRVY
VAQVTGSQISALDLGSGTLETVSPKGGDIIAPDDVAFGPDGALFATEVMD
GRVSVREADGRTRVLRDDLPCANGITVHQGRLFIGECREGGRLLELDRNG
GIVRTLAENLPSPNAMEVGPDGLLYYPLMTANEIWRVDPNGGEPQRVAGD
LGVPDAVKFDADGFLVSTQVASGQVLRIDPRSGAQTLLAQLSPGLDNLTF
VGDRLFVSNFTGEITEILSGGETRTTLAGGLNWPLDLAVGDDGRLYVADG
TYFYVVEADGSLQTVGMLFTPGYPGFLRGLTPVGGGEFVVTTSGGQVTRY
RPAAGESEVLADGFDQLYGIAATPGGAAVFAELGTGRVHSVHDGEVQLLA
GDLREPVGVAIAPDGNPLVAESGAGRVVRLAGSQAVTVVDGLQRPQGLVV
ADGVLYIVDAGAKEVVAVDMNSGARQTIATGLPVGPPPGVEPKPLRGMPP
FSGPQGPFAGIAAAPDGTLFVSADGDGSVLALRRTART
119870522YP_940474.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MTHTESDLDAAIEVEADADDSTGEIAEDLSDAMTIPVEAYISPEYARAER
DKLWRRVWQQVGRVEEIPEVGSYLTYDILDDSIIVVRTGPNEFRAHHNVC
MHRGRKLVDTPDGAKNAVGRARKSFVCGFHGWTYGLDGTCTHIREQDDWK
GVLTPRNTHLAPVQVDTWGGWLFVNMDPDCEPLMDYLFPASKILDPFGLE
NMRYKWRKWLYFDCNWKVAMEAFNETYHVFTTHPEFNKFGEFKGWAKAQG
KHSNIGYDAPKGMDETKSKIRLGTGDDPRVSTAEMQMYTWEQTNATTTET
LVNAAKRLVDELPEGTPADKVLQHWLASARRDDEARGVIWPTIPPDILGQ
SGTAWQIFPNFQIGQGLTSALCYSARPDPSYDPNKCIFEVAVFELYPKGE
EPETEWAYTPKDSPNWLSVLPQDFSNMAAVQQGMKSAGFPGTMPNPYRER
STVNLHHQLSKYMGTGEPREL
119870520YP_940472.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MTDLRYDGRVAVVTGGGRGLGRAYALLLASRGAKVVVNDLGGDLTGDGVD
AGPAHEVVREIVAAGGEAVASTDSVATPEGGRAIVDTAMDTYGRLDILIH
NAGNVRRASLSEISDEDFDAVVDVHLRGAFHVVRPAFPVMCDAGYGRIVL
TSSIGGLYGNHDVVNYAVAKAGVIGLSNVAAIEGAEYGVRSNVIVPAAVT
RMAEGIDTSAYPPMDPELVAPTVGWLSHETCSVTGEMFIALAGRVATAVL
VETPGVYRSSWTVEDVAADLDAIRDRSHPVVFPVVPDGHNAHIRYSFAMA
AQKAGT
119870518YP_940470.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMSMDFDMGPRAAELRSRLRELVSEHVPEHFLGAFTDDPADLETAQRFCRL
LAEQDLLCLAWPQEFGGGGASVWEQTVVREEMWAHHEPRGAQYMGVNWVG
PIIMRHGTEEQQRRHLPPIARGEVIWCQGFSEPEAGSDLASLRTTARRDG
DGWLISGQKIWTSYATMAQWCFLLARTSRGERKQQGQTIFLVPMDDPAIQ
VRPIRAMLGPHHLNEVFFDDLRVTEADVLGTVDAGWSIVQDVMAFERVGI
ARYARCERLLAAAPTVLGDRWGDLSEELRGRWVRMLTHCRRARLMAYRVV
SLQSSGRIQPGDAAAYRIAVTKLDQDSAEVLMDISAEVSRDDPRAAWFLG
EVEDHWRYSQAATVSSGSIEMQRILLSRALLAAAK
119870516YP_940468.1 oxidoreductase domain-containing protein [Mycobacterium sp. KMS]MKVLVIGTGFGKHAAAPAYESAGFDVEVVSPRDESAVARGLGSGADLVSV
HSPPFMHVDHVSAALDRGLAVMCDKPFGRTADEATAMRDRAHAVGVPTFL
NFEFRCRESWAKVKELADSGAIGTPNHLSWNWFGNRLRGRRYGWINDAEL
GGGWIGAFGSHLIDFTRWLFGSEIVDCGGVTRIDDPMHADADGTPRQATA
EDAYAAWFRLADGATAAQDTGFAAATSTLPRAVLLGTDGSIELTADTTLV
LRTKGSEPETFEFDRPGRPDPALVTLFGQVADALRTGSRTTPSFDDGLAV
ARVMDRLRANAVRMGTR
119870514YP_940466.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMSIDDFRATVRAWCAEHVPSDWREKQTGVGDEEFVRFQKAWFAELHSAGY
AVPHWPAEWGGGLSVAEQIVLYQELAAHDAPRLVLAFVGIHHAASTLLVA
GTDEQRRRHLPAILDGEIWVQGFSEPEAGSDLASLRTTAHRTGDTFVVNG
QKLWASGGMHADWCLLLARTDPDAPKRKGISYFLLDMTTPGVDVRPIRNA
VGDSHFCEIFLNDVEIPAANLVGAENAGWQVAQETLGAERGMTMLELAER
LANAGFRRLVRTSPVDDPVVADRLAQFECEITALRGLCRKVVEGHDSGAI
GPADASIVKLYYSELLQRLTDFGAEIGGPAGHTEIAKPMSSGWESGSWVL
DFIGSWEWTIPGGSSEIQRTIIGERGLGLPREPSAV
119870512YP_940464.1 thiamine pyrophosphate binding domain-containing protein [MycobacteriuMGVPVYKRILDLFEAEGVNTLFGIPDPNFVHMFTEAEARGWSVVAPHHEL
SAGFMAEAASRMTGKPGLCIGTLGPGVANIAGAMMCALVENSPVIFLGGQ
RARITERRVRRGRIQFVQQEGLFTPSVKFSSSIEYADQTDEIIREAIRRS
MSGTPGPSYIEYPSHVILEELDVPEPLPPNRYRLVNQGAGEREIAEAATL
IREAKSPILLVGHGVHTSRTQEQVRELAELMACPVIQTSGGTSFIPGLED
RTFPYLFSPAANEAVEQSDLCVALGTELGEPMHYGRTQHWAGNDANRKWV
YVEQDPTAIGVNRQFDVPLVGDLRGVVPQLVDALRDAPRTPSATLESLVE
ADAAEIARVAEEAPSGRTPVHPARFVVEATKAFNEYAEDGIMVRDGGATV
IFQWTYSQAKPRDVIWNQNFGHLGTGLPYAVGASVAEGRKRPVMLLTSDS
AFLFHIAELETAAREGLPLVCVVGVDHQWGLEVGVYKRTFEQPSPQPGVH
WSKDVRMDKIAEGFGCHGEFVEKDDEIGPAIQRAYASGKTAVVHVCIDPK
ANSEEMPKYDRFRTWYAEGTQ
119870510YP_940462.1 amidohydrolase 2 [Mycobacterium sp. KMS]MVAGRYEYGIDFARVGAVDFHTHVEVDGHGHRAYDDALVEATAAYFKLGA
GALSSVDALADQYRRHNTAAVVFTIDARTAMRHAPNSIEDLVAGAVRNND
VLIPFGSVDPWHERRAVHRVHELVRDYGVRGFKFHPSMQAFEPNDRRFYP
IYEAIAEAGVPALFHTGQTGMGAGLPGGHGIKLRYSDPMLLDDVAADFPE
LTIVMAHPAVPWVDAQISIASHKANVFVDLSGWSPKYFPPQLVSAIGRQL
RTKVLFGTDYPYIQLDRWQRDFDDLGIDPAVRRLVYKDNALRVLGLAG
119870508YP_940460.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MKVGARSTTGWKATISVAMSNYIEAGSIIAIATSLGFWQAEFGISNFGVG
LLAALSANAFGAAIGAILGGPLCDRFGRKAIYTYDLLVYMAGVLVAACAV
NFTMLLIGFIVTGIAVGAGVPASWTYIAEQAPSVQRAKHVGTAQLAWSTG
PLVGFALAAALAPLGLLGSRLIFAHLFVVAAIVWWVRQGLQESQIWQDEG
RDEPTQVASAVGVRGLRGLFSRRVNITALLFLGGIYLFWNTVAGQAGIFM
PRVYDTAGLHSAVQQNLLQVLVWGCTVLATYFGFMGLADRMSQRLLYVIG
AALGIVGWIVLVAFTDSGVPTMLIFAVLWGVSSGIGAQAFYSLWTSELFA
TPYRASAQGVMFFVVRTATGLLSYFFPTMLAVTGLTGVGLLLVGLLTIAL
VIGAVWAPQTRGKTLKQIEAERYGAPVSPANVEKAAVTP
119870506YP_940458.1 short chain dehydrogenase [Mycobacterium sp. KMS]MTDTVRELIDRSNRLGADPKNTNYAGGNTSAKGTETDPVTGAPVELLWVK
GSGGDLGTLTEKGLAVLRLDRMRALVDVYPGVEREDEMVAAFDYCLHGRG
GAAPSIDTAMHGLVDAAHVDHLHPDSGIAIATAADGEALTKQIFGDRVVW
VPWRRPGFQLGLDIAEIKRANPQAIGTILGGHGITAWGDTSAEAEAHSLE
IIETAERYIAEHGRRYPFGAPLAGYGALPEGQRRDKAAALAPFLRGLVST
DKPQVGHFTDDPRVLEFLSCGEHPRLAALGTSCPDHFLRTKVKPLVLDLP
ADTSVEDCKARLAELHEAYRADYRAYYERHAGPDSPAMRGADPAIVLIPG
VGMFSYGKDKQTARVTGEFYLNAINVMRGAEAISTYAPIDEAEKFRIEYW
ALEEAKLQRMPKPKPLATRIALVTGAASGIGKAIATRLAAEGACVVIADL
DAGKAAAAAEELGNTDMAVGIAADVTDEAAVQAAVDATVLAFGGIDIVVN
NAGLSLSKSLLETTAADWDLQHDVMSRGSFLVSKAAARALIDQGLGGDII
YISSKNSVFAGPNNIAYSATKADQAHQVRLLAAELGEHGVKVNGINPDGV
VRGSGIFAGGWGAKRAAVYGVPEEELGAYYAQRTLLKREVLPENVANAAF
ALCTSDFSHTTGLHVPVDAGVAAAFLR
119870504YP_940456.1 LacI family transcriptional regulator [Mycobacterium sp. KMS]MREVAAAAAVSVGTVSNVLNSPDKVAPATVARVHAAIEELGFVRNDAARQ
LKAGRSRSVGLVVLDVGNPFFTDIARAAEHRAGEHNLTVLLGTSDDDPRR
ERAYLDAFDEQRVFGLLVSPIGDDLSRLRASQQRGTPVVLVDRDGSGTPF
DSVAVDDVAGARLAVDHLCATGRRRIAFVSGPTELRQVRDRLRGAREAVA
EVAGATLEVIETPALTVLEGRAAGERLRERPPGRRPDAVFCANDLLAIGV
LQALALIGDIRVPDDIALVGYDDIDFARSAVVPLTSVRQPTRAIGTTAID
LLMAAADAGGAHRPDHIVFQPELVTRDST
119870502YP_940454.1 iron-sulfur cluster binding protein [Mycobacterium sp. KMS]MSTFLGTPGTGNLRGDEAFPRAARKALQDSQMRRNVGHATRTIRTKRLHA
VGECADWEELRAAGSALKQDVLARLPELLDELERNVTARGGVVHWARDAD
EANRIVGELTRAAGADEVVKVKSMATQEIGLNEYLESIGIAAVETDLAEL
IVQLGHDKPSHILVPAIHRNRAEIREIFRREMPGTADLTDEPRALAMAAR
AHLRRKFLSAKVAVSGANFGVAETGTLAVVESEGNGRMCLTLPQTLITVM
GIEKIVPRFTDLEVFMQLLPRSSTAERMNPYTSMWTGVHPGDGPQEFHLV
LLDNGRTSVLADEVGRAALHCIRCSACLNVCPVYERTGGHAYGSVYPGPI
GAILSPQLTGTAGHDDPNSSLPYASSLCGACFDACPVRIDIPSILVHLRA
KQVDAQRGGIPGGQDLAMRAAAWAMASPRRFALAEKALAAGRFAANADHR
ITTLPWPGSKWTASRDMPEPPTEAFRQWWSRTHG
119870500YP_940452.1 GntR family transcriptional regulator [Mycobacterium sp. KMS]MWSDHTRVDGYPHRMRAHELVLERIERDLADGALAIGDRLPGERALAEEL
SVSRSSVREAIRVLEAMGVVRTAVGSGPDAGATVVADPSSSIGSALRLHT
ATRHLPIADLVDTRILLESWALREAAHRRPRPDLTAVEAILDAMDEVALS
PEEFLRLDAAFHVAMSELAGNVVVGAMMAALRDSIHGYVLAGVPLLDDWP
VVATTLCAEHRAILNAVRRGHGARAGKLVDAHIHGYVDLIRR
119870498YP_940450.1 hypothetical protein Mkms_4469 [Mycobacterium sp. KMS]MSDLPAWAQRLDLAPHPEGGWYRETWRSDLTVTQSALPPDYTGPRSAGTA
ILFLLMPGQQSAWHTVRSAELWMYHRGSPLLLEMGPEHDSATTHLLGSDI
DGGASPQLIVPARHWQRARPRDDEPSLVSCVVVPGFDFADFELGAVSD
119870496YP_940448.1 heat shock protein Hsp20 [Mycobacterium sp. KMS]MLRFDPFSDLDTWTRGLLSSQTGSDRTPRFMPMDLCKIDDHYVLTADLPG
VDPGSVDVNVDNGTLTISARRTARSEESAQWLANERFFGSYRRQLSLGEG
VDSAAISATYENGVLTVTIPMAERAKPRKIEVAHGGGQKSIQPTTVDAE
119870494YP_940446.1 hypothetical protein Mkms_4465 [Mycobacterium sp. KMS]MIRAKLLKTMAMGIGAAALPVGVALAGAAPASAGPDVCVSGPYGFAYACV
DTPRWVEWYDDGPRGRGNGHWKHGHHD
119870492YP_940444.1 cytochrome c oxidase subunit III [Mycobacterium sp. KMS]MTATASPARARRIPGEAGTWVFLLGDMLVFGVFFGTFLVARAGDPELFDR
ARATLHIGIGLADTLVLLTSSLCVVVALGAVRAGAGALARRAVIAAIGLG
VVFVGLKVSEYLSLGAAGHGPGANDFYLYYFILTGLHLFHVAIGLTVLAV
VADQVRRPPLTPGRTALVEGGACFWHLVDLLWIVLFALLYLVS
119870490YP_940442.1 luciferase family protein [Mycobacterium sp. KMS]MSRDFRFGIGLHSAASMAKVQDAARRAEDRGFDVLHVPDHLGAPAPFPVL
TAAAAATSTLHLGTFVLNAGFYRPALLARDAAALRDLSGDRLELGLGAGY
VRKEFEAAELPFPTARERVDHLEHTTTYLAEHVPGMRMLIAGNGDRLLRV
AARHADIIGLTGGDRAAEGDDDPLAERIAFVRAAAGERFDELELNIAITA
MPLDDSGRPDLTIPRRFLPGLSDDQLLRHPGVLSGTPQDMADRLREYRDR
YGVSYVIVQAPHEDAFAKVIAQLR
119870488YP_940440.1 hypothetical protein Mkms_4459 [Mycobacterium sp. KMS]MTEPNNTDLLDLATPYALHAVSIDERFEIDRWLATAPPEVADAFTDEVRS
VQETMAVLSAATATEPPAHLRDNVLAMVADDPVRDLGSARRRRGGESRWR
TAVLAAAAVAVVGLGALGVGLALRPAVSPTTADQVFAAPDVQTVSGPIPG
GGTATVVFSKERDAGVLVMNDVAPPKPGTVYQMWLVGSDGPHSAGTMDDK
AISPSTTAVLSDIGTSQALAFTVEPPGGSQRPTSPAFAELPLT
119870486YP_940438.1 hypothetical protein Mkms_4457 [Mycobacterium sp. KMS]MKDVEPKTTPALYRTRVTHLRRAPVHHYFELNSYSWYVDLDELPQLPLGL
RSLARFDARDHFDGVAGDTLRARVDAFLAQRGIDLGGGRITALLQPRVFG
YAFKPLSLYWCHDARGVLCHVIAEVHNTHGEWHAYLMPPDGPTPTMVRKR
FYASPFNGMDGYYLVRAPRPDDGLDVTISLHRENQPAIVNTLRGTRRPAT
VAQVLRMQMTKPMAPQMTALSLRVQGLILRARRVPVTPRAVVRAPQLRTA
TVAHSGAKA
119870484YP_940436.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MSSTTPLNPSVGEGEGQLRRVLGVPSLVLFGLVYMVPLTVFTTYGIVTVE
SGGRVPLAYVVTLAAMIFTARSYARMAAAYPVAGSAYAYTQKTFGAPVGF
LAGWSLLLDYLFLPMLNYLVIGLYLNAAVPAIPQWLIVVVTIAIVTVLNI
IGIVSVARANLLIIAIQAIFIVVFIVMAVAAVSGSGSVDVMAPFRGDGTA
DGMAPVLAGAAILCLSFLGFDAVSTLSEEARDARRDVPKAIMLATIICGV
LFIILSYVSQLVFPSNAFTDVDSGSLDVMQSAGGAFLAAFFTAAYVAGAS
GSALTSQASVARILYAMGRDGVLPRKVFGHVSVKFGTPTWAVLVISIVSL
LALVIDLAILASVVSFGALVAFSAVNLTVIKHYFVDAGEKNVVNNLVLPL
IGFVLTVWLWTSLSAESLTIGLIWLAIGFLWLLGVTRGFRRPTPVLDLEE
LPAQPAK
119870482YP_940434.1 Mn2+/Fe2+ transporter [Mycobacterium sp. KMS]MLPDTDRRTRSTWLLLGPAFVAAIAYVDPGNVAANVSAGAQFGFLLVWVI
VLANVMAGLVQYLSAKLGLVTGRSLPESVAGRTRTPTRIAYWLQAELVAM
ATDLAEVVGGAIALYLLFDLPLLIGGVITGAVSLALLAVQNRRGQRHFER
VISSLLLIIAIGFLTSVFVEPPPVADVAGGLIPLFEGTDSVLLATAMLGA
TVMPHAVYLHSGLARDRHGHAEPGARRRLLLKATRIDVGLAMLIAGAVNM
SMLLVAATNLQGMSDTDTLEGAHAAVQQTLGPAVALCFAIGLLASGLAST
SVGAYAGAMIMGGLLRRTYPLLVRRLVTLVPALAILAIGVDPTRALVLSQ
VVLSFGIPFALIPLIRLTSDRAVMGDDVNHRITTTLGWVVAGLISLLNVV
LIYLTVTG
119870480YP_940432.1 hypothetical protein Mkms_4451 [Mycobacterium sp. KMS]MNKFIGFAPLAVAAGIGAAVLMAPAAAAQPNCVTTGQGAYGGSTTQCSSP
GNTQIVTSPGQTNYLYPWNDYYYGPALVFGW
119870478YP_940430.1 dihydrodipicolinate reductase [Mycobacterium sp. KMS]MAIRVAQIGTGNVGSHALTQLIIDPQFELTGVWVSSAAKAGKDAAELAGL
DEPTGVTATNDLDEVLAAKPECVVYTAMADNRLPEALEDYRRILSAGVNM
VGSGPVFLQYPWQVLPEELIAPIEEATRTGGSSVFVGGIDPGFANDLLPL
ALAGTCQRIEQIRCMEIIDYATYDSPTVMIDVMGFGKPLDDLPMLLQPGV
LSLAWGSVVRQLAAGLGIELDEVTETYVREPAPEDFDIASGPIAKGTAAA
LRFEVRGIRDGKVAVVLEHVTRLREDLCPDWPQPAQPGGSYRIEITGEPT
YTLDLCQSSPHGDHNRAGLVATAARIVNAIPAVVAAEPGIRTTLDLPLLT
GKGLYAS
119870476YP_940428.1 DNA end-binding protein Ku [Mycobacterium sp. KMS]MRSIWKGSIAFGLVNVPVKVYSATEDHDIKFHQVHAKDNGRIRYKRTCEV
CGEVVEYRDIAKAFESDDGQMVVITDEDIATLPEERSREIEVLEFVPASD
LDPLMYDRSYFLEPDGKSSKSYVLLAKTLSETDRVAIVHFALRNKTRLAA
LRVKDFSKRDVMMIHTLLWPDEIRDPDFPVLDKEVEIKPAELKMAGQVVE
SMTDDFNPDRYHDDYQDQLRELVEAKLEGGEAFAVEEQPTELDETEDVSD
LLAKLEASVKARRSGSSSGSDSDDGDEPAKKAPAKKSAAEKAPAKKAAKK
TAAKKAPAKKASAKK
119870474YP_940426.1 mannitol dehydrogenase domain-containing protein [Mycobacterium sp. KMMKLDESTLPDIPIAKPTYARGDVTVGIVHFGVGGFHRAHQAMYVDALLEK
GLAAEWGICGVGVLPGDRKMADALGAQDGLYTLLLENPDGSRDARVIGSI
VDYRYAPDDPEGVVELLAAPSTRIISLTITEGGYEVDKVDADSVNVFGLI
TDALALRRDRGVDPPTIVSCDNIEGNGDVARAAFMSYADRTHPGLSEWIG
SNARFPNSMVDRITPVTTPEVIATVRDEFGVDDAWPVVAEPFTSWVLEDT
FTDGRPPFEDVGVLLVDDVTPYELMKLRLLNASHQALCYFGYLAGYRLVH
DAAADPLFAELLRRYMDSEATPTLRPVPGIDLPDYKRTLIERFANPGVRD
TIARLCYGSSDRIPKWLLPVVRENLRTGAPIRLSAAVVASWSRYAEGVDE
QGEPIDVQDQLADELVPLARAQRDNPTSFIENRLVFGDLVDEKRFVDEYV
AALESLHRVGARATLEALVGKP
119870472YP_940424.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MKVQTIARRLAGGLAAAGLVFTSGCSGAGSLGSSDNEVTIALVSNSQMTD
AQQLSSEFEKENPGTKLKFITLSENQARAKITMSAAMGGSEFDVVMISNF
ETPQWAKDGWLVNLSEYAKNTPGYDEDDFISSLRESLSYEGNMYAVPFYG
ESSFLMYRKDLFEQAGITVDQNPDYQPTWPEVAQWAETLKTDDRAGICLR
GKPGWGEVLAPLDTVINTFGGRWFDEQWNAQLDSPEVKKAVNFYVDTVKN
FGELGAASTGFQECANLFGQGQTAMWYDATSAVSVLEDPKEYPDLVGKIG
YLPAPIVEKPNSGWLYTWALGIPKGAKNPDGAWEFISWMTSKDYMKLVGE
KLGWARVPPGSRTSTYTDLPEYEAISKSYGPLTLKSIESATPNQPTVQPV
PYTGIQFVGIPEFQDLGTRVSQQISAAIAGQKSVDDALAQSQEYAEVVGR
TYQEK
119870470YP_940422.1 binding-protein-dependent transport system inner membrane protein [MycMTTTVEETTPTTGSDITAKKKSRKFSVWGVLAWLVGLGFFFPVFWMILTS
FKQEGDAATDPPKLFFTPTLDQYGAVFDQGIGPAMLNSLFATGLSTILVL
LLGTPAAFALSLRPVRKTQDALFFFMSTKMLPIVAVILPLYVIVSNIGLL
DNIWALVILYTAMNLPIAVWMMRSFFLEVPAELLEAASLDGASLWRSVRE
VILPLVSPGIAATALICVIFAWNEFFFAVNLTAVNAQTMPVYLVGFIAGE
GQYWAVLSAAATMAALPVIICGWLAQNKLVRGLSFGAIK
119870468YP_940420.1 hypothetical protein Mkms_4439 [Mycobacterium sp. KMS]MSEPFIGREAITRGKLTRGQLRARYVAVHPGVYFPKGARPTLAARASAAW
LWTGRHGVISGRAAAALHGAKWVDATTPIEIIAEHGRRRDGVIVREERVG
DDEVVVIGDLPVTSSARTAFDLARHLPRDAAVVHLDALAAATGVSAADTA
PLARRYRGARGVRSADVALDLMDAGAASPQETRLRLTLIDGGLPRPRTQI
RVTDGYSEAFIDMGYDEPKVGLDYEGAHHATSRGQYVHDIGRAELLDREG
WIDLRVVAEHSRRFILHRVREAFARRGWIPPSST
119870466YP_940418.1 hypothetical protein Mkms_4437 [Mycobacterium sp. KMS]MYVRGMSGHDLQAAVTALRAAFDEVASCDVALLDRAELVAALDELEALGC
RLPTMSHRLLARLRSEATPQQMGAKSWREVLTVRWRISGSEANRRLTEAG
LLAPRQALTGPSLPPVLPATAAAQAHGLINSEHVEVIRRAVDKLPGFVDT
VTREQFEVTLVRTAVGVGPKELKDAADLTLFLLDQDGPEPDDTERARKRG
VSRSKQRPDGMVELSGHLTPEAWAVWEVIFAKYAAPGMCNPDDPEPCTSG
APSQEQIDNDHRTLAQRQHDAMVAIGRIALMSGELGQLNGLPVSIIIRTT
LEDLESRAGVGTTGGGTVVPIADVIRMAGHANHYLAVFDGATGSALDLFR
AKRTASAAQRIMLIARDGGCTKPCCTVGAYGCQVHHVDADWSDGGNTNVD
ELGLACGPDNRSVDKDGGWSTRMNDQCEVEWIPPPRLDTGQARLNHYHRP
ERLLRPSDDPVPTSQDRSGAIEPADGGKVGDAESGPPRSADDTGEPGGPA
PPGNRAA
119870464YP_940416.1 hypothetical protein Mkms_4435 [Mycobacterium sp. KMS]MTVTVDEIRVADPADAWIRAGFDVDPDDVCRIGGVRIRLVGRDRGTGIVG
WSLRGLPGPSADLDGIATNASEAAGAVPARHANGVTAIDHVVLMSPDLKR
TVAALAAVGLAPRRERDADPGGRPVRQIFFRLGEVILEVVGSPETAREGP
SRLWGITYVVADIDATASFFGDRTAPVKAAVQSGRRITTLRHRDLGMSVP
TAMISPLILES
119870462YP_940414.1 FHA domain-containing protein [Mycobacterium sp. KMS]MPCHLEVWKPSGRQLIALDGQRVTLGKASTNAVPLEHDETVSRLHAVFEN
LGSAWSIRDLGSRNGTYLNGEKITAERVLRSGDEVRVGRSRMIFWQGHGT
GEGPGDEQTVSAQPSDLPPRLTPREIDVLMALCRPLVSDDLFPEPASVRR
MAGELFVTEAAVKQHLQNLYDKFAVPAEGDRRVRLANEALRRGAVTIAQL
RDAT
119870460YP_940412.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MPVLDRFRLDDKVVIVTGASSGLGVAFAKACAEAGADVVLAARRVEKLEG
TAELVRAAGRRALSVATDVVDPAQCQAMVDAAMAEFGHVDVLVNNAGVGT
AVPATRETPDEFRAVVDVNLNGAYWAAQACGRVMGPGSSIVNISSILGIT
TAGLPQAAYSASKAAIAGLTRDLAQQWGIRKGIRVNAIAPGFFESEMTDQ
YKPGYLESVIERAVLGRTGDPEELAATLVWLASDAGGYVTGQTIVVDGGV
TIT
119870458YP_940410.1 hypothetical protein Mkms_4429 [Mycobacterium sp. KMS]MRFTYAEAMTDPTYYIPLAKAAEAAGYDAMTIPDSVAYPFESESKYPYTP
NGSREFLDGKAFIESFVLASALCAVTTTLRFNFFVLKLPIRPPALVAKQA
GSLAALFDNRLGLGVGTSPWPEDYELMNVPFAKRGKRMDECIEIIRGLTT
GEYFEFHGEFYDIPKTKMTPAPTKPVPILVGGHADVALKRAARCDGWMHG
GGDPEELDGLIAKLNRFREEQGQSGPFEIHVISVDAFTLDGIKRLEDKGV
TDVIVGFRIPYITGADTEPLADKIRNLEWFAENVIGKL
119870456YP_940408.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MTRVPTRQPWLTRNVRLLSAVSFLQDAASELLYPLLPIYLTSVLGAPAAV
VGAVEGAAEGAASLTKLASGPLADRFARRPLIATGYGMAALGKVIVAAAG
TWPGVLAGRVTDRLGKGLRGAPRDALLVDGIDPDARGRVFGFHRAMDTFG
AVVGPLLGLAGYELLDHQIPPLLWVAVIPAVLSVALVFCVRERTRAVPAV
ARPPLLSRVRDLPRRYWRVTALLVGFGVVNFPDALLLLRLNEIGFSVVEV
ILAYVGYNVVYAVASYPAGALADRVGTPAVFAVGLGFFAVGYTGLGLTTD
TLTAWMLIGVYGLFTACTDGVGKAWISSLVGADVQASAQGVFQGASGFAI
LAAGLWAGLLWGADGTVPLLISGLAGGVFAVIVAVFAVRHR
119870454YP_940406.1 putative ribonuclease BN [Mycobacterium sp. KMS]MAEAASTKHRAPDPDDPRKPESPTDLTKPSAFYVLRKTAREFGHDQCTDL
AAALTYYAVLSLFPAVLVMVSLLGVFGQGRRTTDALLDIVSDVAPASTVD
TLRPTIEQLVESPSAGFALVIGILTALWSASGYVGAFGRAMNRIYEVAEG
RPVWKLRPLQLVLTFAALLGAALVAFMLAVSGPVAEALGNAIGLGEAAVT
AWSIGRWPVILLLVVVAVAVLYYATPNVQQPKFRWISLGAGLAILTWIVA
SVGFGFYVANFSSYNKTYGTLAGVIIFLLWLWITNLALLFGAELDAELER
GRQLQAGLPAERELQLPPRDTRVIEKKEAAIEEDVERAKALRRSRGRDDG
119870452YP_940404.1 membrane protein [Mycobacterium sp. KMS]MGFLLRAAVTGVALWLVTQFVSGMEFVGGENTLQRVGIIFVVAVVFGLVN
AIVKPIVQILSIPLYVVTLGLFHVVVNALMLWLTAWITEHTTHWGLYIDD
FWWTAVWAGIVLSIVSWVLSVLSGNLIKR
119870450YP_940402.1 short chain dehydrogenase [Mycobacterium sp. KMS]MTRQRILITGASSGLGAGMARAFAAKGRDLALCARRVDRLDELKAELKQR
YPEITVAVAELDVNDHDQVPKVFAALSDELGGLDRVIVNAGLGKGAPLGS
GKLWANKATIETNLVAALVQIETALEMFKRTGAGHLVLISSVLGNKGVPG
VKAAYAASKAGVSSLGESLRAEYAKGPIRVTVLEPGYIESEMTSKSASTM
LMTDTDTGVAAMVRVIEKEAGRAAVPWWPWAPLVQLMRVLPPRLTRLFA
119870448YP_940400.1 succinate-semialdehyde dehydrogenase (NAD(P)(+)) [Mycobacterium sp. KMMDTTALLKSVPTGLWIGGEEREAKSTFNVLDPSSDEVLVAVGDATAEDAV
AALDAACAVQAEWAATPARKRGEILRSVFETLTDRADDIAALMTLEMGKV
LAESKGEVTYGAEFFRWFAEEAVRIGGRYTPSPAGTGRIIVTKQPVGPCY
AITPWNFPLAMGTRKMGPAFAAGCTMIVKPAQETPLTMLYLAKLMAEAGL
PKGVLSVLPTSSPGPVTEALVDDGRLRKLTFTGSTGVGKSLVKQSADKLL
RTSMELGGNAPFIVFDDADVDAAVDGAMLAKMRNGGEACTAANRFHVANS
VREEFTEKLVKRMSEVTLGNGLDESATLGPLINNKQLQKVTELVSDAVSR
GATVAVGGVAPGGPGNFYPATVLADVPADARILKEEVFGPVAPITGFDSE
EEGVAAANDTEYGLAAYVYTRSLDRALRVAEAIESGMVGINRGVISDAAA
PFGGIKESGFGREGGTEGIEEYLDTKYIALTK
119870446YP_940398.1 hypothetical protein Mkms_4417 [Mycobacterium sp. KMS]MRPEPPHEESEMSIETDQSLDIDALRQEIDELDAAILAAVQRRTEVSKII
GRARMASGGTRLVHSREMKVIERYSVLGPEGKDLAMLLLRLGRGRLGH
119870444YP_940396.1 hypothetical protein Mkms_4415 [Mycobacterium sp. KMS]MSSADSTGRPDDSPPQHDPETRIIRRHPTGAQPVVPSAQQTGIIRRHPTG
ELPAVAHEPQTSYIEPPAVEDGAQTSYIPRPRPVEIPATTFVAHPRTAIA
AAVLTIVSGWATAVIATDLIAGWWRTDQLFCVAIGFLTTISAAASIGGLV
MLLLRRRMSRLLVVVGCVIGLLIFGSLFVAGAKFPWIVYAIPVLPVAAIA
LTLLPSTGRWAQSG
119870442YP_940394.1 succinyl-CoA synthetase subunit beta [Mycobacterium sp. KMS]MDLFEYQAKELFAKHNVPTTPGRVTDTAEDAKAIAEEIGKPVMVKAQVKV
GGRGKAGGVKYAATADDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEY
YISFLLDRANRTYLAMCSVEGGVEIEEVAATKPDRLARIPVDATKGVDEA
FAREIAEKGHLPAEVLDAAAVTIAKLWEVFVGEDATLVEVNPLVRTPDDQ
ILALDGKVTLDANADFRHPEHAEFEDRDATDPLELKAKENDLNYVKLDGQ
VGIIGNGAGLVMSTLDVVAYAGEKHNGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGEEANKPLVVRLDG
NRVEEGRKILADANHPLVVLAQTMDEGADKAAELANK
119870440YP_940392.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MVDPRTPVIVGVGQFTERIDDDGYRGLSAVDLATEATRAALSDTGADTAA
VAQAIEVFAGLRQFEICTPFADPPLGASDNYLRSVAKRVGADPARAVLEP
IGGNGPQKLMTEFAGAIAAGDIEVALVVGSEPGSTAKYFAKRDRKPDFTE
HVGGQLEDRGYGFEQYMSDYTVAHGLTGAPVQYGLLDNARRAAKGLGVAE
YRREMAELFAPFSAVAAKNPYSSSPVERSVDEIVTVTDENRMICDPYPRL
LVARDTVNQGAAAIVMSVAAARRLGVPEGKWVYLRGHADQTEQDLLDRER
LGVSVSAKQAVAEALRVAGIGIDDVATFDLYSCFPFPVFAVCDEFGLDAD
DPRGLTLTGGLPYFGGPGNSYSLHGIAETVAAMRDNPGSYGLVGANGGVM
SKYSVGVYSTEPADWAADRSKELQADIAGLPKVPVTRHADGRGTVETYSV
RYDWPVRTGIIIGRLDADGSRFLAISEDDDLVALMSDGDPLGAAIEVRPD
GDKNRATSA
119870438YP_940390.1 alkanesulfonate monooxygenase [Mycobacterium sp. KMS]MSTERIADHVKFAYWVPNVSGGLVTSTIEQRTDWNYEYNKKLAQTAENNG
FEYALSQVRYEASYGAEYQHESTSFSLALLLATERLKVIAAVHPGLWQPA
VLAKLGATADQLSGGRFAVNVVSGWFKDEFTHLGEPWLEHDERYRRSAEF
LQVLRKIWTEDDVDFRGDFYRIHDFTLKPKPVNTPERPNPELFQGGNSTA
ARRNGGRYADWYFSNGKDFDGITEQIVEVRDHAREVGREVKVGLNGFIIA
RDTEKEARDTLREIIEKADKPAVEGFRSAVQQAGNSTADKKGMWADSSFE
DLVQYNDGFRTQLIGTPEQIAERIAAYRKRGVDLILGGFLHFQEEIEYFG
ARVLPLVREIEASDASSADAPALATV
119870436YP_940388.1 hypothetical protein Mkms_4407 [Mycobacterium sp. KMS]MDNRPVGTRQARELLRVAFGPSVVALVVIAAVTLLQLLIANSDMTGAFGA
IASMWLGVHLVPVSIGGSELGAMPLMPALMMVWGTARTTAAATPPHGSWF
VTRWVVASALGGPLLIAAIALAVIHDAASVLTELQTPSALRAFGGVLVVH
LIGAAIGVASRVGRRTVLTSPLPNWLPDAFRAAAAGVLALAGLCGVVIAG
SLVVHWSTMHELFAITDSVFGQFSLTVLSLLYLPNVVVGAAAVAVGSSAH
IGLATFSSFTVLGGDVPALPVLAAVPEPPLGPVWVALLIVGAAAAVAVGQ
QVARRPAPIHIAAAKLVVASAVAALTMALLGEAGGGRLGNFGQVGVDQTT
FGPGVFLWFTVIGGLTVVMSGGIVRRPRRVRVTEPEPEPEPEAAPEQDLD
DAETGPIVDPVAAAPEPVTAEPVAEPVPGEPDPALDPEEHFIVDDAGSPP
NDSAPNDSPPNDSAPTDGEPRR
119870434YP_940386.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferaseMSGDQGQAGAKRPIRRALISVYDKTGLIDLARGLHEAGVDIVSTGSTAKT
IADKGIPVTPVEFVTGFPEVLDGRVKTLHPHIHAGLLADTRKPEHVEALA
KLGIAPFDLVVVNLYPFSETVESGASVDECVEQIDIGGPSMVRAAAKNHP
SVAVVVEPNGYDGVLAAVRTGGFTLAERKILASLAFRHTAEYDVAVASWM
GSTLAPEEPAQKLPAWVGGTWRRAAVLRYGENPHQQAALYRDATAWPGLA
QAEQLHGKEMSYNNYTDADAAWRAAFDHEEICVAIIKHANPCGIAISSVS
VADAHRKAHECDPLSAFGGVIATNSSVSVEMAETVADIFTEVIVAPAYEP
GAVEILSRKKNIRILVAAQPPTTGTELRPISGGLLLQQRDALDADGDDPV
NWTLATGEPADPATLANLKFAWRSCRAVKSNAIVVVADGATVGVGMGQVN
RVDAARLAVQRAGDRVRGAVAASDAFFPFPDGLETLTEAGVKAIVHPGGS
MRDDVVTEAAAKAGISLYLTGARHFAH
119870432YP_940384.1 protein kinase [Mycobacterium sp. KMS]MPLETGQVFAGYTIVRLVGTGGMGEVYLAQHPRLPRQDALKVLPASFSAD
DEYRHRFSREADLAAALWHPHIVGVHDRGEYDGRLWISMDFVDGHDAARL
LVDRYPNGLPAADVIEIVTAVADALDYAHQRQLLHRDVKPANILITGPDR
ARRRILLADFGIARHAEDNTGLTSSNIAVGSMSYSAPEQLMGHPIDGRAD
QYSLAATAYRLFTGSPPFPHSNPAVIISHHLNTPPPRLGDTRPELRAFDA
AMARALAKDPAARFGSCHDFAVALAQATGSPAAPPSLATAPPGPVGPPPG
VSYPGPPISAPPAQPQMGAAGPPVMVSPWMPSGAPYPGTQYGPAQGQPPP
RRRGLIVAGAILAVILLVAAVVSVVAVSGSDDDSTPNPATTTTTTRSRTA
PTTTRPTATSARPNRSAYTIADYIRDNRIVEVPIRRETPDAPVVTLPIPP
GWSDAGPRAPSWAYSAMVFDGLPANVDPPTVISLMSKLSGDVDPARIFEY
APNELKTLPAARTGIAGPIKLSGYDAVQVEGTYERDGRPRATWQKTAVVD
TADGLFILQVNGDAPAAESRLITDVGAVIDQQTTIAP
119870430YP_940382.1 sulfate transporter [Mycobacterium sp. KMS]MNPARLLPRRSDYADLPTSWRRDVLAGVTVGVVALPLALAFGISSGVGAA
AGLITAVVAGVVAAVFGGSHVQVSGPTGAMAVVLAPIVAAHGLGSVALVT
VVAGLLVAGCGIAGLGRTVTFIPWPVIEGFTLGIAVIIFAQQLPAALGVS
APAGGRTLTTALHVLTHADWAAAAKTLVVVGFVAVVMVALPRLHPGAPAS
LLAVVGATIGVIALHVPVAAIGELPSHLPAPVLPTVDVDSLRTLLSAAVT
VAALAAIESLLSARVAATMSPTGPYDPDRELLGQGLASVASGVFGGMPAT
GAIARTAVNVRSGARTRVAAIVHSIVLLGVVYLLSGPVSQIPLAALAGVL
MVTSFRMISAATVRSILRSGRSDALTFVVTAVITVSFDLIEAVMIGVLAA
AFFALRNVAGRSSVTREQLPGPNRDGDEHIALLRLDGAMFFGAAERISTE
IAEAFGTPGGPAAAGIRVVIIRMSQLGMLDATGARTLAEITAELEARGIT
VIIKGVRPEHLNMITSVGVLDSLRHENHLMDSLDDAIAHARTHVAEHPS
119870428YP_940380.1 von Willebrand factor- type A [Mycobacterium sp. KMS]MADARAHKGHGRSSRYSRYTGGPDPLAPPVDLREALEQIGEDVMEGSSPR
RALSELLRRGTKNMRGADRLAAEANRRRRELLKRNNLDGTLQEIKKLLDE
AVLAERKELARALDDDARFSEMQIEALSPSPAKAVQELSDYQWRSPEARE
KYDQIKDLLGREMLDQRFAGMKEALENATDEDRQRVNDMLDDLNELLDKH
ANGQDSQQDYDDFMAKHGEFFPENPRNVDELLDSLAKRAAAAQRFRNSLS
PDQRAELDALAQQAFGSPSLMNALNKLDSHLQAARPGEDWSGSSEFSGDN
PLGMGEGAQALADIGELEQLAEQLSQSYAGATMDDVDLDALARQLGDQAA
VDARTLAELERALMNQGFLDRGSDGKWRLSPKAMRQLGQAALRDVAQQLS
GRHGERDTRRAGAAGELTGATRPWQFGDTEPWNVTRTLTNAVLRQAGSSV
REIPVSITVDDVEISETETRTQAAVALLVDTSFSMVMENRWLPMKRTALA
LNHLVSTRFRSDALQIVAFGRYARTVTAAELTGLEGVYEQGTNLHHALAL
ATRHLRRHPNAQPVILVVTDGEPTAHLEDFGGRDGAQVFFDYPPHPRTIA
HTVRGFDEVARLGAQVTIFRLGTDPGLARFIDQVARRVGGRVVVPDLDGL
GAAVVGDYLTSRRRR
119870426YP_940378.1 hypothetical protein Mkms_4397 [Mycobacterium sp. KMS]MAKHRTVRKSSGRRSSMARLMAPGGLAAAAVGATGLSSALMTGATTAIAP
SVDLVALITPANSTSQIFAGTTYYGTDYANPPLYGEQQVVPFFLGPQGIA
DAIRAADDDSRGTVVLSSGWGAGQTGTALGMLSPGDRDNVDLVILDNNTN
RAGGGFWTTYSPFAPLLLTSADPTPTDLGVPVLDVAYEYNINSSAPVDPL
NPFALGNSLVAYLYGYGAQQTAEVPPEVMAEAKNPAGPHYHYVLDSNGEI
VGEPTLLPDSTTTYVTFESDGLPLVRPLRLLPGGDIVADAIEPTLTELVN
AGYNDGLGMEDNPAIPLDPTVERPMKPGSSLTALDGVPESASTGVDAGVK
TAQEDLAEPTKLVTKPVDEVGKLPVLSTLADDASETLLPNLKRNTTGAAS
DDDESDAPAKERPGQRFAERINDVVKKVTGGASIGANTDKTDDAAGGDET
D
119870424YP_940376.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MSTLVRYAVDGPVARLTLDSPQNRNALSTVLVEQLHDGLRRAAADAGVRT
VVLGHTGGTFCAGADLREAAGRDPGDVAVDRARELTGTLRAILESPVPVI
AAIDGHVRAGGLGLVGACDIVVAGTGSTFALTEARIGVAPSIISLTLLPK
MTPRAAGRYFVTGETFGAQEAERIGLATVATDDVESTVAELAAQIGRGSP
QGLAASKALTTAALLQAFDRDAAALTEQSAALFVSEEAREGMLAFLEKRP
PRWIG
119870422YP_940374.1 pyruvate carboxylase [Mycobacterium sp. KMS]MITRVLVANRGEIARRVFSTCRRLGIGTVAVYTEPDAQSPHVAEADARVR
LQGNNGYLDSAQLIAAARAAGADAIHPGYGFLSENAEFAAAVCDAGLTWI
GPPAAAVAAMGSKIEAKKMMAAAGVPVLDELDPATVTADRLPVLVKASAG
GGGRGMRVVRDLDALAGEVQAAQREAQSAFGDPTVFCERYLAAGHHIEVQ
VMADVHGTVWAVGERECSIQRRHQKIIEEAPSPLVERTPGMRAKLFDAAR
LAAEAIGYTGAGTVEFMADDTGEFFFLEMNTRLQVEHPVTEATTGLDLVE
LQLLVADGGRLDAEPPPSRGSSVEARLYAEDPAKNWQPQAGTVHRFHVPP
TVRVDSGVEDGSVVSIFYDPMLAKVISYAPTRRQAAAILADALVRTRLHG
VRTNRDLLVNVLRHPAFLDGATDTAFFDTHGLAELAAPIGDARAGELSVL
AAALADAARNRSDATVFAAAPSGWRNLASGYQTKRYRDAAGDEHEVRYRF
TRAGVQFGDHDDVRLMSATPQRVVLASGGVEFPFDVARHGDAVFVDSPLG
AVEFVALPRFPDPESAVAQGSLIAPMPGAVVRVGAAVGDTVSAGQPLVWL
EAMKMEHILTAPGDGVLAELTVAPGQQVEVGTVLARVESPEGDDT
119870420YP_940372.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMSIWDTPERDQLRKTVRAFADREVLPHVDEWERAGELPRELHRKAGAAGL
LGAGMPESVGGGGGDGADAVIICEEMHYAGAPGGVFASLFTSGIATPHMT
ASGDERLIDTYVRPTLHGELIGSLAITEPGGGSDVGHLTTRAERDGDSYV
VNGAKTYITSGVRADYVVTAVRTGGPGAGGVSLLVVDKGTPGFEVTRKLD
KMGWRSSDTAELSYTDVRVPAANLIGAENTGFLQIAGAFVSERVGLAAQA
YSSAQRCLDLTVQWCRDRETFGRPLISRQSVQNTLAEMARRVDVARVYTR
HVVERQLSGETNLIAEVCFAKNTAVEAGEWVANQAVQLFGGMGYMAESEV
ERQYRDMRILGIGGGTTEILTALAAKTLGYQG
119870418YP_940370.1 hypothetical protein Mkms_4389 [Mycobacterium sp. KMS]MSWVTQALFGAVWAVGGVVIGLSPPLSETGRGASTPVAGWFFAAFGVYLL
ISGFRRTADPPRDPTRRPRHASGREPDRRTAVVVPLSIVITALAGFGSIW
WGFTSGNVALLWLGVLGASIIVFGAPIIVDMVRDRRSRR
119870416YP_940368.1 two component transcriptional regulator [Mycobacterium sp. KMS]MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAV
VLDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTSPDEGPDSPALTFLDLTLDPVTREVTRGS
RQISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIG
YLRRKTEASGEPRLIHTVRGVGYVLRETPP
119870414YP_940366.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium sp. KMS]MTNHPRYSTPPQQQPGHRPVGPDTGYQGADPYSQQQPYDWRYAAQPQQQF
RAPYDPYRGAAQPTAVMPQPRPTQKRSRAGALTVGALAVAVVSAGIGGGV
ATMVQQDRPSFGSSITGAAPSVPAAALPAGSVEQVAAKVVPSVVKLETNL
GRASEEGSGIILTSDGLILTNNHVVAAAADGPGAPGGAQTKVILSDGRTT
SFTVVGTDPSSDIAVVRAEKVSGLTPITLGSSSDLRVGQDVVAIGSPLGL
EGTVTTGIISALNRPVAAGGDTRNQNTVLDAIQTDAAINPGNSGGALVNM
NGELVGVNSAIATMGGDSAQAQSGSIGLGFAIPVDQAKRIADELIQNGSA
SHASLGVQVSNDAATDGAKIVEVNQGGAAAAAGLPSGVVVTKVDDRVINS
ADALVAAVRSKAPGDKVTLTYLDPSGKPQSVQVTLGKMQQ
119870412YP_940364.1 hypothetical protein Mkms_4383 [Mycobacterium sp. KMS]MKAISRVLIALAAAIAALFTSTGTSNAGLDNELSLVDGQGRTLTIQQWDT
FLNGVFPLDRNRLTREWFHSGRAKYIVAGEGAEDFEGSLELGYQIGFPWS
LGVGINFSYTTPNIAFDGEVLDVTGGVGGIVPLDAIVTPPLFPGVSISAD
LGNGPGIQEVATFAVDVEGAEGAVAVSNAHGTVTGAAGGVLLRPYARLIA
STGDSVTTYGEPWNMN
119870410YP_940362.1 integrase catalytic subunit [Mycobacterium sp. KMS]MRGCGDRVVSEDCVRFGDRLARLFKAGVPVKEAAVATGVSRDRCYAILRA
IGRPVGQARGRGERADQRGVADLGVVVAVFKDTGSILQAATACGVSHSTA
RKLLVAEGLVTSGKIPWGKPEAKRRCLELFEQGWSTGAAAREVGVNVRTA
RDWRKGIRHTNNTRVHPDGRVVDYTDQTVYKQSVSNLICDDTGRPAIDDR
YLSVQDRVAIADGLLGKESLRTIAGRIGKNVSTVSREIRARSIDGRYLPY
HADRAAASARARPKQSKLVVNVVLRGAVEEGLSRKLSPEQISNRLRRDHP
DDESMQVSHETIYQALYFQARGGLKKEVQQALRTGRTRRKPHRKEGERYQ
RFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQTAIGTLVERSTRYT
MLVHLPGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMA
TDMAVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQE
LNGRPRKTLGWDTPAERLRDLLLTN
119870408YP_940360.1 SAF domain-containing protein [Mycobacterium sp. KMS]MGESLDPTPIARLTGLRPDWSRTVTARRIVAAVLVMLAAVAAVRSDPDGD
QVDVVVAATDLTPGTELAESDVRVERRPLTTVPDGAAVDPTAVIGATVAG
PTRRGEVLTDVRLLGPRIAEAAAGPDARIVSLQLADGALVDLVRTGDVVD
VLAAPASNTGEEARPRVIATRAVVVLVSEKRQGPGAAGERAVLVALPAQA
ANDVAGASLTQAVTLTFH
119870406YP_940358.1 5-formyltetrahydrofolate cyclo-ligase [Mycobacterium sp. KMS]MTSPTKSEMRAQVLQARRKVTPETQEREAAALAAHLAEIAAPGRTVCAYV
PIGSEPGSLAMLDELLARGARVLLPVARHDEAGVPAPLRWGEYRPGRLAD
AQFGLREPAPPWLTADAVAEADVVLVPALAVDRCGVRLGRGAGFYDRSLG
RADSAALLVAVVRDEEVVDRVPGEAHDVRMTHALTPGCGLVALRESQ
119870404YP_940356.1 molybdenum cofactor synthesis domain-containing protein [MycobacteriumMRSVEEQQARIAAAAVAPRPVRVAIAESQGLMCAEEVVTERPMPGFDQAA
IDGYAVRSVDVLGVGGGPGADDHDGRDVSLPVMAMIEAGARTPSRLQPRQ
AARVQTGAPMPTLADAVLPLRWTDGGANRVRVLRGVRSGAYVRRAGDDVQ
PGDVAVRAGTIIGPAQVGLLAAVGRERVLVHPRPRLSVMSVGGELVDISR
TPGNGQVYDVNSYALAAAGRDAGAEVNRVGIVDTDPARLREIVEGQLNRA
EIVVIAGAVGGAAAESVRTVLAELGEMEVSRIAMHPGSVQGFGQLGRDRV
PVFLLPANPVSALVVFEVMVRPLIRLSLGKRAPMRRIVEARALSPITSVA
GRKGYLRGQLMRDQDTGEYLVQALGGAPGASSHLLATLAEANCLVIVPTD
VDEVRTGETVDVAFLAQRG
119870402YP_940354.1 hypothetical protein Mkms_4373 [Mycobacterium sp. KMS]MPSIPQSLLWISLVVLWLFVLVPMLVSKREAVRRTSDVALATRVLNSGQS
ARLLRRSGPAAGHHSDPDWRPSADELDDEPLDDRDTRDAEPEGAVVLAAA
PQRDTEPDYLDVDIVEEDSGALPIGSAADQPFEDILPTAAGAPEFDAEPE
DDVDDETDDVAADSDDAESVDDGTEDEYEYVPDSSGIETPADDERAEPAD
DALGAARRRRYESKTAEAVSARKYLFRKRMVTSMAVALLASAVAAYLVAP
WAWWLCGAVGAVTVLYLGYLRRQTRIEEQVRRRRAQRIRRSRLGVENTED
PELDVVPARLRRPGAAVLEIDDEDPIFEHLDEVAFARHFDLPKAAGQ
119870400YP_940352.1 hypothetical protein Mkms_4371 [Mycobacterium sp. KMS]MAEHAEALVRKTKKLGIMGFGAVAVTGAFLAFGAGTAGADVEDVEGDPAA
PSAFPVAEDGIRVADPGVVNAGPSEVRAADINAPLPPAGGESKDSLRAVP
SITGGIGQYIDFGPFGGAGAPIWDW
119870398YP_940350.1 shikimate 5-dehydrogenase [Mycobacterium sp. KMS]MGRPPLNKDTRLCISLAGRPSNIGTRFHNHLYEVLGLDFLYKAFTTTDIG
AAIGGVRALGIRGCSVSMPFKQDVLDLVDEVEPSARIINAVNTIVNDDGH
LTASNTDYLAVQRLIDQYGLDSGCSVMVQGSGGMASAVGAAFRDRGFATG
TVVARNETTGRALAERLGYDYAAQVASRSAEVIVNVTPIGMAGGPEERQQ
AFDADTIAQAHTVFDVVATPAETPLITAARQAGVAVITGAEVVALQAAEQ
FERYTGVRPTPEQVAEASAISRRD
119870396YP_940348.1 hypothetical protein Mkms_4367 [Mycobacterium sp. KMS]MRGPVGSLLAVFTAIAGVVLLAFSGMLTGIVQLLATTALIMGGTDHPLST
PPDTISFVDGYMDDAVDNYIDPGLDTGPSVNKVAVITPEQFFPAFGSMTF
DDSVQEGRDNLNECVAGTPSCEYNESEALGSDAPKPDDSFIVFGYSQSAV
IASLVKRDLMQTPPADATGVSFVLLSNAMRPNGGILARGFEGMTIPLLGV
TFYGPTPTDSCEADGPCYPTVDVAQQYDFMGGDAPVAPLNVVAMANSLAA
YYYLHGSVPAKSLDDPNVIDQGEWGDTHYYLIPAERLPLLMPFEQAGVPA
PILAVLDAPLRVIVEAGYDRESSPGEHVQFRLLPIGDPFRFLVNLAKSVP
VGIDDGLQEAGLGRALGTEDVFRPYGVGGEDLPQPGDSATEDNLRTAAVP
TETTASEPAAEPLTDGPVVSGQPSERKGDEPSQLSNDSPVPPAPEQVKER
RLSPLLRGLSDREEADAPKLPSIRPPGERLVRRVVESVTGQRAERPDDSG
DDASGGTPAAESDPDAA
119870394YP_940346.1 hypothetical protein Mkms_4365 [Mycobacterium sp. KMS]MSTPKKIAAAAGVGLLAACGSPEDADIARVSEVKATFGEQYQYRDIAPTG
IDPKLLQPQKMPAGMRFQPPECAKFAEGRLPEADLKGNMAAATAEGEGNR
FIALAVETNAPVPVTEPGDSCKKVEFSGPGLRGAVEVVEAPHIDGVQTSA
THRVLQTVVAGAPRTGELYNYTARFGTYMVIVTANPLVIPDKPVAPVNTE
LARRLLVDAVAAVQG
119870392YP_940344.1 MerR family transcriptional regulator [Mycobacterium sp. KMS]MDGHELTPSEMSARSGVAVSALHFYEREGLITSRRTAGNQRRYARETLRR
VAFIRMSQRLGIPLARIRAALATLPTDRVPTSKDWAKLSASWREDLDERI
LHLQRLRDNLAGCIGCGCLSLKTCALANPGDVLAGSGPGPVRL
119870390YP_940342.1 hypothetical protein Mkms_4361 [Mycobacterium sp. KMS]MGTIILGSEAIDRGEVSRQGLRSAYRTIFPDVYIPAVAEPSLYANTVGAW
LWSKRRAVITGKAAAALHGAEWVDENSPVELIWRNNRPPHGIVTRNDRFT
CDEVVEIYGLAVASIQRTAFDLGRFLPRGEAVAHLDALARATGLAVDHVL
PLAEQYRGARGVRRCREALGLMDGGAQSPRETWLRLLLIDAGFPRPTTQI
PVLDDYGDPFAHLDMGWERLMIAVEYDGKQHQIDRSRYVWDHKRLTMLRR
RGWLHIRVISEDRPYDILRRVREAWTQRETAQRVVNRSA
119870388YP_940340.1 uroporphyrin-III C/tetrapyrrole methyltransferase [Mycobacterium sp. KMTAGRLLLGATPLGQPGDASERLVNALARADIVAAEDTRRVRQLAQALGV
RPVGRVQSFFDQNEASRVPALVEAIKSGATVLVVSDAGMPLINDPGYRLV
SACVEAGLTVSCLPGPSAVTTALAVSGLPSDRFCFEGFPPRKHAARLSWF
QALATEQRTCVFFESPRRLPDTLRDAADALGGDRRVVVCRELTKTHEEVK
RGTLAELADWAADGVLGEITVVLAGAVPSADLDTLVADVNDRVAAGARVK
DACAEVIAAHPGAPSRRELYDAVVRSRG
119870386YP_940338.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. KMS]MSTTTEHAERFTLLRPLLFTIAYEILGSATESDDVLQESYLRWAEVDLDT
VHDTKAYLAQLVTRQALNALRAQSRRREDYIGPWLPEPLLVQSKDAEADV
VLAESVSMAMLVVLETLTPDERAVFVLREVFGFSHDEIAAAVGKSTTAVR
QMAHRAREHVQSRRKRFEPVDPKTSTEITMRFFAAASTGDLDGLMELLAP
DVVWTADSAGKRSAARRPVTGAERVGRLVLGLLRAAGEAGRIEPAVYNNA
PALKLFLGDSFEGIVTVEIVDGRISHFYAMRNPDKLVGVDVPREITRTV
119870384YP_940336.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. KMS]MTTEHAERFTSLRPLLFTIAYEILGSATESDDVLQDSFLRWADVDLATVH
DTRSYLAQLVTRQALNAVRTNARRREDYVGPWLPEPLLVDDGDAASDVVL
AESVSMARLVVLETLTPDERAVFVLREVFGFDHAEIAEAVGKSVGAVRQM
AYRAREHVHARRKRFGPADAADAAKVTEQFMTAAATGDVEGLLALLAPDA
VWITDSGGRAKAIRRPVLGAKKVAALIAGFFRAAPKQVPDLRLETATYNN
TPAVLVRSGDRVEGMILIDVVDGRIANFYAMANPDKLTGIGVARTIRRQ
119870382YP_940334.1 glutamate dehydrogenase [Mycobacterium sp. KMS]MNGLHENLQGIFEEVARRNPGETEFHQAVYEVLQSLGPVVAKHPEYADSA
IIRRLCEPERQILFRVPWVDDSGAVQMNRGFRVEFNSALGPFKGGLRFHP
SVYLGIIKFLGFEQIFKNSLTGMPIGGAKGGSDFDPKGRSNGEIMRFCQS
FMTELYRHIGEYTDVPAGDIGVGMREIGYLFGQYKRITNRYESGVLTGKG
ITWGGSLVRTEATGYGTVYFIADILKSRGESFEGTRAVVSGSGNVAIYAI
EKIQHLGGTVIACSDSDGYVVDPDGIDLALLKEVKEVQRGRVADYAEMRC
GRARFVHGNVWDVECDIAVPSATQNEINGADAAALVKGGCRIVAEGANMP
CTPEAVKLFAEAGTVFAPGKAVNAGGVATSALEMQQNASRDSWTFDETED
KLAEIMGRIHDRCLQTAEEYGQPGNYVAGANIAGFTRVADAMLALGII
119870380YP_940332.1 TatD family hydrolase [Mycobacterium sp. KMS]MVWDVSRSNRPAPPAPEPLTPLIDAHTHLDACGARDGDDVRAVLDRAGAV
GVGAVVTIADDLASAHWATRAADWDDRVYAAVALHPTRADALTDEAKVEI
ERLVAHPRVVAVGETGLDLYWPGKLDGCAEPEVQREAFAWHIDLAKCTGK
PLMIHNRDADAAVLDVLAAEGAPETVIFHCFSSDAQMARTCVDAGWLLSL
SGTVSFRNAHALREAAQLIPGEQLLVETDAPFLTPHPYRGAPNEPYCLPY
TVRALAEVRGEPAEELAQQTADNAIRAYALRTG
119870378YP_940330.1 dimethyladenosine transferase [Mycobacterium sp. KMS]MTIRLLGRTEIRRLAKDIDFRPRKSFGQNFVHDANTVRRIVSASGVHRHD
HVLEVGPGLGSLTLALLDRGAHVTAVEIDPLLAQQLPTTIADHSHSEINR
LTVLNQDILTLMPSDLENQPTALVANLPYNVAVPALLHLLAEFPTIRSVM
VMVQAEVAERLAADPGGKDYGVPSAKVRFYGNVRRYGMVSPTVFWPIPRV
YSGLVRIDRYETSPWPTDADFRAQVFDLIDIAFAQRRKTSRNAFAEWAGS
GNESARRLLAASIDPSRRGETLAIADFVRLLQRSGEAEEQVRVQ
119870376YP_940328.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. KMS]MSRFTEKMYRNARTVSTGMVTGEPHEPIRHTWGEVHERARRIASGLAAAG
VGHGDAVGVLAGFPVEIAPTAQGLWMRGASLTMLHQPTPRTDLAMWAEDT
MNVIGMIEAKAVIVSEPFVVAIPVLEEKGIKVLTVSDLLAAEPIDPIEVG
EDDLALMQLTSGSTGSPKAVQVTHRNIHSNAEAMFIGAEYDVENDVMVSW
LPCFHDMGMVGFLTIPMYFGAELVKVTPMDFLRDTLLWAKLIDKYKGTMT
AAPNFAYALLAKRLRRQAKPGDFDLSTLRFALSGAEPVEPADVEDLIDAG
KPFGLKPEAILPAYGMAETTLAVSFSPCGAGLVVDEVDADLLAALRRAVP
ATKGNTKRLADLGPLLTDLEARVIDENGNVMPPRGVGVIELRGECVTPGY
MTMGGFIPAQDDHGWYDTGDLGYITEEGHVVVCGRVKDVIIMAGRNIYPT
DIERAAGRVEGVRPGCAVAVRLDAGHSRETFAVAVESNNWQDPAEVRRIE
HQVAHEVVAEVEMRPRNVVVLGPGSIPKTSSGKLRRANSVSLVT
119870374YP_940326.1 ABC-2 type transporter [Mycobacterium sp. KMS]MTAVESRQSDQARRPLTHRTNLVQQSWIMVKRNMIHTKRMPEMLSDVTAQ
PIMFVLLFAFVFGASITNTGGASYREFLLPGIQAQTIVFSAFVVASGITA
DVEKGIIDRFRSLPISRSSVLIGRSIASVIHSSLGVFVMALTGLAIGWRI
RGSVGEAVLAFALLLLFGFGMIWFGILIGSLMRTVEAVNGVMFTALFPMT
FLANTFVPTEPMPHWLRVIAEWNPVSSLAQAMRELWGNGGPAAPDAQLPL
HHPVLATVLWSLVLTAVFAPFALRAYARRTGG
119870372YP_940324.1 hypothetical protein Mkms_4343 [Mycobacterium sp. KMS]MAAPEHHDTDNTQPPPPVRPTPPGGGLGSVLGPLERTGRFYAESWRDYLD
RSDRTVPVARPTLSLASHALRDEIVLLGLRARRPLSDPGTFSRITREVEA
AVDFYGERGWLDDPTRFFAPPPPLTDISIQRVKSARHTHQRLVFDSGYAP
HPGEPGAERWQTYTANRRCYGLMLRHREPRPWLVCIHGAEMGRAALDLTL
FRTRWLHHDLGLNVVLPVLPMHGPRARGLPKGAVFPGEDVLDDVHAAAQA
VWDVRRLLSWIRSQDPDAPIGLNSISLGGYVASLVASLEDGLTCAVLGVP
VADLVELLGRHAGLGRDDPRRATIKLAEPLGRMTSPLSLNPRVPMQGRFI
YAGLADQLVHPREQVVRLWEHWGRPEIVWYRGGHTGFFQARPVQRFVEAA
LVQSGLVDGAARSRER
119870370YP_940322.1 hypothetical protein Mkms_4341 [Mycobacterium sp. KMS]MLLTAGHGRLSGAELTDLLRGAGVTSLIDIRRFPGSRTNPDMSRDAMASW
LPAAGIGYRWEARLGGRRRLTADEPRDDPWWQVEQFAAYAAHTRTAEFDA
ALTEVLDESGCRTVLVMCSESVWWRCHRRLVADVAVLRFSAAVSHLMHDG
RLTPHPVAAGARLRDDGFVVWDGAVQDG
119870368YP_940320.1 50S ribosomal protein L25/general stress protein Ctc [Mycobacterium spMAKNAPNKLTAAVRTETGKGASRRARREGKVPAVLYGHGTDPQHLEVNAR
DFAAVLRHAGTNAVLTLDIDGTEQLALTKSLEIHPIRRNIQHADLLVVRR
GEKVTVEVNVVVEGDATPGALVTQEANAIEIEADVQSIPEQLTVSVEGAE
EGTQITAAQVELPSGVTLISDPETLVVNIVSAPSAEELESEGGGASLEEQ
AAEVAEAEASEEAAEAGEESAE
119870366YP_940318.1 hypothetical protein Mkms_4337 [Mycobacterium sp. KMS]MTARRVTAAAAALLVLAIGGCGAETPDYQSVWSTSSSAAPSPETPTETPV
PVAQYLEEAGVTGRTVAPEKLPDLTVSIPTPPGWQPYPGTQFEPGTRVIA
KGDTYPIAMLLVFELTGQFDPAEAIKHGDDDARLSENFKELNASQENWRG
LPSAMVEGTYDLNGQRMQTYNRIVIATGSPPANQRYLVQLTVTSFANEAE
KYGKDIEAILTGFTVAPKK
119870364YP_940316.1 ribose-phosphate pyrophosphokinase [Mycobacterium sp. KMS]MGTEWTDNRKNLMLFSGRAHPELAEQVAKELDTPVTAQTARDFANGEIFV
RFDESVRGCDAFVLQSHPAPLNQWLMEQLIMIDALKRGSAKRITAILPFY
PYARQDKKHRGREPISARLVADLLKTAGANRILTVDLHTDQIQGFFDGPV
DHMRAQKLLTGYIAEHYPSEDMVVVSPDSGRVRVAEKWADSLGGTPLAFI
HKTRDPLVPNQVVSNRVVGDVRGKTCVLTDDMIDTGGTIAGAVKLLKQEG
AGDVIIAATHGVLSHPARERLAECGAREVIVTNTLPIGEDKQFPQLTVLS
IAPLLANTIRAVFDNGSVTSLFDGSA
119870362YP_940314.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAAPDKEVRAPRARMTGSERRQQLVEIAKSLFAQRGYEGTSIEEIAQRAN
VSKPVVYEHFGGKEGLYAVVVDREMSALLDGITSSLTNNRSRVRVERVAL
ALLTYVEERTDGFRILIRDSPAAITSGTYSTLLNDAVNQVSSILAGDFSR
RGLDPELAPLYAQALVGSVSMTAQWWLDTREPKKEVVAAHLVNLMWNGLT
HLEADPRLQDEE
119870360YP_940312.1 transcription-repair coupling factor [Mycobacterium sp. KMS]MTVSGLHHVQTPIAGLIELALRDPCLADLSARAADKPDDLAMVGPASARL
LVTAALAQAGPLLVVTATGREADDLTAELRGVIGDSAALFPSWETLPHER
LSPGVDTVGARMMLLRRLAHPDDARLGPPLRVVVTTARSLVQPMAPGLAE
VEPVTLTVGAEMDFDGVIKRLVDLAYTRCDMVAKRGEFAVRGGILDVFPP
TAEHPVRVEFWGDEISEMRMFAVADQRSIPEIEVDTVIAVPCRELLMSDE
VRSRAAVLAAEHPTHENSVPGSVPDMLAKLAEGIPVDGMEALLPLLRPTD
LAMLSDHLPDGAPILVCDPEKVRTRAGDLIKTGREFLEASWSTAAVGGAA
PIDLEAMGASGFLGFEEVRTGARAGGHPWWTLSQLSDEKAIELDIRSAPS
ARGQQSSVEEIFAMLRAHVATGGYGAVVTPGAGTAHRVVEQLGENDTPAT
MLEPGEEPKAGVVGVLKGPLHDGVVLPGANLVIVTEADLTGSRVTATEGK
RLAAKRRNVVDPLALTAGDLVVHDQHGIGRFVEMTERVVGGARREYLVLE
YASSKRGGGSDRLYVPMDSLDQLSRYVGGEAPSLSKLGGSDWANTKTKAR
RAVREIASELVALYAKRQAAPGHAFSPDTPWQNEMEDAFGFTETVDQLTA
IEEVKADMEKPVPMDRVICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPT
TLLADQHLQTFTARMAGFPVTVKGLSRFTDPAESRAALEGMKDGSVDIVI
GTHRLLQTGVVWKDLGLIIVDEEQRFGVEHKEHIKSMRTHVDVLTMSATP
IPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPQDDKQVAAALRRELLR
DGQAFYIHNRVRTIDQAASKIAALVPEARVVVAHGQMPEELLERTVEGFW
NREYDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQLRGRVGRSRE
RGYAYFLYPPEQPLTETAYDRLATIAQNNELGAGMAVAMKDLEIRGAGNV
LGAEQSGHVAGVGFDLYVRLVGEAVEAYRAAADGKTVATPQETKDVRIDL
PVDANLPPDYIGSDRLRLEAYRRLAAAQDDAGVDAVIDELVDRYGPLPEP
AQRLVGVARLRLVCREYGITDVSSVSASTVKLSPMELPDSALLRLKRMYP
GATYRATTGTVSVPIPRATDSVGAPRIRDAELVAMVAGLVLALNGKPQAQ
IDTAKFGGSRA
119870358YP_940310.1 Dyp-type peroxidase family protein [Mycobacterium sp. KMS]MTGGSRRTGLSRRTFFAGALGTGAAVGVGAALSGCSDARPAAPVSGARFV
PFDGPHQTGITSVPIPEQGLIASFNVLSKDRAGLAATLAELTDEIRGLMA
GRPPEVRDPAYPPVDSGILGEKPPPDNLSVVVGVGASLFDDRFGLADRKP
RELETMPFLANDRLDPKLSHGDVSIILEAGHTDTVQFALRQLMRRTRSHL
VLRWMVDGYARGIGAGPASEAATPRNLLGFKDGTSNLDPEDDALMDRHVW
VGPDDGEPDWAVGGSYQAVRIIRMFVEFWDRTRLAEQEAIFGRRKVSGAP
IGMTDEFADPDYAEDPDGKRIKLDAHIRLANPRTAETEQNLILRRGFSYS
RGFDGAGRLDQGLAFVSYQRSLEKGFLTVQRRLKGEPLEEYILPVGGGFF
FMLPGVTGEDRFLGDRLVD
119870356YP_940308.1 putative lipoprotein LpqU [Mycobacterium sp. KMS]MSDEGSLSTRTKARWMTVAAVVVATILVLASSCSWQMGIPIPEGVPPPPG
DPVPAVDTYADGRPADALREWAAERAPQLGIPVTALEAYAYAARVAEVEN
PDCHLTWTTLAGIGMVESHHGNYRGAMVAANGEVTPPIRGMRLDGSSGNL
EIVDTDSGLLDGDDELDRAMGPMQFIPETWRLYGVDANGDGKSDPDNIDD
AALSAAGYLCYTGKDLSTPRGWMNGLRAYNYSEQYARTVRDWATAYADGR
RL
119870354YP_940306.1 septum formation initiator [Mycobacterium sp. KMS]MPESKRPDPKRRSPASRPGKPGGANRGRPKGTSTPRREPRAIEAKPASEQ
PYAESVGHAIVRRAEQLAVEQSEQRFGSAARRAAILAAVVCVLTLTIAGP
VRTYFSQRTEMKQLKATEEQLREQIAELEQQKVKLADPVFIAAQARERLG
FVMPGDIPFQVQLPPGAVAPGSRPADEQPNAPSGQPWYTSLWKTIADEPH
GAPAPPPVPPGPPPLPAPPPPPGG
119870352YP_940304.1 Ppx/GppA phosphatase [Mycobacterium sp. KMS]MAAVDCGTNSIRLLIADAADGRLTDVHREMRIVRLGQGVDATGEFAPDAL
ARTQGALAAYAELMRAYEVAKVRMVATSAARDVANRDAFFQMTADVLGEV
VDGAVAEVITGTEEAELSFRGAVAELDPADGPFVVVDLGGGSTEVVVGRD
RVDASFSADIGCVRLTERCLHSDPPTAEEVSAAREFIRGALDEALQQVPV
QGARTWVGVAGTMTTLAALAHRMTTYDSEAIHLSRVGFRSLLEVCDELIA
MTRQQRAALGPMHEGRVDVIGGGAIIVEELARELGERAGINELVVSEHDI
LDGIALSIA
119870350YP_940302.1 hypothetical protein Mkms_4321 [Mycobacterium sp. KMS]MTHPPGPPYPGGYGYPAPPPQPPKKISIGMVFVGAPVYVALNSLLGFLAF
IIASSSTDSANIILGAAAVMLALIAFGGGAALLTVRNPQAKGVGLGLMVG
WALVSLVTVGICTGINPSLYAT
119870348YP_940300.1 hypothetical protein Mkms_4319 [Mycobacterium sp. KMS]MLGALLWGLVAASSLIVGALAGVARDWNRHLIGLVLGFGAGALVAGISFE
LAEEGFRVGGALSVSLGLAAGAVTFFIADHLVDRVGNGKKTTAGIPLLLG
ALLDGIPEQAVLGIGIAAGGAVSPALLTAIFVSNLPEAVGSASDLRGAGH
RVKGIVLGWTAIALLCAAATVGGYQLREIAGASLQGGIDGFAAGALLVML
VGSMIPEATEKAREQAGLAAVLGFALAAGLSLAA
119870346YP_940298.1 hypothetical protein Mkms_4317 [Mycobacterium sp. KMS]MPFYWTEAHHTDDYSRGGRTDIDDLTLACQPANLLIEKTGWTTHRPGNGR
TEWTPPKEQDTGQPRINNHFHPHRYLTDKSEGDDPPG
119870344YP_940296.1 hypothetical protein Mkms_4315 [Mycobacterium sp. KMS]MSRIPLWDRAIHITSRTLSGMTINMSIPTRDEIENLSDTDHKVLENRLRR
AAERQDLRLLKSRARDPRSRLYGTYMLTDQNNGVVFADHSTGRGYGLDLV
DVAEWLFGDREQFAVQADTREALR
119870342YP_940294.1 hypothetical protein Mkms_4313 [Mycobacterium sp. KMS]MIGATGSPQQAAEKVAADLAALAEKLDVLRERPDWHHDDVLAPALAALTS
AAKSTPAQRAKRRAAKDEARADELARAKAARNRFRTPASDRRTGGPNAVK
ARRS
119870340YP_940292.1 phage major capsid protein- HK97 [Mycobacterium sp. KMS]MAFLSTSAGSILKPEEVHDLIVQPTQEQSVAMQTATVVPTSSAEFRFPVV
VEDAAAQWLSEGEEIPLTDPTVDEVVARPKKIASLTKVSRELAEDSSPEA
TALVGASVARDMARRIDAAWFAASTAKGPAGLASLIGTAQSVAGGAYTNL
DALAEALSLIEDVGGNPTAFVSNSSTVLALSKLKKTSDSNEPLLSPNLAT
GATQRIERQLLGVRLHSTPDTNLEDDVIWAYDQSKVFVVLRRDVDLAVDQ
SAFFTSDSLAVRCTMRIDFAFPHPQSVVRVGPDGS
119870338YP_940290.1 hypothetical protein Mkms_4309 [Mycobacterium sp. KMS]MPESSTTATDSGSSTGAEGGAQHQDSTGRELPADSPEATERQDNPASEAP
GTDTGGGAGEPVADSRQVSDDPPADLQEGEPDPADDGKPDREAAKYRRER
NEARAEVDRLRATVETFQRAEVERLAALKLIDGRDVWAAGAKLADLLADD
GTVDIEKVSAAAQEIAATRRHWAKQAAAPASVVTGNQKPGYGDDEKTTWG
DVFQRVRNGVAPEDR
119870336YP_940288.1 hypothetical protein Mkms_4307 [Mycobacterium sp. KMS]MRCPLCSRLTWLDRLPSTRSVPAHCNPHALLRLETHTLRRTIEHHRDQRP
EAAARRAFIAQCRAQHLADHDQGGADDAVAGGD
119870334YP_940286.1 hypothetical protein Mkms_4305 [Mycobacterium sp. KMS]MTERSGLDRPNPHLNGWSTNDVVRLLLSLAEELQNLDAELSGLERDAVTK
AEQLNVAQAKALLTATGKTVGEREAQALLATEAERLAARLAEINVKATKR
RVETLRMRIDIGRTVCATLRSETELERSSWR
119870332YP_940284.1 hypothetical protein Mkms_4303 [Mycobacterium sp. KMS]MRPNPHLVQPPVPDTPRLREAREALQTCYGKQESIAAIREYLAALAEARA
RPGRGADAAVAERLCCECQTRPATTDDGLCRSCHIAETREQAALLLDVPP
EKENSR
119870330YP_940282.1 hypothetical protein Mkms_4301 [Mycobacterium sp. KMS]MLVGPVSAYRSPALSQMETDNRMSDYAPLYGEVWGDPRWRQLSKTAQWLY
LMLMSSPSRNAAGIVQMQPIGWANCAVDATVDEMHDAIGELVAQRYIDVD
DDTQEVILLGFIENDAIRNPTFYVSSLKHARNCQSPRLRAVLFKAVQGVH
PPDLSCFKAEKVRERRQAGIDAAYDAFAERVQRDAAADLNLPAVTFNSSP
LPASVAATTTASVTTTTTRGDAMGDAMGDQTMGHRMGDAMGDVMCSMHPD
QPAVDGSKWCADCLERERRWQGQS
119870328YP_940280.1 recombinase [Mycobacterium sp. KMS]MRAAIYTRISKDQTGEGLGVQRQLDACLALADRLGWAVVTRYDDNDLSAY
NGKTRPGFEALLDGMKRGEFDAVICWHTDRLYRSLKDLVRLLEVAVGIDI
RTVCGGDLDLSTPTGRMLATILGGVAVQESEHKGERQREANEQRAAAGRW
HTANRPFGYTMSGEALEPEASAVRQAAADVLAGKSIRRVAMEWNEAGLRS
TLAGRERKSKDGTVVKVVDGRWNAPRVRQLLLRPRYAGLRVYRGKVVGKG
DWEPLIDEDTHRGLVAFLSDPSRAPRTKFERKYQGAGVYRCGKCGGPMRT
GKPKGGRRTYLCREYSHVVRQGESLDRYVEMLVLDRLSRPDVHLVLAGGD
RLDLPTLHARREALQARLDEAAGMFAKREIDGAQLRRITNDLRTEVAGVD
KVLADAARVSPVTGLISESTDRDEVQQRWEALSPDLRGKVIDELMTVTVQ
PAPRGTNGFHPEHISVEWK
119870326YP_940278.1 two component transcriptional regulator [Mycobacterium sp. KMS]MTRVLVVDDEPQILRALKINLSVRGYEVTTAATGAEALRSAADHKPDVIV
LDLGLPDMSGIEVLAGLRGWLSAPVIVLSARTDSSDKVEALDAGADDYVT
KPFGMDEFLARLRAAVRRATKESDGDEPVVVTGSFTVDLAAKRVVKNGAE
VHLTPTEWGMLEMLVRHRGKLVGREELLKEVWGPAYAKETHYLRVYLAQL
RRKLEDDPSRPRHLLTEAGMGYRFQQ
119870324YP_940276.1 K+ transporting ATPase- KdpC subunit [Mycobacterium sp. KMS]MKLSSILRGHAAALRALLVLTVAVGLAYPVLIWLVAQLPGLRDQADGSLL
EQDGKPLGSSLIGQLYTDADGNPLPQYFQGRPSAAGDGYDPLSSGATNLG
PEDIVDTPDRPSLLTQVCARSLAVARLEGLTDDAGARPFCTGGGVGAVLS
VIGPRDTNGLVTRPVRVTSVNEPCASTDRPFLDTYEGVRVECARDGEDYG
TGQIVPIRGGAPADPPVPADAVTASGSGLDPHISPAYAELQVARVAAARG
LSPERVRALVAAHTEGRTLGFMGEPRVNVLELNLALDGG
119870322YP_940274.1 potassium-transporting ATPase subunit A [Mycobacterium sp. KMS]MSTTTAGILFALSLALALAAVHVPLGDYMYRVYASEKHWRAERVAYRIIG
ADPAAEQGWGSYARSVLAFSAVSILFLFGLQLLQGRLPLHLNDPATEMTP
ALAWNTAVSFVTNTNWQAYSGESTQGHLVQMAGLSVQNFVSAAVGMAVAM
AFVRGLARRDTGELGNFWVDLIRGSLRILLPLSIIGAIILVSGGVIQNFA
LHDTVVSTLSGAQQTIPGGPVASQEAIKELGTNGGGFFNANSAHPFENPT
TWTNWVEIFLLSCIAFSLPRTFGRMVGSRKQGAAILAVMAVIATLSLSLM
MLFQSQTHGTVPTAVGSATEGVEQRFGVADSAVFADLTTLTSTGAVDSFH
DSYTSLGGLMTLFNMQLGEVAPGGVGSGLYSMLVLAVITVFVAGLMVGRT
PEYLGKKITPREIKLAATYFLVTPLIVLIGTAVAMALPGQRDGMLNTGPH
GLSEVLYAFTSAGNNNGSAFAGLSVNTEWYNTALGLAMVFGRFLPIILVL
ALAGSFARQGRTPESVGTLPTHRPQFVGMVTGVTLILVALTFLPVLALGP
LAEGLH
119870320YP_940272.1 endoribonuclease L-PSP [Mycobacterium sp. KMS]MPITPINPEGLPAVGLYHQVSLATGSKLVFIAGQVARDATGAAVGEGDLA
AQVEQCYLNIGAALAAAGATFDDVAKLTVYLVDWTPEKMPAFADGLARAQ
ATLGFTAAPPLTGIGVAALAEPDMLVEIEATAVID
119870318YP_940270.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MGVNRERRGRGDEVEVSASAELESDVKGRILDAAAEAFMARGFANTTIDD
IADEVGATKGLIYYHFRSKFDIFLAVYQDGMRRVRERVEPHSTAPGTGFE
RLHAMSVAHLENLMTELGYHHVVHQGVRHQDSTALKVRQRDALTALNELR
RDYERMFRRVIAEGIADGSLRKVDEALATRTLLSNLNAVDVWYRRIDGQT
DEEIRALAGDVVDLLIGGLGA
119870316YP_940268.1 hypothetical protein Mkms_4286 [Mycobacterium sp. KMS]MSLWEDAAAKKAAERSQASAGERADQRLAEQQRAQLKEFVEAMTRLGVAP
TKQTFWSNVGIRDSGGTKKVRVPAMQGWTIMHDPGRYDMHPTHYFVATTG
DVYSSTVPPHQKMFSKPPLPEPWALPIKWDHWGQLFESKTLGERLRDIIA
EKMA
119870314YP_940266.1 XRE family transcriptional regulator [Mycobacterium sp. KMS]MASERLGEFLRARRAQVNPEDVGLQHYGERRRVAGLRREELAQLAGVSVS
YYTRLEQGQSVNASAAILDSLARALQLNEYERQHLRDLATRRTEPVRRPP
AERVSTLTRDLLRSLGDLPAVVVGRRTDVLAWNDVGHALVAGHIDREAVE
RATERPNLARMMFLDPHTRELYLDWPRKARAVVGNLRHVAGRHPEDALLS
APIGELTVKSPEFVALWADHRVKRCEADTYDLHHPLVGPLTVTQQNLTLA
RSPEQALSVMTTAEGSASADTMQLLIRSVRGDHPAPQRV
119870312YP_940264.1 type B carboxylesterase [Mycobacterium sp. KMS]MSDPVVVTGSGAVRGRTLAECQVFHAIPYAAAPEGRARFAAPEPHPPWPG
IRDATMPGPTAPQPRRDGFGRLDMSPFFGPGWVRDPDYMTVNIWTPHANA
TAGQPYPVMVFVHGGGFVAGSTRTPLYDGSAFARDGVVLVTVTYRLGIAG
FLDIAGAPRNRGLLDVLTALAWVRDNIAAFGGDPDNVTLFGQSAGATTTA
GVLAEAQAPTLIRRAIMQSGNPYGAFSPDQAERVSRAVADALGVEPTVDD
LAGIPDEILVGVAAELGGVDLRVGDRFDPLVGLSPFSLVSDRQTDPTAHP
EVGVLIGTTTEEGNLYLVPQGHLDISTEEDVHALAARVHPDPDTLVQDYR
TRHPRACWGALRSTILGDALFRTGTERFALERQASAPTYRYEFGWRSTGV
GGELGAAHAVDLPFVFDRTDVDVLRGPRGLLGDGDVPPELVGAMHGAWVR
FATTGDPGWAPNELRRWR
119870310YP_940262.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium sp. KMTRTRSDSLAAGGLNWNSMPLKLFAGGNAKFWDPADIDFSRDRADWESLS
NLERDWATRLCAQFIAGEEAVTQDIQPFMAAMRAEGRLGDEMYLTQFAFE
EAKHTQVFRMWLDAVGMTDDLQCYLDDLPSYRQMFYEELPASLEALATDP
SPAAQVRASATYNHVIEGMMALTGYYAWHRICVDRKVLPGMQELVRRIGD
DERRHMAWGTFTCRRHVAADDANWEVFENRMNELIPLALSNTDDSFALYD
EIPFGFAKEEFQQYAADKGMRRFGTISSARGRALAEIDVDYSPLQLEDTF
AAEDSRVLATSA
119870308YP_940260.1 hypothetical protein Mkms_4278 [Mycobacterium sp. KMS]MVLARELGAIRSGLGSALFGMVAGPDGPDNRARIHGTPGPRWFAEDRPIR
RVHADASMFVGGLRALLLQSLHPLAMAGVAGHSDYRGDPWGRLQRTSTFL
AVTTFGPAADAQRAVDKVRGIHRRVRGVAPDGTPYDATDPHLLEWVHIAE
IDSFLLAHQLYGAQPLDQTGRDAYVADTSRVATALGVLNPPRTEDQLRER
IEAYRPELRSTAAARDAARFLLLTPPLPLPARAPYGVLAAISVAMLPGWA
RKPLRLPYFPPLEATAVRVSGRVLVGGIRWAMTASQEERTTARSTPSVR
119870306YP_940258.1 hypothetical protein Mkms_4276 [Mycobacterium sp. KMS]MRVPRRIAEFNKRVTNPVARTITPWLPGLGTLEHVGRKSGKRYRTPLLVF
ETHDGYAILIGYGPQTDWLKNVLAGGPTVLRKRGRAVALVNPRVVSKAEA
AALVTPRSRLLYRAFPYNEAALLLTTAGSRN
119870304YP_940256.1 hypothetical protein Mkms_4274 [Mycobacterium sp. KMS]MNAITIHAPVLRAIALSTFAGAAAVGAIMFGPASPAHADSAAATIHQLEA
SGFDVRLNRIGSAPLEECRITEIGRPQERRRLTLVEGRDDDRALIPVVVK
RTITVTLNCA
119870302YP_940254.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MHITRVGTGDPPLFFVHGLACDGTDWRAQVRTLKPTMTVVTCDLPGHGLS
PGTPAECTIEAYGTAVAQALAALDVPPAVLVGHSMGCRVVLAASRRRPQA
VAGLVLVDGSRIGAGDSEAAGQSMADELVGDGYLRFMRSFFESMFVPSSD
PAIRQAIVDRALRFPAALGRPLLTDLARWDAGDVEGALDAVDVPLLAIQS
TTMDTARERVSLAPGVASPWLDLVGSHVPRSRQAILPGSSHFPQIELADE
VTALIGDFAVAVKNDDHPREGLTPA
119870300YP_940252.1 hypothetical protein Mkms_4270 [Mycobacterium sp. KMS]MMPTRGVVDETVDATEQLIALPSMESARGVCALGPGIEKSQVPSVMSASQ
ADLVVVGSPLDSNAKLDHVIAVDSSAKVSR
119870298YP_940250.1 hypothetical protein Mkms_4268 [Mycobacterium sp. KMS]MRCGRGTGRSISCEGLMKVVAHQDMCVSAGQCAFTSPALFDQRDDDGVVV
LLNQPIADQHDDARRAVESCPARAIDIEE
119870296YP_940248.1 Cl- channel voltage-gated family protein [Mycobacterium sp. KMS]MTDPAVDRDQPAESGRRWVYLCATAVVAGVAIGFIGGAFRWCLQAADRLR
VDFVDWAHDLAGPGWLAPMAAAALGATLAALIVRWVPLAAGSGIQHVEAV
YRGDARAPLLILLPAKFVGGVLSIGSGLVLGREGPTVHMGAAIGAEAARR
ARLPDPDIRMMQTAVGGAGLAVAFNAPIGGTLFALEEVTKSFRLPTVLTT
LFAAAAAVGCMRFILGNEPDFFVTSVDTPALAWLPLFVVFGLLTGCLGAA
YNRLVLWFLDHVGGMRRVPAIAKAAVIGAIIGLAMFVYPEAVGGGDTLTQ
LILGGHEIVLPVVVGYLLVRFVAGPLSYSAAVPGGLFAPLLAVGALWGLL
FVGVSGPLLPGDVAALSIPMALVGMAAFFGATVRAPVTGIVVVIEMTATT
AVAIPMLAATAAAVLAAELTGSPPIYDSLRERMLPRAKR
119870294YP_940246.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MTGLLTQFRSFGWPSRLLMINQFGINLGFYMLMPYLAGYLAGPLGLAAWA
VGLVLGVRNFSQQGMFIVGGTLADRLGYKPLIVAGCLLRTAGFGLLIFAE
SLPAVLIASAATGFAGALFNPAVRAYLAADSGARRVEAFALFNIFYQAGI
LAGPLVGLALLVLDFRVAAAAATAVFAVLTVAQLFALPQHSASAPTEKSS
VLADWRVVVANRSFLLFAAAMIGSYVLSFQVYLALPLQAGMLAPNDETLI
VAGVFVVSGLVAVFGQMRITRWFSARWGAGHSLVVGLVILAAAFVPLMAV
PDGGRFGGGAAVAALLVAAGVLAVGSAAVFPFEMDTVVSLANDRLVGTHY
GFYNTIVGVGILVGNLATGSLMQAARDAGMAGLTWAALAAIGLASAAALY
RLDRTGRLRPAPTAVTGV
119870292YP_940244.1 hypothetical protein Mkms_4262 [Mycobacterium sp. KMS]MLVHAGLVPLRPRNETGKPSCATCLAERDRAVVTTRCQVGGLMDESKSAV
RVGAIVRFNDAVLQKRWRPAVALMLALWLVAVGFEWTQPGAGHPHHGPHA
LAAGPHGDPAAMTDHAHFENGSIPVSPDTYADAVRPRATVALMALGLLAA
MVAVAVFYRGAPLALIRGPPRGLGEVLTGRVLLTRLCIARR
119870290YP_940242.1 hypothetical protein Mkms_4260 [Mycobacterium sp. KMS]MVVLGVLLLILAAVAVVVGLVFYGNGMGTVPDEPMRDTGATRRGVSRIAW
SELFGTMKTSVKGATRSDDRRQRAASMGAFLVMVGLILVVLAVVSFLTAM
L
119870288YP_940240.1 L-ectoine synthase [Mycobacterium sp. KMS]MIVRTTQAITGTERDVAAKDWRSKRIVLADDGVGFSFHETTINANSVSEF
HYRHHVEAVWVVEGSGTLTDHETGEEFPLLPGTMYLLDGHERHRVTCHEQ
LRMLCVFNPPVTGQEVHDESGAYPAPVAS
119870286YP_940238.1 L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium sp. KMS]MHALNTDPRATTWTTGSDDTVRQRNSWLRYLRRPTKSDAIAMHRLVSETG
VLDVNSTYAYVLLATDFADTSIVADRGDDLCGLITAYHPPTRPEVLFVWQ
VAVTSAARGTGLAGTMLDALVHRVRKDRHGHPITVETTVAPLNAPSRALF
GAFARRHRVPIAEQPHFSAAHLDADEAHDDEPLLRIGPLTTTLAD
119870284YP_940236.1 cation efflux protein [Mycobacterium sp. KMS]MAADRALTAHRREILSRRIRWFVTATISYNIVEAIVALAEGSRVSSSALI
GFGLDSVIEVSSAAAVAWQFAGRDPEAREKVALRVIAFSFFALAAFVTVD
AVRSLFGIGEARHSTVGIVLAAVSLAVMPVLSWAQRRAGRELGSLSAVAD
SKQTLLCTYLSAVLLAGLVLNSAFGWSWADSVAALVIAAIAVKEGREAWR
GEACCAAPPRDAANCCEAERDGAPGETAL
119870282YP_940234.1 M15D family D-Ala-D-Ala dipeptidase VanX [Mycobacterium sp. KMS]MPKTLRGVLGIVSAAVLAAVAAPVASAQPEPTAPADFVSLTDVDPSILLD
VRYITPHNFTGDPVDGYRAPLCLLTRPAAEALRRAQQEFVEQGYSLKVYD
CYRPQRAVNDFVAWAKNLPDQRMKAEFYPRVDKTQLFADGYIAENSGHSR
GSTVDLTLVALPAEEQPAFVPGQPLVDCAAPVAERFGDDTIDMGTGYDCF
DTLAHTLDPRIQGEQLKNRLLLKDGLEKQGLENYENEWWHFTFKPETYPD
TYFDFPVDPSSLTGLGHR
119870280YP_940232.1 hypothetical protein Mkms_4250 [Mycobacterium sp. KMS]MMSPDGANVRPMSHRLVRIYREGRAAYPHTIDCPYTGDLVAARMWRLGWQ
KARDEHRGIPPVTETLQRMSEQLADLAPLAERLGDHD
119870278YP_940230.1 putative esterase [Mycobacterium sp. KMS]MAQRFSGWSWTRVLGAVLLTALLPLSPSIAPSATAYSRDGLPIETLEVPS
AAMGRNIRVQFQGGGPHSVYLLDGLRAQEDANGWDINTAAFEWFYESGVS
VVMPVGGQSSFYADWYQPAANSAGVVTYKWETFLTQELPGWLAANRGQDP
RGNAVVGLSMSGGAALNLATWYPTQFIFASSLSGYLNPSAGLWPTLIGFA
MKDAGGFNPQNMWGPTSDVAWRRNDPTVNVGRLAANGTALWIYCGGGVAS
DLDTGSDFGGNFSAGYLENITVSTNKEFQQKYLAAGGHNAVFNFPPKGTH
SWGYWGSQLQAMKPDLLRVLGVGVAPPPPPPAAPVPPALPAPAVPPAPVP
PAPALPGA
119870276YP_940228.1 peptidoglycan binding domain-containing protein [Mycobacterium sp. KMSMVEHPGWTQRGHGDFDDIRGVMVHHTGSDTATAASIADGRPDLAGPLSQL
HIARDGTVTVVAAGVAWHAGAGRYRWLPANTGNRHTIGIECANTGTGPTA
PHRTNWPDAQYLALVRCCAAIMRRLGFGAARTIGHREYAGGVQGKWDPGA
IDLDTLRADIQARIGFADAHVAEAQRRLKYAYRRYAGHLEIDGVYGPETE
AAVREFQRRTPGLLADGIVGPATAAALGVAAR
119870274YP_940226.1 Fis family transcriptional regulator [Mycobacterium sp. KMS]MSTRPISVLIVEDDPLIAEAHQTYLSRLTGFATAAVAHTARDAMRAASEA
ATGEHPIDLVLLDLGLPDATGISLASALSGLRPAPDIIAITSERDLEMVR
AAVSHGALAYLLKPFTFAAFRDRLERYRRYRDALPAGIDAASQTEVDRAL
AELRGSADRATAPKGTAPGTNDEIARAVRDSADGLTADQVASQVGVSRVT
AWRYLERLADDGTVTRLTDYGRAGRPKTRYQWR
119870272YP_940224.1 sodium:dicarboxylate symporter [Mycobacterium sp. KMS]MSVTLDPPPEAPAAKRRDRTHWLYIAVIVAVVAGVAVGILAPEVGKSVGV
LGSMFVDLIKMMIAPVIFCTIVLGIGSVAKAATVGKVGGLAFVYFLVMST
FALAIGLVVGNILHPGTGMNLSESTAGKGAELAEKAHESGGLLDFVQGII
PDTLVSALTAGSVLQALFVALLVGFALQAMGRSGEPILRGVEHLQKLVFK
ILVMILWLAPIGAFGAIANVVGQTGWAAVTQLLTLMLGFYLTCAVFVFGV
LGALMRAVAGVSIFKLVRYLAREYLLIVSTSSSESALPRLIAKMEHLGVE
RSTVGVVVPTGYSFNLDGTAIYLTMASLFIAGALGDPLSLPEQIGLLVFM
IVASKGAAGVTGAGLATLAAGLQSHRPDLLDGVGLIVGIDRFMSEARAVT
NFSGNAVATILVGSWTKTLDRDRVDAVLRGDDPFDELTMVDDHAADTRRA
EERVPAPA
119870270YP_940222.1 lipid-transfer protein [Mycobacterium sp. KMS]MRGNRVFVVGVGMTKFEKPGSREGWDYPQMAKESGTNALADAGIEYSAVE
HGFVGYCSGDSTSGQRALYELGMTGIPVVNVNNNCSTGSTALYLAAQTIR
GGLADCTIALGFEKMQPGSLSGGASDRESPMGRHIKAMAEIDEFAMPVAP
WMFGAAGREHMRRHGSTAEHFAKIGYKNHKHSVNNPYAQFQEEYTLDDIL
GSRMISDPLTKLQCSPTSDGSGAAILASEAFVDEHGLADRAVEIVGQAMT
TDFESTFDGTAKNLIGYDMNVKAAQQVYAQSGLGPADFQVIELHDCFSAN
ELLLYEALGLCGEGEAPKLIDNDDTTYGGRWVVNPSGGLISKGHPLGATG
LAQCAELTWQLRGTADARQVDNVTAALQHNIGLGGAAVVTAYQRADR
119870268YP_940220.1 MOSC domain-containing protein [Mycobacterium sp. KMS]MLSVNVARPRPNPARASKVTGIDKVPTADAVHVRAPGPLRKGLGSGLTGD
VIGNMKLHGGADQAVYAYAREDLDRWQTTLGRSLADGNFGENLTTSGVEV
TGAVIGERWRVGAGGLLLEVTSPRTPCRTFAAHLGVRGWIKTFTEAAVPG
AYLRVIESGPVRAGDGIEVVDRPDSDVTVGLVFRALFGQPDLLSRLHDVE
ALPDEIRKRAARV
119870266YP_940218.1 patatin [Mycobacterium sp. KMS]MTKRVALVLGSGGARGYAHVGVIHELRDRGYEVVGISGSSMGALVGGLQA
AGKLDEYAEWAKSLTQRAVLRLLDPSLTAPGVLRAEKIIDAVRELLGDVC
IEDLPVPYTAVTTDLIAGRSVWLQRGPVDAAIRASIAIPGVITPHVLDGR
LLADGGILDPLPMAPVAAVNADVTIAVSLGGSESGGGEPDDDAAHSTADW
LNRLLRSTSALLDSKSARAVLDTPAVRSMISRFGTTPEDEDGESTGEPET
ETSADQLVDSAKELALPRLGSFAVMNRTIDIAQAALARHTLAAYPPDLLI
EIPRSACRSLDFHRAAEVIELGRQLAVEALDQFEQPQAASLLQT
119870264YP_940216.1 cysteine dioxygenase type I [Mycobacterium sp. KMS]MSVHTLAPAVPAVSAPTRLRLPDLLHATDRGADDVLNGRYDHLLPRGGVP
TDDRWYTRLHGDDELDIWLISWVPERSTELHDHGGSLGALTVLSGSLSET
RWDGEGLRQRRLAAGDQAAFPLGWVHDVVWAPDTTTGPTLSVHAYSPPLT
AMSYYEVTDRKTLRRNRTELTESPEG
119870262YP_940214.1 hypothetical protein Mkms_4232 [Mycobacterium sp. KMS]MTDTAQTVEETPPQETPPPKRAWWLRHYTFFGTATGLVFVWFSLTPSLLP
RGPLFQGLVSGGAGAAGYAIGVFAVWLTRYMLSRDTSPPAPKWAWVALVV
VGVVGQVLMIVYFHVWQDQIRDLMGVPRMGFWDHPLTAVLAIVVLFALVE
VGQLIRRLVVFLVRQLNRVAPPRVSAVVVVALLLALSIALLNGVVVRGLM
SAINNTFETVNDETDPDTPAPESPLRSGGPQSLVSWESLGHQGRVFVSGG
PTVAELSAFNGAPAIEPIRAYAGLNSADGIRATARLAAEELLRTGGLNRA
VVAVATTTGTGWINEAEASALEYMFNGDTAIVSMQYSFLPSWLSFLVDKE
NARQAGQALFEAVDALVREMPEAQRPRLVVFGESLGSFGGEAPFLALNNL
IARTDGALFSGPTFNNTIWNELTRQRDPGSPQWLPIYDSGENVRFVARPD
DLDRPDRPWGTPRVVYLQHASDPIAWWNPDLLFARPDWLKEPPGYDRTAR
MKWIPVVTFLQVSADMAVAVDVPDGHGHVYVRDVVNGWAAVLQPPGWTPE
KTERLRPVLHSDENS
119870260YP_940212.1 3-hydroxyisobutyryl-CoA hydrolase [Mycobacterium sp. KMS]MAENEDVLVSVENGVGLVTLNRPKAINSLTHGMVTTLADALHAWEKDDGV
RTVLLTGAGERGLCAGGDVIALYHSAKAGGADARRFWFEEYQLNSYIGGY
PKPYVAVMDGIVMGGGVGVSAHGDVRVVTDTTKMGMPEVGIGFIPDVGGT
YLLSRAPGLLGLHAALTGAPFSGADAIAMGFADHFVPHDQLDAFKAAVVA
DGVDAALAAHTTEPPPSQLLTQRDWIDECYAGDTVADIIAALRGHAAGPA
NDAADLIASRSPVALAVTLESVRRAGRLDTLEDVLRDEYRVSCASLRSHD
FVEGIRAQLVDKDRNPKWSHQSVDEVTAADVDAYFAPADPELTFP
119870258YP_940210.1 hypothetical protein Mkms_4228 [Mycobacterium sp. KMS]MDDLPFIGSEALADGRLTRYELRRYHRAIMPDVYVDRRAEPSLRQRTVSA
WLWTRREGVVAGLPAAALHGAKWIDDDVPVELIWRNARTPPGVVTRADAL
LDGEVATLDGLPVTTADRTAFDLGRRGPLTAAVARLDALIRATDLGVGDI
EALAAGHPHTRGLRQLEKALDLVDVGAESPKETWLRLLLIRHDFPRPRTQ
IPVPAPDGHTTYYLDMGWEDLELAVEYDGDHHRTTKDRFAYEIQRAEDIA
AAGWHVVRVAARSREADVIRRVTRAWRLRTS
119870256YP_940208.1 GDSL family lipase [Mycobacterium sp. KMS]MRASRGALAAAVAATLASTGSAYIGVRNLLTGQADQARQVIPKSWDVPPR
ADGVYSPGGGPVEKWHRGDPFDLHLMIFGDSTATGYGCRTADEVPGVLIA
RGLAEQSGKRIRLSTKAIVGATSKGLSGQIDAMFVAGPPPDAAVIMIGAN
DVTALNGVSQSASRLGKAVARLRASGAVVVVGTCPDFGVITAIPQPLRTV
ARAKGLRLARAQAAAVRAQGGVPVPFSDLLAPEFYKQPDVLFSDDMFHPS
AAGYALAASQLLPALCVALGEHSPTGASEQALPTRAADVSTLLAKLGGIT
RLWRRTTGVPAPVIASPG
119870254YP_940206.1 cystathionine beta-synthase [Mycobacterium sp. KMS]MRIAQHVSELIGNTPLVQLNSVVPEGAGTVAAKIEYLNPGGSSKDRIAVK
MIDAAEASGELKPGGTLVEPTSGNTGVGLALVAQQRGYKCIFVCPDKVSE
DKRNVLRAYGADVVVCPTAVAPDDPDSYYSVSNRLVTEIEGAWKPDQYSN
PMGPESHYETTGPEIWRDTDGKVTHFVAGVGTGGTITGAGRYLKEVSGGK
VRVIGADPEGSVYSGGTGRPYLVEGVGEDFWPSAYDPAVPDEIIAVSDAD
SFDMTRRLAREEGLLVGGSCGMAVVAAIEVAQKAGPDALVVVLLPDGGRG
YLSKIFNDSWMSSYGFLRNRLDGSIEQPTVGDVLRGKSGELPDLVHTHPS
ETVRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRA
KLADAVAEHMSPPMPLIGAGELVSTAAKTLRECDALMVVEEGKPVGVVTR
HDLLGFLSDGSTRR
119870252YP_940204.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTVRIDDLLDTDAMLAPEERELRQTVRRFGEQRLRPHVGEWFEAGEVPVR
ELASEFGKLGLLGMHLEGYGCGGSTATAYGLVCQELEAVDSGLRSMVSVQ
GSLAMFAIHKHGSEEQRKQWLPAMATGDVIGCFGLTEPDFGSNPAGMRTT
ARRDGSDWILNGSKMWITNGSVADVAVVWARAEEGILGFVVPAGTEGFSG
REMKHKLSLRASNTSELHLDDVRLPAEAQLPDARGLSGPLACLSEARFGI
VFGSVGAARDCLETTLDYVGSREVFDKPLAAYQLTQAKIADMAVELGKAQ
LLALHLGRLKDEGRIRPDQVSFGKLNNVREALAIARQCRTLLGANGITLE
YPVLRHANNLESVLTYEGTSEVHQMVIGEALTGVSAFRG
119870250YP_940202.1 hypothetical protein Mkms_4220 [Mycobacterium sp. KMS]MARIAEDLLLLLLDNASAQPCLDKPRRERVLAAAVLLDLAHACLIRPAVD
GDPAPAGRLVALTPRGPLDPVAEPAFRLLQRRALRPPVAIDRLRRHTEDA
LLAHLEATGQIGRVELPGKRSKRIGHQYGWPVANRDRAAHSRSQVLSALF
DRTPPTPSTAAVITLLHAVDGLGALLSLNDRGWRWVHGRAGEISLGSWVD
ESPTGLAEVNLAVTAAALRAALG
119870248YP_940200.1 hypothetical protein Mkms_4218 [Mycobacterium sp. KMS]MIERPAARYGRQRVSRRTRRLVAAVLAAGVVVAGVILAIVASQRLGTQEV
EGELGAYRIIDDRTVEVTVSVTREDPSRPAVCIVRARSKDGSETGRREIL
VPPSEQATVQVTTVVEASKPPVIGDVYGCGLDVPPYLVAP
119870246YP_940198.1 hypothetical protein Mkms_4216 [Mycobacterium sp. KMS]MIETVLLATEWLAQEQPRETGPDFGKASPFGLLIVAALLVAVFLLVWSMN
RHLKRLPESFDPEHPEPDQAVDDGTVDLGGDPGAGPRSVAENGNPPRESG
G
119870244YP_940196.1 nuclear transport factor 2 [Mycobacterium sp. KMS]MAVDPKALVQRYLDTVASGTADDVAALYAEDATLEDPVGGGEVHIGRHAI
AGFYKNTDGVEISTELLTIRVGGNEAAFLFAITVGGAMRIEPIEIMTFNH
DGQIASMKAYWGPDDITQL
119870242YP_940194.1 undecaprenyl pyrophosphate synthetase [Mycobacterium sp. KMS]MDIIPRGLKEPAYRLYEMRLRQELMRSKSQLPRHIAVLCDGNRRWARDAG
HDDVSYGYRVGAAKIAEMLRWCQAAGIEMATVYLLSTENLQRDADELAEL
IEIITGVVEEICAPANRWSVRTVGDLSLLGDEPARRLRDAVESTTGNGTA
FHVNVAVAYGGRQEIVDAVRALLSKKLADGVTGEQLVEAVTAEAISENLY
TSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAYWPAFRRVDFLRA
LRDYTRRDRRYGT
119870240YP_940192.1 hypothetical protein Mkms_4210 [Mycobacterium sp. KMS]MTAVHNSVLTRPLSDSTDSLLRFALRADATLCAALGLFVAMAADPLSRLS
GLSATAEWIGGALLVGYGALLYVLAAVPDVRRVGVGALAGNVGFAIAVAA
VLIGGWLPLTPAGVAMTATFAALTLALAYLQYLGVRRLV
119870238YP_940190.1 pantothenate kinase [Mycobacterium sp. KMS]MARLSEPSPYVEFDRTQWRALRMSTPLKLTEDELKKLRGLGEKLDLLEVE
EVYLPLARLIHLQVAARQRLFAATSEFLGEPQQNPDRPVPFIIGVAGSVA
VGKSTTARVLQALLARWGNHARVDLVTTDGFLYPNAELGRRNIMHRKGFP
ESYDRRALMRFVTAVKSGADYACAPVYSHLLYDIVPGEKQVIRHPDILIL
EGLNVLQTGPALMVSDLFDFSVYVDARLEDIEGWYISRFLTMRSTAFADP
ASHFHHYATLTDEQAVFAARDIWHSINRPNLIENILPTRPRATLVLRKDA
DHAINRLRLRKL
119870236YP_940188.1 serine hydroxymethyltransferase [Mycobacterium sp. KMS]MTADSVTSSAAAPGAEYAATASTAYQAALQVIESVEPRIAAATRKELADQ
RDSLKLIASENYASPAVLLTMGTWLSDKYAEGTIGHRFYAGCQNVDVVES
VAAEHARELFGAPYAYAQPHSGIDANLVAFWAILATRVEAPGLAELGAKH
VNDLSEADWESLRNKLGNQRLLGMSLDAGGHLTHGFRPNISGKMFHQRSY
GTDPETGLLDYDKLAAAAREFKPLILVGGYSAYPRRVNFAKLREIADEVG
ATLMVDMAHFAGLVAGKVFTGDEDPVPHAHVVTTTTHKSLRGPRGGLVLA
QPEYSDAVDKGCPMVLGGPLSHVMAAKAVALAEARQPSFQAYAQRVADNA
KSLAEGFLKRGARLVTGGTDNHIVLLDVTSFGLTGRQAESALLDAGVVTN
RNSIPADPNGAWYTSGIRFGTPALTTRGFGAAEFDRVAELVVDVLNNTQP
NSTGPTGFSKAKYTLADGTAERVHAASAEMLDANPLYPGLTL
119870234YP_940186.1 PhoH family protein [Mycobacterium sp. KMS]MPQCPPTGSRGTRGYQERYVTDSPLRTYVLDTSVLLSDPWATTRFAEHEV
VVPLVVISELEAKRHHHELGWFARQALRLFDDLRLEHGRLDQPIPVGSEG
GTLHVELNHSDPSVLPAGFRNDSNDARILTVAANLAAEGKCVTLVSKDIP
LRVKAGAVGLTADEYHAQDVVVSGWTGMDEIDVTTDEVDALFADGEIDLA
AARDLPCHTGVRLLGGSSHALGRVNAAKRVQLVRGDREVFGLRGRSAEQR
VALDLLQDESVGIVSLGGKAGTGKSALALCAGLEAVLERRTQRKVVVFRP
LYAVGGQDLGYLPGSESDKMGPWAQAVFDTLEGLASPAVLEEVLARGMLE
VLPLTHIRGRSLHDSFVIVDEAQSLERNVLLTVLSRLGAGSRVVLTHDVA
QRDNLRVGRHDGVAAVIEKLKGHPLFAHITLQRSERSPIAALVTEMLEEI
SPGALP
119870232YP_940184.1 UspA domain-containing protein [Mycobacterium sp. KMS]MTERHPVVVGIDGSRAALDAALWAVDAAVGRDTPLRLLYAIEPADHDVAA
AARELAIADLAVRDVFTAIQATERPVRIEVEIVQDSAVRALASASRSAAL
VCVGAVGLQDAIPGRIGSTAATLARSAHCPVALVRHNTDGYVLAEVEDWS
DSGAVLRHAVDEALLRRVPLRVLTPGSESARAPAARTLDGWRRRHPDLEI
DLLTSDDGVVDFLAGEPGRVQLVVVGAERARGPGEFTDPRGRSVLREAGC
TLLTCHRQHRL
119870230YP_940182.1 GAF sensor signal transduction histidine kinase [Mycobacterium sp. KMSMTEPIGPDEPRGPGPLRDTLSGLRLRELLTEVQDRIEMIVEGRDRLDGLV
DAMLVVTAGLELDVTLRTIVHTAIQLVDARYGALGVRGHGHDLVQFIYEG
IDDGTRDLIGHLPEGRGVLGVLIDDPRPIRLDDIRHHSASVGFPANHPPM
RTFLGVPVRIRDEVYGNLYLTDKVGGQPFTEEDEVLVQALAAAAGIAIDN
ARLYEQARARQAWIAATRDIATEMLSGASPATVFRRVVDQALTLTGADGT
LVAVPGDTEAPPDQVHDLVVVESAGMFTGAAVTVALDESPIGLAFRKRTP
VRVDRLTLGSAECGAALVLPLRAADTVAGVLVAARVPGAQEFTAEQLDVT
AAFADQMALAWQLASSQRRMQELEILTDRDRIARDLHDHVIQRLFAVGLS
LQGTLARVRDADVQQRLAGNVDDLQAVIQEIRTTIFDLHGGSSGATRLRQ
RLDEAIGQFAGAGLHTTAQFVGPLSVVDATLADHAEAVVREAVSNAVRHA
RATELTVRVTVADDLCIEVADNGCGIDGSITESGLGNLRARAEDAGGTLT
LGESAGGGTLLRWCAPLA
119870228YP_940180.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. KMS]MSTRLVITGASGNVGTALLQRLADAGGYTVTGVTRRKPPESGIYRSAQWR
QLDLAEHDATTRLQAVMGDADAVVHLAWGFQPTRNVQYLDAVGVGGTRAV
LRAADVAGVGQLVHMSSVGTYAAGRYGQYVDETWSTAGIDTSPYSRAKSA
AEALLDDYERSHRDGLTIARMRPGFIVQRSAAGGLRRYTLPAFIEPRWLR
FLPVLPLDRGLVVPIIHADDVADAIARTVERRAAGPFNLMAEPPVRRDDL
AEALGAYPVHVPSSLLRPAVALSWRARLQPMDEGWLDMAFSVPLLDTGRA
QSELGWKPVRTSIEALVDMGEGFKNCADTESPVLSYRGPLTSVLRDLRAG
PITDRKVP
119870226YP_940178.1 fructose 1-6-bisphosphatase II [Mycobacterium sp. KMS]MPADPDALRASGSSRRREAPDRNLALELVRVTEAGAMAAGRWVGRGDKEG
GDGAAVDAMRELVNSVSMRGVVVIGEGEKDNAPMLYNGEEVGNGDGPDCD
FAVDPIDGTTLMSKGMPNAISVLAVAERGAMFDPSAVFYMNKIAVGPDAV
DAIDITAPIGENVRAVAKVKGLSVRDVTVCILDRPRHEQLIADVRDSGAR
IRLISDGDVAGAISACRPNSGTDMLAGIGGTPEGIITAAAIRCMGGAIHA
QLAPKDDEERQKAIDAGHDIDRVLKTEDLVSGENVFFCATGVTDGDLLQG
VRYTGGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAVDFTGDSNAAY
PLP
119870224YP_940176.1 hypothetical protein Mkms_4194 [Mycobacterium sp. KMS]MTARNPNVAAGAAPAADLSGWTAEPFTAAGYTHDVYRKGDGPGVVLIPEM
PGLHPHVLALGNHLVDNGFTVAAPSLFGTPMKPPLGPGALPVLLKGCVSK
EFAAFATNADRPVAHYLRALARDLNARTPGKGVGVIGQCFTGGFALAAAV
DDSVLAPVLSQPSLPLPVTPKHKRDPGLSEGELRIIERRAAEDGLCALAL
RFSKDWMSPAERFETLKARLGDAFEVIEIDSARGNPHGISPTAHSVLTDQ
IREVDGHPAYEARKRVVEFLTQRLVEA
119870222YP_940174.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MDFAGRQAIVTGAGSGIGAALCRALVAAGAEVLCTDIDADAAEATARGLG
ARWSPLDVTDAAAVQRAVDEVVARAGRLDLMFNNAGISWGGDTELLTLDQ
WNAIIDINIRGVVHGVAAAYPQMIRQGHGHIVNTASMAGLTAAGLITSYV
MTKHAVVGLSLALRSEAVAHGVGVLAVCPAAVETPILDKGAVGGFVGRDY
YLQGQRVKAPYDADRLARDTLRAVQRNKAVLVKPRQAHAAWVFARLAPGL
MQRMAARFVAEQRAGQRAQTVGTG
119870220YP_940172.1 hypothetical protein Mkms_4190 [Mycobacterium sp. KMS]MTEDLVRIPAQSATIGSDRHYPEEAPARDVTVDGFWIQAHAVTNAEFAAF
VDATGYRTVAERPLDPANYPDAPAQNLQPGSMVFRRTAGPVDLRHLNQWW
YWTPGASWRHPIGPGSSIVNRADHPVVHVAYDDAEAYAAWAGLELPTEAE
WEVAARGGLPHAGYTWGDEPEGPGHKLANYWHGEFPWRPDRGYGRTAPVG
SYPPNGYGLYDMAGNVWEWTTDWYTDTGGSACCAEDSYDPAQPQFPVPRR
VVKGGSFLCADSYCARYRPAARRPQPVDTGMSHIGFRCVRH
119870218YP_940170.1 sulfatase [Mycobacterium sp. KMS]MPNSTPNILVIWGDDIGISNLSCYSRGMMGYRTPNIDRIADEGMLFTDSY
GEQSCTAGRSSFITGQSVYRTGMSKVGMPGVDIGLQKEDPTIAELLKPLG
YATGQFGKNHLGDLNKYLPTAHGFDEFFGNLYHLNAEEEPENADYPTEEE
APVMRRALLPRGVIHSWATEEDSGEVDDRYGPAGKQRIEDTGPLTKKRME
TIDDETTDACVDFITRAHGTGTPFFVWMNMTHMHFRTHTKPESLGQAGRW
QSPYHDTMIDHDRNVGQLLDLLDELGIADDTIVIYSTDNGPHANSWPDGA
TTPFRSEKATNWEGAFRIPELIRWPGKIEPRSVSNEIVQHHDWLPTFLAA
AGDPDIVDKLKAGHTIGDITYKVHIDGYNLVPYLTGEVAKSPRRGMIYFS
DDCDVLGIRAENWKVVFQEQRCQGTLQIWFEPFTPLRAPKLFNLRTDPYE
RADITSNTYWDWVIDRIYLVLYGSAIATQFLETFKEFPPRQEPASFTIDH
AVDELNKFLSTRGG
119870216YP_940168.1 hypothetical protein Mkms_4186 [Mycobacterium sp. KMS]MHVAAWFTSFKNSDALGGAGMAKRDKGDAGNGDSQIAINSRVLVHPGTDH
EKRGVVVEDFADVAGKAVEIGEHHIADAARRWAVSLDDGGLEFVDDGDLT
ADTGAS
119870214YP_940166.1 exodeoxyribonuclease VII small subunit [Mycobacterium sp. KMS]MKPISEMGYEEARDELIAVVQQLEQGGLDLDASLKLWERGEELARCCEEH
LAGARQRIESALGERDADDG
119870212YP_940164.1 hypothetical protein Mkms_4182 [Mycobacterium sp. KMS]MATAPYGVRLLVGAAVTAVEETRKLPHTILMYPMTVASQVASIVIHFQQN
LADLVNKGDETLENLFPPKDEQPEWATFDEDDGEAPATDGERRTEGRFAL
FSTGEPETTDTGDTGTRQASAASETPAIVTELDYESLTLAQLRARLPSLS
VDDLEALLAYEGATRSRAPFQTLLANRITRATAK
119870210YP_940162.1 hypothetical protein Mkms_4180 [Mycobacterium sp. KMS]MFFFLFGLSTKQQYLGAGQTRTCPRCHNTTQWTQMRQFKQFTLFFIPVAR
WKRRQFEVCGVCGTSVAL
119870208YP_940160.1 GTP-dependent nucleic acid-binding protein EngD [Mycobacterium sp. KMSMPAGLWQTVIPVGLNLGIVGLPNVGKSTLFNALTRNNVLAANYPFATIEP
NEGVVALPDPRLEALAKIFHSEKIVPAPVTFVDIAGIVKGASEGAGLGNK
FLANIRECDAICQVVRVFADDDVVHVDGKVDPKSDIEVIETELILADMQT
LERAVPRLEKEARTHKDRKPVLDAALAAQEVLNSGKTLFAAGTDVSLLRE
LNLMTTKPFLYVFNADESVLTDEARKAELRELVAPADCVFLDAKIEAELQ
ELDDESAAELLESIGQTERGLDALARAGFHTLRLQTYLTAGPKEARAWTI
HQGDTAPKAAGVIHSDFEKGFIKAEIVSFDDLAEAGSMAAAKAAGKVRME
GKDYVMADGDVVEFRHGQPSTSKAKA
119870206YP_940158.1 hypothetical protein Mkms_4176 [Mycobacterium sp. KMS]MMTRVEANFIGKSPDTPRQVCAVKLPSAGQTLVGTGLHHVAAKLDVRGGM
ITAMSVFAAIAAVVALIISVVNFGLGFYDRRRATIRIDDAARRSVRMENR
KKLDAVLEQARQVVTELKKQVGPAGAPVPEPFPEPDEDKMDAVSAGFAAH
QTVVNPDLKAPTINLLHPPLYRLKRDWTRAWNVAQRIGPRNTSSDWKEAS
DRLRQRLETCTREIDDLQAWLASMG
119870204YP_940156.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MSTAGEPRLGLRANLAQFSLLVAVNALVGGMVGQEQTVLPLLAEQQFHLQ
GYTFLLTYVFAFGVTKAATNYFAGTWSDRFGRKPVLLVGWLLAIPVPLLL
IWAPSWTWVIVANVLLGINQGMTWSTTVIMKIDLVGPRQRGLAMGFNEAA
GYVAVALTALLAGHLAARFGLRPAPFLLGLSYALIAVGLTAVFVRETRGH
AELEATTHGDSKADAALTNRQIFVRTSFTEPALSSASQSGLVNNLNFGLS
WGLFPILFATTGMPVDRIGILVAAYPAVWGIGQLATGAFSDRWGRKHLIT
AGMFTQAGGLAMIATGDTFLWWLAAASLLGAGTAMVYPTLLAAVGDVAHP
RWRARAVGIYRLWRDSGYAAGAVVGGVTADLWGLRAAVWAAAAITVASGL
MVAARMYETHTERASSGTG
119870202YP_940154.1 hypothetical protein Mkms_4172 [Mycobacterium sp. KMS]MTSCARRGRIFGAVTGDWRIDRVDEIRSLIKQAEPDVVEEIKWRKPSNPD
GVPAFSLDGLICTLEMYKGKVKVNFAKGSSISDPDNLFNASLQAPVGRSI
DVREDDELDPDAFKALIQEAVRVNRS
119870200YP_940152.1 Serine-type D-Ala-D-Ala carboxypeptidase [Mycobacterium sp. KMS]MKRGTRHLLSLAALVTALLLAGCSSPEPQALRTIDPQELQQVVDGLAREL
TVPGALVLAHTPQGRFTAAAGTTELGAQDPPSADTHFRIASNTKTMTAAL
IVLLAQDGKVRFDDPVTDWVPDVPNGENITVAQLLTMRSGLYGYTGDEAL
SAAMDADPQKPWTPAEVLAIAFRHPPQFAPDSAYEYSNTNYALLGLIAEK
AGGQPLARQFRDRLFGPVGLTQTSLPAADDTTMPTPYSHGYMYGGSFYAL
ADEPYPADMQAAARAGTLQPVDYTNQNSSYATAAGGAISTADDLATWMKA
LVTGKVFDADHHRQWTGSLRPEDPAAPDGQQYGYGISYQRFGPNAAMYYH
GGELPGFNSFMGYDPDNDVTLVIWTNLTLSPDGRTTAQAMLAPMLEQIYA
GLSLG
119870198YP_940150.1 putative adenylate/guanylate cyclase [Mycobacterium sp. KMS]MTGPEIAAAVLAVVAVAEAVGLVTLWVLFTRARGEADELRARVDTRNMLL
SGGREAVKHVWQTANLVREKGFGGAITSSIEDLADWFEVERPDLARLAPH
GRVAILFSDIEDSTALNNRIGDRAWARLIGRHARSVQRHVREHDGHVVKS
QGDGFMVAFASPENAVRCAIALQHSLRRRPNGIRVRIGIHTGKSVRRGED
LFGRNVALAARVAAEADGGEILVSEAVRDAVAGADGVSIGDGREVSLKGF
SGKHHLYVVSAQRGGSDSSSR
119870196YP_940148.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MDYCDNDRLRWANSSRSARSAASNVTPVSVSTAETVSFRGAEGLTLVGDE
WNRGAESAADRPTVLMLHGGGQNRFSWKNTGQILADAGLHVVALDSRGHG
DSDRSPEANYSVEMLCADTCEVLDQIGRPVALIGASMGGLTGILVAREAG
PQRVTQLVLVDVVPRFEKDGSARIRDFMFNHVHGFDTLEQAADAVAAYLP
HRTRPKSHEGLKKNLRHRDGRWYWHWDPAFLTKPGDDPFVRADKLEQAAV
ELTIPILLIRGKLSDVVSSEGVQEFLRKVPGAEFVELSDAGHTAAGDDND
AFTEAVVGFVSR
119870194YP_940146.1 hypothetical protein Mkms_4164 [Mycobacterium sp. KMS]MADDAPAPAPDGEPTVTVDDETAVDVANPESPETAEAPETSAADEADETG
EAGRSPVRKALLAGLALVVVLAAVTGWFGYQAYRSDQDTKERNLFLEVGR
QAAQNLTTIDWERADADVQRVLDVATGTFYDDFQKRAEPFLQVVKEAKSK
SVGTLGEAGLESVSGDTAEVLVAVTVKSSNAGAPEQPPRAWRMRLTVQRV
DDGAKVSQVEFVQ
119870192YP_940144.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MTPRWLDVATPAGQLRALVWGPEDGPVALCLHGFPDTAYGWRKLAPALAA
AGWRVVAPFMRGYVPSSVPSDRSYHVGALMDDALRVLAAAGPTGRDVIIG
HDWGAIAGTGLAAMPDSPFERAVIMSVPPAAAFRPLGRVPDRWRLAAELP
RQMLRSWYIFYFQLPWLPDRSASWVVPWLWRQWSPGYHAAEDLRHVDAAI
GVRRRWRAALGYYRATVRNSRPPAQYAELHRHWLSAPVLPTLYLHGHDDG
CATANFTPWVQRVLPEGSAVAVVEHAGHFLALEQPDVVGRHIVDFIGTAR
119870190YP_940142.1 hypothetical protein Mkms_4160 [Mycobacterium sp. KMS]MTARRLAAVDAQNLWMSAKMPDDQFLVYGFAGLPGDLPGTIAAILERAPS
CGELRLRVRDRGRLRYPEWVDGGVDDAQVRTHAADDWSECLAAVTALTGD
QLDARTAAWRLHVFSPVRAIPGVEGAGTVAVVQVSHALADGLRSAALAAW
LFGRPAPVDAVTVAPWESATLPLRAVRAARAHRQLMRDVTAGTVAAQAGS
RPALRSNARPDGARDLRTVVRRRADLPTGTVTVSVLAAVSRALADHLREL
GDDPSTLGAEVPMASPGPRRAHNHFGNVGVGLHPDLPHAERSSRIAAELA
QRRQRAAHPAMRAATLASAAVPAPLMRWGVVAFDPTVRSPTAIGNTVVSS
VHRGAADLHFGGAPVVLTTGCPSLSPMQGLTHGVHGIGDTVAVSVHAAES
AVGDIDAYVDRLAAALDRPE
119870188YP_940140.1 hypothetical protein Mkms_4158 [Mycobacterium sp. KMS]MGFLKPDMPVVDFAEWSKGTRSEKIRPMARHWAEVGFGTPVVMHLFYVVK
ILLYILGGWLFALATHGVDGFTDVAQWWTEPIVFQKVVLYTMLFEVVGLG
CGFGPLNNRFFPPMGSILYWLRPGTIRLPPWPDRVPLTKGDTRTPFDAAL
YGALLVVLLVALFSDGTGPVPALGTEIGVLPLWQIWTILGLLAVLGLRDK
VIFLAARGEVYGSFTVAFLFVGYGVDMLLAAKLVCVAIWMGAATSKLNKH
FPFVISTMMSNNPLIRTKSLKRRFFEKFPDDLRPGRVSRVIAHFSTAIEM
LVPLALLFSHGGWPTAIAAFVMLVFHFGILSAIPMGVPLEWNVFMMFCVI
TLFVGHADLGLAELSTPLPVVLFAVLALTVALGNLFPRKISFLPGMRYYA
GNWDTTWWCIKPSANEKIERGLVAIASMPASQLEKVYGSPEQAMIYLYKG
YAFRGFNSHGKALLTLVHNALAGRNEDDYVITEGERLCSTAVGWNFGDGH
MHNEQLIAAMQRRCQFEPGEVRVILLDAQPIHRQRQEYRLVDAATGEFER
GYVNVSDMVTGQPWTDDIPVHVTWRRDGDDAPRLRSDRESAQ
119870186YP_940138.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MAEAVIVEAVRSPVGKRNGGLSGVHPAELSAQVLNGLVERAGVDPALVDD
VIWGCVMQAGEQALDIARTAVLSAGWPETVPGVTVDRQCGSSQQSLHFAV
AGVVAGHYDVVVAGGVESMSRTPMGSSLANGGNPYGESFKARYSQTPNQG
VGAEMIAEQWGFSRTELDEFSLRSHEKAAAAQDSGAFKDQIVGIETKDAD
GNDTVVLEDGGIRRGGTVESMAKIKPAFREDGVIHAGNSSQISDGSAALL
IMSADKAKDLGLKPLAKVHTAVLAGADPVIMLTAPIPATQKALKKSGLSL
DQIGAFEVNEAFAPVPMAWLKDIGADESKLNPNGGAIALGHPLGGSGARI
LTTLLYHMRDNNIQYGLQTMCEGGGQANATILELL
119870184YP_940136.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMKRTIYEAEHEAFRQTVKDYIERELVPNSEKWETERLVDRSAYTAAGKYG
LIGFNMPEEFGGGGSDDFRFNAIIDEEIAKAGVHGPALSLHNDVVAPYFN
ELTNDEQKQRWMPGITSGELIIAIAMTEPGAGSDLAGIRTSAVRDGDDWI
INGSKTFISSGINCDLCVVVARTDPEAGHKGFTLFVVERGMEGFTRGRKL
DKMGLHSQDTSELHFENVRVPNANLLGKEGRGFYHLMTNLPSERLSIAIS
AIAGARAVFDETLQYCKDRKAFGQPIGSFQHNRFLLAEMETELDVTENYI
DRCLQGVVDGELTAVEAAKAKWWATETAKKIVDNCVQLHGGYGYMLEYRV
ARAYVDGRIQTIFGGTTEIMKEIIGRDLGV
119870182YP_940134.1 carbonic anhydrase [Mycobacterium sp. KMS]MPEPLIVAVGEHAPELHDTAWVAPNAAVIGRVKLSAKASVWYGATLRAEA
EPIEIGAGSNIQDGVTMHVDPGFPASVGANVSVGHNAVLHGCTIEDDCLI
GMGAVVLNGARIGRGSLVAAGAVVAQGVEVPPGSLVAGVPGKVRRELSEA
EVDGNRTNATLYQHLVDMHR
119870180YP_940132.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTERAVRRPGGRTAAVRAAVLRAAEDLLVEGGLHALELTAVAERAGVGKS
TVYRRWSTVPVLVADVLHEMAEQSVSRARTGTLDGDLRASARLVRRTLTD
PRQGRLFGAVIAAATYDPRTAQALERFYDRRVAEWSACVTDAVARGEAPA
RTDGAAVIRHLSAPLYYQFLTTTTPLSTRDADRAVAATVAATAAGVFVVS
KRRPGGSRSPDLGT
119870178YP_940130.1 abortive infection protein [Mycobacterium sp. KMS]MTETDRSSPTPAPCDERTGFLREARGVVMSVAAPAGEWPAVIRRRRIIVA
IFVVIGFGLLGYSLSIPPGDPDFYWFTAGLAVFWTAGAFLSGPLHLGRIC
YRSRNQRPVITGTVVGLALGGAFVVAALVAREIPLMAEYAVRVLEHANQG
ALWLVVVITVVNGLAEELFFRGALYTSLGNRWNGWWAVLWSTAVYVVVTG
VSTQNFMLAIAAIVLGTVCALERRATGGVLAPMLTHFFWGLVMVLALPPI
FGV
119870176YP_940128.1 HicB family protein [Mycobacterium sp. KMS]MIGPCPPTPIAPNGPRAVANTRLGVWNSPATSATPPPRHKPSRTSSAKSA
TASPSASPDLHSRLSVEAAEQGVSLNQWAITKLAGRLPSLDDLF
119870174YP_940126.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMAGPLQGLRVVELAGIGPGPHAAMILGDLGADVVRIERPGKGPGIPTKGS
DQLLRNRRSVGANLKTDEGRELVLRLIAKADVLIEGFRPGVTERLGLGPE
DCAKVNERLIYGRMTGWGQTGPRSQQAGHDINYISLNGVLHAVGRAGERP
VPPLNLAGDFGGGSMFLLVGILAALWERERSGKGQVVDAAMVDGSSVLAQ
MMWAFRAMGMWSDERGVNMLDTGAPYYDTYETSDGRYVAVGAIEPQFYAE
MLDKLGLDPAGLPDQNDMSRWPELRAVLTKAFAEHDRDHWAKVFTGSDAC
VTPVLSFGEVEAEPHNTERDTFYREGDFLFPAPAPRFSRTTTTTPTPPGV
PGADTEAVLNDWV
119870172YP_940124.1 2-nitropropane dioxygenase [Mycobacterium sp. KMS]MTLHTKFTETFGVEHPIVQGGMQWVGRAELVAAVANAGALGFITALTQPT
PADLANEIARCRDLTDKPFGVNLTILPTINPPPYDEYRQVIVDAGIKIVE
TAGSNPAPHLPMFHDNGIKVLHKCTSVRHAVKAQSLGVDGISIDGFECAG
HPGEDDIPGLVLIPAAASKIDIPMIASGGFADARGLVAALALGADGINMG
SRFMCTEESAIHQKVKEAIVAGTELDTELIFRPLRNTARVASNAVSREVV
EILNRGGQFEDVKDLVAGKRGVKVYEIGDLDAGIWSVGTSMGLINDIPTC
GELVSRMVEEAEQLITDRLAGLVKPAEEPVAV
119870170YP_940122.1 DoxX family protein [Mycobacterium sp. KMS]MASTDVRSTVTTPTSTGTDIALLVLRIGVGATMIQAGLRKAVDFDTVVGF
MEAGGWRLPGLAAFMVTASETLGGIGLVLGVLTPLAATAVIAAMLDAWAV
NVSGAAFWSEPFNVPFLVAIGATALLFAGAGAYSVDARVATRIRWSTRIA
VILLAVAIVAAVVTWIALNGTNPIHLTTPTG
119870168YP_940120.1 type 12 methyltransferase [Mycobacterium sp. KMS]MSADVDNPFFARLWTVMSGHETEEMRRLRAANLAGLTGRVLEIGAGTGTN
FAHYPPSVTEVVAIEPERRLAAHAREAAAHAPVPVTVTMDSVEDFSTAEP
FDAVVCSLVLCSVDDPDGVLRELFSLLRPGGELRYLEHIAETGARARLQK
VADATVWPRMLGNCHTHRHTETAITVAGFRVEDARRERMFPSWVPLPVSE
LAVGRAVRPA
119870166YP_940118.1 GntR family transcriptional regulator [Mycobacterium sp. KMS]MTNLAGVGDTGHVAGLAEWVSLDARAARPLFDQLRTQIIDAVRDGRLSPG
TRLPTVRELAGQMGLAVNTVARAYRELETAGVLETRGRFGTFVSRVDPAD
TAMATAAQNYVETARALGVEKSAALRYVESAFD
119870164YP_940116.1 hypothetical protein Mkms_4134 [Mycobacterium sp. KMS]MTRFVAFLRGVNVGGVNLKMAEVAAAFEDAGFTAVKTILASGNVLLDSDA
DVTTVRRTAEQALRERFGYDAWVLAYDAATVAAVSAAYPFEREVEGHHSY
VTFVTDEQVLDELAALAADAGPEEKIERGEGVVYWQVPKSATLDTTIGKT
MGKKRYKSSTTTRNLRTLDKVLRSVDSAR
119870162YP_940114.1 hypothetical protein Mkms_4132 [Mycobacterium sp. KMS]MAEQPEDDTKRKFREALERKKAHSTDSAGQRKGGPQQAKAHGHGPVENRR
EFRRKSG
119870160YP_940112.1 SSS family solute/sodium (Na+) symporter [Mycobacterium sp. KMS]MTVLAAETIGNPVANMSIFALFVLVTLFIVIKASKKNATATEFFTAGRAF
TGPQNGIAISGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLL
VAELLRNTGKFTMADVLSFRLKQRPVRLAAATNTLAVSLFYLLAQMAGAG
VLVALLLNIESDLGQSIVIAVVGVLMIVYVLVGGMKGTTWVQIIKAVLLI
GGAGIMTIMVLAKFNFNFSEILGSAQAMVSSSEDAKVASRDVLAPGAQYG
ASLTTQINFISLALALVLGTAGLPHVLMRFYTVPTAKEARRSVVWAIALI
GAFYLFTLALGYGAAALVGPDRILAAPGGVNSAAPQLAFELGGVVLLGVI
SAVAFATILAVVAGLTITASASFAHDIYASVMKSHQVTESEQVKISRITA
VVLGTLAIGLGILAREQNVAFLVALAFAVAAAANLPTILYSLYWRRFNTR
GALWSMYGGLISTIVLIVFSPAVSGTATSMIKGADFAWFPLANPGIVSIP
LAFILGIVGTLTSPDDEDPTIAAEMEVRSLTGVGAEKAVSH
119870158YP_940110.1 Na+/solute symporter [Mycobacterium sp. KMS]MTGSALTAAALLAAAVATIAIGAYGVRFSRTTSDFLVASRTVGPQWNAAA
ISGEYLSAASFLGVAGLIAKYGADALWYPVGFTAGYLGLLLFVAAPLRRS
GAYTVPDFAEFRLGSRRLRKVAMLVVIVICVVYLVPQYQGAGLALKTLLG
MPVWIGPVVVGGIVITNVVAGGMRSITFVQAFQYWLKLTAIAIPAIALLG
LFFTDRGELGGPLPPSVTQDTTVAIETDVVVQVTEPAGITVTGTLDGRPV
IAAPIGAPGEHELGADSTMTLADGAATPVLAGTPAAGGEWLASGGGLGGA
HPLYQVVSIIVATFLGTMGLPHVLVRFYTNPDGRVARRTALAVIALLGLF
YLFPTLIGVFSRLYVPQLLITGAADAAVLLAPAAAIGGVFGQLLAALVAA
GAIAAFLATSSGLLVSIAGALATDVLRGRVRDFRIAALVGGLIPIPLSLI
TSGLELSRSVGLAFAVAASTLCPLLVLGIWWRGLTAVGASCGLVVGGAAS
GTAVALAIAGAVDEAALGGWAAVAVGYPAAITVPLAFVTMIAVSRLTRRS
VPPDVAQIFARMHVPERLGMGIERVPGD
119870156YP_940108.1 response regulator receiver protein [Mycobacterium sp. KMS]MNRSGLTVLAVDDEMPALDELAYLLGRHPDIGEVLRVNDATSALRELNQH
SIDAIFLDINMPGLSGIELAGVLGNFAQRPAIVFVTAHDDKAVAAFDVGA
IDYLLKPIRQDRLDEAVRRVVAARSAESAGAARSAESAADEEPDSDVVPA
ELGGITHLVPRDSIGWVEAEGDYARLHSASGSHLVRIPLSTLETRWRERG
FQRIHRSYLVALRLVTGLRTSDGAVLVRLRANGSSPAVELPVSRRQAREL
RDRLVRDPLRHLRPAGGDD
119870154YP_940106.1 HhH-GPD family protein [Mycobacterium sp. KMS]MAKLQLVQDPAADALLESNPFALLVGMLLDQQYPMEAAFAGPKKIADRMG
GVDAREIAEYDPEKFAALCSTTPAVHRFPGSMAKRIQALAQLIVDRYDGD
AAALWTSGDPDGAEVLRRLKALPGFGEQKAKIFLALLGKQYGVTPQGWRE
AAGDYGKAGTYMSIADVTDPGALEKVRSYKKQAKAAAKDQAKN
119870152YP_940104.1 hypothetical protein Mkms_4122 [Mycobacterium sp. KMS]MSPTRTLLTTAAGVGASVALLFSSATATAEPAPGLPIDTLQAPGLPAMES
LGPVIQQAAADPNNAASMLMAAAAVFAGDAAAPASSRDVASAVNQFVADP
AAHVPAPGAVPGTQAHLPAGVNPAHAVGPLPAGATPPAPGPEVAAAPVVD
PVAVPAAAPAPVPGAPVATPVAAPVAAPVAEAAGALPGPAPAPAPAPTPG
PPGFGPDAPPTQDFMYPSISNGCLKDGGNVLATAISVAGPAKIPAPGPGP
GQTAYVFTAVGTPGPAAEQKLPLNVTWVNLTTGKSGSATLKPRSDINPEG
PTTLTAIVDTGSGSIMSTIFGQVTTTEKQCQFMPTIGSTVVP
119870150YP_940102.1 mannosyltransferase [Mycobacterium sp. KMS]MCGIYSTVTEVTGIGYRISRVGPISDSTAAPAATADGANPTRLPGRLAAA
APVLLVLSIAARLAWTYLAANGANFVDLHVYVGGAGALDAPGTLYDYVYA
DQTPDFPLPFTYPPFAALLFYPLHLLPFGVVAFAWQIGIVAALYGVVRLS
QRLLADGGDRRTAMLWTAIGIWLEPLRSTFDYGQVNVLLVLAVLAAVHSS
RWWWSGLLVGLAAGVKLTPAVSGLYFVGARRWKAAVFSAVVFAGTVAVSV
AVVGPQARYYFTDLLGDADRVGPIGTSFNQSWRGGISRIVGHDAGYGPLV
VAAILVTAVLALLAWRAIGGSADRLGAIVIVQLFGLLLSPISWTHHWVWV
LPLMIWLWHGPLRRRAGARALRWGWLALTLIGVPWLLSFAQPTIWEIGRP
WYLAWAGLIYIVATLVTLAWLATTGATGRGSRRSPEPSADPSP
119870148YP_940100.1 NUDIX hydrolase [Mycobacterium sp. KMS]MAEQIVVAGALITGSQLLVAQRDRPPELAGLWELPGGKVARGESDSAALT
RELQEELGIDVAVGPRIGDDIALSATTVLRAYLVTHLGGDLRPIDHRALR
WVAVHELDDLPWVPADRAWLAALGHALRNGAG
119870146YP_940098.1 hypothetical protein Mkms_4116 [Mycobacterium sp. KMS]MKSSKFAELKPKKKCCRSKPRCKRCPLVVHKVLKAEHMGIRGKELEKVYK
RARKA
119870144YP_940096.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MPTRPRRHRVTLGALVSAVALLLGGCTVSPPPAPQSTETPQTTPPPAPKA
TQIIVAIDSIGPGFNPHLLSDQSPVNAAIAALVLPSSFRPIPDPNTPTGS
RWELDPTLLESAEVTNENPFTVTYNIRPEAQWTDNAPIGADDYWYLWRQM
VSQPGVVDPAGYDLITGVQSVEGAKQVVVTFSQPYPAWRELFNNILPAHI
VKDVPGGFGAGLAEAMPVTGGQFRVESIDPQRDEILLARNDRYWSAPAKP
DLVLFRRGGAPAALADSIRNGDTQVAQVHGGAATFAQLSAIPDVRTARIV
TPRVMQVTLRGQLPKLADPSVRRAILGLLDVDLLASVGAGDDNTVTLAQA
QVRSPSDPGYVPTAPPALGTEAALELLAEAGYQMAPVGDGAPGAPAPDHS
RGRLSKDGAPLTLVLGVAANDPTSVAVANTAADQLRSVGIEASVLALDPV
KLYGEALAENRVDAVVGWHQAGGDLATALASRYGCPALEATPVQTAPAAP
PGSSRPTTTAAPATTAPATPTATPTTTPSPAPESGALVQAPSNITGVCDR
SIQPKIDAALDGSEPIAEVIDAVEPRLWNMWTVLPILQDTTIVAAGPSVR
NVSLTGAVPVGIVGDAGSWVKTPQ
119870142YP_940094.1 integrase catalytic subunit [Mycobacterium sp. KMS]MSFSEDCVRFGDRLARLVDAGVPVKEAAVATGVSRDRCYAILRAIGRPVG
QARGRGERADQRGVADLGVVVAVFKDTGSILQAATACGVSHSTARKLLVA
EGLVTSGKIPWGKPEAKRRCLELFEQGWSTGAAAREVGVNVRTARDWRKG
IRHTNNTRVHPDGRVVDYTDRTVYKQSVSNLICDDTGRPAIDDRYLSVQD
RVAIADGLLGKESLRTIAGRIGKNVSTVSREIRARSIDGRYLPYHADRAA
ASARARPKQSKLVVNVVLRGAVEEGLSRKLSPEQISNRLRRDHPDDESMQ
VSHETIYQALYFQARGGLKKEVQQALRTGRTRRKPHRKEGERYQRFTDPM
VMISDRPAEVDDRAVPGHWEGDLITGEKNQTAIGTLVERSTRYTMLVHLP
GGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVY
FCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQELNGRPR
KTLGWDTPAERLRDLLLTN
119870140YP_940092.1 hypothetical protein Mkms_4110 [Mycobacterium sp. KMS]MLLYSQVSLSYSLPIERCARGEGAMRRAIAPFLATGVVLSGAAVVVANPV
VPLPSDIRVSASDFTADGDRLDVLDPEFLESIGAIRQDWLSSIEELQRLF
NDVSNTGRDSVISAFSAGVSVTEPSVALPVEEFTAAHERTLVPNTTIPPG
VPSETLEGVVGALTDIGTSFGEAGITFVKQVTLVPAVAFVLMKQVATGLL
TGEMGPIEALHRLIVEPLSALLVGDPELTGIEAIDKAFAESALKPLIRAL
IRNLPKPLGKEGGLIDQVDQTVDGVVVDIRDGVTPPSAVGAKPQQVESGT
DLEVPLPALEVDPDGESDTPSATTQPGAPKLPKPGELARELGVRVQQGVQ
QGIDNFHSTIKRFTTGGKKTTPAKDGDQAGDAGGQGDTTGGKQPTPGSTN
DASSPADDKTTVDRETDSEK
119870138YP_940090.1 hypothetical protein Mkms_4108 [Mycobacterium sp. KMS]MGGRFVRGAARQHPDLTAPPRGSRRAAGLLRGVILALLTLDGVLTAVLGA
FFLPLRIGVAPFPLSAFVVGAVNAALVWAAFQWTDSGRLAALPLWAWLAT
LAVLTVGGPGGDVVFGGRDVMAFGVLIYTAVGVAPSAWLLWRRGLRTG
119870136YP_940088.1 hypothetical protein Mkms_4106 [Mycobacterium sp. KMS]MTAATTTALSAGTWAIDPVHSTIGFSVRHLMVSKVRGTFDDYSGTITVGE
DGTASVTAEIAVASVNTRNEQRDAHLRAADFFDVENHPVATFTSTGVRAD
GDGYVIDGEFTLKGVTKPITLDLEFNGTNPGMGHGEVAGFDASVVLNRKD
FGIDFDAPLETGGAVVGDKITVTLEIEALKQA
119870134YP_940086.1 N-succinyldiaminopimelate aminotransferase [Mycobacterium sp. KMS]MDEVAPVIREALAAASGAPGYPTTAGTPELRASAKAALERRCGITGLADD
AVLPVIGSKELIAWLPTLLGAGSDDLVVVPELAYPTYDVGARLAGAQVIR
ADSLTQLGPQRPALIFLNSPSNPTGRVLGVDHLRKVVGWARDRGVLVASD
ECYLGLAWDAEPVSVLHPSVCDGDHTGLLAVHSLSKTSSLAGYRAGFVAG
DPAVIAELLAVRKHAGMMVPTPVQAAMVAALDDDAHEREQRERYARRREV
LLPALKAAGYTVDHSEAGLYLWATRGEPCRQTVDRLARLGILAAPGEFYG
PRGAQHVRLALTATDERIAAAAERLSANQG
119870132YP_940084.1 hypothetical protein Mkms_4102 [Mycobacterium sp. KMS]MRAARIRLGELLLALDRTMVTLQQAPRGLDLPVASVALVDADDVRLGIAP
SAGNADLFFLLGVPSDDAVRWLAAQPRPPVAVFVKDPAPELVRHAIARGA
AVVAVDPHARWERLYRLVNQFFDHRGDHGDPPLPGGTDLFGLAQSIADRA
RGMVSIEDAQSHVLAYSASSEEADELRRLSILGRAGPPEHLAWIGQWGIF
DALRAGRDVVRVAERPELGLRPRMAVGIHLRSGARRTPTFAGTIWLQQGS
APFADDAEEVLRGGAVLAARVLGRMAATPSTHTLRVRELLGLSDTDTDIG
AIARELGVDADSRAALIGFGTAAPTPPADVIALSATAFRADAQVASAGDR
VYVVLPEIGAPSVTSWVRGVVGTLRREAGLTLHAVIAAPLPGLADVAASR
AEIDRVFDSAARHPGAIGQITSLADARATVLLDEIVAHVAGRPGLVDPRV
RTLREKDPLLAETLHAYLDGFGDIAAVASRMHVHPNTIRYRVRRIETLLG
TSLDDPDDRLVLALGLRATESAQPLNAPSTSSSNRSNASSRSSSIPRSGP
GSSR
119870130YP_940082.1 L-proline dehydrogenase [Mycobacterium sp. KMS]MGAFQRVARPVILAAARSDSLRHTAERLPVTRNVVHRFVPGESVEEAMYC
VTGLRNSGRMVSVDYLGEDVTDVDTANATVEAYVKLLDALGRRDEPAGAV
RPLEVSLKLSALGQALPRDGEKIALENAHTICTHAQRVGAWVTVDAEDHT
TTDSTLSIVRELRSEFDWLGTVLQAYLRRTQADCAEFAASGARIRLCKGA
YDEPASVAFRDADEVTDNYLRCLETLMAGRGYPMVASHDPVVIDAVPGLA
AAQGRASGSYEYQMLYGIRDQEQQRLADAGNVVRVYVPFGTQWYGYFVRR
LAERPANMAFFLRALAGR
119870128YP_940080.1 hypothetical protein Mkms_4098 [Mycobacterium sp. KMS]MTYTRPPGHIGMSTETTIRQLITRWVDAVAACDIDGVLADHDPDIVMFDV
PPPHTGVRGLDAYRGTWPDFFEFLRGGARFELLELHVTAGTDVAFAYGLL
RCGTQEMCDQNPDTRLRMTIALRQHDGRWYVTHEHHSFCMT
119870126YP_940078.1 NUDIX hydrolase [Mycobacterium sp. KMS]MDSIRQVSSREVYRNDWLTLREDDIQRPDGSDGIYAVVDKPNYALVIACD
GDRLKLVEQFRYPLGLRRWEFPQGTAPGRADMEPLDLAARELREETGLRA
GTVTTLGLLDVAPGMSSQRGWVFLATDLTEGDHDREHEEQDMRSAWFTRD
EFERMVADGEITDAQSIAAYGMLLLRERLLG
119870124YP_940076.1 hypothetical protein Mkms_4094 [Mycobacterium sp. KMS]MGLRFTDLCVDAADIHALGGWWAEVLGYAQEVTDDGDVILRPPSGAGPNI
LFLAVPDEKVVKNRLHVDLTPDDQQAEVDRLLALGARRVDIGQGEQSWVV
LADPEGNEFCVLAAQS
119870122YP_940074.1 hypothetical protein Mkms_4092 [Mycobacterium sp. KMS]MVGDQEAIDAVLNRLRRAQGQLGGVISMIEQGRDCKDVVTQLAAVSRALD
RAGFKIVATGLRECVAGEGADGRDPMSVAELEKLFLALA
119870120YP_940072.1 hypothetical protein Mkms_4090 [Mycobacterium sp. KMS]MPRRPVRPEKERQMCYAVTCPSCGKTTWDGCGQHVDDVMRSVPTADRCRC
ERVTETPRRTAGRFWRR
119870118YP_940070.1 beta-lactamase domain-containing protein [Mycobacterium sp. KMS]MHVSIIETSGLGDRSYLISDRDTAVVVDPQRDIDRVLALADERQARITHV
LETHLHNDYVTGGLELSRTVGAEYVVPAGDDVGYPRRAVTEGDVINAGPI
RLEVLHTPGHTHHHVSYVLSDDTGTVHGVFTGGSMLFGTTGRTDLVGPDD
TEKLTHAQYHSVRKIADRLPADTVVYPTHGFGSFCSATPASGDASTIGEQ
WQANPALTKDEQSFVDELLAGLEAYPAYYAHMGVINREGPAPVDLTPPAP
VDPAELRRRIEAGEWVVDLRNRTAFAAGHLQGTLGFELSGSFVSYFGWLY
EWGAPVTLIGESQDQIADAKRELVRIGVDRLTGSATGDIDELRDGAEVGS
YAVSDFAGLAEHLDDDTVAVLDVRQHGEYEEDHVRGAVNIPLHELPQRLD
EVPAGTIWVHCASGYRSSIAASYLDRAGHDVVLIDDDFGNAGQLPLSSRA
APR
119870116YP_940068.1 succinyl-diaminopimelate desuccinylase [Mycobacterium sp. KMS]MAPSSALRASGSSLDLRGDPVELTAALVDIPSESRHEQRIADEIEAALRE
QTDGFEIIRNGDAVLARTNRGLPSRVLLAGHIDTVPAADNVPSRRVGDEL
HGCGTSDMKSGDAVFLHLAATVADPAHDLTLVMYDCEEIEASANGLGRIE
RELPEWLQADVAILGEPSGGFIEAGCQGTLRVVVSATGTRAHSARSWLGD
NAIHKLGAVLDRLAAYQARSIDIDGCVYREGLSAVRIDGGIAGNVIPDAA
SVTVNFRFAPDRTVDQALAHVHEVLDGLDVTVEQTDAAAGALPGLTRPAA
AALVEAAGGQARAKYGWTDVARFAALGIPAVNYGPGDPNLAHRADERVDV
GQITATTEVLRRYLTA
119870114YP_940066.1 hypothetical protein Mkms_4084 [Mycobacterium sp. KMS]MTGGPLFVQTDGLRQFSQTHAEIAAGVSQLVGGAPTVAGVEASHGQIAFA
VQNALTGLLGARQGTLQTTARSGDKIAELLQKAAAAYDKGDERSAGKLKA
AIEGAGGPGGPASGGGGANTAAGATGAIGQALGQLGQMGQQGSGAVQGLV
QGLQQVPQQVMQGVQQIVQAATGAAGAGESERAPVEENRDGGPDAPTPTQ
QV
119870112YP_940064.1 hypothetical protein Mkms_4082 [Mycobacterium sp. KMS]MRVPDRPDRPWAVCVYCASSPTDERLLSLAARVGEAIADRGWTLVSGGGN
VSAMGALAHAARAHGGRTVGVIPKALVHREVADVDADELVVTDTMRERKQ
VMEDRADAFLSLPGGIGTLEEFFEAWTAAYLGMHDKPVVMLDPIGHYEGL
LAWLHGLVDSGYVARSALDRLIVVDNIDEAMAACAPRL
119870110YP_940062.1 dihydropteroate synthase [Mycobacterium sp. KMS]MESTFCGRPVAGDRAMIMAIVNRTPDSFYDRGATFTDEAAKSAAYRVVED
GADVVDVGGVKAGPGQTVGADEEIARVVPFIEWLRGTFPDVVISVDTWRA
SVAKQACAAGADLINDTWGGSDPGLPEVAAEFNAGLVCSHTGGAVPRTRP
FRVNYGITERGVVDDVIAEVTSAAQRAVAAGVARDRILIDPTHDFGKNTY
HGLSLLRHVEELVKTGWPVLMALSNKDFVGETLGVGLTERLEGTLAATAL
AAHAGAAMFRVHEVGPTRRVLEMVASIQGVRPPTRTVRGLA
119870108YP_940060.1 hypothetical protein Mkms_4078 [Mycobacterium sp. KMS]MTLILLYLVVLVLVGVVLFGVGSVLFGRGESLPPLPRATTATVLPASGVT
GADVDAVKFTQTLRGYKPGEVDWVLDRLGQEIDALRGELAAVRAAAELAE
ESP
119870106YP_940058.1 hypothetical protein Mkms_4076 [Mycobacterium sp. KMS]MAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALGDEL
KNVTS
119870104YP_940056.1 glucose-1-phosphate adenylyltransferase [Mycobacterium sp. KMS]MRELPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVN
ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSMNLIYDEDPDYIVVFGADHVYRMDPEQMVQFHIESGAGATV
AGIRVPRAEATAFGVIDADESGRIRSFVEKPADPPGTPDNPDEAFVSMGN
YIFTTKVLIDAIRADADDDDSDHDMGGDIIPRLVSDGMAAVYDFSNNEVP
GATERDHGYWRDVGTLDAFYDAHMDLVSVHPIFNLYNKRWPIRGESENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVYIDDGAIVEGSVIMP
GTRIGRGAVVRHAILDKNVVVGPGEMVGVDLEKDRERFSVSAGGVVAVGK
GIWI
119870102YP_940054.1 ABC transporter [Mycobacterium sp. KMS]MTTTAAPPRTASPYTGVPQLIRLALRRDRVRLSVWISVLTLMMVYAPNAV
KLAYPDEPQRLARVNLMKTPAAIIMGGPMFGVRETELGAMMANELMLTLI
VAASILSILTVIRHTRAEEESGAAELVLSSVVGRYARTTAALILVGAVNA
VLTVTMTLAMSAAGFRFVDTLAMCLGVTAVSALFGAVAAVTAQLWRQART
ATGAAMAVLALAALVRGIGDVIDNSGSALSWFSPIAWAQQMRAFVALRWW
PLVLLVAVTVALVALAAYLENRRQYDDGTLPSTGDRPDAPAIRGVLGLHL
TLQRGLTVGWGVGLFLGGLAFGSMTKSLIDAAETNELLARVLAVQGNDGV
YTTMTQFLAAAACAYVVSAVLRVYADELSGTGEAVLAGAVSRWRWLLSAV
AAAMLGATLLMVGAGLGNGLGAGLTLGEPATIVKLTVAGLAFVPALAVVA
GVAALAVAVRRPWVAWAAVTFIVVSLYLGALLRLPQWLLDASPVGQTTAP
TDYPVSALVVMCVVAAAFTAVAGSLYRGRDAV
119870100YP_940052.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MRSADADRTTLARIRDAAIEQFGRHGFGVGVRTIAESAGVSPALVIHHFG
SKDGLRKACDEYVAEVIRSDKSASIQSNDPATWLAQIAEIESYAPLMAYL
VRSLQSGGDLARAFWRRMIDNVEQYLDEGVRAGTVKPSHDPRGRARFLAM
ASGGGFLLYLQMHEDPTDLRRVLRDYSDDMVLPALEIYTNGLMADSTMYD
AFLANQGASSTHQGDGDDGSDEQVPATA
119870098YP_940050.1 RNA polymerase sigma factor SigE [Mycobacterium sp. KMS]MEHGRRLRFGNRNTADRVARNDQPTTMTDAGHDSAGPDLEDPTTTTTAAA
QAAPVSMAHLEQFSDSDWVEPTDELTGTAVFDATGDKTTMPSWDELVRQH
ADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITT
NLFLDMVRRRGRIRMEALPEDYDRVPADDPNPEQIYHDSRLGPDLQAALD
SLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDHLA
RHAPDAATSA
119870096YP_940048.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium sp. KMS]MIPPVTNQDQASRRMAPRPVERPPVDPTAQRVFGRPRGVSGSFLGVDQHR
GQGEYAPKDQAPDPVLAEAFGRPPYAGADSLQRHPADSGALDAERAGDTG
DVEPDPWRDPNAPVALGTPAVEAPAPVHGPAQTGKLGVRDVLFGRKVSYV
GLAILLLTALMVGALGGWVGNKTAETVQAFTTSKVTLETSDSGDPPEGRI
TKVADAVADSVVTIEAKSDQEGSQGSGVVIDGRGYIVTNNHVISEAANNP
AKYKMTVVFNDGKEVPANLVGRDPKTDLAVLKVDNVDNLTVAKMGDSDKL
QVGEEVIAAGAPLGLRSTVTSGIISALHRPVPLSGDGSDTDTVIDGVQTD
ASINHGNSGGPLIDMDANVIGINTAGKSLSDSASGLGFAIPVNEVKTVVE
ALIRDGRIEHPTLGLTAKSVSNDVASGAQVANVKAGSAAERAGILENDVV
VKVGNRDVADADEFVVAVRQLKINEPAPIEVVRDGRPVTLTVTPTPDAAT
D
119870094YP_940046.1 hypothetical protein Mkms_4064 [Mycobacterium sp. KMS]MSQNPDERQTAIRAALAKVIDPELRRPITELGMVKNVTVDPGDGSVHVEV
YLTTAACPKRSEITEQVQRAVADVPGTGAVRVSLDVMNDEQRAELRKQLR
GDSREPVIPFAQPGSLTRVYAVASGKGGVGKSSVTVNLAAAMAARGLSVG
VLDADIYGHSVPRMMGTTDRPTQVDSMILPPIAHEVKVISIAMFTQGNTP
VVWRGPMLHRALQQFLADVFWGDLDVLLLDLPPGTGDVAISVAQLIPGAE
ILVVTTPQLAAAEVAERAGAIALQTRQRIVGVVENMSGLLMPDGSTMQLF
GEGGGRQVAERLTRAVGADVPLLGQVPLDPALVAAGDSGVPLVLSAPDSP
AGKELRGIADALSARKRGLAGMSLGLDPAGR
119870092YP_940044.1 hypothetical protein Mkms_4062 [Mycobacterium sp. KMS]MSDLSARGRLDTPRSPRRISFNVDREAVGQVGERVARFLGTGRYLAVQTI
IVIVWIALNMFAISLQWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVSLDEDRRRAAQTKADTEYLARELAALRLAVGEVATRDYLRRELEELR
EMVATLLAANDVDDRRSKRSG
119870090YP_940042.1 citrate (pro-3S)-lyase [Mycobacterium sp. KMS]MNHALRPRELDDSARPRRTCLSVPGSSAKMIAKAKGLPADEVFLDLEDAV
APEAKAEARTRVALALAESGWGGQLRGVRVNDWTTPWTYADVIEVVSTAG
AHLDLIVLPKVTDVSHIHALDLLLTQLETTHGLPVGRIAVEAQIENAVGL
TNVDAIAAGPRVQALVLGPADLMASLNMRTLVVGEQPEGYDVGDAYHHIF
MRILIAARTHGIHAIDGPFLKVRDVEAFRRVAGRSAALGFDGKWVLHPDQ
ITAGNEIFSPRQQDYDHAELILEAYEWHTSRAGGARGAVMLGDEMIDEAS
RKMARVVAGKGRAAGMTRQGEPFRPPA
119870088YP_940040.1 hypothetical protein Mkms_4058 [Mycobacterium sp. KMS]MTSPFQSGPTPGAPPNSPAGARGVPAALPTPPKGWPIGSYSTYAEAQRAV
DHLSDQQFPVQQVTIVGVDLMQVERVTGRLSWPKVLGGGVLTGAWLGLFI
GLILGFFSPNPWSALLTGLIAGVFFGLITSAIPYAMARGTRDFSSTMQLV
AGRYDVLCDPKNAEQGRDLLARLTI
119870086YP_940038.1 binding-protein-dependent transport system inner membrane protein [MycMTATAAPAPPTEVRGGSDDSRSDRRLAFMLIAPAVVLMLAVTAYPIGYAV
WLSLQRYNLAEPSDTEFVGLSNYVTVLSDQYWWTAFAVTLAITVVSVAIE
FVLGMALALVMHRTIFGKGVVRTAILVPYGIVTVAASYSWYYAWTPGTGY
LANLLPEGSAPLTEQLPSLAIVVLAEVWKTTPFMALLLLSGLALVPQDLL
NAAQMDGAGPWKRLVKVILPLIKPAILVALLFRTLDAFRIFDNIYILTGG
ANNTGSVSILGYDNLFKAFNLGLGSALSVLIFLCVAIIAFIYIKLFGASA
PGSDEERR
119870084YP_940036.1 ABC transporter-like protein [Mycobacterium sp. KMS]MAEIVLDKVTKSYPNGATAVKELSITIADGEFIILVGPSGCGKSTTLNMI
AGLEDITSGELRIGGQRVNDKAPKDRDIAMVFQSYALYPHMSVRQNIGFP
LTLAKVNKDEINRKVEETAKILDLTELLDRKPGQLSGGQRQRVAMGRAIV
RNPKAFLMDEPLSNLDAKLRVQMRSEISRLQNRLGTTTVYVTHDQTEAMT
LGDRVVVMLAGVAQQIGSPEELYNRPANLFVAGFIGSPAMNFFPASLTDV
GVRLPFGEVTLTQEAYDLINRRGKPKNIIVGVRPEHLEDASVLDGYARIR
ALNFEVTADMVESLGAEKYVHFRTEGAGARSAQLEQLTVESGQGENEFVA
RVSTESPVRQGDTIELALDTSKLVIFDGDSGENLTIPDERSEEPPAIVEP
AKPAE
119870082YP_940034.1 magnesium and cobalt transport protein CorA [Mycobacterium sp. KMS]MAGPDAYHFRMPSFHVPVARAVVDCAVYCDGERVAGRFTHASALQQAREL
GNEGRAAFVWIGLHEPDDHQMQTVAEVFGLHELAVEDAVHAHQRPKVERY
DDTLFLVLKTVKYVEHESMAKAREIVETGEIMVFVGSDFVVTVRHGDHSG
LTGVRRRLEASPAALALGPYAVMHAIADQVVDSYLEVTEMVETDIDAIEE
DIFSPRSRTNIENIYLLKREVVELRRSVSPLTPALQRISDYDDLISIEIR
RYMSDVLDHNIRASDRISSYDDLLSSLVQAALGKVAMQQNVDIRKISAWV
AIAAVPTALAGIYGMNFDHMPELHSPWGYPAVLLVMLTICSLLYRTLRRN
HWL
119870080YP_940032.1 glycine betaine ABC transporter substrate-binding protein [MycobacteriMRRLLIALCAVALTACGAPQAGPSLTIGSAQDDASLVTAHLYAAALRHYG
TGTRVEPTADPLAALDAGEVAVVPGLTGRLLDRFQPEATARADEQVYRDM
VSALPEGIAAGDYTTAAEDKPALAVTESTVAELGGQDLLAVVRNCGEVRP
GRVRGARTPATIGTCRLPAPRDFPDAAALVAAVKTGQVDAAWTTTASPGI
PPDLVVLADSTSLVRAENVVPLYRRNTLGESQVLALNEVAGVLDTAALAD
MRARVRAGDDPAVVAGEWLAEHPLRD
119870078YP_940030.1 hypothetical protein Mkms_4048 [Mycobacterium sp. KMS]MKRFHRAAVASLAASGLIGSAMSLGTGSAGADTATDMFLSALAGSGVTGV
DTATAVRVGQSVCPMLAEPGQNVANVAADVSDMIGRPLGPATMFTGLAIQ
VFCPGAVAALAYGKSPLPLPGL
119870076YP_940028.1 hypothetical protein Mkms_4046 [Mycobacterium sp. KMS]MSARSDRKKQLALVGAADDEKPGAAAKVLSRIIERSSRVQGPAVKAYVDR
VRAGDRTASPAEIITKLEKHYMAAVMTSGAAVGSTAAFPGVGTIAAMSAV
AGETVVFLEATSLFVLAVAEVHGIPAAERERRRALVLSVLVGEDSRQAVA
DLLGRGRTSGAWISEGAATLPLPAVSQLNSRLVRYFVKRYTLKRSALAFG
KVLPVGVGAVVGGVGNRMMGKKIVENARSAFGPPPSRWPSTLHVLPSAQP
NP
119870074YP_940026.1 EmrB/QacA family drug resistance transporter [Mycobacterium sp. KMS]MFSTSEARPVTGDPWHALWAMMVGFFMILVDATIVAVANPVLMEKLGADY
DAVIWVTSAYLLAYAVPLLVAGRLGDRFGPKNVYLVGLAVFTAASLWCGL
AGSIDTLIAARVVQGVGAALLTPQTLSTITRIFPPERRGVAMSVWGATAG
VATLVGPLAGGVLVDHLGWQWIFFVNVPVGVAGLALAFWRVPALTTTAHR
FDLLGVLLSGVGMFAIVFGLQEGQSHGWQPWIWVVIVAGVAVMAGFVYWQ
SVNPHEPLIPLRIFGDRDFSLSSFGVAVIGFVVTGMIVPAMFFAQAVCGL
SPTESALLTAPMAITSGVLAPAVGRIVDRAHPRPIVGFGFSALAIGLTWL
SIEMTPDTPIWRLVLPFLVMGIGMAFIWSPLAATATRNLAPHLAGAGSGV
YNATRQVGSVLGSAGMAAFMTSRISAEMPSAQGGAPRGEGAVSALPEFLQ
VPFAAAMSQSLLLPAFVALIGVVAAIFLRGFGEVSAPVVAAPVARADPRD
DSVDDSHGYDDDDYLEYAVSWDDLQFTEPISTRPEVGADDSVTTPLATRG
RRAEAAAEPSGADDPWRRVLDELLPEPPARPEAEPIGFAHNGFHVEGEET
PVDDRRGRRYRDDGDAAPAWLREFGERSRRGTDTPSGGRHSRRDGD
119870072YP_940024.1 protein LprE [Mycobacterium sp. KMS]MAVGTAALSALVGCSSGDSTVSKTPEATGPSPAPTAPATPSIAPTVGPPP
AAGPSDPCAVNLAAPEIAKAVSSLPRDPRSNQAWSPEPVAGNYNECAQLS
AVIVRANTNAENPNTRAVMFHLGKFIPTGVPDTYGFNGLDPAGTTGDTVA
LRYSGEVDGLASIVRFRWNGNGVELIGNTG
119870070YP_940022.1 acyltransferase 3 [Mycobacterium sp. KMS]MTAPRGVQDSVSADPVQGGLESVSTAERVASLTGIRAVAALLVVLTHAAY
TTGKYPQGFAGLVYSRMEIGVPIFFVLSGFLLFRPWVQAAARGGPPPSVR
RYAWHRVRRIMPAYAVTVVAAYLVYHFRTAGPNPGHTWEGLFRNLTLTQI
YTDDYLYSFLHQGLTQMWSLAVEAAFYVVLPALAYALLVVLCRRAWRPGV
LLVGLALFAAVSPLWLWLVHSVDWLPDGARLWLPTYLVWFVGGMLLAVLQ
AMRVRVYALAAIPLAVVCYLIASTPIAGEPTTSPHALRDAVVKTAFYAVI
ATLTVAPLALGDRGLYAKVLASRPMVFLGEISYEIFLIHLVTMEVVMVEI
LRYPIYTGSMLWLFVGTMVVTVPLAWVLHRFTRVRPG
119870068YP_940020.1 sulfatase [Mycobacterium sp. KMS]MSDSSPQNTGQQAAAAVRRDVLPIPDPRHVGLTTYDAKDPNTTYPPITRL
RPPDGAPNVLIVLIDDVGFGASSAFGGPCRTPVAERLAANGVKLNRFHTT
ALCSPTRQALLTGRNHHSVGMGGVTEIATSAPGYSSIRPKDKAPISETLR
LNGYSTSQFGKCHEVPVWEVSPVGPFDQWPTGSGFEHFYGFVGGEANQYY
PGLYEGTTPVEPAKTPEQGYTLTEDLADRAITWVRQQQALTPDKPFFMYF
APGATHAPHHVPREWSDRYRGEFDAGWDVLREQIFARQKELGVIPQDAEL
TRRHDEIPGWDDMPDRLKPVLARQMEIYAGFMEQTDHEVGRLIDAVDGLG
ALDNTLIYYIIGDNGASAEGTPNGCFNEMCTLNGLAGIETEDFLLSKIDD
FGTPDAYNHYAVGWAHALCAPYQWTKQVASHWGGTRNGTIVHWPAGIDAV
GQTRDQFHHVIDVVPTILEAADIPAPLMVNGIAQAPIEGFSMMSTLRAAD
AAETHRVQYFEMFGNRGIYHDGWTAVTKHRTPWLSDQPALEDDVWELYGP
GDWTQAHDLAADDPAKLAELQRLWLIEAVKYDVLPIDDRSYERFNPDISG
RPVLITGSTQTIFPGMRLMESCVLNIKNKSHSVTAELSVPESGAQGVVVS
QGGGVGGWCLYAHEGRLKYCYNFLGIEYYYVTAEAPLSAGDHLLRMEFAY
DGGGLGKGGTVTLFCDGEAVGTGRVDQSEPMAFSADEMCDVGSDSGSPTS
PDYGPHDNAFTGRIDWVKIDIGAADHDHLITAEDKLNIAMSRQ
119870066YP_940018.1 cytochrome P450 [Mycobacterium sp. KMS]MTTNVSHAARFELATAETWTNPWPMYAALRDHDPVHHVLPPAAPERDYYV
LSRHADVWRAARDHETFSSAQGLTVNYGELEMIGLADNPPFVMQDPPTHT
EFRKLVSRGFTPRQVEDVEPAVREFVIERIERLRADGGGDIVRELFKPLP
SMVVAHYLGVPEADRAQFDGWTEAIVAANTESAGVTGAGDAIGAMIGYFA
ELIERRRREPGDDTISHLVAAGVDVLPVLAFTFTMVTGGNDTTTGMLGGT
VQLLHQRPDQRRLLAGDPGLIADAVDEFLRLTSPVQGLARTATRDVTVAD
TTIPAGRKVLLLYGSANRDEREFGSDAAELDVTRRPRNILTFSHGAHFCL
GAAAARMQSRVALTELLARCPDFTVDEAGIVWAGGSYVRRPLSVPFAL
119870064YP_940016.1 hypothetical protein Mkms_4034 [Mycobacterium sp. KMS]MAAAPLVAIDAEPALEHLLDIRIAFSAVEIFQTPVGTRLTYVIADGRCEG
PRISADVLPGGGDWVVIGTDGVARLDVRATLRTDDGARIHLTNTGRVSMS
DAATQRFSAGEMLRHDEIYARSSPLFDTDDDRYRWLTALHTVAINEVSLR
AVHYRVFAVR
119870062YP_940014.1 H+ antiporter protein [Mycobacterium sp. KMS]MIASKRVPLYLIYFSALTAGAGNGISLVAFPWLVLQRNGSAVDASIVAMA
GTLPLLVATLIAGAAVDYLGRRRVSMIADGLSALSVAAVPVLAWTFGVQA
VNVAVLAGLAALGAFFDPAGMTARETMLPEAAHRAGWTLDHANSVYEAVF
NLAYIVGPGIGGLLIATMGGVNTMWVTAAAFVLSIGAIAALQLEGAGRPD
RDQLPERVWSGIVEGLGFVWRTPVLRTLAVVDLVATGLYMPMESVLFPKY
FTDRDEPAQLGWVLMALSIGGLVGALGYAALSRYVNRRTVMLAAVLTLGV
AMTVIAFLPPLPVILVLSALVGLVYGPIAPIYNYVMQTRAPAHLRGRVVG
VMGSLAYAAGPLGLVVAGPLADGAGLSVTFLALALPMLALGVAAVFLPAL
RELDREPARPLRGEPGAG
119870060YP_940012.1 luciferase family protein [Mycobacterium sp. KMS]MRLSVLDLIPVRTDQTTSDALAATTRLAQTADRLGYTRYWIAEHHNMPAV
AATSPPVVIAHLAAQTSQVRFGSGGVMLPNHAPLAVAEQFALLEAAHPGR
IDLGIGRAPGSDPVTSMALRGAAGRDDTDIERFPDYLDDVAALMSRHGVR
VSLPRNLMRENYILKATPAATTEPRLWLLGSSMYSARLAAAKGLPYVFAH
HFSGQGTAEALATYRSEFRPSDVAAEPVTFLTVNAVVAETHDEAMALMLP
NLHMMAQLRTGQPLTALDLVEEAQAKELSPQAQAVVRHGLQRAVVGSPTE
AADQVRALAAEFDVDEVMINPVASARRGTDPATAPARDTTLELLAKELF
119870058YP_940010.1 histidine triad (HIT) protein [Mycobacterium sp. KMS]MSCVFCDIVAGDAPAIRVYEDADFLGILDIRPFARGHTLVIPKRHTVNLT
DTPADTVAGMARIGQRIAKAARRSGLHADGNNVVINDGKAAFQTVFHIHL
HVLPRRSGDKLSFAKNMVLRRDPDREESGRLLREAIAELDNAP
119870056YP_940008.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MGAWKNPPAAPVRGVVGRAGSASAYDLRRWAPSPRAAVFVEHFWSVSWDL
RGRPAVDSTVITFPSVHLTREWGEDEVRHGHRLPATLVHGVVERVFRVTV
RERGAVVGARFRPGGFAARFDRDASALTGRVDPIDDDLFGGPLALPCDAQ
RAGAALDDAIGAGSGALDPTYRVLTALVDRIRDDDRLQRVEHVVAASPWS
ERTVQRVFRRYVGVPVKWVLCRYRLQQAALEIESTPDVDFADLAARLGWY
DQAHFTNDFRAMLGCTPGEYASRHGA
119870054YP_940006.1 hypothetical protein Mkms_4024 [Mycobacterium sp. KMS]MSTPDLVQGFAPIVGGAPRTLVLGNAPSVLALAKHQYYGNPRNAFWRIAG
ALYGFDADDPYAVRTAALIAHGVAVWDVLRECRRTGSLDSAVQPDSMVAN
DFGSFFGEHPTIRRVLFNGAAAERNFRRLVPGAFEVEFSRLPSTSPAQTM
RYELKLAAWREALAD
119870052YP_940004.1 heavy metal translocating P-type ATPase [Mycobacterium sp. KMS]MSSVVLAVGGMTCASCAARVEKKLNRIDGVSASVNYATEQATVSYPDTVR
PEDLVAAVEATGYTATLPTPEPEEPEPRGEPDEAAAWRQRLTISAALSLP
VVLLSMIPALQFDNWQWLALTLASPVVVWGAWPFHRAAWMNLRHGAATMD
TLISVGVTAAYLWSLWALFFTHAGMPGMTMSFDLLPSDTGDVHLYLEVAA
AVTTFLTAGRYFEARAKRQSGAALRALLDMGAKDVAVLRDSREVRIPVGQ
LTVGDEFVVRPGEKIATDGVVVSGSSAVDQSMLTGESVPVEKGPGDDVVG
ATVNVGGRLTVRATRVGADTQLAQMARLVNEAQSGKAEVQRLADRVSAVF
VPVVIGLSLLTLAGWLLVGGPVSAAFTAAVAVLIIACPCALGLATPTALL
VGTGRGAQLGILIKGPQMLESTRRVDTVVLDKTGTVTTGQMSVVSTHADE
ATMRLFGALESASEHPIARAIAAHAAERGQLPAVEQFENHGGSGVSGVVD
GHRVAAGRLAWLSRDTAAPVPPDLREVAEAAEAEGRTPVWFAVDGEICGV
AVVSDTVKDHAVDAIADLRALGLTPVLLTGDNRRAAQAVARQVGIDVRDD
TVIAEVLPQDKVDAVRALQRDGKVVAMVGDGVNDAAALAQADLGLAMGTG
TDAAIEASDLTLVTGDLRAVPDAIRLSRATLRTIKGNLFWAFAYNVAALP
LAAFGLLNPLIAGAAMAFSSVFVVTNSLRLRRFTPSR
119870050YP_940002.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MTDLRPLWDTEAFSGVYAGHPGRLYRRGPATITDLIAGTRCWTDREFLVH
GDRRISYAAFRGALGRVGAHLADLGVRPRDRVMVFGYNSPEWIVALFALL
LQGAVPVLGNRWWSPAEVAHAAELLDLRHILTDTALDTDRPASPLADLAY
AFDAPAGPASHADEDVDIDEVAIVLFTSGSSGLPKAVELSRRSVIANQQN
ILTRNGRLPHLLNADSPQAVSLASTPMFHIGGLSSLLTHFLTGGRIVLAQ
GRFDPGQVMALVERERVQVWGAVPTMAVRVLEHPEFGSRDLSSLRSWPLG
GAPVSPELLERIRTQLPTLRERGLSNTWGMTEAGGFLTVADSRDLRARPG
TVGRPYPVVELRIDRPDDDGVGEVLARSPTVMLGYAGRADDDTVDADGWL
HTGDLGHLDDDGYLYIDGRSKDVVIRGGENIACPHVEAALASHPAVVEAA
ALGLPHPDLGEELAAVVVYRSGALPPTDDELRRHLAGIVSSFAVPTRWLI
RTEPLPTLAGEKIDKKTLATAFD
119870048YP_940000.1 hypothetical protein Mkms_4018 [Mycobacterium sp. KMS]MAVLGFVSGPRGGIAAVVCAVALVCAGCSADPEPSGPPAPGQTYPNWPAT
LDSFRFRWTAEPGIDLLTGAAVPIRAYLEGRRVAEFTAGTGSSLPTQFES
YPGFGSTVKRPTGLPWKGPDPVEVWDAYPDARIDIAGKQLFGNEYFHLLQ
LDPIDGGYRAYVCDGRYNLFVKKAKGNAYETTEGVGFGKFDYIFVWRVEV
RNHRELPERGPQRGPNPAPADDVFDGAQILAGNKARWGGFEGVPNTGADP
SESRTSAENHRRCLDKMPDSPHDMGIIAASRPTEPPAFEPAVPGWPAQAG
119870046YP_939998.1 formate dehydrogenase [Mycobacterium sp. KMS]MPSTTVHTFCHYCLASCGVEVTVEDNRVRKISADRLNPHSWHDFCAKGRT
AAELVDHPRRIRAPMRRVGDRYVEATWDEAITDIAARMNAAIEADGPDAV
GAYYGNPTGFSGSNVIFMNAWLDAVGTHNRYFVGSVDQNAMHVVAEAMYG
SMLMAPVSDIDNCDYFLLVGTNPAVSAWNWLETVPGGWRRALERQKRGAT
LVVVDPVRTESADHADVHLAIRPGQDWALLLAMVKVVLDEGLEHRGDCTD
LAVGVPELRSLVAEADLDDLAQRCGVDRATIERVARDFAAARGAMVVTRT
GVSLHAAGTVAEWLGHVLNVITGRMDRPGGRRFEPGYVDALRLAALAKGK
PHVSRVAGREMVSGAHALAELPDEITTPGPGQIKAILINCGNPVVSGPDG
AKLDRALATLDLLVVIDLVQRESHRHAHWLLPAAHWLERDDLLAFTSSMH
DEPFVQYGRRAVEPPPGAREEWQIFTDLALAMGLPLFGVRGMNGFVRATR
RAAALTRRPALAFGPQWLNRILVATSRKVNGRKLRWRDVANSPHGLVLGP
REFGHFRDALRTPDKKVHAAPPEFVTRTRELLAAPHPSAPAGYPFQLGNR
RHRHSMNSWLNDLPGLHPGGKRNEVVIHPEDAAALGVADGDRVRVFSPVG
AVEVHATVSDQPRRGLVVLDHGWGSRVFDPRGDAEPQSYGVNRNLLVDGT
GLDPLSQTSTLSEAWVGVQKV
119870044YP_939996.1 ABC transporter-like protein [Mycobacterium sp. KMS]MPVDLQVSSVCDSSEMLWGLLRQYVRPYRGLLSVVAGLQVVSTLASLYLP
TVNAAIIDDGVAKGDTGTIVELGMVMLGVTALQVVCAVGAVYFGSRAGMG
FGRDLRSAIFDRVTRFSAEDTARFGAPSLLTRTTNDVGQIQLLVQLTCTM
LITAPIMSVGGIFMAIHQDAGLSWLLLVSIPVLAVANYWIVSHLLPIFRR
MQQLIDNINRVLRDQLTGIRVIRAFAREPLERDRFADANQTLSDTALDAG
RWQALMLPVTTLVINISSVALIWFGGLRIDAGQMQVGSLIAFLSYFMQIL
MAVLMATFMLIIIPRAAVCAERIDEVLQTRPGIDTPPDAVRPDAVRGEIR
LEAATFCYPGADQPVVEDVSFTAHPGTTTAIVGSTGSGKSTLISLICRLY
DVTAGAVRIDGIDLRDYDIERLWSLIGLVPQRGYLFTGTVADNLRYGRSD
ATEDQMWEALRVAAADDFVRAHADGLQMRVAQGGMNFSGGQRQRLAIARA
VIRRPSVYLFDDAFSALDVHTDVRVRTALREVSAEATVVVVSQRLSTVAQ
ADQVIVVDDGRVVGVGTHDSLLADCPTYAEFAESQSVGADVGGRQ
119870042YP_939994.1 putative lipoprotein LprC [Mycobacterium sp. KMS]MSRSARTLAAVAALLAALTMLLGCTRTVEGTAARAGSGGGPSNNDSERQY
PNLLKECDVLTEDILAETVGADPLDIQSTFVGAVCRWQAANPAGLVDITR
FWFEEGSLDNEQQTAQKLEYQIENRSVAGVPSIVMRPGDPNGACGVASDA
GGVVGWWVNPQAPGIDACGMAIKLMELTLATNS
119870040YP_939992.1 putative phosphohistidine phosphatase- SixA [Mycobacterium sp. KMS]MASVGPDTDKSADLVRHVAAAPNVEGVSTNIRTLVLLRHAKSDYPDGVDD
HERPLAARGIREAGLAGDWLRTHLTPLDAVLCSTATRTRQTLERARIDAP
VHYADRLYDATPGTVIDEINMVARRFDHPVDTLLVIGHEPAMSHVALGLA
AVEVSNREAAAGIATKFPTSALAVLRTEQGWDRLALGGAALVTFHVPR
119870038YP_939990.1 hypothetical protein Mkms_4008 [Mycobacterium sp. KMS]MKLHRLVLTNYRGISRREIEFPDRGVVVISGANEIGKSSMIEALDLLFAA
KDRSTKKEVKQVKPTHADVGAEISAEISTGPYRFVYRKRFHKRAETELTI
LAPHREQLTGDEAHERALALLEGTVDMDLWQAQRVWQSASTAAADFSGSD
ALARALDAAAGEAATTSGAEPLLVDRIDEEYGRYFTATGRPTGEWAAAIK
RLQAAEAEVARCAAAVGEVDEAVRRHAALTGQLAESAEQRAALTRDVTAA
REAAQAVAALRRQVDEADVIAKAAQATRTASLAAVTERRRLRADIDERRA
AITDLEAAVAAAVDEEATARAVDQAAQQAAERARAAVEEHHARVDAARAV
AQRLSDRDEADRLTARLAKIDAAVRELAAVDTELAGIAVTDTSMRVVETA
ALAVERAAGQAELASARIELDAVADVDVRVGDELVRVVAGEGWSVNATTP
TEITVPGLLTARVVPGTPAAQTQARLDEANADLAAALQAVGAADVATART
LHDRRRELTQTRATLRATVDALTGDDTEAQLRARLAELRNGQPDTDALFE
LDGPADAAAAREALAAAVAAHQRAIGDCETHRKVAVAASAKLGEKATRLG
VVREKLAAAQAELNSATERLAAARDTVADEALSVAAEADREAAERAVART
ARLRDELAQSAPEAVEAHLAEVAARDRALQARHEDTTEALREVTAALKVY
GTEGRQGQLDSAHGEREHAESDYLRVHRRARAVDLLRSVMSRHRTATRER
YVEPYRREVERLGRLVFGDSFEVEVDSDLRIHNRTLAGRTVPYESLSGGA
KEQLGIVARLAGAALVAKEDSVPVVIDDALGFTDPDRLTKMGTVFDVIGG
DGQVIVLTCSPQRYASVPDAHHIELTV
119870036YP_939988.1 acyl-CoA dehydrogenase type 2 [Mycobacterium sp. KMS]MENARALPGSPEFAVLLAQIAAGARDRDRDDENPFDQVAALKRAGFGALR
LPESLGGAGLTVPQLFSTIIDVAAADPIVAHIFRAHFWFVEERLRTADDP
ASRRWLDRVLDGKIVGNAFSEKGGLAVGSLVFDTRLLPDGQGGYRLTGEK
YYSTGTLFSDYLTVTATTDHDSVATVVVPADREGVGIVDDWDGFGQRRTG
TGTTTFTDVAVAADEVLTDAPYDAEPQPTVQFAFLQLFIHAVVAGILENV
VEDGVALLESRERNFSHAVAERPVDDPLLQRQLGELASTAYVARAAVLDA
AAIIGAATDSAVDGVPDATLAQDAQLAVAKVKVHLDRVAPDAATRLLELG
GASAASRTRNLDRHWRNIRTITLHNPVAYKARVVGENLLHGTPVPANAYF
119870034YP_939986.1 oligopeptide/dipeptide ABC transporter ATPase [Mycobacterium sp. KMS]MSLLEVSGLTVTFATDTERVAAVRGLDYRLDAGEVVALVGESGAGKSAGA
MAVAGLLPEHAEVAGSVRLDGTELLGLSDAEMSKIRGRRIGTVFQDPMSA
LTPVYTVGDQIAEALRVHNRDLDRRAARTRAVELLELVGIAQPERRARAF
PHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILEVLRTAR
DVTGAGVLIITHDLGVVAEFADRALVMYAGRAVEIASVSELYTERRMPYT
VGLLGSVPRLDARQGERLVPIPGAPPSLAALPPGCPFAPRCPLAIDECRA
AEPELIEVAPGHLAACIRTEHVAGRSAAEVYGVSTAAAASPPSADDPVVL
KVSDLVKTYTLTKGTVFRRRIGEVRAVDGISFELQQGRTLGIVGESGSGK
STTLHQILELEPPQGGSIEVLGEDVAALDTRARRALRGDLQVVFQDPVAS
LDPRLPVFEVLAEPLQANNFDKSRIDERVAELLGIVGLRREDASRYPAEF
SGGQKQRIGIARALATQPKILALDEPVSALDVSIQAGIINLLLDLQERFG
LSYLFVSHDLSVVRHLAHRVAVMHKGAIVEQGDGDRVFTAPQHDYTRRLL
AAVPQPSVPQR
119870032YP_939984.1 binding-protein-dependent transport systems inner membrane component [MTRFLARRLLNYVVLLALASFLTFTLTSLTFEPLDSLLQRNPRPPQSTID
AKAAELNLDKPIPVRYAQWLGDAVRGDFGTTITGQPVSDELGRRIGVSLR
LLVIGSVLGTVIGVVVGAWGAIRQYRLSDRVITLLSLLVLSAPTFVIANL
LILGALNANSWLGVQLFEYTGETSPDAVGGPFDQFVDRLQHLILPTVTLA
LAAIAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRQALFKHGLRTALIPM
ATLFAYGVSGLVTGAVFVEKIFGWHGMGEWVVQGIATQDTNIIAAITVFS
GAMILLAGLLSDVIYAALDPRVRVQ
119870030YP_939982.1 two component transcriptional regulator [Mycobacterium sp. KMS]MTVRIMETMSPNQTDTDRSVMRRADGNPVRVLVVDDEPVLAELVSMALRY
EGWDIATAGDGATAIALARENPPDVVVLDVMLPDMSGLDVLAKLREQIPG
LPLLLLTAKDSVEDRIAGLTAGGDDYVTKPFSLEEVVLRLRALLRRTGVS
ESGGAKIVVGDLVLDEDSHEVTRGGDPITLTATEFELLRFMMRNSKRVLS
KAQILDRVWSYDFGGRSNIVELYVSYLRKKIDSGREPMIHTLRGAGYVLK
PAAR
119870028YP_939980.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MGRVTLTLDAEQTQNRPNDRPRARFSVWSPRIGLGVLLAGTAVLYLWNLS
ASGWANAFYSAAAQAGSQNWTAMLFGSSDAANAITVDKTPAALWVMDLSV
RVFGLNSWSILAPQALMGVAAVAVLYAAVRRVSGPGAALLAGAVLAVTPV
AALMFRFNNPDALLVLLLVVAGYCVTRACEPDARRWWLIAAGVAVGFGFL
AKMLQAFLVLPGFVAAYLLAGSRPVGRRILDLAGAAAAMVAAAGWYLLLA
ELWPADSRPYIGGSQHNSIVELALGYNGFGRLTGDEPGGLGNLNHDVGAG
RLFGFGMGLDIAWLLPAALICLGAALLLTRRTPRTDTTRAALLSWGGWLV
VTAVVFSFANGIVHSYYTVALAPAIAAVIGIGSHLLWRNRSRPWCAVSMA
GAVLVTAVLAAVLLSRNADWMPWLRAAVAVGGVGAAVLLIVAGRLPDGVV
RAAAGLAVVVCLASPAAYSVATAAAPHTGAIPSVGPARGGFGGPPGLLSS
PEPGEQLTALLARDAHAYRWTAAVVGSNNAAGYQLASGAPVMALGGFNGT
DPAPTLEQFQRHVADGDVHYFIGSRSPLGFGRGAEQSGSRAAADIADWVQ
ARYPGRTVDGVVVYDLTRAPA
119870026YP_939978.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MTVTTEAPPAAAPATSGGRARWERLALLTLLAATAVLYLWGLGSSGWANE
YYAAAVQAGTQNWTAWLFGSLDPGNSITVDKPPASLWLMVLSARLFGFSA
FAMLLPQALMGVATVAVLFAAVRRVSGAGAGMVAGAVMATMPVAALMFRF
NNPDALLVLLLVVAAYCMVRAIETASTRWMVLVGCALGFAFLTKMLQAFL
VMPGLALAFLVAAPVALWRRIGTLAVGAVSMVVSAGWFIALVEVWPASSR
PYIGGSTDNSLLQLALGYNGIQRIAGGGGPGGGPGGGPGDGPGRGANLFF
GGEPGIGRLFGHSMGVEASWLLPAALIGLAAGIWFTRRAVRTDAVRASLL
LWGGWLLVTGVVFSFMDGTIHPYYTVALSPAVAALVGIAVVECWRGRRYL
QPRLALAAMMAATGVWAFVLLVRTPDWLPWLRWVVLALAILVAAILVVGA
HRLKRAATAVVVAAALAGLAAPTAFAVYNVAHPASGPGTMSGPARGDAFG
GMPPGGPRGDRDDAAVAELVRGVDSRWAAASVGSMGSAGLQLDSGASIMA
IGGFTGSDASPTLAQFQQYVADGDVRYFIGSDRGGPPGFGRDGTAAEITA
WVQENFTPVQVGGATVYDLQSG
119870024YP_939976.1 hypothetical protein Mkms_3994 [Mycobacterium sp. KMS]MFDTVFAGLEESALLAAIEQAAREEAQAGARRLAAIAQLVHLTVTCDEEC
DGWVYDSWAAAASEVGAVLNIGHKRASGQMRIAVALRDRLPKVAALYLQG
RLSARLISEISWRTRLVDGEQVLGLVDAALAEAALRWGPLSEARLARALD
AVIHRYDRDAVIRAKDTVKTRDFHIGSGDDPDELVLVWGQLLGCDAAALS
ARIAALLKGICDNDPRSVGERRSCAVGAIVQGHDHLPCRCGSPACAAAAP
EKSNVVISVIADPAAVEAAQMLIAAEDEHHAEQDEPEPVPCQKDSGVALL
PGVKLLPIVALAEAIRGGAAIKPLWLPGPDPEPHYRPSAKLAAFVRARDL
FCRFPGCDVPAERCDIDHVVPWPYGPTHASNLNCKCRTHHLGKTFWDGWR
DEQSPDGTVTWTTPTGKRHTTVPGSRLFFPEWDNTTAPLPPLEQPPPDPG
RTAKMPKRRRTRAADNAARVKAEREHNAAARAMADHAANADPPPPAPHPD
YGDDPPPF
119870022YP_939974.1 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinMTQTTTLLRIATAGSVDDGKSTLIGRLLYDSKAVMEDQLAAVERTSKERG
NDYTDLALVTDGLRSEREQGITIDVAYRYFATAKRKFIIADTPGHLQYTR
NMVTGTSTAQLAIVLVDARHGLLEQSRRHAFLASLLGVQHIVLAVNKMDL
IDWNQEKFNDIRDEFHAFAARLDIHDVTTIPMSALLGDNVVTKSDKAPWY
DGPALLSHLEEVYIAGDRNLTDVRFPVQYVIRPQTRDHADHRSYAGTVAS
GVMRVGDEIVVLPSGKTSIITAIDSPTGPVGEAFPPMAVSVSLADDIDIS
RGDVIARVHNQPHVSNEFDATVCWMADASALEPGREYLIKHTTRVTRARV
ASLDYRLDVNTLHRDKSATALKLNELGRVTLRTQQPLLLDEYSRNAATGS
FILIDPDTNGTVAAGMVRDTTPVAARTATPNTVRHQSLVSAKDRLSRGRT
VWFTGLSGSGKSSVAVRVEQKLLERGCPAYVLDGDNLRHGLNADLGFSMA
DRAENLRRLAHIATLMADSGLTVLVPAISPLAEHRELARAVHVDQGYDFF
EVFCDTPLEDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTP
DRDVDDLAQLVIDMLDGSR
119870020YP_939972.1 isochorismatase hydrolase [Mycobacterium sp. KMS]MANPTLRVLADLPQQPVNLSQSTLVLIDCQNTYTRGVMELEGVQAALEEA
ASLLERARSAGIPVIHIQHSDGPDSLYDIEGETGAIVPIVAPREGEPVVV
KQYPNSFVQTDLDDRLKAVGASNLVLAGFMTHMCVNSTARGAFNLGYAPT
VVASATATRALPGLGSDDTVPAAAMQAASLAGMADLFAVVVPSSQDIPD
119870018YP_939970.1 hypothetical protein Mkms_3988 [Mycobacterium sp. KMS]MAVDSERSDGPPRRRRALNLALRGRRDPASGAGQRRRVSGGLSERHTRKV
LDLTVRLAEVMLSSGSGTADVVATAQDVAQAYQLTDCVVDVFVTTIFVSA
LPTADSPPVTIVRAVHARSTDYSRLAELDLLVRRITSGGVSVDEAHEAMD
ELTERPHPYPRWVATAGWAGFALGIAMLLGGSWLTWILAAVSSALIDRVG
RVLNRWGTPFFFQQAAGAFIATMIAVAAYLYAGVGPTALVATGIVMLLAG
LTLVGSVQDALTGYMVTAVARLGDVLFLTAGIVVGILAGLQVAALAGIQI
ELHVDATESFVMPTRPVPILLAVLGAALAGACLTVASYARLRSVLTAGVA
AGLAEAVLIGLGAAGVGGVVATGTAAVGVGLLATLISIRRQAPALVTATA
GITPMLPGLAVFRAVFFFAVDRNIPGGIAQALGAAAIALAIGAGVVMGEL
LGSPLRYRAGRIGDFLRVEGPPGLRRAIGNVVALRPSAGQQQARTPHRRS
WSVALEPKVKNSAADDDEASAGPSDGENAER
119870016YP_939968.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSVTFNHTIVAAKDRQQSADFFTELFGLPAAREFGPFLAVELEHGVSLDY
AQVSSGEDVRPQHYAFLVSEDEFDAIYGRIQQRNLQHWADPHGRQPGEIN
HHDGGRGVYFQDPAGHYLEIITRPYGSGAQTFS
119870014YP_939966.1 hypothetical protein Mkms_3984 [Mycobacterium sp. KMS]MTTIAPPPPPPAPVGPPPELSPGGRTALRGVLIAAATILVVAAVAALGVA
AWGLSTVRVLSDSHALPSAMRSLVIDTADIPVAVRITSDPRAEEGRANLR
LVNTASSGEHRLAMTTTGPETRIVLEGRPSRTFGWARGGEITVTLPPEQA
RRLSVRTQQETGVVLAQADIDQLTARTTHGAVVLSGSARRVEVQTADGAV
TARDPISVRERFSATTSEGDIAVDFRDAAPRTVEAISRDGDIVLGLPDRG
PYLVRAQSGDSTRVRVPETSDPADATSEITARTDNGSVVIEESDDGWRR
119870012YP_939964.1 integral membrane sensor signal transduction histidine kinase [MycobacMVAVTASPPPASVAVNDTTSPPRTVGIVPTASMVIGAAIGVVWFWIPLGL
LVLGTSSIPSVIGFILAAVVFIYLVRGIDWVERVRSEAVFGMRIGRPFRR
MTEYTGFQGWLHQLWLDVSSARFWKTFAHHYLRMIYDILATALALALLAF
GFLAPAAALAIDHSDDAAGLAFLPPALAWPLAVVAVAASVAILIFAPALD
AIIDRWLLTPSPTATLKYQVSALSDARAGAVSSAQTERHRIERDLHDSVQ
PRLVSLAMAIGLAQTKLDSDLPAAKQLIAEAHDEAKNALVELRNVVRGIA
PTILADRGLDAALSAVVQRADNSGVPTTLNLHLPRRLPEETESVAYFVVA
EALTNVAKHAGASQAVVTVRYDEPSNSLYVSVFDDGRGGAAIADDDNATG
LRGLDERVRAARGTFTVSSPTTGPTIVTAVLPCAS
119870010YP_939962.1 hypothetical protein Mkms_3980 [Mycobacterium sp. KMS]MAADHLPPIVSRSEWEHARAELLVREKELMRLKDKVSAARRRLPMVEVVE
PYVFDTESGPVGLIDLFDGRRQLIVQHFMFGRDWEQGCEGCSMMADHLGP
LSHLHAKDTSLVLVSRAPLGKLLAFRDRMGWDLPWVSSGASTFNEDFHVT
VDGEERHGISVFLRDGDRVFHTWSTYNRGEEPFMVVFDLLDLTPYGRQET
WEDSPAGWPQRPPYEWIRLHDAY
119870008YP_939960.1 oxidoreductase domain-containing protein [Mycobacterium sp. KMS]MGRCRVAFVGAGGVAVRHARHLAELPDVTIASVTDPAGPAADAFARATGA
AVVPDLPALLADPPDAVYVCVPPHAHGPIEESLVEAGVALFVEKPLGTDP
GTARRIAGLIGERGVTSAVGHHWRYSAAVGLVRDMLGDSVVRLAVASWLD
RVPPVAWWCRRDLSGGQIVEQAVHVLDMLRYLVGEVAEVSAYANAAPPSA
PDADIDGATAATLRFASGAVGTVAAACCLTWKHLAGIDIHADGLSVAVRE
DAITARTADGPLQRDLDPDDAKRAADRAFIDAVMDRGAGRDGILVDYADA
LRTHELACAIAESAHLARPVAVHV
119870006YP_939958.1 hypothetical protein Mkms_3976 [Mycobacterium sp. KMS]MKFKKLVVGTAMAGAFGFAAVGFGAGQAQADEFRWWDPVPSPGQISQLPF
VPPPGQIAKLPFVPPPGQWDKPAHWFK
119870004YP_939956.1 stage II sporulation E family protein [Mycobacterium sp. KMS]MDPDQGALGDHRVRSRKPAVVFVVGCLFAVLVVGWLSLVTQPTALASTAW
WPVAGIAVGLGIRFPRRQVWAPAAAVAAITLPLLLWAGRPAALATALAFA
VALEMVIATLILRGRHDRLPSLSEPRDLGRLLVAVASAAIVYDVVGAGAT
YLLADSTEAWIRFVTSAPKHAAGMLLLVPLFMHLPRRPRPAGPVETVAQV
VTTLGLVTFVFAFNPGMPLSFLPFMPLVWVAIRLTTRELILLMLAIAVIA
SAGSAYGTGPFAFNLLAPEVGNLVLQVFELSMVVVFLSLSLAVGHERTTA
RRLNESEELFRRIFETSVAGMLIATRAATGWKVLRANDSAVAIIPGLADA
SAELTDLLGEEATAALSAEADALTEGNARLTLTTGTERILNVSISPISVD
GDSRTLALQFYDITEAMRARRLEQEELERAAEVQRALLPGTLPPTPGWTS
GAASVPARQVGGDFYDIRVQVPHVVLSLGDVMGKGMGAGMLAAATRAALR
ATDPELSPSAAVSHMAGVVDHDLQRTSAFITLTYVLVDLVTGDFRVADAG
HGLHFVVRTGSGLVERTASSDMPVGLDSGWGEKRGALQPGDAILLVSDGV
MDLWGGSVEELSDAVAQCARQHGTSPQALVDALCARANGDLDRDDVTAVV
LRREPVDVAAR
119870002YP_939954.1 arginyl-tRNA synthetase [Mycobacterium sp. KMS]MTPADLADLLRTTATAVLTERDLDTAALPATVTVERPRNPEHGDYATNLA
LQVGKKVGVNPRELAGWLAEALTATAGIASAEVAGPGFVNLRIEAAAQNV
IVGDIITSAERYGHSAALAERNINLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLATQGAAVVREYYFNDHGAQIDRFVSSLIAAAKGEPTPEDGYAGSYI
GDIAAQVLAKDPGALELPDDEMRETFRAIGVDLMFDHIKISLHDFGTDFD
VFTHEDSMHTSGRVEEAIARLRENGAIYEKDGATWLRTTDFGDDKDRVVI
KSDGAPAYIAGDLAYFLDKRQRGFDLCIYMLGADHHGYIARLKAAAAALG
DDPDTVEVMIGQMVNLVRDGQPVRMSKRAGTVITLDDLVEAIGVDAARYS
LIRSSVDTPIDIDLALWSSASNENPVYYVQYAHARLSALARNAADLGVVA
DTAHLDLLTHDKEGTLIRNLGEFPRVLESAAALREPHRVCRYLEDLAGDY
HRFYDSCRVLPQGDEAPGSLHQARLALCQATRQVIANGLAILGVSAPERM
119870000YP_939952.1 homoserine dehydrogenase [Mycobacterium sp. KMS]MNSDKSVGDTPVGVAVLGLGNVGSEVVHIIEQSATDLAARVGAPLVLRGV
GVRRVAGDRGVPVDMLTDNIEELVSREDVDIVVEVMGPVEPARKAILSAL
EQGKSVVTANKALMAQSTGELAQAAEAARVDLYFEAAVAGAIPVIRPLTQ
SLAGDTVLRVAGIVNGTTNYILSAMNDTGADYDSALADASALGYAEADPT
ADVEGFDAAAKAAILASIAFHTRVTADDVYREGITKVTAEDFESARSLGC
TIKLLAICERLTTDDGQQRVSARVYPALVPLDHPLASVNGAFNAVVVEAE
AAGRLMFYGQGAGGAPTASAVMGDLVMAARNRVQGGRGPRESKYAKLPVS
PIGFIPTRYYVNMNVADRPGVLSTVAAEFARHEVSIAEVRQEGVVDEGGQ
PCGARIVVVTHRATDAALSETVSALAELDVVQSVNSVLRMEGTSE
119869998YP_939950.1 homoserine kinase [Mycobacterium sp. KMS]MTQTLPAGLTATATVAASSANLGPGFDSLGLALSLYDEIVVETVDSGLTV
TVEGEGAGQVALDSSHLVVRAIEAGLRATGCIAPGLVVRCRNDIPHSRGL
GSSAAAVVGGLAAANGLVSQTDWTPLTVEQLIQLSSAFEGHPDNAAAAVL
GGAVVTWTDGAGAQARYAAAPLRVHPDIHLFPAIPQQRSSTAETRVLLPD
TVSHTDARFNLSRAALLVVALTERPDLLMAATEDVLHQPQRAAAMPASAE
FLRVLRGCGVAAVLSGAGPAVIALSTEPVLPAEAVEFGIANGFTIAEMAV
GDGVRWSTGVAAGR
119869996YP_939948.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTPAQSVRDRLMDAAESCLRAKGIRATTVSEVAEVAGVSRGWLYRHFPDK
VSLLGAAIVRLNEAYWSEAHAVLEPIDGLAEQIVAGIRHGRLAYDDPGAL
LMKLRLEEPEEFAACAGAGVQGLVPDLAAFWSRYLLAARERGEIHPATDI
AEASEWVARSVISLATVPGNTLDPADPAALLTHIRRYVMPGLTADPAV
119869994YP_939946.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MAETPSVAMLMFVAHRAAETRIHEALRAAGFDDLTLAQSRFGQRLRPDGI
RLTDLAEEARVTKQTAGALVDELERAGYVVRRPDPTDARARLVMLSDRGQ
KLCAAAAAELAEVEREWRAHLGAETFDRLRDAMVSLREITDPYR
119869992YP_939944.1 50S ribosomal protein L31 [Mycobacterium sp. KMS]MKTGIHPDYVETTVQCGCGNTFTTRSTKKTGNIVVEVCSQCHPFYTGKQK
ILDSGGRVARFEKRYGKRGANKAANTDSADK
119869990YP_939942.1 HemK family modification methylase [Mycobacterium sp. KMS]MTRAPASSLRQVIDEAAAVLAAAGVASARVDAELLAAHAAGTDRGRLMFA
DLPPDFGIRFADLVSARAKRIPLQHLTGTAAFGPVQVSVGPGVFIPRPET
EALFEWVVRQALPDEPLIVDLCTGSGALALAIATALPKARVIAVENSADA
LGYARRNLAGSGVELLDADVTAADLRPDLDGAVDLVVANPPYIPEGAALD
PEVAEHDPPQALFGGPDGMVVIDAIVGLAQRWLRSGGRVAVEHDDTTSEL
TVAAFRRTGAVFEDAALGDAVFDDVTTHTDLTGRPRFVTARRRPATTATA
EAR
119869988YP_939940.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MQYRFAVMVEYLALSDRGAGVPLRELVLVGLTAAIITYFATGWVRVLATR
LGAVAYPRERDVHVEPTPRMGGLAMYVGVAAAVLLASQLPALTRGFVYST
GMPAVVVAGGLIMAIGLIDDRWGLDALTKFAGQLTAASVMVTMGVAWSVL
YIPIGGVGTIVLDQVASILLTLALTVAIVNAMNFVDGLDGLAAGLGLITA
LAICLFSVGLLRDHGGDVLFYPPAVISVVLAGACLGFLPHNFHKARIFMG
DSGSMLIGLMLAAASTTAAGPISQTAYGARDVFALLSPFLLVVAVMFVPA
LDMLLAIIRRTRAGLSPFSPDKMHLHHRLLEIGHSHRRVVLLIYMWVGIV
ALGAASTIFFDPRHTGMVMLGATAVAVVVTLVPLVRRREVAAESVYDEK
119869986YP_939938.1 F0F1 ATP synthase subunit A [Mycobacterium sp. KMS]MTQTFLAAESGIQVGHHTEANWFGLTVNTDTILSTAIAAAIVLGLAFFLR
AKVTSTGVPNGVQLFWEALTVQMRNQIESAIGMRVAGFVLPLAVTLFAFI
LIANWLSVLPVQYSDETGIHELLKPAASDINFVLALALFVFIAYHAAGFW
RRGLLGHPKKLLKGHVAILAPINLVEELAKPISLSLRLFGNIFAGGILVA
LIALFPPWIMWAPNAIWKSFDLFVGAIQAFIFALLTILYFSQSMELDDHH
D
119869984YP_939936.1 F0F1 ATP synthase subunit B [Mycobacterium sp. KMS]MGDLSTTILAAEEGGGGNFLVPNGTFFFVLLIFLIVLGVIAKWVVPPISK
VLQEREAMVTKTVEDNRKAADLFAAAQGDSQQVMAKARREASGIRDEARG
EGRKILEDMRSRASAESAATLQKTNEELSRQGQQTAAELQSSIETLSATL
ASRVLGVDISSAAATSQGR
119869982YP_939934.1 F0F1 ATP synthase subunit alpha [Mycobacterium sp. KMS]MAELTISAADIQGAIEDYVANFATDTEREEIGTVIDAGDGIAHVEGLPSV
MTQELLEFPGGVLGVALNLDEHSIGAVILGDFEKIEEGQQVKRTGEVLSV
PVGDGYLGRVVNPLGQPIDGRGEIETTDRRALELQAPSVVQRQGVSEPLQ
TGIKAIDSQTPIGRGQRQLIIGDRKTGKTAVCVDTILNQRQNWETGDPNQ
QVRCVYVAIGQKGTTIASVRRTLEEGGAMDYTTIVAAPASDSAGFKWLAP
YTGSAIAQHWMYDGKHVLIVFDDLTKHAEAYRAISLLLRRPPGREAFPGD
VFYLHSRLLERCAKLSDELGGGSMTGLPLIETKANDISAYIPTNVISITD
GQCFLETDLFNQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQY
RELESFAAFASDLDATSKAQLDRGARLVELLKQPQNSPMPVEEQVVAIFL
GTRGHLDTVPVEDVQRFEQELLEHVRSSKEEIFTEIRESKKLSDELEKTL
TDVVNEFKKGFETTSGESVVPDENVEAMSEDDVEKESVKVRKPAPKKK
119869980YP_939932.1 F0F1 ATP synthase subunit beta [Mycobacterium sp. KMS]MTAATEQKEKTGTDNVGRVVRVTGPVVDVEFPRGSVPELFNALHAEISYK
DLAKTLTLEVAQHLGDSLVRCISMQPTDGLVRGVDVTDTGASISVPVGEG
VKGHVFNALGACLDDPGYGKDFEKWSIHRKPPAFDELEPRTEMLETGLKV
VDLLTPYVRGGKIALFGGAGVGKTVLIQEMINRIARNFGGTSVFAGVGER
TREGNDLWVELADANVLKDTALVFGQMDEPPGTRMRVALSALTMAEYFRD
EKQQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGELQER
ITSTRGRSITSMQAVYVPADDYTDPAPATTFAHLDATTELSRSVFSKGIF
PAVDPLASSSTILDPSVVGDEHYRVAQEVIRILQRYKDLQDIIAILGIDE
LAEEDKQLVQRARRIERFLSQNMMAAEQFTGQPGSTVPLKETIEAFDKLS
KGDFDHLPEQAFFLIGGLEDLQRKAESLGAKMEDTSGDGAPAQSDSKSDS
KGDDADKDA
119869978YP_939930.1 hypothetical protein Mkms_3948 [Mycobacterium sp. KMS]MSAPMWSMVALIGVLLLVVIALTYRLWKLRQVGGTAAILRDVPAVGGHGW
RHGVVRYRGGEASFYRLSSLRWWPDRRLSRRGLEIVSRRSPRGDEFDIMT
HEIVVLELRDTSPERRRGYEIALDRGALTAFLSWLESRPSPRARRRSY
119869976YP_939928.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Mycobacterium sp. KMSERFVVTGGNRLSGEVAVGGAKNSVLKLMAASLLAEGTSTITNCPDILD
VPLMAEVLRGLGATVELDGDVVRITSPDEPKYDADFAAVRQFRASVCVLG
PLVGRCKRARVALPGGDAIGSRPLDMHQAGLRQLGARCNIEHGCVVAEAD
ELHGAEIQLEFPSVGATENILMAAVLAKGVTTIHNAAREPDVVDLCAMLN
QMGAQVVGAGSSTLTITGVDRLYPTEHRVIGDRIVAATWGIAAAMTQGDI
SVTGVDPQHLQLVLHKLHDAGATVTQDDNGFRVVQYERPKAVNVATLPFP
GFPTDLQPMAIGLASIADGTSMITENVFEARFRFVEEMIRLGADARTDGH
HAVVRGIPQLSSAPVWSSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYP
LFVENLKSLGAEIERVV
119869974YP_939926.1 DNA-methyltransferase [Mycobacterium sp. KMS]MAHDHVGFPPVVSVAACKSDSMYDDFDRCYRAVQSKDARFDGWFVTAVLT
TRIYCRPSCPVRPPFARNVRFYPTAAAAQAAGFRACKRCRPDASPGSPEW
NVRGDVAARAMRLIADGTVDRDGVTGLAGRLGYTTRQLQRILQAEVGANP
LALARAQRAQTARVLIETTDLPFSDVAFAAGFSSIRQFNDTVRATSACTP
TAMRERARRRFGAATAGAGSLSLRLPVRRPFAYEGVFGHLAASAVPGVEE
FRDGAFRRTLRLSRGHGIVGLTPRDGHVDCVLHLEDLRDLSSAIARCRRL
LDLDADPEAVVDVLGADPDLTALVTKAPGQRIPRTVDEAELAVRVVLGQQ
VSLKAARTHAARLVTHYGRPISDPHGGLTHVFPTVEELADIAAPHLAVPR
SRQATVRSLIAALASGDVRLDPGCDWNEARAQLTVLPGIGTWTAEVIAMR
GLGDPDAFPVTDLGVLTAARHLGLAEDARALAAHGARWRPWRAYATQHLW
TALDHPVNDWPPKEIRQ
119869972YP_939924.1 putative adenylate/guanylate cyclase [Mycobacterium sp. KMS]MDATTTAKKSVPQRLGLLLEKVTRQSGRLPDTPHYGSWLLGKPEENQQRR
RIRIQIILTFLILVTNILGIGVSLLLNAVAIPVPSVFSDAPAWLTWGVVP
AYMLVALLFGTAWITSHIVRSLRWAIEERTPTRADQYNVFRAPWQVARML
LLFWGVGTALLTLLYGLQDSAFIPRFLFAVGFPGIVVATACYLVTEFALR
PIAAQALEAGRPPRRLAQGVMGRTMTVWLLSSGVPVLGILLLAVFSLSMQ
NLSATQFGIAVMIIAVVALLFGLILMWLLSWLIATPVRVVRAALKNVERG
DFDCQLVVFDGTELGELQRGFNKMVEGLRERERVRDLFGRHVGREVALAA
EKEQIELGGEERHAAVIFVDIIGSTQMVTSRPASEIVELLNRFFAVIVDE
VDRHHGLVNKFEGDAVLAVFGAPVALDNAAAEALAAARAIAERLTSEVPD
CEAGIGVAAGQVVAGNVGAKERFEYTVIGEPVNEAARLCELAKSVPNRLV
ASSDTVKAATDAERAHWTLGDTVTLRGHDEPTTLALLADA
119869970YP_939922.1 hypothetical protein Mkms_3940 [Mycobacterium sp. KMS]MPRRRPPPRRSRPLPAVFEQRRVETGPDGYEYEVRPVVGSRATKTYRCPG
CDHEIRPGTAHLVVWPADSGESAVEDRRHWHTPCWTHRATRGPTRRWS
119869968YP_939920.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MTTSVIVAGARTPVGKLMGSLKDFSGSDLGGIAIKAALEKAGVAPSAVDY
VIMGQVLTAGAGQMPARQAAVAAGIPWDVPALTINKMCLSGIDAIALADQ
LIRAGEFDVVVAGGQESMTQAPHLLVNSRSGYKYGDVTALDHMAYDGLHD
VFTDQPMGALTEQRNDVDQFTRAQQDEFAATSHQKAAAAWKDGVYADEVV
PVSIPQRKGDPIEFSEDEGIRANTTAESLAGLKPAFRKDGTITAGSASQI
SDGACAVVVMNKAKAEELGLTWLAEIGAHGVVAGPDSTLQSQPANAIKKA
IAREGISTDQLDVIEINEAFSAVALASTKELGVDPERVNVNGGAIAIGHP
IGMSGARITLHAALELARRGSGYAVAALCGAGGQGDALILRRP
119869966YP_939918.1 thioredoxin domain-containing protein [Mycobacterium sp. KMS]MTRPRPSIGPALAGAVDLSALKQRPAAEAAGPAGAGGPGGVEITEANLEA
EVLIRSSQVPVVVLLWSPRSDSSVALGQTLAELANADAGKWSLATVNVDT
TPRVAQMFGVQAVPTVVALAGGQPISSFQGPQPADQLRRWIDSLLEATAG
KLAGSGDPDQPEQVDPEVAQARAFLDNGDFDAALSAYQAILDAQPNHAEA
KGAVRQIVFLQRATTQRPDAVTVADAAPDDVDAAFAAADVEILQQQVEAA
FERLIALVKRTAGDDRTRVRTRLIELFELFDPADPEVIAGRRKLANALY
119869964YP_939916.1 alpha amylase [Mycobacterium sp. KMS]MAGRIGIDDVAPVVSGGRYPAKAVVGEVVPVSATVWREGHEAVSATLVVR
YHGTSYPELADAPVGRVSTTEAVPIDEVVSPSPRKKPQALPMSLGRTPDV
FHGHFVPDAVGLWTYRVDGWGDPIASWRHNVIAKLDAGQSESELDNDLLV
GARLLERAATGVPRQDRYPLAQAVERLREPGDPFYRAGAALAADVTALLD
QYPLRELVTRGEQYGVWVDRPLARFGSWYEFFPRSTGGWDSQGHPVHGTF
ATATKALPRVARMGFDVVYLPPIHPIGKVHRKGPNNSVTAGPNDVGSPWA
IGSDEGGHDAVHPELGTIEDFDDFVAAARDEGLEVALDLALQCAPDHPWA
REHPEWFTVLPDGTIAYAENPPKKYQDIYPLNFDNDPTGLYMEVLRVVRF
WISHGVKVFRVDNPHTKPPNFWAWLIGEIKNEDPDVLFLAEAFTRPARLY
GLAKLGYTQSYTYFTWRTSKHELTEFGRQIAEHADYARPNLFVNTPDILH
ESLQHGGPGMFAIRAVLASTMSSVWGVYSGYELFEHRPVREGSEEYLNSE
KYELRPRDFDAALADGESLEPFITRLNEIRRVHPALHELRTITFHYPDND
AVLAYSKFDPATGDQVLVVVTLNPFGPEEATVWLDMPALGMEPYDRFWVR
DEITGEEYQWGQSNYVRIEPAKAVAHVLNMPQVPADQRLNLLRRE
119869962YP_939914.1 hydrolase [Mycobacterium sp. KMS]MSLIREIAGGPYALAAGPDGAMWVTLVHDGAIARVGADGAVDRFPVADGS
RPSLISAGPDGALWFTRNGDDRIGRLTTAGELTEFPLSEGSAPFGICAGA
DGALWFTEMGSGGIGRITVDGQTSGWASVGGTPSMITRGPDDAVWFTLNQ
GNAIGRLHPRDGVTMRELPTRGAGPVGITATHDDAIWFTEILADKLGRIP
LDGALQEIDLPGKPHAVVADPSGGVWVSLWGADRLARVSADGDIETFDLP
PGSEPHGLAFGPDGGLWVALESGFVLRMPD
119869960YP_939912.1 protein LpqM [Mycobacterium sp. KMS]MSRRRVFGVQVTAAAVLVVAGCSTTLQGRPVSVFDDPFRVAGMVATDGPT
GLRPDAEAPGRDVVGSDGGDIDALAAAAVSDVEEFWTQAYPETFAGEQFT
PIETLMSWNSSEFDGMFCGIDTIDLVNAGFCLEENTIGWDRGELLPALRA
ANGDMGVAMVLAHEYGHTIVRQAELNDPDTPVLVPEQQADCFAGAYMRWV
AEGSSPRFTLSTADGLNGVLSAVIAFRDPLFSEGDLFAALDEHGSAFERV
SAFQFGFTDGPSSCAAIDLREIGQRRGDLPVLLAEDQTGELPVTAESVRS
IVDALTITFEPARPPQLDFDADAAQTCPDARPSPPVSYCPATGRLVVDLA
ELQIMGAPQEEVDTNGLANGDNTAYSVLMSRYLQAVQHEQGLVLDTAEAA
LRTACLTGVATSLLSRDVTTPDGSTIALTAGDLDEAVSGILTNGLAASDV
NGDSVPSGFSRIDAFRVGVLGDEQRCLTRFP
119869958YP_939910.1 nicotinate phosphoribosyltransferase [Mycobacterium sp. KMS]MAAVTAALLTDKYELTMLAAALRDGTAHRRATFEIFARRLPDGRRYGVVA
GTARLVEALREFTFDDTALAAVADFLDDETLGYLAGYRFGGDIDGYPEGE
LFFPGSPVLSVHGTFAECVVLETLALSIFNHDSAIAAAAARMATAADGRP
LIEMGSRRTHEQAAVAAARAAYLAGFAGSSNLEAQRRYGVPAMGTSAHAF
TLLHTTADGPDEVAAFRAQVEALGVDTTLLVDTYDITAGVANAVEAAGPR
LGAVRIDSGDLGVLARQVRAQLDGLGATGTRIVVSGDLDEFSIAALRAEP
VDFYGVGTSLVTGSGAPTAGMVYKLVEVDGLPVEKRSSHKESHGGRKQAA
RLAKPSGTIVEEVVHPFGSPPEATAGYDLRPLTVPLVRDGEPVGDVDLAA
ARERVVAGLHSLPWDGLKLSRGEPAIPTRMMAPVRGAGRP
119869956YP_939908.1 hypothetical protein Mkms_3926 [Mycobacterium sp. KMS]MRKWKRVQTADGARFRSALEPHEAALLQSLVSSVKGMLDERESSAPADEL
EEITGMRTGHNAPPQDATMKRLLPDFFRAATDHPAGSGTAESLNSALRSL
HEPEILAVKRDAAQRLLDTLPAGGGRFELTEDDAHAWAAAVNDVRLALGT
MLDIDAMGSDELPPDHPMAGHVDVYQWLTVLQEYLVLSLVGKPLR
119869954YP_939906.1 Mov34/MPN/PAD-1 family protein [Mycobacterium sp. KMS]MLVIRADLVDAMVAHARADHPDEACGVIAGPEGSDRPERHVAMLNAERSP
TFYRFDSMEQLKVWRSMDEADEVPVVIYHSHTGTEAYPSRTDIALASEPD
AHYVLVSTRDPDEHELRSYRIVDGVVSEEPVKIVDTY
119869952YP_939904.1 cysteine synthase [Mycobacterium sp. KMS]MARYDSVLEALGNTPLVGCPHLSPRWDDDENGPHVRLWAKLEDRNPTGSI
KDRPALRMIEQAERDGLLQPGSTILEPTSGNTGISLAMAALLKGYQMICV
MPENTSIERRQLLELYGARIIFSPAEGGSNTAVAHAKELAAANPDWVMLY
QYGNPANADAHYYGTGPELLADLPEITHFVAGLGTTGTLMGTGRFLREKV
PGVQIVAAEPRYGEGVYALRNIDEGFIPELYDPDVLTTRFSVGSFDAIKR
TRELVTKEGIFAGVSTGAILHAALGMAAKAIKAGERADIAFTVCDAGWKY
LSTGAYTGSLVDAEDALEGQLWA
119869950YP_939902.1 glutamate racemase [Mycobacterium sp. KMS]MTDAVDDRLLPVGIFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGP
LTIPQIRAHALAIGDDLVERGVKALVIACNTASSACLRDARERYAPVPVV
EVILPAVRRAVATTRNGRIGVIGTAATIASGAYQDAFAAARDIEVIGVAC
PRFVDFVERGVTSGRQVLGLAEGYLEPLQRADVDTLVLGCTHYPMLSGLI
QLAMGDQVTLVSSAEETAKDLLRVLTELDLLRPHPADPGATPATRVFEST
GDPEAFATLATRFLGPSLNGVRPVQRRIEA
119869948YP_939900.1 ribonuclease PH [Mycobacterium sp. KMS]MSRREDGRLDDELRPVRITRGFTSHPAGSVLVEFGETRVMCTASVTEGVP
RWRKGTGQGWLTAEYAMLPAATHDRSDRESVKGRVGGRTQEISRLIGRSL
RACIDLNALGENTIAIDCDVLQADGGTRTAAITGAYVALADAVTYLAAAE
KLSDPRPLSCAIAAVSVGVVDGRVRVDLPYSEDSRAEVDMNVVATDTGTL
VEIQGTGEGATFPRSTLDKLLDLALASCDQLFVVQREALDAPYPGALPEP
TSPPKKAFGS
119869946YP_939898.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MARHGVETSAADAAAVAARVRPNVLVAVLAAAGISVSLMQTLIIPLIPEL
PTLLRTGPANASWAITATLLTAAVATPLFGRLGDIYGPKPVLMTCAALLT
AGSVIAAVSTSLVPVIVGRGLQGFGMPIIPLGISVLRAAVPADRVGSAMG
IMSASLGVGGALGLPLSAVIAQNFNWHVLFWFAAGLGAAALICFAVLVPP
VGSRTSERVDLLGAVGLAGGLTTLLLAISKGQTWGWTSTTTVSLFAASPV
IFAVFAWWQLRAPAPIVDLRTTVRRPVLTTNLASVGVGFGLFALSLVAPQ
VLELPTQTGYGLGQSMLHAGLWMAPGGLAMMVSAPIAARIAAVTGPRLTL
VIGCAIISVSYLAGLQLLDSPVEVLILNVAVSVGVGFAFASLPALINAAV
PIAETAAANGINALARSLGTSVSSAVMGAVLAGMTTSFAGRVLPSLEGFH
TALIIAACAAGVAGLIALAIPKPAPAIAQVHSEPGPPVHDLEAVLTRLGR
HSALGTYADGTSTPFLGRRTYVLLTHLEEAGPASVEEIADALGVDAATVG
SEAFVMLRDGLVAPVAQDSPPAWSGRTPRFALTVGGRDRLRRQRSHKVAG
LRRAVDGWDHADVEALVGYVTRLSDDIDGARRGVRPVTGRSAP
119869944YP_939896.1 hypothetical protein Mkms_3914 [Mycobacterium sp. KMS]MSTTRRRRPELILLVVAAAGGCLALAWWQWTRWESTTGSFQNLGYALQWP
MFAGFCVYAYYKFVRYEEAPPEQNPRGALTEIPADLLPERGTTAAAPAPD
DDPALREYNAYLADLAEADNEGRTTP
119869942YP_939894.1 hypothetical protein Mkms_3912 [Mycobacterium sp. KMS]MTLLRLIARVLLGASLLFAGIGHLTFARTDFYAQVPPWLPLDVDLVVIAS
GVVEIALGVALIVLHRWRVPLGWITAAFFVLVFPGNISQCLTHTDAFGLD
SDRDRAVRLLFQPVLVVWALWSTGAWAAWRRRASAEEDPHVRA
119869940YP_939892.1 general substrate transporter [Mycobacterium sp. KMS]MESQTSAPAPAETAAIRKAVAGASIGNAVEWFDFAIYGFLATFIAAKFFP
AGNDTAALLNTFAIFAAAFFMRPLGGFVFGPLGDRIGRQRVLAVVILLMS
AATLGIGLLPTYASIGVAAPLLLLFLRCLQGFSAGGEYGGGAVYLAEYAR
DRNRGLTVTFIAWSGVVGFLLGSVTVTVLQALLPTAAMDSYGWRIPFLIA
APLGLVGLYIRLRLDDTPEFAALSETDRVASSPLREAATTAWRPILQVIG
LFIVFNVGYYVVFTFLPTYFIKTLEFGKTAAFVSMSLASLVALVLILPLA
ALSDRIGRRPLLIGGTVAFVILAYPLFLLLNSGSLAAAITAHCVLAAIES
IYVSTAVTAGVELFATRVRYSGFSIGYNVSVAAFGGTTPYVVTWLTATTE
NNLAPALYLIVAAVVSLATLLTLRESAGRPLAATVAADVRR
119869938YP_939890.1 cytochrome P450 [Mycobacterium sp. KMS]MTVSASPDVYFDPYFDPYDVELNADPYPMFKRLREEAPLYYNTQYDFYAV
SRYDDVCKALVDHETFSSARGAIIELIKANIDIPPGTVIFEDPPIHDVHR
KLLARMFTPRKINALEPKIREFCAQSLDPLVGAGRFDFITDFGAQMPMKV
ISSLLGIPEDDQEMIRDYGNAQLRTEAGKPMSAAEQGMVTGEVFEAYIDW
RKDNPSDDIMTELLNVEFADETGTVRRLRREELLVYLNVVAGAGNETTTR
LIGWAAKVLAEHPDQRRELVDNPALIPQAVEELLRFEPPAPHVARYVTRD
IEIHGQTVPEGSVMLMLIGAAVRDHRQFPPDGDVFDIHREPRQHLAFSVG
THYCLGSALARLEGRIALEEILKRFPEWDVDMANAALSPTSTVRGWDSMP
AVVR
119869936YP_939888.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MAATSATATVGTSPLRVASASFIGTTVEYYDFLIYGTAAALVFPRLFFPD
VSPATGLLLSFATFGVGFVARPLGGIVFGHYGDRVGRKRMLVYSLLIMGT
ATVLMGALPTYAQIGVAAPILLTLLRLAQGFAVGGEWGGATLMAVEHATP
DRKGLYGAFPQMGAPAGTATATLAFYAVSLLPDEQFLSWGWRIPFLASAV
LIVIGLVIRLSLAESPEFAAVQARAAVLRLPIAVAFRRHWRQILLVAGAY
LSQGVFAYICVAYLVSYATTVAGIDRAQALLGVCVAAVVAVVMYPVFGRV
SDAVGRKPVFLAGVIAMGMSVLPVFALINTGRPGLFLLALVLVFGLAMAP
AAGVTGSLFSLAFDADVRYSGVSLGYTLSAVVGSAFAPTIATALYAATES
SDSIAAYMIAVSVISAVSVSLMPGPWRQPRVR
119869934YP_939886.1 putative adenylate/guanylate cyclase [Mycobacterium sp. KMS]MRARYAAGLATAFLLTAAEVTAIVVTLGVERVAGAEALLTARNLFAVVGL
IAAGVLGTTVGGLAALAPAFRRLSDGRDSPESRRATTNITARLSAALLTP
WAVAAGVLIALNLRAGAEPLLVIITAAMFGATATVCTGFLFTQRTLRPLM
AVLTTEVDQAEVVPGVRGRLVLMWTVCTALPGAGIVTLVALQRLGLLVDD
PASIELPVLVLALVAVLLGLRTLIVVSRSISDPVHDVVEAMGEIERGGAG
RLVDVYDRSEIGHLQSGFNRMVIGLQERDRLRDLFGRHVGPEVVRRAEAA
TGAEGGVRYAAILFVDLVGSTRLAIGRDPQRVAELLNDFFQVVVAAVDHR
HGLINKFQGDAALAVFGVPLAIDRPADAALATARTLAAQLRSRPLDFGIG
VSAGPVFAGNIGAENRYEYTVIGDPVNEAARLADQAKASDERVLCSGAVC
ERADPQERSHWSAQGEVLLRGRVDPTPIFTPCENTR
119869932YP_939884.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MSISLLLEMSVSADPERTAVVSDGLRLSVEELSALADGGAGVIAKSGAAH
VAYVGTGGVLLPLLLFASARAAIPFTPLNYRLSREGLHELIARLPDALVI
ADPDYREVVAGAGKQLMDSEEFLAAARTAEPTAEFADPDSVAVVLFTSGT
TSRPKAVELTHNNLTSYVTGTVEFASADPEDAALICVPPYHIAGVGAAMS
NLYAGRKMVYLRHFDAREWIRLVSTEGVTTATVVPTMLDRIVSALSEEPV
ALPTLRNLAYGGSKVALPLVRRALELLPGVGFVNAYGLTETSSTIAVLGP
DDHRAALASDDAAVARRLGSVGQIVPGIEVQIRADDGTVLGPGETGELFV
RGDQVSGRYTDIGSVLDADGWFPTKDVASLDEDGYLFIGGRSDDTIIRGG
ENIAPAEIEDVLVEHPDVRDVAVVGPEDPQWGQIIVAVVVPAPGADPDAD
DLRAHVRKHLRGSRTPDRVVFRAELPTNATGKVLRRELIEEYAAAARDPE
KEPA
119869930YP_939882.1 methylmalonyl-CoA mutase [Mycobacterium sp. KMS]MPLSRPSRLRYWHSHFLQVRYPLMSDLVQTSSGLPLEPVYGPGDRSGEPP
APGTYPFTRGNFASGYRGKLWTFRQYSGFGTAEESNRRYRYLLDQGGTGL
SVALDLPTQCGYDSDDPEFGEEVGRVGVAVDTLADAEILFDGIPLDKIST
SFTINGTAAILLAFYVAAAEKSGVPREKLTGTIQNDILKEYASRGTWIWP
PEPSLRLIADTIEFCAAEVPRFNAISVAGAHFRDAGANAVQEMAFTLADG
VTYCDTVVERGRMSIDKFAPQISFFFYTHGDFFEEIAKYRAGRRRWATIV
RERYGSTSDKASMFRFGCVSGGASLYAPQAQNNVVRIAYEAMASVLGGVQ
SMFTAAWDEPFALPSEESATLALRTQQILAYETGVTRVADPLGGSYFVEA
LTDATEAKIIEIMHDLEAHGGMVRAIEDGYLQGLIADEAYKLHQEVESGE
RPVVGVNKFVTDEPPPDIDTYELDAEGRDLQLKRLSKVKADRDADAVAAA
LAALSRAAEGDDNLMHKLIDCAKAYCTVGEMVSALKAVWGEFQQPVVF
119869928YP_939880.1 luciferase family protein [Mycobacterium sp. KMS]MRLGVMIGAERGDMARKVTKLVSDIQWAESAGMDTAWMPQVPNDFDCLTM
VAVMAAHTSRIELGTAVVPLQAQHPIALARQALSVHAMAGGRLALGVGPS
HHWIVRDMLGLPYEKPAAYTRDYLEVLNAALAGPGDVDVENDSFTVHNPT
VLQADTPMPVLVAALGPVMLQLAGELTDGTVLWMADEKAIGDHIAPKITK
AAADAGRPAPRIVAGIPVCLCANSEIDAAKERANRILAEAETSPNYQRLL
DRGDARNVGDLCAAGDEDAILARFKQFADAGVTDLSVRLLPIGDTRDELI
ASKYRTREVIAELGKQVR
119869926YP_939878.1 ferredoxin [Mycobacterium sp. KMS]MTADPMPAVPDGGAGTEVTIVLDRKTLSVAQVPGETLLESARRAGMSPPF
SCEAGNCGTCIAKLTEGTATMRVNDALDDDEVADGYVLTCQAVPDTARVS
VTYDD
119869924YP_939876.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDVRLTAEQQQLRDAAAKLADDLGPGSVADLADSARLARLEKTVESTGWR
ALRSDGASGVEVAVVAEEFGRGLVDVPFLGPALSDDLGRLLGRAPSTPAG
APGDVDLTGSAAGVSEAPAELSELSPEDAQRWHALALATTSADILGAARG
AHALAVDYAKVREQYGKSIGSYQAIAHLLAEGLALIEGSVSIQRHAAWAV
DELPGAEAVRAGRYAKLYCARAARTVCETAIQVHGGIGNTWECLAHVYLR
RVLTSTELWPVRLEDIDLGFS
119869922YP_939874.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MYDMPDEIQVTADGPLRIITLNRPDALNAVNDSLHCGLAQLWPRLNEDLD
ARAAVITGAGRAFSAGGDFAYLDELGKDARLRAKTILHGREIVLGMTRTR
IPVVAAVNGPAVGLGCSLVALSDIVYMAPTAYFADPHVQVGLVAADGGPL
TWPLHISLLLAKEFAMTGTRIPAQRAAELGLANHIVEDPLAEAIACAEKM
MQMPRQALESTKRLLNIHLERAVLASLDYANTAEEQSFQTEDFRTIVGKL
NAKNN
119869920YP_939872.1 hypothetical protein Mkms_3889 [Mycobacterium sp. KMS]MSGKACPAMESTTPNTTPELTYASISVAHRALIDALPPGSEVPSRMFIRR
AAARGDIRSINIGRRITQYHLDDVRALVVIPGVTRRER
119869918YP_939870.1 hypothetical protein Mkms_3887 [Mycobacterium sp. KMS]MTGRWRCGRCGHDIAHHGLYRDPVCVGNIADDDLPDCECQAFVDGSQAPA
PQEGAVRASAGRSAANPAVSGGDLDAT
119869916YP_939868.1 excinuclease ABC subunit C [Mycobacterium sp. KMS]MLVGRIKDAAQMASIIAHTAAAGLDFEQDLADLKSHLDRAAWSTDQHLRG
CLERLEAKEAAAQAHSERVEQIKRSMTINVVAEHLDEFFNPHGGFVYLLW
GEDPNTPLYVGQSTNILSRLGAHMGDKTKRALVKRVQLIRCSTEKLADTE
WRLIQHYQPPLNVVGCSRTGRLGESGIGHD
119869914YP_939866.1 hypothetical protein Mkms_3883 [Mycobacterium sp. KMS]MPANIFRLELNERDYQRVGAALAALVHCDARGIADVLKDATEAKRGFHYH
VAVLQTLAHRMGLDGPDRDELLANLQQEIAELARRAEAGGDD
119869912YP_939864.1 hypothetical protein Mkms_3881 [Mycobacterium sp. KMS]MLWLAVIDRDYPAVDRALDMLPADPEVRAIAITLCEIGIAIEPRLRCDAA
RDQALTQLALLDHTFKMLTGRD
119869910YP_939862.1 hypothetical protein Mkms_3879 [Mycobacterium sp. KMS]MPASKRSKRQIAIQRSQRRHRPDDPAMKPQPWHPLPDGDVRPFVPRNQRN
ATRDERGRVRNTEEVHDELRRLNP
119869908YP_939860.1 hypothetical protein Mkms_3877 [Mycobacterium sp. KMS]MPRNRFKPGAEHPNWRGDAASYAAIHYRLRTTLGSARDHRCVDCGEPAKH
WSFSGCESEIPRRRNEAGRVISPPYCPHPEHFSPRCIPCHWRHDGAADRL
NKKPAKKSA
119869906YP_939858.1 HNH endonuclease [Mycobacterium sp. KMS]MPRAPKMCGRNGCRTIVHPPRKHCPEHSGWNTSPRTASAAATERSYWRTV
IRPQALARDNHQCQLRFPGICTGHATEVDHIVAVSDGGADELDNARSACR
RCHARRTAQDAARASHRAR
119869904YP_939856.1 hypothetical protein Mkms_3873 [Mycobacterium sp. KMS]MDKKQATVYDKEIRRLVGKIQDDLDTLAHLINQMLEGQAHLALGFKTPQA
YLQDVFRIDGVSRVIEQRRPVVAMLTQKGLSQRAIADIVGVSVGTVVNDQ
AASGAQKLSTSSEDRVIGRDGKSYPATKPKPEPEVSDDEIIDYQAAQDDF
NRLTSSMFAAKRKAQDALSLALHLRGFNEDEKRSIVADVADEVIDVFNAI
KDAAKGRSMDAELRKLLDQG
119869902YP_939854.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MSLAGKVAFVAGASRGIGATVAKALAAEGAAVAVAARSEQPGKLPGTIHT
VAESITASGGRALPVSCDVTDESSVETAVAETVSEFGGIDILVANAGVLW
LGPIESTPLKRWQLCLNVNLTGVFLVTKAVIPHVRARGGGSLIAVTTTGV
TMTDQGSNAYWVSKAAAERLYLGLAADLRADNIAVNCLSPSRVVLTEGWQ
AGGAGMEIPPEMVEPPEAMGRAAVLLAAQDASGITGTIQRSEEVVR
119869900YP_939852.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MPEAVIVSALRTPIGTAMKGTLRDTDAYRLAEHVVAAAAEDLPTGQIDDV
VLGEGLYGGGVIARHAAITAGLISVPGLSNNRHCAAGQAAVQSAAASIRA
GMDQLVIAGGVNSASTTPRFTRRASSAKDAAMLDWFPPTHPDRADAPNMD
MSITVGWNAAVRAGVSREEMDQWALDSHRKAIQAIDEGRFKEEIVPIDTP
YGLFDTDEHPRRDTSIEKLASLKPLHPEIEGFSITAGNACGANDGAAVLA
LASDRLGLPALGAVKAWASVGVDPAFTGLAPVEAIPKALKRAGISLSDVD
LFEINEAFAAMCVATVKMLDIDPAKVNVSGSGCSLGHPVAATGARMLVTL
VHELRRRGGGIGVAAMCAGGGMGSATVIEVPAP
119869898YP_939850.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPPVHDHPAVRRSAAQVRVLDAALDLIAENGVGGTSLQMIADRIGVTKAA
VYHQFKTKEEIVIALTERELAGLEDALAAAEAEENRSRAREVLLTRVVDL
AINRRRVASVLQFDPVIVRLLAEHEPFQRFIDRLYSAMLGNETGTRARVH
AAMLSGVISVAVMHPLVVDIDDDTLRDEVLQTMRRIVDLPG
119869896YP_939848.1 hypothetical protein Mkms_3865 [Mycobacterium sp. KMS]MSPPIVEPPPGSVIGRFFWNVRHHPKKELWFAWWVMVVFYQLYGVLFFLV
TRVQPPPSPAWDIPTVVQWFDDRHLGILAGFGVVFLISGMCGPMNALLAY
SMRRMSVSPIFGYSYLAMYALSAIPGMLVMAIAMTVAALRPDRDPELIHW
LYDFAFLSFSGTMGVFLIGSLVWMVAILLDKNRVLPKWFGYLGLCNALTE
VVVAPAWMFQRGVFAWNGAIAWWINMVVFLLYTAAFIMLLRRMIQREDFG
TGPLPDLPAEGIREDSDTVEAVR
119869894YP_939846.1 hypothetical protein Mkms_3863 [Mycobacterium sp. KMS]MSVSVNMRLLLVWVVLSALTVVYVWLDHGADQDGTLKASSVVTVGAIVIA
LIKVRIIFREFMEVRHAPAWLCRLTDGWVVLIGTALIGTYLVGAALSA
119869892YP_939844.1 regulatory proteins IclR [Mycobacterium sp. KMS]MLISLTNVHYVKSIALAMTSVKGSGGTGGGMGDGKVPDKLAAGSQTLARG
LSALQAVATAPGGLTVQQVADYVGVHRTIAYRLLGTLTQFRYVAKGEDGR
YRPAAGLALLGSSFDNNVRALSVPVLRGLADELGTTVSLLVAEGDQQVAV
AVISPTNVYYHLSFHEGSRYPLDRGAAGIALLASMPPRPGERELVPRARE
QGWVITHGEVEPNTYGLAVPVRRRPPSPPTCINLISHREDVVLDGKDAVI
AAAKELAAIL
119869890YP_939842.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium sp. KMS]MTPATARDATERDATDTDVVIVGAGPVGLTLANILGLQGVRTMIVEERAT
LIDYPRGVGLDDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEM
APPDARFGWPKRNGFVQPMVDAELHAGLARFPHVEVRWGHRMAECEETAD
GVTVRLDGDPTPVRARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVVDI
ANDPLGHPNSEVGADPARPYASISIAHGIRRFEFMIHADETDEQAEDPAF
IHRMLGLLVPHPERVEVIRHRVYTHHSRIAGAFRKGRMFLAGDAAHLMPV
WQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDTYDVERRKHARAMIDL
STMVGRVISPTNRRVAAVRDKLIRGASVVPTLKRYVLEMRFKPMPRYEQG
AVFHPEAPSPTSPAGTLFIQPRVDTRDAQNVLLDEVLGTGFAVLCWNNNP
RALLGADLFDRWKALGARFVAARPLTQLHWTGHDDPDVTVIGDRTGALKG
WFDAHAESVLFLRPDRCIAGACIAQRAPEVSTALFGVLHLTQGGGNGHHG
ADRPVLHVAQSATEPSGTVAGTP
119869888YP_939840.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium sp. KMS]MNFDRHVDVLVVGSGGGGMTAALTAHSCGLDTLVVEKAAHFGGSTALSGG
GIWVPGAPSQRKAGYTPDPDAVFGYLKQITGGLVSDARLRTYVDAAPQMM
EFLENLSPWFEFVWKPGYADYYPELPGGSELGSTINVPAIDLRRLEEDEQ
HLLQPLALAPKGIWFAPKDLRLFYQVRQNWRGKAVLVKLIWRMVRARVFG
DRMAAIGQSLAARMRLAMKQENIPLWLDAPMTELITGPDGEVVGAVVETD
GRAVRIGARRGVILAAGGFDHDMDWRREHLPVLEKDWSFGNPANLGDGIR
AAEKVGAATELLDEAWWFPAMCWPDGRLQFMLNERMMPAQFVVNGDGKRF
INEAAPYMDFAHAMIDGQRSGVEHIPCWLITDIRSFHRYVVGGHLPIPKV
PFAPVPTGWKVPKAWLDSGVVKEAHSWDEMAAKIGVPAENLRRTAERFNE
LARKGHDDDFNRGDSAYDNYYGDPTLPNPNLHPLGKPPYYAFQIILGDLG
TSGGLRTDEYARVLRDDDSAVPGLYAVGNNSAAVMGRSYAGAGATIGPAM
TFGYVAARHIAAKDAAAQPDSGTAHVDHQAQPSPGPSPIGGST
119869886YP_939838.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium sp. KMS]MSHIEQLWRYDGKRVVVTGCASGIGAHLVRQLSELGARVVGLDMRRPAAD
LDEFGEIDLSDRASIDTAVAAIGGDVDVLFNVAGVSSGIGDPPLVVRINF
LGTRHFTESMLPRMRPGSSIVSVSSLAAASYLDNAPTTAGLVRTATMEDG
IAWCAEHPEALADGGYRLAKEALILYTMRSAGPLGARGIRINCTGPGVTE
TPILDQLRTAYGPAFLDDIPKPLGRVSDPEEQSAVLTFLGSNAASYITGQ
VIWVDGGNLAGRVAASLDATSEGK
119869884YP_939836.1 NADPH-dependent FMN reductase [Mycobacterium sp. KMS]MTDPGEIPFVVGLGGTLRANSSTERAVRYCLEAVERQGGRTRMFAGPDLD
LPMYAPHQLERTPGALELVAALRDADAVVVGSPGYHGAISGLVKNALDYI
EDLREDPRVYLDNTPWGCISCAYGWQAAVNTLGQLRSIGHALRAWPTPLG
VAINSADPIWDGDGLLVDEPVRNQLDLLANQVLTFAAAHRTAK
119869882YP_939834.1 type I site-specific deoxyribonuclease [Mycobacterium sp. KMS]MTDLVSLVRYATGVEDELVPYGDRVREKYAAWLTQQEQAGVTFSDTERWW
LDRMVSVIASSAGIRVEDLDDAPFIERGGTDGAIRDLGDRAAELIDELNA
ELTA
119869880YP_939832.1 hypothetical protein Mkms_3849 [Mycobacterium sp. KMS]MTGRQIKLFLVDGSPGSLTTAEITNWTGHVLSAPRSELADLLKRDEAQRT
GAYLLLGEDEEAVGNTRCYIGEADVVAERLRYHQREKDFWDRVVVITSKD
SN
119869878YP_939830.1 hypothetical protein Mkms_3847 [Mycobacterium sp. KMS]MIKQIELRLVDGSAPSGEITLKDLSGIAAALQELVTRLSREAADAAGPGR
SKQYVEEFAELRLDGITAGSTVLKVSKGPTDKLDVDVPGLTEADDRLWDI
LGAISADHRPAWTSTLVAESVGKLATALRGAAPTTVISSPDRGEVRIDAA
RIHPETWAVNRVTAAGSGTAAGWLEKVDLHSHTFRIRDDVGNTVELRRVA
DDKAAGRLVGQWVTAEGDATLSPSGRVVALNHARVRETGDPAAEFLGSRV
VPLDEILASAPGPDPNGGIDLTDEEAAEFLRAIRS
119869876YP_939828.1 N-6 DNA methylase [Mycobacterium sp. KMS]MRRAPTSKSSTPTFWSGWPSNPGTLGTIYRKAQNRVQDPAKLKRLIVDLI
DKENWSASGTDLKGDAYEELLAKGASDKGSGAGQYFTPRDLIRAIVDVID
PSVADTVVDPACGTGGFLLVAHEHVAEEAGKLTPTQRNHLRDKFVTGYEL
VDGTARLAAMNLLLHGIGTADGPSLIEVRDALIADPGQRWSVVLSNPPFG
RKSSLTMVGADGREARDDVEIERQDFVVTTSNKQLNFLQHIMTILDINGR
AAVVLPDNVLFEGGAGETLRRKLLDDFDLHTMLRLPTGIFYAQGVKANVL
FFDKRQANEQPWTSKLWVYDLRTNQHFTLKQNRLRRHHLDGFVDSYLTGK
PREERVESERWKAFTYDDLIARDKVNLDITWLRDESLEDADNLPAPEVIA
REIVEDLTAALAEFEAVAAALEAAATDRS
119869874YP_939826.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MVTRPNDELHGRVAIVTGGASGIGRGVAERFVAEGAKVVIADVQDELGEA
LAEQCGPNALFHHTDVGDQEQMRRLVDVAVERFGALDVMVNNAGISSPLR
RGLFTEDLEEFDRVMRVNLLSVMAGTRDAGRYMSEHGGGSIINLSSIGGI
QAGGGVPVYRASKAAILHFTKCAAIELAHYDIRVNCIAPGNIPTPILQSS
ATGEDRERLEKFEARIRAQMRNDRPLKREGTPDDVAEAALYLATDRSRYV
TGIVLPVEGGTIAGKIIPRKAEPGATVNGAQT
119869872YP_939824.1 putative ferredoxin [Mycobacterium sp. KMS]MKVTVDQDKCVSSGQCVLNASDVFDQRDDDGVVELLVDHPAPDQEEDVRR
AAAACPALAIHLEE
119869870YP_939822.1 amidohydrolase 2 [Mycobacterium sp. KMS]MSAPSPTQTLYPPEGFGAPKHRHGHSAGAVTGLPEGTEIFSADNHISVAD
DIFYERFPEELKGAAPRIWYEDGAYMVGMKGKAWTGGDFGRVLMQYDDLA
GAASNNIEARIRELKEDGIDKELAFPNAVLALFHYPDKALRERVFRIYNE
HIADLQERSNGHFYGVGLINWWDPKGTRSTLEELKSLGLKTFLLPLNPGK
DDEGNIYDYGSTAMDAVWDEIEASGIPVSHHIGETPPKTPCQNNSVVVGM
MVNVDSFREQFAKYVFSGILDRHPSLKIGWFEGGIAWVPTALQDAEHMLA
SYRHMFNHQLEHDVRHYWDNHMSASFMVDPLGLQLIDRIGVDNVMWSSDY
PHNESTFGYSEKSLATVVDAVGPENAVKIVSTNVRKFLGV
119869868YP_939820.1 peptidase M24 [Mycobacterium sp. KMS]MGIEIEADGRALRHSRRERALAQMKAYDLDMLVLGRQANVRYISGAPQLW
VVGTRPFGPICEFVRATGEIHLNSTWDEGIPEEIPHENLYGFAWNPMTLV
GILQNIKGADTVRRVGTDALTPTFAKLLPMAFPNAELVDAEQAMQAARRI
KTPEEVQALRRALVVAEEGLAAGVAALGPGTTEKALAGAVLEAEAAGGVS
TPATQDAAWVTSKEHPWRRADSDGLVREGDLVALSAGVLADGYVAEVART
LCVGEPTDAVRALFRRRDDLWDRLIEACRPGMTTSGLLAAYEQAGERLPA
MPVAHGLGLGFDPPVVSPALRATAEADVLEEGMVLAVTAYVWEQGVGAVF
TRDAVLITVDGAEILSTAPAYGEAVHG
119869866YP_939818.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMGADVDSDPRRGPLDGFRVVDLSTGIAGAYCTKLLVDGGAEVVKVEPPEG
DPLRRWSASGADTGGDGALFSYLACSKHSVVADPAESSDIAFVEDLLASA
DAVVWSRGSALAEHPDVAPAAIHRRHPGLIVTAITPFGLDGPWTDRPATE
FTLQAWSGGIVGLGRGAPDRAPVYVGGQVGEYLAGAYASAATLAVRLRGV
GELIDLSMLETQILGLTYYPVTYHQMLGRPWRDARKLTVPGIARAKDGLV
DIGCGTAQQWFDLCAMTGHDEWIDEDSPLSITEQANEKAEELYAWVAEQT
VDEIRDLASAFRIPNAPVANGETVATLDHYVERGSFVTNPRDGFTQPGPP
YRLNPPVLRTPQPAPRLGEHTETYRRNSIPGRQAGGLAAGNPVSAQPTGA
QLPFEGLRVLDLTTFWAGPSCTHILALLGAEVIHVESARRPDGTRLIAGI
PATEQQWWERSPIFSGLNTNKKGLTLDLHTPRGRELLNRLIETADVVAEN
FTPRVLDHLGLDFAAVQALRPDAIMLRMPGFGLDGPWRDNPAFAYVIEAA
AGISWLTGYPDRNPNEPYSVGDPNAGIHALNGLLLALEHRRRTGQGVLVE
AAMVDAALNVAAEQVIEYSAYGALLGRSGNRGPTAAPQNLYLSDGIDEFG
RPDIWVAIAVATDAQWDALCAAIGAADWASDPALATQAGRRAAHDEIDER
LERWCGQRSADDIVEILWTAGVPVAKVMQPHRQTELPQLTHRGFFEEVAH
PVNPPAPHSSLPFRLSAGPQRFHRHPAPLLGEHTEELLAELGLTADDIAR
LAADKVIGHTV
119869864YP_939816.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. KMS]MSDAVLVTGGFGLVGSQTVRRLVELGRRVVATDLQTDANRKAAGSLPDGA
EVRWADLTDSDQVDQLLTEVAPSAIIHLAAVIPPPIYRNPKVARKVNVDA
TATLVRAAEALPQPPRFVQASSNAVYGARNPHRHKAPVTAETPPNPTELY
GAHKLEAEEIVRASSLEWVVLRLGGVLSVDPKAMPLTTDALFFESALPTD
GRLHSVDVRDVAWAFAAATTADVVGEILLIAGDDTHKRRQGEVGPALAGA
RGLAGALPPGRPGDPERDDAWFITDWMDATRAQEALQFQHHSWPDMVAEM
SGQVGLLRYPLQLIAPLARVFVARQGAYRNKPGKYADPWAAIRSRLGDPG
LDRPR
119869862YP_939814.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MIPVLGDTAAKVGASVGLMQTLWRSRLIAPMRPDRYLKMGAAVRRVGMTA
TVGFATAAQRCPDRPGLIDERGMLTFAELDDASDALAVALQGLPGGTPGT
VAIMCRNHRGFIEALLAANRIGANALLLNTSFAGPALAEVAEREGADVVI
YDEEFSETVERALSGLPDAVRIIAWTDEPGGGAETTVDALIEAHRGERPR
PAERSSEIILLTSGTTGTPKGAKRSAGSGGAGDLKAVLDRTPWRAEETTV
IVAPMFHAWGFSQLLFAGLLACTIVTRRRFDPEATLALVDEHKATGLIVV
PVMFDRIMDLPDEVRARYSGRSLRFAAASGSRMRPDVVTAFMDQFGDVIY
NNYNATEAGMIATATPADLRAAPDTAGTPADGTEIRIFDPDFRELPPGET
GSIFVRSGTLFDGYTSGSTKDFHDGFMASGDVGYLDENGRLFVVGRDDEM
IVSGGENVYPIEVEKTLAAHPGVAEAEVLGVDDEKYGQRLAAFVVPAAGA
SLTPDELKEHVRDNLANYKVPRDIVILDELPRGGTGKVLRNELRAHLN
119869860YP_939812.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MAGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKQIDSVRIPL
STPEDLAETADLVKGLNRRIYTAEVDTRDFEALKAAVDAGVEQLGRLDII
VANAGIGNGGETLDKTSDGDWEDMIDVNLGGVWKTVKAGVPHILAGGRGG
SIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRTFAVELGAQNIRVNSVHP
TNVNTPLFMNEGTMKLFRPDLENPGPEDMKVVGQMMHTLPIGWVEPEDIA
NAVLFLASDEARYITGVTLPVDGGSCLK
119869858YP_939810.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMQLTFDADVEAFRAEFVAFLDANQPDEADTAQRPRSSADLPDWARRWQRL
LFDNGWLLPGHPPEFGGRNATILQQYAYQLELSRRRIYHSFNPQGVGIIA
ASLISFGTPEQQQKWAVPILRAEMTAALGMSEPGAGSDLASLRTRAVRAP
DAAHYVVNGQKVWTSGASEADVILTFVRTDPDAAKHRGISVLMIPTDSPG
VIRRPFASICDAGELDFNEVFFNDVEVPVENLIGPENDGWRVANGSLGHE
RTMLWLSYADRLQDLIDDFPAHTALDRDRYATMVIDSMAVRLLGSVALAR
AARGVDDAGALSVLKLLGSETGQRATEHALEAVGVDGLAHPTTVGPWTPL
NLDAYSCGWFERYTRTFAGTIAGGTSEIQRNIIAQRLLGLPRN
119869856YP_939808.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMIVDQQSLEMLETSLRKTMLSTSGPDLDAALTELGWAEMLTDMPDTAVPL
VFRLLGETGSHASALVDVVLHATGNTIGDTVELPLPYAGNSWVVWDRVGT
APNTTLGGLPLRREEEGYPIRVAEARLAVGWWLVGSARAMLRLACTHARD
RVQFGKPIAQFQAVRHRLAETLVAIEGAEATLTLPGSENPDLTALLAKAA
AGKAALTAARNCQQVLGGIGFTEEHELHVHVKRALVLDGLLGSARELTRK
AGAGLRARGSAPRLVSL
119869854YP_939806.1 hypothetical protein Mkms_3823 [Mycobacterium sp. KMS]MTAPISESRLADHIEIQQLLAKYAVTITQGDIDGLISVFTPDGTYSAFGS
TYTLARFPELVDAAPKGLFMTGTALVHLDPDDPDKATGTQPLCFIEHSKH
DMRIGYYNDTYVRTDGGWRLRTRAMTFIRRSGEHDSGRPHAIGRPEAG
119869852YP_939804.1 hypothetical protein Mkms_3821 [Mycobacterium sp. KMS]MSDTQERLLPEEFADLERFSDWILPTEPERYAKRLASTMEEMQDLYDVGM
ARLEEVMTYLDARFPLHGMPDDAKRLMHLMQSVVMVSFPVEVWKQPRVLD
SGAAWVEIIREPVV
119869850YP_939802.1 carboxymuconolactone decarboxylase [Mycobacterium sp. KMS]MRVAPLPADQWDDDVRRALSVMLPDERLNPEGAGNLLTTLARHPRLTRAF
LRFNVHLLFRSTLPARLRELAILRVAHLLGSEYEWEHHVAMGREVGLSDA
AIEGAARGEGADELDQAILDAVDQLQEKANISDHTWAQLSAHLDERQRMD
LVFTIGCYGALAMAINTFGVEPDQER
119869848YP_939800.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMQQSFSNTEENQVSGGMNFELTEDQQLIYKSVSELAARFDDQYWMEKDSN
HEFPTEFYDAIAGGGWLGMTIPEEYGGHGLGITEATLLAEAVARSGGGMN
AASSIHMSIFGMHPVVKHGSDELKARTLPRIASGDLHVCFGVTEPGAGLD
TSRITTFAKRDGDSYVVNGRKVWISKALESEKILLLTRTTPYDEVTKKTD
GMTLFMTDLDRAHVDIRPIAKMGRNAVSSNELFIDDLRIPVEDRVGEEGR
GFFYILDGLNPERMLIAAEALGIGRIALDKAVKYANDRHVFDRPIGMNQG
IQFPLADSLARLDAAELMLRKATWLYDNGKSCGREANTAKYLCADAGFTA
ADRALQTHGGMGYAEEYHVARFFREARLMKIAPVSQEMILNFLGSHVLGL
PRSY
119869846YP_939798.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMQTLPPLAGITVVTLEQAVSAPMCTRVLADFGARVIKIENPKGGDFARHY
DDVVHGQAAHFVWANRGKESLSLDLKSPAGMDILHRLLDGADVLVSNLAP
GATARMGIGAADLKHRHPRVIPVEIDGYGAGGPISHKRAYDLLIQAESGA
CAVTGYPGMPAKPGPPVADISTGLYAALSILALLYARKGDGAEPAPAVAV
SLFDTMTDIMGYQLTYTQHSGVDQQPLGMSSPAVAPYGAFPTRDGQTVVL
GTTNDREWQRLAREIIERRDLADDPMFASNSDRCAHRDILNEAIGSWCAQ
HDLAHIQKKADDAGIGNSRYNLPSEVVAHPHLTARDRWRPVETPNGEISA
LLPPPVIEGFEQPMGAVPGLGQHTDEILGGLGLSADEIAALREQGAVGPA
QS
119869844YP_939796.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMRRDLFTDDHDAFRQLARDFVEKEVVPQYPEWEKAGRMPREVFKQMGALG
MLGMAIPEEYGGAGIDDYRYNVVLQEEAARALVTLSTVRTQLEVILPYFL
HYANDEQRKRWFPGLADGTLLTAIAMTEPGTGSDLAGVRTTAVRDGDDYI
VNGAKTFITGGIQADLVVVVARTSTDPENRRRGLSLIVVEDGMPGFERGR
ELEKMGCKVQDTAELSFTDVRVPAANLLGEEGEAFSYLGHNLAQERLTVA
VGSVAQARSALHATIDYVKNRKAFGTPVASFQNTKFELAAVSTEIEAAQT
MLDRAVLDHVDGVLSREDAARVKLFCTEMQARAVDRCLQLFGGYGYMMEY
PIARLYNDARVARIYAGTSEVMKVIIAKSLGL
119869842YP_939794.1 hypothetical protein Mkms_3811 [Mycobacterium sp. KMS]MTEQPDMRYRLDIVSPNVRDAVRFAGGWLYDRSMAGWDVTVLIDAAGEDV
RPLEILGATVLPLQPVLEAWTDRPHPQTVAVAADLIDCDERVRRHVRTAL
DSGYTEVTLWGERCPADLDDDVDAVRHELSAAARAFKAQALAAVNDIEAA
FVGQIETFRCGMMARPSVAADLIPAS
119869840YP_939792.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MTQSDSAPHVRDIDTARLATWMDEAALPGKGEPLQTFFLSGGTQNVIYEV
RRGEHRCVLRMPPPGAPPDRDKGILREWRIIEALDGTDVPHTAAVGVCDD
PGVLGRPFYLMGFVDGWSPMDTHARWPEPFDSDLSARPGLSYQLAEGIAL
LSKVDWRARGLADLGRPEGFHERQVDRWIGFLERIKRRDLPGLDVATAWL
RARRPLDFIPGLMHGDYQFANVMYRHGAPAQLAAIVDWEMGTVGDPKLDL
GWMVQSWPDDTDAPGESEMSYVDMRGMPSRDAVVAHYAEVSGRQVDDLDY
YLVLAKWKLAIVLEQGFQRAGDDEKLLAFGPVVTDLMASAAELAESSDYR
119869838YP_939790.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPRPATPMPTDRGQRRTSLQQERSRETKRMLVQAAMALWRTNGYANTTVA
DICTAAGVSKALFYFYFPRKEDVLFEVGVMSTRSARQTADALLAKPYEVP
AVIAAALADLERSMARNPPELVVAAILEGYRHEHRILAGAEAVEDDGGMF
TALFDRAQRDGKLARHIDAGHLAYLAHTLVSEGARHWAVGAFGDRSFTEV
VGADIDALIAGLSREP
119869836YP_939788.1 hypothetical protein Mkms_3805 [Mycobacterium sp. KMS]MPSSTTGFVPSAPRAARLEACFEELAELTGQRNAIDGRIVEIVAEIDRDQ
LWGATGARSIPALVAWKLGLSSKNAKTIAAIAHRLDEFPRCTQALREGRL
SLDQVGAIAERATTGSDDHYAELATHASVSQLRTAIKLEPPPQPQPEPEP
VSDADVEPKPLPDPADLQPSITTTSDEQYTHWHIKVPHVDAAKVDAALHS
RLDGLIAQWKRDHGDHGDTDHKDARGFGRPPMPRLADAFMDLIDTAWDAE
AARRPHGDRTTVVMHLDINDRIAALHLGPLLSDADRRYLGCDATCEVWFE
RNGQPIGTGRTTRLINRRLRRALEHRNRTCVVPGCESTRGLHAHHIQHWE
DGGPTDLDNLVLVCPYHHRLHHRGIITITGPASKLTVTDATGRQLHSGSL
ARPPTTPPPTVPLYRGPSGERADWWWYTPFQPPPQAAN
119869834YP_939786.1 hypothetical protein Mkms_3803 [Mycobacterium sp. KMS]MELPGTPSDDVPAVLAEGRGDIGTLFVSMATRHPDGADADYLRWHTLDHR
PEQHRLSAVRASLRLVSTPACRSARAVSTGPYDAIDHVMTYFFTDPGGME
PFLALSKALGDAGRKLPLLPPVERGVYEVGAKAAAPRVKVGADVLPWWPV
RGVYLLLERGASTSTDLLGVDGVAGVWTATSLPVGARLASAPAGQTLSYC
FLDEDPVDTAGRLLPVLQQRWREPGVTPLFAAPFHPVVPYEWDRYVP
119869832YP_939784.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MVLVHGNPETDAVWDPLVDALGRTDVVRLSPPGFGAPLPGGFPATFIAYR
DWLVAELQSIGEPVDLVGHDWGGGHVVNVMMHRPELVRSWASDVVGLFDR
DYVWHDMAQGFQTAETGEQLVAMMQEGSVQDRTQQLVGFGVPADVAASFA
TALGPEMGRAILALYRSARQPALADAGRALENAAARPGVSLVATEDPFVG
SEEMRRRAADRAGARTEVLDGLGHWWMVEDPTAGAAALTRFWESLDG
119869830YP_939782.1 ATPase [Mycobacterium sp. KMS]MLNSTAAVTTPVSNAPFYRAVRDEVEVFRAAARRGLPVLLKGPTGCGKTR
FVEAMAHQLGRDLITVAGHEDMTSADLVGRFLLKGGETVWVDGPLTRAVR
EGAIFYLDEVVEARQDTTVVIHPLADHRRELPVDRLGTTLQAAPGFQLVI
SYNPGYQSVLKNLKESTRQRFVAIELGYPSPEVETEVVAYEAGIDTQTAR
ALVKLAYAIRNLDGSPLREVSSTRMLILAGGLAAEGLNLRSAVHAAVVQV
LSDDEDVIRALDELVDTVLPRSRGGGDIRPET
119869828YP_939780.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVEPWTRERRLERTRSLLLDAAEEVFAEKGFMTATLDDIAKAAGYSKGAI
YKYFATKEELFLAASDRYWRRYFDNFAEVMSSSDHIGARELENIGERWRQ
LSRDRGAEHAALGLEFNLYLLRNPEARERVAAKRSEVVDQLAAYIVEGID
SLGATLLIPATTFAHIIIATTDAVELASHLDDIDLYQSIVEMYVSAVKMP
119869826YP_939778.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVERWTRERRLEHTRSLLLDAAEDVFAEKGFAPATLDDIAHAAGYTKGAI
YKHFSTKEELFLAVSDRYWRRYFENFAEVMSSSEQVGSRELDEIAARWRE
LSRDRGAEHAALGHEFALYLIRNPEARKRVAAKRSEVVEALAAFIVEGID
RLGGALLIPPMTLAQVLVATSDSVVLGSELDDVDLYRPVIEMYMSAIKLP
DH
119869824YP_939776.1 integrase catalytic subunit [Mycobacterium sp. KMS]MSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRKCVHTWISRFEAD
GEAGRIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGPEEIGAKLGVSAR
TVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERGRPGELVHMDVKK
LGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDDHSRLAYSEILPD
EKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRYSLRDVCTQLGAR
QIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHRAAALAPWLKHYN
TQRRHSALGGLPPISRLTPTS
119869822YP_939774.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MRGDELFIGGTWCAPSTDRRIEVISPHTETTVGHVAAAAPADVDRAVGAA
REAFDTGGWPRTSPAGRIDAVRRLAANYERRRSEMAELITSEIGAPISFS
QRAQVALPWSMINAFCDLAQTYPWREARPGRYGSDIQVLREPVGVVGAVV
PWNMPQFLIVTKLIPALLAGCTVVVKPAPESPLNALLLAEVIAESGLPPG
VVSVLPGDGSVGEYLVGHRGVDKVSFTGSTAAGRAVATACAADLRRVSLE
LGGKSAAIVLDDADPVVVAAGVRSASLSNSGQICNALTRVLVPRSRAGEF
TDALAAEVSALVVGDPTDGATQVGPLVARRQQQRVTGYLEQGVRDGARVV
TGGTGMPDGLDRGWYVKPTVFDRADNSMTIAREEIFGPVLTVVAYDNEDE
AVAIANDSDYGLAGSVFTADTDRGLAVGAAIRTGTFGVNQGYTMDPFAPF
GGVKSSGYGRELGREGIDGYVDTKSISVAPKQDLATAAAGKGA
119869820YP_939772.1 hypothetical protein Mkms_3789 [Mycobacterium sp. KMS]MTVSDTATTTAKLPPEFADLEQFSDWCLGSEAERYAKRLNSSMREMQAFY
DAITARAEEAISYCDKFPLDDMPDDVLNLMHLLYSMIQVSFPVECWKQPK
VPDSGATTLDCDAEPFP
119869818YP_939770.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MELTDNILWLLKQAFYFSLTTVNEAVSEHGVSTAQIGVLRQLSNEPGLSG
AELARRLLITPQGVQLAVKALEQRGFVERRPDPQHARILQAYLTAEGRRV
AAAVVSDAIAAHEAVFGVLTPDEQKTLRDLLARVVVKGTGHTLADDHVGE
119869816YP_939768.1 ferredoxin [Mycobacterium sp. KMS]MSEPVADFSPLRVKRVVRETSDAVSLVLDVPRHCSGRFRYQAGQFLTLRV
NLDGQELRRCYSMSSAPVEEELRITVKRDPGGLVSNWLNDTVSEGAEIHA
APPEGRFLLRDTDSEIVAFAGGSGITPIMSLIRTALATSARSIRLFYANR
NRGSVIFADDLARLVEHNADRLVLTHHYDDDSGVVTPAAIESFVAGAGDA
DFYICGPGPFMDTVEGALATRGAPRDRVHLERFQVAQVPAGADASEAQAT
EEIVIELDRKTTTVPYRSGNTLLQTARTAGLRAPSSCETGSCGTCMAQVV
SGSARMLNNDALDDDEVADGWVLTCQSLPTSRSVHVVYE
119869814YP_939766.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MGRWPKPPEGSWTEHYPELGTGPISFRDSVSPEFYELEREAVFKRAWLNV
GRVEELPRVGSYLTKQIDVAGVSVIVVKGRDEQIRAFYNICRHRGNKLVW
NDFPGEEVKGTCRQFTCKYHGWRYGLDGALKFVQQPGEFFDLDTEKLGLA
PVQCDVWNGFIFINLDPEPRWSLREFLGPMITALDDYPFELMTERYEFEA
HNNSNWKIFADAFQEYYHVPSLHSQQVPSAVRQPNATFECGHFQIDGPHR
LVSTAGTRRWLLDPEFMYPVERITRSGLVGPWRTPETLQSAGLNPGGIEP
WGITNFQIFPNLEILIYHGWYLLYRYWPTSHNTHKFEAYNAFHPARTVRE
RIEHEVASVVLKEFALQDAGMLGGTQAALEYGLDEPIIDDYPLSDQEILV
RHLHHEAVKWVDDYRAERAPVGVRA
119869812YP_939764.1 taurine catabolism dioxygenase TauD/TfdA [Mycobacterium sp. KMS]MTVLTINKLTASVGAEVTGLDPDALAGDEALGAAVLEALEDNGVLVFPGL
HLDPQAQVEFCRRLGEVDHSSDGHHPVAGIYPVTLDKSKNSSAAYLRATF
DWHIDGCTPTGDEYPQMATVLSARRVAESGGETEFASSYGAYDHLDDDEK
QRLASLRVVHSLEASQRRVTPDPSPELLARWRSRPTHEHPLVWTHRSGRK
SLVLGASADYIVGMDLDEGRALLADLLDRATQPELVYSHTWSVGDTVIWD
NRGVLHRAAPYPENSPREMLRTTVLGDEPIQ
119869810YP_939762.1 cytochrome P450 [Mycobacterium sp. KMS]MAEDLTSVDFFRDGRLTDDPYPFYAALRDKCPVTREDHYGVTMVTGWQEA
VDVYNDAETFSSCISVTGPFPGFPIPLEDFKDGDVTELIEKHRDEIPFSD
QLPTLDPPTHTNHRALLMRLITPKRLKENEDAMWQLADDILDEFLAPGQG
EFIKGFAAPFTLRVIADLLGVPDEDRPELLERLAKGTHGGALGSADKALT
KTPLEYLYDVFAEYVEDRRREPRDDVLTGLATASFPDGTMPEVGDVVRVA
TNVFSAGQETTVRLLSTALKVMGDQPEIQRALREDRSLLPNFIEECLRIE
SPVKGDFRLSRVPTTVGDETLAAGTTVMVINGAANRDPRRFEDPDTFDPQ
RKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTTDIRISEAHHGP
AGERRYDYIPTYILRGLTELHLEFDTTGVEAEEKP
119869808YP_939760.1 hypothetical protein Mkms_3777 [Mycobacterium sp. KMS]MPKAYVLLTEDVKDPAGMAEYGKLAGQTMGTAKVLAFGPAVENLEGQWHG
NQTVLLEFESVDAAKQWYYSDEYQAAAKLRQAAADCNGVIVSGLG
119869806YP_939758.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MLPATRPGDWLDPASGLGSSLDDVEPGTFNTTIPTDRYTCRDYAARERDA
IWMRVWQIAGRVEDLPKPGDWKKYQILDQSFIIVRGKDGTLRGFVNACRH
RGNALCVTETGNAKRGFLCQYHLWSYDLEGRLKGMLREDLAGPIDKTENS
LLPVSVDTFAGFLFLNPDPDAEPLREYLGEDVVTLLEPYNIEQFTTVMDV
TEAIDCNWKVVMDAFEEGYHINGIHPQLLQVLHINPRTARYRFFENHSVA
MAPFEVVGAGVQDQVAGILALPETFPGTVAVIPRFQELIAPYQDSDGNVD
FPEGVTARLLLQQATREVLTGMGLDVSALTDDQMVDNQGWVLFPNYFMTV
RAGECHVIMSAPHPDGDPNRCIWHVASYMYVPQEFRDAVRAEAIVVDTPG
SHKYFEALQQDYEQMPRQQKGLRNDRLDHMSLVKEEVVIAHYHSVVDRYM
ESRTR
119869804YP_939756.1 hypothetical protein Mkms_3773 [Mycobacterium sp. KMS]MTTIEDVIGESTGRSRAVLEYSQTMGRLVKSAKDPGFSVDSWAPLAELIA
VDEFIRIGPFKEVMNWDEYVEFLTNWAKSSDWDCSFKRLTETADVAFLEL
EERSRIGDFSSVVNSASVYEFNADNKIRYIAVYLQMQLPDPATLPDFQGD
119869802YP_939754.1 cytochrome P450 [Mycobacterium sp. KMS]MTTPKTNSDLVFDPFSEEYFNEPWEIYRRMREEAPVYYNEELDFYALSRH
ADVAAAFKDYQTFSSAYGLDLSMVKTGEPAPFKMIILMDPPEHRQMRSLV
NKVFTPRQIAKLQPMVEETIDSCFRAADPEHFDVVQEFAAFFPVEVITRM
LGVPEDRRQQVRQWVDTSLHREPGQEEMSPEGMQAIADAMGLYFELIAQR
RENPQDDMFTALVQAEIEREDGRMERLDDLEIAGFATLLGGAGAETVTKL
IGNAAVTFARFPDQWQKLLDDRSKIPAAVEELLRYEAPAQYNVRRSMQDV
TIHGVTIPAGKPVFLLGGSANRDPEAFTNADTFDIDRDRTEAQNLGFGYG
VHSCLGAALARMESAIALERLLDFMPRYEVLWDECRRVAMQNVAGWSHVP
VRVLR
119869800YP_939752.1 cytochrome P450 [Mycobacterium sp. KMS]MTKPRLKFDPVSQEYFDNPYEIYRRMRDEAPVYYDEAEDFYALTRHEDVA
AALKDHESFSSSRGCDLAMVRSEEGPAKSIIFMDPPEHRHMRSLVNKAFT
PRAIQSQRETITELVEHYLSQVDPDGFDVVQDFSGPFPVEVITRMAGVPE
AFRQQVRHWIDKGLERKPGQLAWSDENMQANIDSGVYYYGLVQERRRNPQ
DDMISRLIAAEIPGENGEMRKLDDIEITGFTSLLGGAGAETVTKLVGSAV
VEFARNPEQWQLLLDDRSLIPAAVEELLRYVGPVQYNVRYTLKEAVLPNG
TVPAHKPVFLMNAAANRDPRAFDNAETFDITRDRAQAQNLGLGYGIHSCL
GAALARMETAIALEHLLDFMPRYEVDFDGLERVHMQNVAGYHHVPVRVLK
119869798YP_939750.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. KMS]MRVGFIGLGSQGGPMARRIVEGGYELTLWARRPASLEPYADTAAKTAGSP
AELAAASDLVCVCVVGDDDVREVLYGDTGVLAGLAPGAMIAIHSTVHPDT
CREIAEKAAAQNVSVIDAPVSGGAPAVEQGKLLVMVGGEEADVEKARPVF
ATYADPIVHLGPLGSGQVTKILNNLLFTANLGSALSTLELGESLGIPRTQ
LAEVLNGGSATSKALGSISMFGGTVEALAPIAGALLQKDVRHAASIAARA
SAPKGSVFTAADTALESMDHPR
119869796YP_939748.1 hypothetical protein Mkms_3765 [Mycobacterium sp. KMS]MADIPGRPLPQVTAQNEFFWTAGADGELRIQQCQDCESLIHPPQPICRYC
RSQKLGVRTVSGRGTLAGFTVNHRFGFPDLPPPYVVAQVAIDEDPRVRLT
TNIVESDPDGLELGQPVEVVFQQADDVWLPLFRPVAGDPGELPADEIAPE
RFGDHIRPMLRTEKFEQHSAITGIGASRLGRRLMVPPLSLTIEACEAAVA
DAGLTLDDIDGLSTYPGLDVAGMGEGGVTALEGALGLRPTWINGGMDTFG
PGGSVIAAMMAVATGMARHVLCFRTLWEATFGQLLKEGKMAPPGGGRTTS
WQMPFGATSAAHTLALNAQRHFHRYGTTRETLGWIALNQRANAALNPTAI
YRDPMSMEDYLSARPITTPFGLYDCDVPCDGAVAVVVSAVDAARDMPKKP
VFIEAVGTQIVERTDWDQTTLTHEPQVLGQSAHLWTRTSLRPSDVDVAEL
YDGFTFNCLSWIEALGFCGIGEAKDFLDGGHNIARDGVLPLNTHGGQLSH
GRTHGMGLMHEAVSQLRGEAGDRQVADARVAVVSSGGLTPSGVLLLRSDA
119869794YP_939746.1 respiratory-chain NADH dehydrogenase domain-containing protein [MycobaMNPTAATDLTTAVWPGTTPRLLHVPAGREDYADYAQSGGYRELPDPERLL
EEVELSGLLGRGGAAFPMAVKLRSVRDHGRTRGGAVAIANGEEGEPASIK
DRWLLRHRPHLVLDGLRLAARVVEAERAIVYVSDPESARSVETALTQVDS
PVLDGVSISVVVVDPGYVAGEETAAVRAIDGGPAKPTDKPPRPFEEGVGG
LPTLVSNVETLANLPYLHEHGAREYRSAGTPSSPGTFLATVTGGGGPPAL
YELPHGVALADVLTWHGISPDSVSGVLMGGYFTGLLNRDVLDATLDHEAL
RRLGSGLGCGAVGVLTDECPVAVAASVLAYFDRENAGQCGSCFNGTAAMA
AVAVALRDGVASDDDLARLERWSVVLRGRGACGTLDAATNVAASLLTAFP
QAVARHREGSCDRCAVDLYDVRRPYEVEAVVSA
119869792YP_939744.1 hypothetical protein Mkms_3761 [Mycobacterium sp. KMS]MTTTDDTTEQVGPQLKRGEKVIEINGGRVVYEILGKTGDFIALTPGGRFS
KDIPGLRPLAQALVKGGYRVLLWDRPNCGKSDVQFYGQSESHMRAETLYQ
LITTLDIGPCILAGGSGGARDSMLTTMLYPEIVTKLVVWNIVGGVYGSFV
LGSYYIVPSILAVRGAGMKAVAQVAEWQERIAENPANRDRILSLDADEFL
KLMLRWLNAFVPKPGQTIPGVEDEMFDNIRVPTLIIRGGENDLDHPKRTS
LEVSCLIKGSTVIDPPWPEDAWERAGEKRASGKVKRFNMFDTWVQAAPAI
LDFLGR
119869790YP_939742.1 amidohydrolase 2 [Mycobacterium sp. KMS]MTVTANPRVPAAERIAVRCVDSDVHPTPRSGELGQYIPEPWRSRYFGTHK
VGDQIYYDAPDYAHSYAMRVDSFPPDGEFACSDPDLAFKQLIMEAGADIA
ILEPAAYPARIPEAQHAMSVGLNDWQANHWLDSHNNWHERWRGSICLAIE
EPEASVAEIERWVGHPYMAQILIKAEPRPSWGNPKYDPIWAAAAKHDITV
ACHLSRSHYDELPMPPVGLPSYNHDFMVTYSLLAANQVMSLIFDGTFDRH
PNLRIVFVEHAFSWILPLMWRMDALYEARKSWLDIKRKPSEYVKDHIKFT
TQPLDYPEDKTELTRAFEWMECEKILLFSSDYPHWTFDDPRWLVKHLPEH
TREAIMFRNGIETYKLPDTVPALEGQVRVF
119869788YP_939740.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMLLEFDADQRLWQETVRDAVTKQCPASLVREIAENGVDPTPLWKSYVDAG
WTELTDPENAVELAIVCEEMGRATDPTPFLSTMTQYAPLAADRFDPQQAG
AAVYDGISAVRDTEGWVLDGAARYVLDGDRADRLAVVTDAGVFVVDAAVA
IRRRSPVFDPVLHVADVSFDAVRVPDTDRVRTDSERARHLALTGIAVTTV
GACQRILDLALDHVKQRQQFGVPIGSFQAVQHKAVDMHVAVERARALAYF
AALTIAADDPRRRLAASMAKAAAGECQSLVFRHGLQLFGAMGFTWENDLQ
FALKRAKAGELLLGGAAEHRATIAEEFHAADF
119869786YP_939738.1 hypothetical protein Mkms_3755 [Mycobacterium sp. KMS]MLKLSRKNIAITLGGLAVAIPLSAGVASAQPNLGPIINTTCTYDQVIAAL
NDQHPDLAAQFAQQRSGQQAVRNFLAASPQQRQATVAFLQSNPTAQAYFG
PISNVAATCNNY
119869784YP_939736.1 cytochrome P450 [Mycobacterium sp. KMS]MSSVDDLRGEPASSDRKKNSYHFDRHTPEYRLQFEKITEEMQTKCPMAWS
DTYGGHWVAADSRHVFELARCPAVSNHHDISGETPFQGITIPKASRATVV
RGGILEMDEPEHSAYRGALNPYLSPAAIKRWEPFVDEITRAALDEHIESG
RIDFVEHLANVVPAVFTLAMMGISLKKWNVYSEPTHASVFTPEHSPEREK
INEQHREMGIDLITNMMEIRENPRPGLVNALVQLRIDGEPAPDMEILGNL
GLIIGGGFDTTTALTAHALEWLGEHPDQRERLSRERATLLHPATEEFLRF
FTPAPGDGRTFADDVEVEGQQFKKYERLWLSWAMANRDPSVFTAPNEVIL
DRKGNRHFSFGIGVHRCVGSNVARTVFKSMLTAVLDRMPDYVCDPEGTVH
YDTIGVIQGMRNLPATFTPSKPLGPGLDETLEKLQRICDEQELARPITER
KEAAVID
119869782YP_939734.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MGRVEGKVAFITGAARGQGRSHAIRLAEEGADIIAIDICADIETVGYPLA
TREDLEETAQYVEKAGRKAVIAQADVRDAAQLKQAVDNGVAELGHLDIVV
AQAGIAAMKGAPPMQAWTDGINTNFVGTINAIQVALPHLKEGASIIATAS
AAALMDASKKDRPGADPGGMGYMTSKRLISQYMHDLATELAVRNIRANVI
HPTNCNTDMLQSEPMYRSFRPDLEKPTRADAELAFGVQQAMPVPFIEPED
ISNAVLWLASDESRFVTGMQLRVDAGGYLKWYDYHV
119869780YP_939732.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MAQTPTVSADRQSAAGSRAGDVQADRRLLIDGRLVDTGRVFPSLNPATGQ
VLGYAPDATVADAEAAVAAARRAFDTTDWATNVELRLRCLDQLHTALVEH
RDELAALTIAEVGATEALCQGAQLDQPIAIVRYYADLLADYPMTEDLGNI
ESRGMQHHRWVEKEAAGVVAAIIAYNYPNQLALAKLAPALAAGCTVVLKS
APDTPLITLALGELIAEHTDIPAGVVNVLSGADPEVGAVLTTSPDVDMVT
FTGSTPTGRRIMAAASETLKKVFLELGGKSAAIVLDDADFNTAALFSAFS
MVTHAGQGCALTSRLLVPARHKDEIVEKIKNNFGLVRFGDPADPSTYMGP
LISEKQRDKVDGMVQRAVAAGASLVTGGEKVDPGYFYSPTLLADVDPDSE
IAQEEVFGPVLVVIAYEDDDDAVRIANNSIYGLSGAVFGSEERALAVARR
IRTGTFSINGGNYFSPDSPFGGYKQSGIGREMGTAGLEEFLESKTFATVV
G
119869778YP_939730.1 hypothetical protein Mkms_3746 [Mycobacterium sp. KMS]MARGSGPERWTPGLPQVKNLAGPMAAVGGLFAMSADAIRNVFRRPFQWRE
FLEQSWFVAKVSLAPTVLVAIPFTVLVSFTLNILLRELGAADLSGAGAAF
GAVTQVGPLVTVLIVAGAGATAMCADLGSRTIREEISAMEVLGIDPVQRL
VTPRMLASGLVALLLNSLVVIIGILGGYTFSVFIQDVNPGAFAAGITLLT
GVPEMIISCVKALLFGLIAGLVACYRGLTVSGGGAKAVGNAVNETVVYAF
MALFAINVLVTTVGIHMASE
119869776YP_939728.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MKGSAVRPLTGLALLVAIGLIIALAIGLFAGTFTRTVPVTVVSDRAGLVM
NPDAEVKMRGVEVGRVETIERRPDGKAVLHLAMNPSQLHLIPSNVNVDIA
STTVFGAKFVRFFPPEDPSPEKLRKGQVIEGQHVTVEVNTVFQQLVEVLD
KIDPAKLNETLGAISSAFNGRGEKFGQTLVDLNAVLAKIEPSLPNLAQDI
EASVPTLTAYGDAAPDLISAVQNTTQFSNTIVDQQQNLDEFLVSAIGLAD
IGNEVIGGNREALGDVLENLVPTAELLNTYKKSLWCGIGGLIPFAKSGPQ
YSGIMVSAGLTLGVERYRYPGDLPKVAAKSGGRDYCKELGLPELPPEFVP
PMVVGDVGSNPAQYGNAGILLNSEGLKNWLFGPLDGPPRNTAQIGMPG
119869774YP_939726.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MDKYRGSQLIKAGIIGVVLMILVIMIGLQPIRLLSWATALRYQALFTEAG
GIAGGNDVTVSGLKVGQVSSVELVNGDALVSFTVDGKYALGSDTTAHIRT
GTLLGERVLALESEGSGTLDRDQPIPTSRTSSPFSLTDAVSELTANTAET
DTDSLNRSLDTLSETLDQIAPQLGPTFDGVSRLSRSLNNRNESLAELLKT
AGDVTGIFSERSQQVNSLILNSNDLLAVLNERRYAITSLLRSTAAVSREL
TGVVAENEQELAPTLKHLNEVMAMLERNRDNLAKILPGAAKYYLTQGEIV
SNGAYYNALVPNIQPAQLLQPFLDYAFGFRRGMDAGQPPDDAGPRAELPF
PINAIPQPGDLPDDGTP
119869772YP_939724.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MKRLTVAGSCLALTLTGCSFQGVNSLPLPGAEGTGPGATSYTVEIANVAT
LESNAPVLIDDVVVGSVRKMTVDDWHAEVQISVKPDVVVPANAVATVGQT
SLLGSMHLALNPPLGESPEGRLQAGATIPLSDSSTYPSTERTLSSLSVVA
NGGGLGQIGDIIHNFNLALSGREPEIRQLITRLDNFVGVLDAQRENIIAS
IQQLNRVAGTFAGQRDAIDRALKEIPPALDVLISERPRLTAALDKLGKLG
DTATALVEDAGDDLVKDLENLGPALGALADIGPDLNLALLWASAFPYGPT
FADRITRGDYINLFATFDITYPRLKKTLLLGTRWGDENAKLIPAPGDPYY
LNYSYSPMSIGVAPPPAEAPAGATMPPVSGPLLPVSPPPPAAPWLPQAPV
STSAQIFAGPYGAESAPPADAQLPAPPADAQLPAPPADAQPPAPPADAQP
GGGG
119869770YP_939722.1 hypothetical protein Mkms_3738 [Mycobacterium sp. KMS]MRGFDIAVGAAAIALVASVGVATPAAASNFGVELNGTYSVMSDGEWALRN
AGPFGMGGAQSFFDQQTVVETWTVTTECVSPIECFGEVKSDRGYTATIRL
EDFWLIDHDVPNWLPCPNGTFAPGHQKFILEGVNPARNEFVNNPDFLVGR
NVTKSASGACGRNQPVVVEMPVKMQKLS
119869768YP_939720.1 cytochrome P450 [Mycobacterium sp. KMS]MTADFDSVDYFTDPSLVPDPHPYYDHIREKNPVCCPINNGVLAVTGWEAA
NTVYKDSENFSSCVAVMGPFTPMPFTPEGDDICAQLEAHRTEIPMYEHMV
TMDPPQHTDARSILSRLLTPKRLKENEDFMWRLADRHIDEFIADGQCEFL
AAYAKPFSLLVVADLLGVPEEDHEEFREAFGAERPGSNIGGLDHEVIAAN
PLAWADEKFSRYIEERRESPRDDVLTSIATAKYPDGSTPEVVDVVRTATF
LFAAGQETTAKLLGAAMRVLADRPDIQQQLRDDRSLIPVFIEECLRMDSP
VKSVFRMARKTTTLGDAAVPAGTTVMVSPGAANRDPKRFDNPHEFSLDRK
NVREHIAFSRGIHSCPGAPLARVEGRVSIERILDRMADITVSEEKHGPID
ARRYVYEPTFILRGLTEINIEFKPVG
119869766YP_939718.1 hypothetical protein Mkms_3734 [Mycobacterium sp. KMS]MKLSQTNGRTRRSVLPTLIAATAIAAGGVLFAPTQAGAQGPPPLPPLHNV
KYTVFAEQPFFVDIYYRDVDPENWAAYSHNPYVYSPKVAAQVGPDQQWNL
DVQLAKPDQWAMVTATSGPGEQTPNIHCVLAVDGVVVATHQGPKGALCSI
RKW
119869764YP_939716.1 hypothetical protein Mkms_3732 [Mycobacterium sp. KMS]MAKALAPEISTWPEDQPQLIGSRCGRCEATTFPVQNHCPKCSAGEMSPVL
LPRRGTLIAWTTQGFPPGAPYKGPTGKDFAPFGVGLVQLEDVIRVEGRLT
ENDPARLEFGMPVELTMIPFTKDEDGEDIVTFAFQPV
119869762YP_939714.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MREIPVELIKRYEQEGWWTPETLGELLARHLATGPDTGFCVYSDVRPYRG
TFGDVELQARRLAAGLRRRGVGPGDVVAFQLPNWAEAAMAFWASAFLGAV
VVPIVHFYGRKELAHIMATARPKVFITVAEFGRMTFQPDLCADVPIVGLV
GEAGFDELFDDESMTDTVHTDPAGPALIAFTSGTTRDPKGVIHSHQTLGF
ETRQLLENYPPDRGRQLTATPVGHFIGMVGAFLIPVLENAPIDLCDVWDP
GKVLGLIETEGLSVGGGPPYFVTSLLDHPDCTPEHIARFSTVGLGGSTVP
AAVTRRLADLGLFVFRSYGSTEHPSITGSRPTAPEDKRLYTDGDPRPGVE
IRLTDDGEILSRGPDLCLGYTDDALTAQAFDDDGWYHTGDVGVLDADGYL
TITDRKADVIIRGGENISALEVEEVLLSMPAVAEAVVVAAPDARLGEHAA
AVLRLRNGHPMPTLDDVRAHFEHAGVARQKWPEELHQVDEDFPRTASGKV
QKVLVREQIRQCSPTRDIAAFSK
119869760YP_939712.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. KMS]MTYVPKWSTIPEMVLSAADRFGDAEAVVDGPLRLSFAEVVHRIRCAAGAF
ADLGIGKGDRVAIWAPNSAEWIIAAFGLLTAGGVLVPVNTRFKGEEAADV
ITRSGARAVLVQQGFLGVEYAAPEGVPVIDLKSDFLAGGEPFSRTVDSSD
ISDIIFTSGTTGRPKGVMMNHRQNLRLYEEWCNLADLRQGDRYLMVNPYF
HTFGYKAGLIASFIRGATMVPVPVFDVDRVVDLIAAERITMLPGPPTLYH
SLLSVADKSKLATLRAGVTGAADIPVELVRRVLEELPFQTLATGYGLTEA
GTATLSRPGDSFADIATTVGTACDGVEVRIADDGEVLVRGYSVMQGYLDD
PAATAEAIDPDGWLHTGDLGTLDDAGRLRIVGRKKDMFIVGGFNAYPAEI
EGFLLEHPDVAQAAVIGVPDERMGQVGKAFVVRRDGHAGPLSAEGLIAWS
RERMAGFKVPRYVEFLDELPLNATGKVMKDQLR
119869758YP_939710.1 twin-arginine translocation pathway signal [Mycobacterium sp. KMS]MTEKDDASVTDTSVTDVEPSVDEIDRRDESLEDVSEGESEGAVQSRRRLV
GAVGMAVLAIALIASVGATAWLYFFQFRPDQETDSEAAKVAIDAASQASV
SLLTYSPETLDKDFAAAKTQLTGDFLDYYTDFTEKIVTPAAKQKQVKTSA
AVVQAALSQLSPESAEVLLFINQTTTSKENPDGAYAASSVKVGMTKIDGA
WKISSFDPV
119869756YP_939708.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MRPWIVWATGLLAYIVAVMDRTTLGVSGLDAAERFSATPSVLATFVVLQV
VVYAGAQVPAGVLLDRFGSKVLIAAGAALMAAGQLTLAVSEALPAAIAAR
AVLGLGDALTFISVLRLVPHWFTPKQVPLVTQLTGICGQLGQVLSAVPFL
AILGVAGWTTAYTSGAALGLASLVLTLVLVKDTPSGRHVPESRGTVGDTL
RSVKTVWLRPGTRLGFFTHMGTQFSVTVFALMWGVPYLTVSQGLSTSAAG
TLLSVSVASAIASGIVIGVLTGRHPHRRSWLVLGIIGSNALVWTVVLALP
GRAPLWLLVTLVIVISVGGPGSMVGFDFARTFNPSATLGTAQGMVNMGGF
LASLLVMQAMGQILDATGGYSFESFRWAWTAQYAVWTLATVGILITRGKA
RRGMRLEQERMLLESFEAHPAPRSEG
119869754YP_939706.1 hypothetical protein Mkms_3722 [Mycobacterium sp. KMS]MAAPAVLGMSAGLQAVASALAPTAAAAPLGVLLDYAAGVLKATDIRASGA
IGAIRYVSDRRPGGAWMLGKPILLSEARDLYQNGLKIVSCYQFGKADTAD
WLGGQNAGVQHAKRGWELHVAAGGSYGAPIYASIDDDPTFEQYKQQVAPY
LKGWEAVLGRQRVGIYANSKTIEWALQDGIGTYFWQHNWGSPGRVAHPAA
HLHQVEIDARTVAGVGVDINHILRPQFGQWD
119869752YP_939704.1 4'-phosphopantetheinyl transferase [Mycobacterium sp. KMS]MAIVGVGIDLVSIPDFAEQVDRPGTVFAETFTPGERRDAADKSSSAARHL
AARWAAKEAVIKAWSGSRFAKRPALPEGIHRDIEVVTDMWGRPKVRLTGD
IAEHLREATIHVSLTHEGDTAAAVAVIEEP
119869750YP_939702.1 hypothetical protein Mkms_3718 [Mycobacterium sp. KMS]MKRRPTTLVPMSDVVARVQEVLPSVRSDLEDLVRIESVWADPARRDEVQR
SARAVADLLGAAGFDDVSIVAEGGAPAVIARHPAPPGAPTVLLYAHHDVQ
PEGDPGQWSSPPFEPTERDGRLYGRGTADDKAGIATHLAAFRAFDGKPPV
GVTVFVEGEEESGSPSLANLLAAHKESLAADVIVIADSDNWSTDRPALTV
SLRGLADCVVEVATLDHGLHSGLWGGVVPDALTVLVRLLASLHDDDGNVA
VAGLHEGSAADVDRGPDWVREESGLLPGVSEIGSGSVVQRLWAKPAITVI
GIDTTPIDKSSNTLIPRARAKISMRVAPGGDAKAHLDALTRHLEAHVPWG
ARLTVTPGDTGQPYAIDAAGPVYDAARAAFTQAWGATPVDMGMGGSIPFI
AEFAAAFPQATILVTGVEDPGTQAHSVNESLHLGVLERAATAEALLLEKL
GAS
119869748YP_939700.1 hypothetical protein Mkms_3716 [Mycobacterium sp. KMS]MADRDPEAIKKDIDAARDQLALTVDSLAERANPRRLADDIKTQVIRFVSQ
PPVAVSLAGVTLLIVVVAVRRRR
119869746YP_939698.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium sp. KMS]MWQVRSVTRPRRQRAWWAGMLVVPAMVLGLTSCSSDSEEQAQQVITDKGT
PFGDLLVPKLTSSVTDGAVGVAVDSPVTVAAEGGVLGSVTMVNEDGEAVS
GKLSQDGLTWATTEPLGYNKSYTLTAKSMGLGGVTSRQMTFETHSPENLT
MPYVLPNEGEVVGVGQPVAIRFDENITNRLAAQRAISVKTDPPVEGAFYW
LSNQEVRWRPAEYWEPGTKVQVEVNTYGVDLGDGLFGQDNVKTQFTVGDQ
VVATADDSTKTLTVRRNGAVVKTMPISMGKNSTPTNNGTYIIGDRYSHLV
MDSSTYGVPVNSPNGYRTEVDWATQMSYSGIYVHSAPWSVGSQGQSNVSH
GCLNVSPSNAKWFFDNTKRGDIVEVVNTVGSVLPGTDGLGDWNIPWEQWQ
AGNAGV
119869744YP_939696.1 hypothetical protein Mkms_3712 [Mycobacterium sp. KMS]MTSESTDGRAAGIAAGYATEGQALELGTVVVDGVADPAARVRIPLATVNR
HGLVAGATGTGKTKSLQVLAEQLSAAGVPVLMADVKGDLSGLARPGEPGE
KVSERAADTGDAWTPTAYPVEFLTLGTGGVGVPVRATVSSFGPILLSKVL
GLNQTQESTLGLIFHWADQKGLPLLDLKDLRSVIHFLTSEEGKPELKALG
AVSSTTAGVILRTLINLEAEGADTFFGEPEFEPDDLLRLHADGRGVATLL
ELGSQAARPVLFSTFLMWVLADLFTTLPEVGDLDKPKLVFFFDEAHLLFA
DASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDVPNGVLSQLGARVQHAL
RAFTPDDEKALRKTVRTYPKTDVYDLQSALSTLGIGEAIVTVLSEQGVPT
PVAWTRMRAPRSLMDTIGAEAITAAATASPLQAEYGQTVDRESAYERLAA
RLAPPPVAPPADLPPVPPPYDIPPMPAPAPEPGLFDKVMDSPAFKSAMRS
AGTVIGREITRSIFGTGRRRRR
119869742YP_939694.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MTQHAPKPPPSAPTAGRARIVAWALWDCGNTGMNAIVATFVFAVYLTGAV
GSDLPGDTSATSWLGRAMTVAGLVVAVLAPVTGVWVQAPRRRRVVLTVLT
GTAVLLTASMSLIRDDHRYLWAGLVLLACTAACGDLASVPYNAMLRQLAG
PQRSGRISGIGWASGYLGSVFLLLLVYVGFVSGDGDTRGLLGIPVSDGQN
IRAAMLLAAAWFLLFALPLLLTVPPHLPGADEVDPDQPSGVFAAYRRLWT
EIAGEWRRDRNIVYYLLASAVFRDGLAGVFAFGAVLGVSVYGISEADVLL
FGVSACVVAAVGAVIGGLIDDRVGSKPVIVVSLTAMIAVGLTLLSLSGPS
AFWVCGLLLCLFIGPTQSSARTLMLRMSPPGKEGVAFGLYTTTGRAVAFL
APWLFFMFIDLFDSDRAGMAGLCVVLAAGLAAMLAVRAPHRRPALAHADA
EGQP
119869740YP_939692.1 peptidase S9 prolyl oligopeptidase [Mycobacterium sp. KMS]MIADADTVRGGRSVARTRTTKSEENQRVRRQVRANYGASLSPDATAFAHL
VDDGGFPRAVQRFLLGWRASSSRDVELPVEGPVTRVMHSADGHWLACQVA
PDGSDRFQIWVVTTDPDDRDARRIDSWPMDQPDGSAELIGWDGTQVAAIL
TGEDGVGSSCLIDPADGATIVLDRRTAGRLVDAWAGAALVRVGPRGYRDL
IMLRGLTETALLPYDPGSTTDLGFILDDHSPRRLRSGPMGESFTLYHPAK
DYGLNSTEGYVRALIRSDNGGSHARLIEVTTTAEGVSYHVVAEKPGFDLD
EFVVSDDMSTVALLWNVNGCSELQILEYADNTLSEPIPLPGLVATELTIS
AGGSMVAMTVESPSLPPTVELVDPRSREWQRVDREPSEGPLTADPTLEVV
VARDGMELTGWLYRPPAPVEPVGAMIFLHGGPEGQSRPGYNEYYPALLAA
GITVFTPNVRGSGGFGRAFMHADDKELRFAAIDDVADCVRYLIEHEAVPA
DRVACCGWSYGGYLTQAALTFHPELFAAGISICGMSDLNTWYRNTEPWIA
AAAYPKYGHPIGDRDLLERLSPLLRAPALTAPLLLVHGGNDTNVPPSESQ
QMFDALRALDRTVELLVFDDDGHEIVKRENRAALVNAMTTWLLKAFSAAS
VL
119869738YP_939690.1 hypothetical protein Mkms_3706 [Mycobacterium sp. KMS]MIILGIILVVLGFVLGMNILTTIGAVLIVIGAVFWILGATGRAVGGRKVW
Y
119869736YP_939688.1 propionyl-CoA carboxylase [Mycobacterium sp. KMS]MAPRASHRDAHTALVEELRTKLAGAALGGPAKSRERHVSRGKLLPRDRVD
GLLDAGSPFLEIAPLAADGMYDDECPGAGMIAGIGRISGRECMIVANDAT
VKGGTYYPVTVKKHLRAQEIAGQNRLPCVYLVDSGGAFLPRQDEVFPDRD
HFGRIFYNQATLSAQGIAQIAAVLGSCTAGGAYVPAMSDEAVIVRNQGTI
FLGGPPLVKAATGEVVSAEDLGGGDLHSKTSGVTDHLAHDDRDALRIVRR
IVGTLGRPQPPPWDVAPAVDAVADQSELYDVVPVDSRVPYDVHEVITRIV
DGGEFAEFKAEYGTTLVTGFARIHGHPVGIVANNGVLFGESAQKGAHFIE
LCDKRVIPLLFLQNIAGFMVGRDYEASGIAKHGAKMVTAVACARVPKLTV
VIGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRGEM
TPEQEQEFKAPIREQYERQGNPYYSTARLWDDGVIDPADTRTVVGLALSI
VGQAPLEPVSYGVFRM
119869734YP_939686.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTDFLASGTLPDHYEQLAKTVRDFARSVVAPVAAKHDAEHSFPYEVVRGM
ADMGLFGLPFPEEYGGMGGDYFALCLALEELGKVDQSVAITLEAGVSLGA
MPVYRFGNEDQKREWLPQLTSGQALAAFGLTEPGGGSDAGAPKTTARLDD
GHWVINGSKQFITNSGTDITKLVTVTAVTGEVDGRKEISSILVPVPTQGF
TAEPAYNKVGWNASDTHPLSFDDVRVPEENLLGERGRGYANFLRILDEGR
IAIAALSVGAAQGCVDESVRYAKEREAFGRTIGSNQAIAFKIARMEARAH
TARAAYYDAAALMLSGKPFKKQAAIAKLVASEAAMDNARDATQIFGGYGF
MNEYPVARHYRDSKILEIGEGTTEVQLMLIGRELGL
119869732YP_939684.1 HpcH/HpaI aldolase [Mycobacterium sp. KMS]MTLGNNGPGWLFCPADRPERFEKAAAAADVVILDLEDGVAARDREAARAA
LVDTPLDPSRTVVRVNPTTTPDHALDLQALARTDYTTVMLAKTESAEQVS
ALAPLEVVALIETPLGALTVVESSRVDNTVAVMWGAEDLLAVTGGTSSRW
PDGSYRDFAVHVRSRSLLAAKAYGRMALDSVYLDIKDLDGLRAETDDAVA
VGFDAKVAIHPTQVAVIRDGYRPTDEQVDWARRVLDTAHDERGVFQFEGI
MVDAPVLRRAERIVALAPHPGS
119869730YP_939682.1 transketolase [Mycobacterium sp. KMS]MTQLIERPTGADDHDRFFTDVPTVTELTMVQAINRALHDAMAADDRVLVF
GEDVATLGGVFRVTDGLSETFGEQRCFDTPLAESAIVGIAIGMAIRGFVP
VPEIQFDGFAAPAFDQVVSHLAKYRMRTRGDVDMPVTIRIPSFGGIGAVE
HHSESTETYWLHTAGLKVVTPSSPTDAYWLLRHAIAARDPVIYLEPKRRY
WARGAVDTTEPGLPIGRAAVRREGTDVTVLTYGPLVATALSAAEHAAAES
DWSLEVVDLRSLNPLDFDTVAASVGKTGRAVVMHEGPRTLGFGAELAARI
SEELFYDLEAPVLRATGFDTPYPPARLEKLWLPGVDRLLDCVQRTLEMP
119869728YP_939680.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MADSVLMQVDDHVALVTVNDPDRRNAVTFEMSAALRAAVDAAEADPEVHA
LIVTGAGKAFCAGADLTALGEATEDGLRRIYDGFLAVAHCPLPTIAAVNG
AAVGAGLNLALAADVRIAGPNALFDPRFQKLGIHPGGGATWMLQRAVGPE
VARAALLFGMRFDAEAAVRHGLALEVADDPVATARQLAAGPAAAPREVVL
ATKASMRATASPGTVDTEQHRTAVDIELGPQAASIESPEFARRLAAAKRK
119869726YP_939678.1 UspA domain-containing protein [Mycobacterium sp. KMS]MSTAVHPGIVVGVDGSVGSHAAVRWSAREAVMRRVPLVLVNVLATDVTAA
WAMAVPAAPLPAEYFESREQDARAVLAEAETVAKDAGAVDVTTELVQAAA
VPGLVDVAKEADMLVVGTRGHGAVKRLLLGSVTTGLLHHARCPVAVIGPD
ADQPSETGPVVVGVDGSRASQRAVEIAFEEASMRGVDLVALHSWSDRNES
LHPYVDWATVRAPAEETLAVSLAGWCERYPDVTVHRESVFDRPVEHLLER
SESAQLLVVGSHGRGGFAGMLLGSVSTAVVQAARSPVIVARGR
119869724YP_939676.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. KMS]MSPDDGQQSERRPMRLPGSVAEILAAPEGPQVGAFFDLDGTLVAGFTGVI
MTRDRLRRRQMSVGEFIGMVQAGLNHQLGRSEFEDLIGKGARMLRGSSLS
DIDELAERLFLQHVRDRIYPEMRALVRAHMARGHTVVLSSSALTVQVEPV
ARYLGIQNVLSNKFETDDNGCITGEVVRPILWGPGKAHAVQAFAARNGVD
LSKSYFYADGDEDVALMYLVGNPRPTNPAGKLAAVAAKRGWPVLRFSSRS
GSSPLSQLRTVAGIGSVLPVAASALGVGLLTRNRRTGVNFFTSTWSRLLL
TTAGINLNVLGRENLTAQRPAVFIFNHRNQADPLIAGRLVETDFTAVGKK
ELENDPLIGTIGKVMDAAFIDRDDPKAAVEGLRKVEELAGKGLSILIAPE
GTRLDTTEVGEFKKGPFRIAMSARIPIVPIVIRNAEVVAARDSSTFNPGT
VDIAVYPPIPTEDWTLQDLPDRIAEIRQIYLDTLKAWPHGNLPVPALYKR
SPGEAVEPRKVEDKPAKKAAKKAAKKTPAKKTPAKKAAKTAEPQPKTSAN
GRSQPGVKGRQ
119869722YP_939674.1 copper resistance D domain-containing protein [Mycobacterium sp. KMS]MTTVAVKTRPSAVWPVLVGVAALAGLTAAGIGALSLADALTATGLPDPGP
VTTYGLPFVRAAGEIAAVTAVGAFLFAAFLVPPQANGVLDVAGYRALRLG
TAASAVWTVCAVLLVPLTVSDVSGQALRDHLNPVEIWSVAGQVDVASAWR
WTALLAAVVTLAALPVLRWAWTPPLFAGSLLTLMPLALTGHSSSGGAHDL
ATNSLVIHLVAGALWAGGLLALLVHALRGGEHGDVAARRFSAVALWCFVA
MALSGVINALVRMSPADLFRTEYGGLVLAKAAALTVLGVLGYLQRRKGVA
GLQADPGARGPLVRLALVEAVLFGATFGIAVGLGRTPPPPPGRQPTPVEV
EIGYDLAGPPTVTRILFDWRFDLILGSAAIILALVYLAGWWRLRRRGDAW
PAGRTVAWLLGCATLLITTSSGLGRYMPAMFSVHMVAHMLLSMLVPILLV
LGAPVTMALRALPVAGKGKPPGPREWLLAALHSRVSRVLTHPIVALALFV
AGFYGLYFGGLFEAAVDDHAAHVVMNIHFLLSGYLFYWVVIGVDPTPRRI
PQLAKLAIVFASLPLHAFFGVVLMGMNSVLAEDFYRSLHLSWHNDLLADQ
KLGGSIAWAAGEIPLVLVLLALLIQWRRSDDRDAKRLDRAAERDHDADLA
AYNAMLAELARRDGR
119869720YP_939672.1 putative ABC transporter ATP-binding protein [Mycobacterium sp. KMS]MAEFIYTMRKVRKAHGDKVILDDVNLNFLPGAKIGVVGPNGAGKSSVLRI
MAGLDTPNNGDAYLAPGASVGILQQEPHLDETKTVRENVEEGVPIKGKLN
RYNEVAELMATDYSDELMEEMGRLQEELDAADAWDIDSQLEQAMDALRCP
PPDEPVTHLSGGERRRVALCKLLLSKPDLLLLDEPTNHLDAESVLWLEQH
LASYKGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGNYSTYLEKKAER
LEVQGKKDQKLQKRLKEELAWVRSGAKARQAKNKARLGRYEEMAAEAEKS
RKLDFEEIQIPTPPRLGNVVVEVEHLDKGFEGRTLIKDLSFTLPRNGIVG
VIGPNGVGKTTLFKTIVGLEQPDSGVVRVGDTVKLSYVDQNRAGIDPKKN
VWEVVSDGLDYIEVGQNEIPSRAYVSAFGFKGPDQQKPAGVLSGGERNRL
NLALTLKEGGNLILLDEPTNDLDVETLSSLEHALEQFPGCAVVISHDRWF
LDRTCTHILAWEGDDDNEAKWFWFEGNFGAYEENKVQRLGAEAARPHRVT
HRRLTRD
119869718YP_939670.1 hypothetical protein Mkms_3686 [Mycobacterium sp. KMS]MTAGFVAPVHVRWSDIDMYQHINHATMVTILEEARIPFLREPFEARITDI
GLLIADVHITYKGQLRLIDSPLQVTMWSKRVRAVDFTIGYEVRSVGAPAD
SKPSVIAETQLAAVHIEEQRLERLTPEQRTYLQRYLR
119869716YP_939668.1 alpha amylase [Mycobacterium sp. KMS]MGAMAHPPTADQPWWSRAVFYQVYPRSFHDSDGDGVGDLDGVTAKLDYLS
ELGVDALWLNPVTVSPMADHGYDVADPRDIDPLFGGIDALDRLIAAAHDR
GIRITMDLVPNHTSSAHPWFQAALAAGPGSAQRERYIFREGTGPDGLLPP
NNWISVFGGPAWTRIVEPDGQPGQWYLHLFDPEQPDLNWDNPEVFEDLEK
TLRFWLDRGVDGFRIDVAHGMAKPPDLPDMEIAENRMLAETASDPRFDHQ
GVHDIHRNIRSVLDDYPGAVAVGEVWVYDNAAFAAYLRADELHLGFNFRL
VRADFDADEIHDAIENSLAAVALENATPTWTLSNHDVEREVTRYGGGALG
LARARAMALVMLALPGVVFVYNGEELGLPNVDLPDEVLQDPVWERSDRTE
RGRDGCRVPMPWSGDAPPFGFSTTADTWLPMPAEWSSLTVERQLAEPDSM
LHFFRRALRLRRDRCGVDGATLTQLSAEDGVVTFRTDGGLTCVLNAGERP
VDLPPGEVLLASAPLQAHSPSLRSPQDRRLPPDTAAWVV
119869714YP_939666.1 HNH endonuclease [Mycobacterium sp. KMS]MAHRKKSPSRPTGHKRAAAVGPSGPAASARVLHSVEIHGGETAASIHDGS
LWGRRRVLLLNSTYEPLTALPLRRAVVMLICGKADVVHEDPSGPVIHSAT
RSISVPTVIRLRSFVRVPYRARVPMTRAALMHRDRFRCAYCGAKADTVDH
VVPRSRGGDHSWENCVAACAPCNHRKADHLLAELGWTLRHVPLPPKGQHW
RLLSTVKELDPAWMRYLGEGAA
119869712YP_939664.1 hypothetical protein Mkms_3680 [Mycobacterium sp. KMS]MASGEVQVTGHRAAVERQGLPYGWALTSSGRLSGVTEPGTMSVDYPFATK
DLVVLDDALKYGSRAAKARFAVYIGDLGADTAATAREILSQVPTPNNAVL
LAVSPDQRAIEVVYGVDVKGRGIETAAPLGVSAAAASFKEGNLIDGLISG
IRVLSAGVSPR
119869710YP_939662.1 aminopeptidase N [Mycobacterium sp. KMS]MALPNLTREAAVERAALITVDNYRIELDLTDGAGAPGEKTFHSVTTVTFD
ATPGADTYIDIAADTIRAATLNGHDVDVSGYDESTGIPLAGLAEHNVLVV
DADCRYSNTGEGLHRFVDPVDDEVYLYSQFETADAKRMFACFDQPDLKAT
FDVTVTAPAHWEVVSNGALEGSRDDRAAQANGGTKTHVFVQTPRMSTYLV
ALIAGPYARWDDLYRDEHGEIPLGLFCRKSLAEFMDAERLFTETKQGFGF
YHNNFGVPYAFGKYDQLFVPEFNAGAMENAGAVTFLEDYVFRSKVTRASY
ERRAETVLHEMAHMWFGDLVTMTWWDDLWLNESFATFASVLCQAESTEYT
EAWTTFANVEKSWAYRQDQLPSTHPVAADIPDLHAVEVNFDGITYAKGAS
VLKQLVAYVGLESFLAGLRDYFRDHAFGNATFGDLLGALEKASGRDLSGW
GRQWLKTTGLNTLRADFDVDADGRFTRFAVTQSGAAPGAGETRVHRLAIG
VYDDDPTTGKLVRVHREELDVEGESTEVPALQGVPRGKLVLVNDDDLTYC
ASRLDPDSLQTVLTRIADIAEPLPRTLAWSAAWEMTREAELRARDFVALV
MSGVHAETEVGVAQRLLLQAQTALNSYADPQWARETGWPAFADRLLDLAH
ESAPGSDHQLAFVNALCASVLSRNHVAVLATLLDNEPAAVNLTGLVLDTD
LRWRIVTALAASGDIDADGPETPFIDAEAERDPTAAGRRHAAAASAARPQ
PAVKEAAWQQVIEDDTLANITTRSIVGGIVQPGQQALLAPYTEKYFAAIA
GVWERRSSEVAQTVVIGLYPSWDISDEGLAAADRFLSGDVPPALRRLVLE
GRAGVERALRARKHDVS
119869708YP_939660.1 DSBA oxidoreductase [Mycobacterium sp. KMS]MPEKSRADFWFDPLCPWCWITSRWILEVEKVRDIDVNFHVMSLAVLNEGR
DLPEEYQEAMKRAWGPVRVAIAAEQAKGADVLGPLYTAMGTRIHNRGYGE
SDPDFTAVISESLAEVGLPAELAEAATSGEYDEALRKSHHEGMDPVGDDV
GTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFWELKRTRT
EKPSFD
119869706YP_939658.1 zinc-binding CMP/dCMP deaminase [Mycobacterium sp. KMS]MPSPPRPVTSVADMLDVAYAEARKGLSEGGIPIGAALFSAGGTLLGSGHN
RRVQDDDPSVHAETDAFRNAGRQRDYRSTVMVTTLSPCWYCSGLVRQFNI
GAVIVGESRTFTGGHEWLAEHGVEVTVLDDDRCVSMMTEFIDAEPDLWNE
DIGR
119869704YP_939656.1 ribose-5-phosphate isomerase B [Mycobacterium sp. KMS]MAAMRVYLGADHAGYELKQVIIEHLRSTGHEPVDCGAFDYDADDDYPAFC
IAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAR
EHNNAQLIGLGGRMHSEADALAIVDAFLATPWSKAERHQRRIDILSEYER
THEAPPVPGAPA
119869702YP_939654.1 sodium/hydrogen exchanger [Mycobacterium sp. KMS]MELILVVVGAIVVTAIAHRRGLEPALVLVVVGFAVSFAPDFNGIELESDV
LLSVVLPPLLYSAALSFSFPTFLRNIRPILGLGVGLVVITTFAVAGLASW
LVPSLTFGTALILGAVVAPPDAVTAVAVGRRLGLPKKVMAILTGESLVND
AAALSLFSIAVAQVAGTRAFIENPVLLFGYSALLGPVVGAALGFITLWIR
RRLANPGLETIQGLVVPFAAFISAEHLHASGVLAVVVAGFVVGHGSLDAG
YQTRLQERYVWNSVDVMLEAFVFAYIGLQLRFVLEDLNEAHESLAEVAVA
SAVVLLVVLLIRPVCVFAMFGRGVLSRKVESKLSVPKPEQGGRGALGVRR
RGGAGRLSGLVDRRMLTWQENVVVSWTGMRGVVTLAAASGIPMMTIDGEP
FPERATIQAIAFVVSVGTLLLQGWTLPPLIRWLQPSFEHDRQSDETETRK
AEQVVHAAADDVLNRFADAPPPGLDDATLANIRQTIARHAQDADEMPDPE
SHTPRAEVFSKLYRDVLCAQRNALIAERDAGRIEDEAVRAMLERLDLQEA
GVSARLESRI
119869700YP_939652.1 beta-lactamase [Mycobacterium sp. KMS]MICSTAPLISGCCADEFTGVREAFARNFTDRAEVGAAVAVWVDGELVVDL
WGGSADGSGTRPWRRDTLASIYSGSKGLTSTCVHLLAERGDIDLYAPVAR
YWPEFGRAGKEDITLAMVMSHRSGVIGPRSRLHWSQATDWDAVCAHIAAA
EPWWAPGTAQGYHMVTFGFILGEVVRRVTGRTIGQYLRTEISEPLGADVH
IGLPAAEHHRCAEMVGKPHIRDVLAAGTAPDHPHSLTEHPMAGLAVAMGF
VPDDELGSNALDAWREAEFPATNAHVSALGMATFYNALAQEKLLSRRHME
TVRVCQGGFDTDMVLGPRVADHGWGLGYMLNQRGVAGPNRRTFGHGGSGG
SFAFVDLEHRIGYAYVMNHFDATKCNADPRTVALSDEVYRVLGVRVR
119869698YP_939650.1 hypothetical protein Mkms_3666 [Mycobacterium sp. KMS]MRRRNMAGRLSVVPGAILFACGAIGAAIWLWVKRRQLAVAAAKAVPEQTA
AAATDQVSTVTGAVPGQVDEIKAKRPPSVP
119869696YP_939648.1 hypothetical protein Mkms_3664 [Mycobacterium sp. KMS]MSVNGSRVPAPAIAMISSLESRLVRVKYIAAALVGVCVGALLGGLAFAAM
GTDTTATAFVRLQNPADLTAIAAGASQVTPDNQGNTSNFVGGEIAYLSGE
GFAQAVARKMAMDEPAELNVAQASESAVVTISNSSKSRGDAIRTVQVAID
LYRQELAQRVDEQLRTILAALSRWQQDETVDPVRMQELARIRAAVELQAS
EASTLLVVQPPTPNHDSSGQWLIGVFLGGLLGGSVAVAILLARGRRSGRA
AMTATLTDSVDGVLVPAVDLGAASPDNHDGEQARVARTLYAQCPTARGGV
LLVIGASPSSGSAEVAELLELGAADQPPSVRVRHGGVVGDPTLTPELIAA
ATGIVLVARIDADTAAQAVALRSATADSDAPVVAAFTYHRAGGAHRKKRK
PEVSPRQDVDDAERSMQ
119869694YP_939646.1 hypothetical protein Mkms_3662 [Mycobacterium sp. KMS]MPDTKHLQAGVQVAAGLALNVFPAIFIAIYARIAPIETQGFLALALAVGV
YVAQLFNAFIVEGRLATPDADGELGLPTWVVLLSTAACGLLVFGPAVASS
AILMASAIGVMTGLLMTRSIGVVTGEWKNEGAAAGALIVASLIALWMADQ
GSPHSVRVLAIGALLAVVVRYRPRKAMPRMGFPPDVRRSSWVTAETAVVG
AVQPAITSLLLVLVGPAASVTFRVISTVAGALEPILAYGRYRLLAHGHRG
ELKAFVAVFAVGMAAVLIAAFGGVGSLVFGPAWQDVGVAAMLLACLWKAA
MLVSTVPFAALRKAGKTVLVFWIRGASTVVYLVVSVGLLFVWQNTAAIFL
AFVVAEMITAVVYHFAAVMGAPDYAATFGTRRLRQRFG
119869692YP_939644.1 hypothetical protein Mkms_3660 [Mycobacterium sp. KMS]MTLSRRELLARTSAAAASALLAGCSTNGPRTVVDVRAHGATGDGITDDSR
AVQAAAAALRPGSTLRFSRGTYRFAQRWPPGGAAVVISGLADVRVEFDPG
AELYMDNLHPTKHTGSSHGLLVRGPASRIHLRGLNIRWADGARRSLGDGI
RVEGFPDLDGAQPKGWSGQSRPVTEVTVSDCTVRSSPQTGVVMMGVSDIE
VTGLRVTDSGADGLHFNACRRATVTEYSAVNTGDDGLALVTYFEAEPTFD
PAAHTFSLPELTDWSNADFTVENVNVFGCRANGVRLAGAHRVTVEGLDVV
GVHAGSAFLIDSAEPGTDVGWHYVASRAVRLDDVTATDCDMGIHLLARPG
TSGDPRFTDFDIHVGDATIDDCPTWAVRAESLTDTRVNGMRIDNCSVTTA
STTGGNGGVGVGDANGITFGIMTIRHAEPVIAFQTVNAGALTVEKLGVAI
TRRDRPEGKLDPCVRLDNSDGVIDQLTIGWPAAGDGWVPVRLSEPGPCED
DIGETPLAIRGLTVTPPVERPSAVVCGR
119869690YP_939642.1 putative GAF sensor protein [Mycobacterium sp. KMS]MTGFDEWLNRLLEDCARDAGEDVVSYVARAVASQMVADLRRTERASIDEL
MAHLNECRVFAETEMPSVESEITDPDRLQALYATGLLDSPPDEAYDRITR
AAAAALDAPSAAMSLIDVDRQFFKSSVGMGDDERQTPLDRSVCQYAVANG
SALLLEDARTDPVFRNHPAVRDGTMVAYLGIPLTDKDDNAVGTLCVFDVK
PRLWGTGHVRILSDLAQLAAEKMFGSRAGQQ
119869688YP_939640.1 di-trans-poly-cis-decaprenylcistransferase [Mycobacterium sp. KMS]MGLIPDGLRRWADANKATLVDAYRRGAMKVVDILLALQEHGVQTVSVYNL
SRANLARRDDELEAVFAASTHFFSTLIPANFDHTACGVRIHGDLDLLPDE
YVAAARSVEQTMTGRDFRINILAAYDAADELRAAHRRARQNGCDITAALE
IGDVDLVIRTTPEPLLSGFLPLQSQYAQLMFLTTALNDLQRADIDDLIAD
YRRFPQRRGR
119869686YP_939638.1 hypothetical protein Mkms_3654 [Mycobacterium sp. KMS]MVSQSCRAGGAALAVGIGMLLAPGIAAADPSADAAGTDVSAHAPADTRQD
DHTEKADEETDAPEDNAEDIPEDSAEDEAEDEAAPVEDEDTDAKTGHRDA
DDEEPTEDPVDEPVADDPVEDNEVDPEEPAESPAPVATLTDTVGAGGTPA
PVESPATWAVLAWARRQPFSTTTAANTSARHTTASSSTATPATTVDVKDY
GAVGDGVTDDSAAIKAAEAALASGQRLYFPEGSYRFAQQNPAGNAAVLLK
GLSDVTVEFAPHARLLMDNLDAAEHGTSHGIRVEGAASNVTILNATIEWK
TRPSARSFGDGFSILGWASNTAPPPGWTGSTGTVSNVSLVNATVINAPQT
GAIFMGASDVTVTNFTAIGTLADGLHFNANRRVTVHGLLAQNTGDDGLAF
VTYYDPTLPWTYGPGDGPFNQPGLGEWNNGGSVATNITVTGGAASGVRVQ
GGYDITITDVTVTGKEFGLQVNSAKATGPGDWTSLASRDISISDVTISAT
VTGIVLATNNIDGTEASMWWDFSGLTISDVTIHNSRNWSLAVETPASTTS
RFAGVTLRNIHAEVDADVGPLGGGNGGILLASLRDSVIDGVRLVSVHGSD
INVVGAAQIRSQYSVADLPSSNLTIDDLVLEGPGRILIQDIAGLDVGTVA
SHGANSAAIELFRVKSASFDTIGAYLPGRGNGAGWGVRLLQVHDLDVANI
EVITDDHIGTSWWAVELGGGNPAQDIAGAGVRIDDVTYVSGRDATDSDIV
VQGGPYGPVDWYINATWRHEGEASPLWRAGLWGDAIPSLTS
119869684YP_939636.1 trigger factor [Mycobacterium sp. KMS]MKSTVEKLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAP
RKLLEARVGREAMLDQVVGEAVPGRYTEAVTSSDVQPLGQPEIEITKKEY
GEDLVFTAEVDVRPEITLPDLSALEITVDPIEITDEEVDTELQSLRARFG
TLTGVDRPAKDGDFVSIDLSATVDGKDVPEATTEGLSHEVGSGQLIEGLD
DAIVGLSEGESKEFTTTLAAGEHAGKEAIVTVTVKSIKERELPEPDDEFA
QLASEFDTIDELKESLTEQVRRVKRVQQAEQIRDKALELLLEQTEVPLPE
KIVQAQIDDTVHNAIHGLDHDEDRFAEQLAEQGSSREEFDANTRTEAEKA
VKTQLLMDALADQLEVQVGQGDLTERLVLMSRQYGLEPQQLLQILQQNNQ
LPAMFADVRRGLTIAAVVHGATVKDTDGNDIDTTEFFGPSGGAQAEAEGA
DEADADSDADSDTEADSDTEADEADEAK
119869682YP_939634.1 ATP-dependent Clp protease proteolytic subunit [Mycobacterium sp. KMS]MSNQTDPRLQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVD
DASANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRAD
IQTVCLGQAASAAAVLLAAGTPGKRLALPNARILIHQPALSGVIQGQFSD
LEIQAKEIERMRTLMEVTLARHTGKDPETIRKDTDRDKILTAEEAKDYGI
IDTVLEYRKLSAQTS
119869680YP_939632.1 fatty acid desaturase [Mycobacterium sp. KMS]MAITDVAAYAHLSEADVEALATELDAIRTDVEASLGARDAAYIRRTIRTQ
RLLDAAARILIHRSRGKVGWVLGTVALATAKSIENMEIGHNVGHGQWDWM
NDPEIHSNTWEWDMAGLSSQWRYSHNYTHHVYNNIIGVDDDLGFGVLRVS
PDQEWKPDYLAAPVRNVLLALIFEWGIALHGLHSSRDRALLVGGSKGGRE
LLAKVARQVGKDYVVLPALSGRRFRRTLLANVAANVLRNLWAYVVIFCGH
FPDGADKFDPAVLEDETRGAWYLRQMLGSANFHAGPAMGFMSGHLCYQIE
HHLFPDLPSNRLAQIADRVRALCDKYDLPYTTGPLSRQYLQTFRTIHRYA
LPNRFTVAKMH
119869678YP_939630.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MPEVLIASMSPIGHLGPLLNLARGLVDRGDRVTVLTSAARAGMIRAAGAR
PRALPPQTDIDESRLNESLPGREKTSGIKRVDFDITNVFVTPMPHQAAAL
AEAFAETRYDAVIVDAMFLGILPFLLGEHAARPPVLAYSTTPLLISSRDT
APPGLGLPPSSSPLGRLRNSALTTLTHRVLLRGCHRAADEALHRMNSRPL
PMFVTDAALLADRFIAPTVPEFDYPRGDLPPHVRYVGAVHPARTQTFTPP
PWWGALDGERPVVHVTQGTVDNADPRRLLLPTVEALAGEEVTVVVTTGGR
GLSVPHTALPTNTHVAEFIPHDVLLPKVDVMVTNGGFGAVQRALSLGVPL
VVAGDTEDKPEVAARVAWTGAGVDLRTGTPTPGAIRSAVRDVLDRAHYRE
NARRLEVAFTRRDGVAEIAAVIDEVLAERRQTVR
119869676YP_939628.1 hypothetical protein Mkms_3644 [Mycobacterium sp. KMS]MALLRAAAAAAAVLTVVGGCASEQSAQPPSTSAATATTTGLLPSGVPTEG
SRPPVEGLPPPAEPQRAPAPTTPVPGRTVAVGAQPEGIVVDAQTRTVAVL
KRQPDELVLLDADTGEVTGRTALPGFGRHLQLARPGGPVLVPVESADALI
RVALPGGESQSQIVTGTFPHDASEAPNGTVFVANELGGTVTVLRGDEIVK
VFTDSVQPAGLAPVGDSMGLLDVRKNDLTVYDTEELTIVGATTAGEGPTH
QVADKHGRLIVTDTRGDAVRVFTPRPEPREVGLAAQPGGPYGITYDPNRD
RVWVASSCTNEVVGYDMAEPTPREVARFPTVQNPYTVAVDPTTGRLFVAG
LTGGVVQIIDVTS
119869674YP_939626.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MAKPPLSMKPTGWFCVAWSDEVGVGDVRAMHYFGEEMVAWRTQSGRVTVM
NAYCEHLGAHLGHGGHVVDEVIQCPFHGWQWNAEGRNVCIPYQDRPNRGR
RMRTYPVVERNDAIWIWHDVDGREPFFDAPDVFASFADGSSAAGYYPQQR
LFRGSLEMHPQYVLENGVDFAHFKYVHQTPIVPVFTRHDFSAPVSYVDFT
ITFEGDEGQSIDDVRSGVEAINGGLGIAVTKSWGMVDNRTISAVTPVDER
TSDVRFMVYIGRTPGRDDQRAADKARGFGEEVIRQFAQDIHIWSHQRYSD
PPALATAEFEGFTAIRQWAKQFYPDGIGGSAAEVHAALQKG
119869672YP_939624.1 pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing proteiMGLNGNGAAPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQ
PNYPAEIRAPQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKAN
VSDLPRGGLIIANSDEFTKRNLAKVGYDANPLETDELSDYVVQAVPMTTL
TLGAVEEIGASKKDGQRAKNMFALGLLSWMYGRELHQSEAFIQEKFARKP
DVAAANVLALKAGWNFGETTEAFATTYEVSPAKLKSGEYRQISGNTALAY
GLVAAGQLANTQLVLGTYPITPASDILHELSKHKNFNVLTFQAEDEIAGI
GAALGASYGGALGVTSTSGPGVALKAEAIGLGVMTELPLVIVDVQRGGPS
TGLPTKTEQADLLQALYGRNGESPVAVLAPRSPSDCFDIAVDAARIALTY
RTPVIILSDGAIANGSEPWRIPDITGYERIDHTFAQSGDDFAPYARDPET
LARQFAVPGTAGLEHRIGGLEKANGSGNISYEPKNHDLMVRLRQAKIDGI
TVPDLEVDDPTGDAELLLIGWGSSYGPIGEACRRARRKGVKVAHAHLRHL
NPFPANLGDVLARYPKLVAPEMNMGQLALLLRGRYLADVQSVTKVEGMAF
LADEVEGIIDAAIDGTLGDKENEKATFARLAAATVGAGVGADE
119869670YP_939622.1 molybdopterin-guanine dinucleotide biosynthesis protein A [MycobacteriMTQGATTSPVPLAAVVLAGGASRRMGRDKATLVVDGSTLVEHVVTTVGRR
CSQVFVIAAPGQPLPELEAHVLRDEVRGVGPLLATGRGLRAAAEAGCEWA
FVCAVDMPYLTMDFVDDLAVPAARLGVDVVLPWDGRDHYLAGVYRTSLAG
HISALVAAGERSMRALVDTVDTQRIVMPEQRALTNANTPADLPVTR
119869668YP_939620.1 transglycosylase domain-containing protein [Mycobacterium sp. KMS]MINIGKALTRGIWLTVIGAAFALVPTFFSSATASADSVNWDAIAQCESGG
NWSTNTGNGYFGGLQFKPTTWSSHGGRGNPANASRSEQIQVAERVLATQG
LKAWPKCGPRGVATRAAVWNNPQTPRVAAPAAAPRPATGCAAVRSGSVLG
IVDLKQLCSTVLSPLGTLGQR
119869666YP_939618.1 FAD-binding monooxygenase [Mycobacterium sp. KMS]MSQQILVVGAGIAGLATAVALQRIGHPVTVVEEKADTSAGAGISIWPNAL
AALDAFGLGDAVRASGGRVTAGALRWHDGTWLRRPSADRMVRALGEPLVV
TRRADLTAILAGALAPGTVQRGVAARVIDTTPAGVRITLSDGSVRDAAAV
IGADGVGSMVARHLNGPLRHRYAGYTAWRGIAAHRLDPQLAGQTLGAGTE
VGHVPLGPDHTYWFATERTAEGGSIPQGELDYLRRKYRGWAEPIPTLLAT
TAARDVLRNDLYDREQIRVWSRGPVTLVGDAAHPMRPHLGQGGCQGLEDA
AVLARFVAAATGTETDFATAFVRFAGFRRARVRALVRESKLIGRVVNLRP
AVLSALASRATVVIPEAVLGRHLAAVAAGSAFTLPEAPG
119869664YP_939616.1 saccharopine dehydrogenase [Mycobacterium sp. KMS]MSPAQQREFDIVVYGATGFVGKLTAEYLADHGAGARIALAGRSQDKLLEV
RESLGPKATDWELITADASQPSTLNAMAARARVVITTVGPYTKYGLPLVA
ACAAAGTDYADLTGETMFVRDSIDHYHKQAVDTGARIVHACGFDSIPSDL
TVYALHRKVAADGEGELGDTSMVVRTLAGGASGGTIASILEVLNTASTDP
EARREMTDPYTLSPDRSAEPELGAQPDMRWRRGAEIAPELSGYWTAAFAM
AGPNTRIVRRSNALLGYAYGRRLEYSEVMSTGRTPVAPALAALTTAGSAA
VMGLGSRYFNRLPRKLVDRVLPAPGTGPSEQTRERGHYTVETYTTTTTGA
RYLARMSQRGDPGYKATSVLLGECGLALALDRDKLSDLRGVLTPAAAMGD
ALLARFPGAGVSLETSRLA
119869662YP_939614.1 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase [MycoMSRPEPTPDEIAALLQVEHLLDARWPETKIEPSTARISALLEMLGNPQRG
YPSIHIAGTNGKTSVARMVDALLTALSRRTGRTTSPHLQSAVERVAIDGE
PISPARYVEVYREIEPFVLMVDERSEEAGGPRLSKFEVLTAMAFAAFADA
PVDVAVVEVGMGGRWDATNVVNAPVAVITPIGIDHADYLGDTIAEIAGEK
AGIITRQPDDLVPTDTVAVIGRQAPEAMEVLLAQAVRADAAVAREDSEFA
VLSRQVAVGGQLLELQGLGGVYPEIFLPLHGEHQAHNAILALAAVEAFFG
AGAERQLDIDAVRAGFAAAASPGRLERLRSAPTVFIDAAHNPAGAAALAD
ALQTEFDFRFLVGVVSVMGDKDVDGILAALEPAFDQIVVTHNGSPRALDV
EALAVRAEERFGPERVIRAATLPDAIETATAVVEDSGGEGLAGAGMVITG
SVVTAGAARTLFGRDPQ
119869660YP_939612.1 hypothetical protein Mkms_3628 [Mycobacterium sp. KMS]MSDLCSPTFADLAERLGFSCDEAGGLVEFRNPFGLENWTLPVLEVLIVVG
AVLTLVYAINRLRRHGDPTNLVLWFGAIAYLLIIEPPLYFPSAFGIDEHV
DTMFAHNVFTVEFLWGRLPLYIVAIYPMMATVSFEIVRRLGVFRRYGTFV
GALCVGFVHHAFYEIFDHLGPQLRWWEWTLDNPLNQPFFASVPLPSVVVF
AALWPTSLAFCVQFFVGRHVDAGRSFSGGSLVLRTVVVGVLASVGTFVLP
LPATIAGGVSGSTDVGGVVYALELVVLSVISAAVLAAQWRRLRAGRPHRD
PSPTLIFGYAGVYLAVMAVLWLTALPAFFGAVNGVTADGDPIGSLWYTVA
CFVVAALSLAAAATVPTRRVAAADEAVDVTT
119869658YP_939610.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MARRRGWNGSPPADDEEASRRIVEAAVGLLAQTGTAISISDVAASLGVIR
QTVYRYYPTADALMRAAAIASVDDFLDRLAEAVRGIEDPAEAMTEGVLYV
LDEVARTPHLGILLSEPYVNTHSGEVASDEARAIGMRMVNRFDVDWVDHG
YDDAALVDLVEFTLRTMLSFFVAPNPPSRSRDDLRRFVHRWLGGAIMAQN
RL
119869656YP_939608.1 ribonuclease [Mycobacterium sp. KMS]MADSENTQAQDSPDSSEEASPRERLPERLRVHSLARVLGTTSRRVLDALA
ELDGRARSAHSTVDKTEAERVREVLAGSDGDAPVEAPAPAEIAESVADAP
EVVIETVESVEVTIDVAPVGDTSDVPEPEDEPESRTILETAPVERADYLP
LFVAPQPVRFEPADEDDDEDEDDDVAASADSEDDDEDDQSERPAARRRRR
GRRGRGRGRGEQSDDNGEPDAAEGTETKTDGQADSDQDTGDDSDEDGDED
TSGGDGSSRRRRRRRRRKSGASDDSDNGSPDDPPNTVVHERPPRERGGKS
GDSDDNEIQGISGSTRLEAKRQRRRDGRDAGRRRPPILSEAEFLARREAV
ERVMVVRDKVRTEPPHEGARYTQIAVLEDGVVVEHFVTSPASASLVGNIY
LGIVQNVLPSMEAAFVDIGRGRNGVLYAGEVNWEAAGLGGQNRKIEQALK
PGDYVVVQVSKDPVGHKGARLTTQVSLAGRYLVYVPGASSTGISRKLPDT
ERQRLKEILREVVPADAGVIIRTASEGVKEDDIRSDVNRLQERWTQIEAK
AAEITAKKAGAAVALYEEPDVLVKVIRDLFNEDFSGLIVSGDEAWNTINS
YVESVAPDLMPRLTKYEPAGNPNGEGPDVFAVHRIDEQLAKAMDRKVWLP
SGGTLVIDRTEAMTVVDVNTGKFTGSGGNLEQTVTRNNLEAAEEIVRQLR
LRDIGGIIVIDFIDMVLESNRDLVLRRLTEALARDRTRHQVSEVTSLGLV
QLTRKRLGTGLIEAFSTPCPHCAGRGIVLHGDPIDNASGNGRKSEPGTGR
RSKRGKKGGKPEEAPAAVPVIKVPPHPAGEHPMFKAMAAANGRDDESEDE
SDESADEQSGAREDDTAEKVHEAVGEELDDEDFEDAEDAEDSDDSDEDED
EDEDEDSDDSDEDEIDLDNDDDEEDDDIEVLDDEDSDEDEDSDEDEDSDE
DSDEDSDEDSDDEDEPEVIAVPVRRPRRRAAARPAGPPSSE
119869654YP_939606.1 50S ribosomal protein L27 [Mycobacterium sp. KMS]MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEIIVRQRGTHFHPGVN
VGRGGDDTLFATAPGSVEFGSRRGRKTVNIVPVARPEA
119869652YP_939604.1 gamma-glutamyl kinase [Mycobacterium sp. KMS]MTEAATRPSVHREAVRTARSVVVKIGTTALTTPTGVFDANRLATLVEAIE
KRMKAGSDVVIVSSGAIAAGIEPLRLSKRPTDLATKQAAASVGQVALINS
WNTAFARYERTVGQVLLTAHDISMRVQHTNAARTLDRLRALHAVAIVNEN
DTVATNEIRFGDNDRLSALVAHLVGADALVLLSDIDGLYDGDPRKAGPDN
PARFIAEVNGADDLDGVVAGRGSHLGTGGMASKLSSALLAADAGVPVLLA
AAADAATALSDASVGTVFAPRAERMSARRFWVRYAAESTGALTLDEGAVN
AVVRQRRSLLPAGITGVSGRFYGGDVVELRAPDATMVARGVVAYDATELA
TMLGRSTSDLPADMRRPAVHADDLVAV
119869650YP_939602.1 silent information regulator protein Sir2 [Mycobacterium sp. KMS]MESPELVALLAGRRVAVLTGAGMSTDSGIPDYRGPDSPPSNPMTIRQFTS
DPAFRQRYWARNHVGWRHMAATLPNAGHRALAAMERTGVVLGVVTQNVDL
LHTKAGSRNVVDLHGTYARVICLDCGYTMSRADLAEMLEAANPGFLERAE
RVGGIAVAPDADAIIGDTDRFRIVDCPACGGMLKPDIVYFGESVPKPRVE
QAFAVVDDADVLLVAGSSLTVFSGYRFVRHAAAHGMPVAIINRGPTRGDD
LATVKLDNGCSPMLALLADELPAFASSA
119869648YP_939600.1 NAD synthetase [Mycobacterium sp. KMS]MDFYSAYRHGFARIAACTHHTSIADPKGNAESVLRMARDCHDDNAALAVF
PELTLTGYSIEDIVMQDGLLEAVEAALLQVVTASAELLPVLVVGAPLRYR
HRVYNTAVVIHRGQVLGVVPKSYIPNYREFYENRQIAAGDEERGEIRVGG
QEVPFGPDLLFEATDVPGFVLHVEICEDMWVPVPPSAEAALAGATVLANL
SGSPITIGRSEDRCLLARSASSRCLAAYVYAAAGEGESTTDLAWDGQTMI
WENGSCLAQSERFPKGERRSIADVDLQLLRNERLRMGTFDDNRRHHLIDE
DSFRRIEFTLDPPTGDIGLYREVERFPFVPADPARLEQDCYEAYNIQVAG
LEQRLRALHYPKIVLGLSGGLDSTHALIVAARAMDREERPRSDILAFTLP
GFATGEHTRNNATRLAEALGVTFETIDITSTAKLMLTEMDHPFSRGEKVY
DVTFENVQAGLRTDYLFRLANQRGGIVLGTGDLSELALGWSTYGVGDQMS
HYNVNGGVPKTLIQHLIRWVILSKQFDDTVNEVLQSVLDTEITPELVPSG
EDEEIQSSEAKVGPYVLQDFSLFQVLRYGFRPSKVAFLAWHAWRDADSGN
WPTGFPDSKRPSYTLDEIRHWLQVFAQRFYSFSQFKRSALPNGPKVSAGG
SLSPRGDWRAPSDMSARVWLDEIENAIPKG
119869646YP_939598.1 diacylglycerol O-acyltransferase [Mycobacterium sp. KMS]MEHLKTLDAGFLEAEDADPHVSLAIGGVAVLDGPMPDFAALTATLTERLT
AVPRLTQLVHTRPLDIGAPEWVPDEHFDISHHIRRAALPRPGGDADLDRL
VADIMERRLDRARPLWECWVIEGLSRHRWAVLMKVHHCLADGIAATQILT
ALCDDGPTAALRPYPRAVPSPGWSLRIDPVGWMSSAVRTSLGLTTAAVRA
VRGAIDLAGGVLRPAPSSVLNGPVGSMRRYAAVDVSLPDVRRVCDEFGVT
LNDVALAAITHSYRELLIRRGENPGRDSLRTLVPVSVRPADAMDEPDNRV
SLLLPRLPVDKADPLHQLQAVHRRLTYVKGSGQRQAGSAVMSAANAIPFA
VTAWAVRNLTRLPQRGVVALATNVPGPQEELTIMGRKVGRLLPIPPIALQ
LRTGIAILSYADKLFFGIISDYDAVPDVDELARGIAQGVGRLADLASVPH
RSTPLGTLALVT
119869644YP_939596.1 ribokinase-like domain-containing protein [Mycobacterium sp. KMS]MAAARVCVVGSVNADLRFAVPSLPRPGQTVLASSMTTSPGGKGGNQAIAA
ARAGGDVSLVAALGDDPAAGQLRAHLRANGVGLDGVVTVPGPSGSAVVIV
DAAAENAIVVAPGANAHLSVASSAVREAIAGADVVLLQLEIPLHTANDAA
RVARDAGAVVMVNASPAGAPPHELLRLSEVADVVVVNQAEAGEWHWPVPH
LVITRGARGASYLGDGERFDVPAPAVEAVDTTGAGDVFAGVLAVHWRSGH
ENALRRACVAGALATLVPGAGDCAPTAEAIDDTLR
119869642YP_939594.1 ATPase [Mycobacterium sp. KMS]MSVPARPAPLFADIDDVARRLAETGYLPDTATATAVFLADRLGKPLLVEG
PAGVGKTELARAVAQATGSELVRLQCYEGVDEARALYEWNHAKQILRIQA
GNAGEAGDWDRTKLDVFSEEFLLSRPLLTAIRRTDPTVLLVDETDKADIE
IEGLLLEVLSDFAVTVPELGTIKAERTPFVVLTSNATRELSEALKRRCLF
LHIDFPDPDLERRILLSRVPELPEHLASELVRIIGVLRGMQLKKLPSVAE
TIDWGRTVLALGMDTIDDAMIAATLGVVLKHQSDQQRAAGELRLN
119869640YP_939592.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTAPTQKVAVAIIGGGPAGLTAAAALAPDVDVLVLEREAMTGGIPRHSDH
PGYGMRDLRRFMSGPAYARRLTAQALDAGAMLETEAMVTGWGGERLLQVT
TPRGVRTVSADAVVLATGARERPRPARLIPGDRPDGVYTTGQLQNLVHLH
HARVGTRALIVGAELVSWSAVLTLREAGCATVAMVSRYPRSEAYAGFRVP
GRALMSGPVLTRSRLVSIHGKDRVRKAVVENLDAGERTTVDCDTVVFTGD
WIPDHELARTGGLAMDARTRGPVVDAALRTSAPGVFAVGNLLHPVDTADG
AALDGRHVAAAVRGWLQRREEPSPGVRIRTDEPFKWVAPQLISPNGGAAA
RGDLLFWVDEYRRLPKLRAVQDGRVLATARTPWPAAPGRVYRAPWSLVAN
ADPNGGDVTVEFA
119869638YP_939590.1 carbohydrate kinase [Mycobacterium sp. KMS]MTHLLAIDQGTSGTKAIVVDYGSDGSGRVVSVAEVALRPQYLAGGAVEQD
PEAMWDSVVGAGREALARAGVPVAAVALANQGETVLAWDRDTGRPLTPAI
VWQDRRAESVCAPLAGSADRIAQRTGLVLDPYFSAPKMAWLRAALTRSGV
VTTTDTWLVHRMCGAFVTDTSTASRSLLTALESPTWDDELLDLFGLAGES
LPAIVDSDQIVGETDVFGPTIPVAGLIVDQQAALLAESCLEPGAAKCTYG
TGAFLLAQLGETPARSSSGLTTSVAWRLRGQTSYCADGQVYTAASAVRWA
IDLGLVPAADHLDTVATDSSDGVLCVPALAGLAAPWWDSAATASFTGMTL
SSTRGHLVRALLEGIAAQVTALADLVGTDLGRPLTRLRVDGGLTRSTVLM
QAQADLAQIPVDVYPSLHATALGAAACARLALEPSLTPAEAVGTWTPVHT
YEPRWSADHAADYLQRWRRAAESTLQNQGETS
119869636YP_939588.1 GntR family transcriptional regulator [Mycobacterium sp. KMS]MPAAARKSPPQGGGDPPRYLAIAALVRDRIATEQLGPHTLLPSERELAEQ
HGVSRMTARQALSLLESEGVVYRRPPRGTFVAEPRVRFHIGSFSEEVSRL
GRRPAARLLWAERQQPTPAVQLALALPDGAAVHVFHRLRSVDDAPVALET
TFLPADLTPGILDTPEEGSLWAVLRDRYGMRLARSTAVLESIVLDDTSSS
QLAVRAGSAGTLLTRRTEDDAGRCVEYARDVYRADRAAFEVSEVLTVDRT
TV
119869634YP_939586.1 iojap family protein [Mycobacterium sp. KMS]MTASDEAIQMATVAARAASSKLADDVVVIDVSGQLVITDCFVIASASNER
QVNAIVDEVEEKMRLAGHKPARREGTREGRWTLLDYVDIVVHIQHQDERN
FYALDRLWRDCPTVPVDLDGLS
119869632YP_939584.1 hypothetical protein Mkms_3600 [Mycobacterium sp. KMS]MTSSEPDPARRTLLVFADSLAYYGPTGGLPSDDPRIWPNLVAGQLGWDLE
LIGRIGWTCRDVWWAATQDPRAWAALPRAGAVVFATGGMDSLPSPLPTAL
RELIRYVRPPWLRRWVRDGYGWIQPRLSPVARAALPPHLSAEYLEMTRGA
IDFNRPGIPIVASLPSVHIAETYGKAHHGRAGTVRAITEWAEEHDVPLVD
LKAAVAEQVLGGHGNPDGIHWNFEAHQAVAELMLKALAEAGVPQGN
119869630YP_939582.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MVTYQQDEAWVAMADRTRRSIVERLARGPCAVGELARDLPVSRPAVSQHL
KVLKRAGLVHDHADGTRRVYQLNPDGLAAMRADLDRFWARALADFKEIVE
QREGEGP
119869628YP_939580.1 hypothetical protein Mkms_3596 [Mycobacterium sp. KMS]MTAQAPLTELTRAERADLAGFLATLTPEEWYAPSLCAGWTVKDVVAHVIS
YEDLGVAGFLGRLVKGRITDANQVGVNEFSHLSPSELLDHLNRHLDPSGL
TAQFGGMIGFVDGTIHHQDIRRALDRPRTIPADRLSRILPLVPGNPRLGA
GRRIRGLRLRATDVDWTHGDGPEVVGPGEALLMAMTGRPAALADLDGPAK
ALLAQRLRPRRDHGS
119869626YP_939578.1 endoribonuclease L-PSP [Mycobacterium sp. KMS]MAIRSFTFTPDDGVPPAVAPFAHATAAGQTLYVTGQMPTDHTGEIVGTGI
EAQTDQVLRNLLRVTRLCGGGLDDVVAVRAYLTDWAEYAAFNTAYAAWFP
DRLPSRTCVGVTGLAVGARVEIDWTCWRADGWGR
119869624YP_939576.1 hypothetical protein Mkms_3592 [Mycobacterium sp. KMS]MSDEAAPLDLRLVPAASTGWAVTAAAIHWHTAAAVLVLLGGIAATAAAAV
WGGAAVTAVAAIRSAAAGLAGVAVVGAAFTVAVTVRVDQVRHHPVTALYG
ATAPVTVTPGDSPRPLGGGRLMFRAVLHAVDGRPMSGRVVVFASAKGFSE
VSAGRPAAFRAGIGRPTRRDLTVAVLSATGEAAVGTAPPVHRMAQSVRSG
LADAARGALPVDQAAMLPALVLGDTATVPPDTTADFRTAGLTHLSLSLRH
G
119869622YP_939574.1 putative phiRv1 phage protein [Mycobacterium sp. KMS]MGLNMPEIRSAACRVARATKAGDPTAEADARRELAEAKIADYVRRCLAAA
PPLSDEQRTRLAELIRPVRVNGGIR
119869620YP_939572.1 hypothetical protein Mkms_3588 [Mycobacterium sp. KMS]MAGGYYRRRPPPPPPWLALCAAILRRAPKLEGAKCAGRAELFEGDGPDGE
RTRTAIALCRQCPALTACASWADGLSPVRRPRGVLAASYRPPIRDRL
119869618YP_939570.1 prohead peptidase [Mycobacterium sp. KMS]MHTRAVELTEVRTDDDAGTFTGLAAGYDNVDTHGTVLQRGAFASSLAGGG
VVPLFWEHGHDDPRAIVGEVTAAVETTRGLEIVGKLDTDTERGAAAYRAV
KGRRIRGLSVGMRPTQRRGASIIAADLCEISLVMRPSNSRALVESVRSAD
DALQTRAASAVATFETIAKDTTMPETITTERRDELVAETRGLVAAAQGRT
LSAEEVATVETNTEAIRRHDEQALETRNDAQAARLAQALGQAIDTRSGGR
QSPFMLSADNVTTLETARKRFENITVLETRAALATTDMGTAREYGPNGLQ
APRSLWRSAGIPTTAPDGYSGVVPQFTLPGGAVLVGEGVDHQEFDGVNPD
AVTIGRAGAWSTLTSEALLSTSITEVSAAHARIIARNVDRATVAKIEDAS
PDTMSIDQALVTVAAECACDVSDLWIVGAPAAVAALVGNATFTPANGGDA
ESYASRYGGAAVYPTTSATADTLTVFHPQSFRAFASPLSSGVFVDPKSGK
QDFGQWMFYGLGQALVGAAITVDTTP
119869616YP_939568.1 ComEC/Rec2-like protein [Mycobacterium sp. KMS]MSGANVTIVCGAVLLSAAVLGPRAAVTLAALALITFVVVVQPSASVLRAA
VMGAITLLALVTHRRRQAIPALAASVLLLLIVAPELAVDAGFALSVAATA
GLVVIAPVWSRRLTGRGWPKPVADAVGVAMAAQLVTAPLVAGISGRVSLV
SVLANIVVAPVIPPITVIGTAAAALCWLWPAGAGLLIRFTGPPLWWLLRV
ADWAAAVPGASVPVPSGWAGVGLVAAGGIALVVLWRWRWVRLAAGAAVLG
LVAWSASGHAALGGVGGA
119869614YP_939566.1 30S ribosomal protein S20 [Mycobacterium sp. KMS]MANIKSQEKRIRTNERRRLRNQSVKSSLRTAVRGFREALDAGDKDKAAEL
LVATSRKLDKAASKGVIHKNQAANKKSALSVALNKL
119869612YP_939564.1 hypothetical protein Mkms_3580 [Mycobacterium sp. KMS]MLARNAESLYWIGRYVERADDTARILDVTVHQLLEDSSVDPDRVARTLLR
VLGMEAPDHPLDVWSLTDIVAFNRDSADGTSIVDSISAARENARGAREVT
STEIWECLNTTYNALAERERAAKRFGPHEFLSYVEGRAAMFAGLADSTLS
RDDGYRFMVLGRAIERVDMMVRLLLSRVGDSGSSPAWVTLLRSAGAHDTY
LRTYRGVLDAGRVVEFMMLDRLFPRSIFYSLRLAEHNLDELLNRPHNRLG
ATAEAQRLLGRARSELEFMHPGVLLESLEQRLAGLQKTCSDVGEALALQY
FHVAPWVAWTDAGRNAMVIEEGEV
119869610YP_939562.1 ribonuclease Z [Mycobacterium sp. KMS]MIEVTLLGTGSPVPDARRAGPSTLVRAGGHAFLVDCGRGVQLRMAAAGIA
ANGLSALLLTHLHSDHIADLGDLLITRWVTTFTDQVPLQIIGPPGTAETV
TAMLAAFGRDIGYRIAHHPDLTAPPPVEVHEVTEGVAWDHDGVTVRVAPT
DHRPVAPTIGFRVEHADASVVLAGDTVPCATLDALAAGAGALVHTAIRKD
LVELAPQQRVREVCEYHSSVEEAAETAERAGVGILVLTHYLPPIAPGQEA
DWRARAATAFPRQIELGDDLHRVEVHPGVCVKPAG
119869608YP_939560.1 putative monooxygenase [Mycobacterium sp. KMS]MSKPLYFSAFVMNTASHVLHGLWRAPEAHNHEFNSLRHWTSLAATVEKAG
YDLLFFADVFGLRAPWNGNWRKAVEGGIQVPVNDPSVLASALATVTDTLG
IVFTSSIVQDHPFNFARRMSSLDHYTDGRLGWNIVTSFNQNMFRSFGHDG
TLAHDERYEWAYEYLDVVYKLWEGSWDEDALVQDKVRGVHSDPAKIHRIN
HVGPRYRVEGPHFTSPSPQRTPVLFQAGASPAGQLFSARNAEGVYISSPN
PAAAHALTSETRALAAANGRDPGAITFAQGLSFVIGDTHREAVRRSDEIK
RYLDLEGVALHALGDAGVDAGRFPLDTPLSELGEFTGVQGFARWAAESSG
HSEPTIRDLAWVLEGANRVVGTAEEIADRLEEWREAGVDGINVYHATVPG
TFTEVADRLFPTLRERGLIATDKSGTLRHKLLGRGDRLPDSHPAAAYRGA
FGDNTLLDTVPDPAEELIPG
119869606YP_939558.1 binding-protein-dependent transport system inner membrane protein [MycMNLLAAEDFNTPWPNVPDLLLPAYGETWLMVGITMALVVTIGIPVGITLH
NTSELGLYPNPRVFAVLNTIVNIGRSLPFLILMAAIIPVTRFIVGTTIGI
QAAIVPMTVAGVPFFARLVQNALREVRTDVADMGLVSGGSTLQVIRTVQL
SEALPGLAGALTVNTIAMIEYSAIAGSIGAGGVGNLAITYGYNRFDDNIM
IATAVSLIITVQIVQFTGDRVVKALTR
119869604YP_939556.1 coenzyme F420-dependent N5 N10-methylene tetrahydromethanopterin reducMPLHSRWFEPSTPPAATTRVLPVSGYPRFGVWANVHGTMAALSHPDDPVN
ASWSRVRDQILLVEQAQGIEEISGGRFAVNIVNAWWVPDLERSGIGMLEH
GERYVYGAEWLHIVRRLLAGERTTFHGKYFHVDDFHLHPTGTHRTRPRIY
LGGESGPARDLAAAEADVLFLNGQAPEEAVTLLTDVRRRPRHGLDPIRFG
LAAFVVTAPTQREAAELLDYHWELNARDRAGDGDTIDRFSRDTDPASVMW
QRLRERPHIGPNGGTAAGLVGDYDTVAQRIVEWHRLGIETFMLAFQPFEA
EMQRFAAEIMPRVQVLSQRAEVAV
119869602YP_939554.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MCDRGRMAAVDVRPGRRSDVRELADVLGRAFHDDPVMKWILPDDADRGRG
LTRMFATMTRHHFLRGGGVEVAAADDGLGAAALWDPPGRWKQTRLEEFLM
MPAFVRAFGKRVAIGQQVADLMKEHHPEEPHWYLGMPNTSA
119869600YP_939552.1 hypothetical protein Mkms_3568 [Mycobacterium sp. KMS]MSDPVLQRFFADPLIAAQHKRCGKLVAVYRVDASGGIWYRDRQQCRCAPS
PTLPEGAELAALVERAEARERWSSHRARIRIYI
119869598YP_939550.1 hypothetical protein Mkms_3566 [Mycobacterium sp. KMS]MPPPDSRVSAPEGTDTRHDAQVDSPDLTGPYAAACNIYADLGWRGVIPVD
PRDKGGVPAGFTGYGGIDVTPENMAWFAKSKPGHNIGLRLPDGVIGIDVD
AYGPKKGADTFAEAQGRWGALPPSYRSTSRDDGISGIRLYRVPAGTKLET
IIEFKDLDIRDIEIVQRHHRHVQCWPSIHDKTGQRYRWVSELDGSAMDTP
PAPDDLPNLPAAWVAALRAESGSNGTPLNGAEAPVDVQTALTEGDASPRV
AELLARAIGDCYGGSRFDHTRGNVLTLLRFGKQGDTGVRPALSALKAVYV
NAVSPDRAGGQRAAEVEFDRLVSGKKVATLLAEPDYNDWVSDLAPANAAD
IAAPELPADDGRAPAATGWEPVDLGPWLRGEIELPTPSLGIARSDGLRLL
YPGHEHAVIGETEAGKSWLALQCAAVELRADNAVVYVHFEEGNPSSTIER
LRLLGVDIETMTRRLRFVAPSRALADAEWLAALLRDPTPTLVVLDGVNEG
MALHGLDIFAADGAAQFRRVLVAPAIRVGAAVLSCDHLPKSRDGQGRDAY
GSVHKGNALDGARFVLENVTPFGRGMRGASNVYVTKDRPGHLRSHGRPSK
LAGKTYLGTLVADDSEPFQPFSLTLYAPQDDEESPTQQAAAKLTDAVYDV
IAAQPDRTVRSTRDLYAAMRAAGHAQRNSAFRDALDDLLAAGRIEEVSGA
RRLGYRAVATVSQECTA
119869596YP_939548.1 hypothetical protein Mkms_3564 [Mycobacterium sp. KMS]MTASRNDEHDTGGGLYRCLGLSIAVGPTADAIVTGAATAEDAWDLWLYWL
TPSDLLDAARELIAADERGEDIATALAGWAALRGLR
119869594YP_939546.1 prohead peptidase [Mycobacterium sp. KMS]MHTRAVELTEVRTDDDAGTFTGLAAGYDNVDTHGTVLQRGAFASSLAGGG
VVPLFWEHGHDDPRAIVGEVTAAVETTRGLEIVGKLDTDTERGAAAYRAV
KGRRIRGLSVGMRPTQRRGASIIAADLCEISLVMRPSNSRALVESVRSAD
DALQTRAASAVATFETIAKDTTMPETITTERRDELVAETRGLVAAAQGRT
LTAEEVATIETNTETIRRHDEQALETRNDAQAARLAQALGQAIDTRSGGR
QSPFMLSADNVTTLETARKRFENITVLETRAALATTDMGTAREYGPNGLQ
APRSLWRSAGIPTTAPDGYSGVVPQFTLPGGAVLVGEGVDHQEFDGVNPD
AVTIGRAGAWSTLTSEALLSTSITEVSAAHARIIARNVDRATVAKIEDAS
PDTMSIDQALVTVAAECACDVSDLWIVGAPAAVAALVGNATFTPANGGDA
ESYASRYGGAAVYPTTSATAGTLTVFHPQSFRAFASPLSSGVFVDPKSGK
QDFGQWMFFGLGQALVGAAITVDTTP
119869592YP_939544.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MALMPALPHWYLAIIGSDPTVRGAGLGQALMRSRLDRCDAEYAPAYLESS
NPDNIAYYERFGFEVTGELRVPDGGPSLWAMWRQPR
119869590YP_939542.1 hypothetical protein Mkms_3558 [Mycobacterium sp. KMS]MRVLRGLLGALLWILGGVVGLVGVVLCLTAILLPLGVPLLALARRLVTRA
AQLMLPRPLAHPVKELAKTTDKTSRDARKAVRGQRKRLSRMVSK
119869588YP_939540.1 GTP-binding protein LepA [Mycobacterium sp. KMS]MCRRAPRSIPLRCAHAPRRDVYQEIPISSFADQTFTAPAQIRNFCIIAHI
DHGKSTLADRMLGITGVVADRDMRAQYLDRMDIERERGITIKAQNVRLPW
EVNGEKFVLHLIDTPGHVDFTYEVSRALEACEGAILLVDAAQGIEAQTLA
NLYLALDRDLAIIPVLNKIDLPAADPDRYAGELAHIIGCEPSDVLRVSGK
TGAGVRELLDEVVRLVPPPTGDADAPARAMIFDSVYDIYRGVVTYVRVVD
GKITPRERIAMMSTGATHELLEVGIVSPDPKPSAGLGVGEVGYLITGVKD
VRQSKVGDTVTTARHGAKEALTGYREPRPMVYSGLYPVDGSDYPVLREAL
DKLQLNDAALTYEPETSVALGFGFRCGFLGLLHMEITRERLEREFNLDLI
STAPNVVYRVEKDDGTEIVVTNPSDWPEGKVRTVYEPVVKTTVIAPSEFI
GTIMELCQSRRGELGGMDYLSPERVELRYTMPLGEIIFDFFDSLKSRTRG
YASLDYEEAGEQEADLVKVDILLQGEAVDAFSAIVHKDGASAYGNKMTTK
LKELIPRQQFEVPVQAAVGSRIIARENIRAIRKDVLSKCYGGDITRKRKL
LEKQKEGKKRMKTIGRVDVPQEAFVAALSTDAAGDKPKK
119869586YP_939538.1 hypothetical protein Mkms_3554 [Mycobacterium sp. KMS]MGRIWAVAIGVVALTAGCADTVSGNAVRPANIVPVGVPPLSETHLADVLL
SIGELNGIVGSTRMTVTSDSAEMTDHSGDVSDPGCLGAIYGAEAPVYADS
GWTVMRDQVAREPDEGNQHWVEQTAVLYPSDKEAQDFVDASRTTWQDCAS
AALTVDDGVVRSVWDMASVINDGSLLTQVSVQRDADGWGCQHALSAVSNL
TVEAWACAFGPGGEAATIATEMVANAAEAVR
119869584YP_939536.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MPPYGHNVFDVRRLVVLREVVRCGSLSAAAVSLNYTTSAVSQQITALERD
VGAKLLERGPSGTRVTAAGTRLLEHTDVILGAVTAAEQDLARAASAVPDT
LRVASFSSAAATILPRVITRLRHEYPTTGIELVTADPDDGVALLGADGAD
AAMVTEVPGEPPEFRGVYTVPVYDDEFFVVLPRDHRFAAAVEVPFEALAA
ERWVVSTATGTCPDTRVFHTACRRAGFDPQVTFRADDYGTVQGMVAAGMG
VSLVPSLAAWAARGDVAVRRLTHRPVRRVAVATAAEPAAASALARLVSLM
ADTGARLRARGVFSVPASPSSVA
119869582YP_939534.1 hypothetical protein Mkms_3550 [Mycobacterium sp. KMS]MTDHEDPRFYLTGSINVPGVEDAFRLVGAHLQPGVTRVPDGEPGDRANWV
LTQAGHFLDNPTLDIVDGRARIRPGVSVEFPAVDYHSVAAESYALFRAAR
DRGVLAPDSRFLVSIPTPFNAVNSFAEFDSRVEIAFAYEQRLRESVEAVQ
EAVPPRDLAIQWDLPTELATVEGWFDNPYGGLEPIFAATARLAHWVHEDA
ELTFHLCYGDSKFGASPFMGDPPDEEAAARGGRHVLPRDARAIVTLANGL
SRHVQRRIDAIQAATVAAWTRRAHWQPLADLALEPGTEIYLGLVHAEDGA
DGARARSALAREFLPEFGLSTECGLGRHSTEQLAAVLAAWQNLTTREFVP
A
119869580YP_939532.1 ANTAR domain-containing protein [Mycobacterium sp. KMS]MDNRITDVTSRRVIDIAIGILVGLRGCTERQAFDELVTVVKQTGLGIGRV
AGGLVALAAGSSSAEHAEAFAAWGELIRGARRVPTG
119869578YP_939530.1 hypothetical protein Mkms_3546 [Mycobacterium sp. KMS]MDAFLSWWDGVELWLTGLGFVAQTAVVMPVALLLAYGLAVLLDGALAAGV
RVLRRARHDGQEPS
119869576YP_939528.1 sulfate ABC transporter permease [Mycobacterium sp. KMS]MITAVDGDNGRAPGGFARRRGTASLRVGVATIWLSVIVLLPLAAILWQSV
GGGWEAFYRAVTGNAALESFRVTLTISVGVTIVNAFFGLLVAWVLTRDDF
PGRRLVDAVIDLPFALPTIVASLVMLALYGPASPVQLHLQHTKWGVGIAL
LFVTLPFVVRSVQPVLLELDREVEEAAASLGANNWTILTRIILPALLPSL
LSGAGLAFSRAIGEFGSVVLIGGAVPGETEVSSQWIRTLIENDDRTGAAA
ISIVLLAISFVVLLILRALGARAAKREQMAG
119869574YP_939526.1 sulfate ABC transporter ATPase [Mycobacterium sp. KMS]MTDAIIVRGANKHYGDFAALDNIDFEVPAGSLTALLGPSGSGKSTLLRAI
AGLDQPDTGTITINGRDVTAVPPQRRGIGFVFQHYAAFKHLSVRENVAFG
LKIRKRPKAEIKEKVDNLLEVVGLAGFQNRYPNQLSGGQRQRMALARALA
VDPQVLLLDEPFGALDAKVREDLRAWLRRLHDEVHVTTVLVTHDQAEALD
VADRIAVLNKGRIEQVGSPTEVYDTPANAFVMSFLGAVSSLNGTLVRPHD
IRVGRNPELPIYESESIQATGVVKAVIDRIVVLGFEVRLELTNAATHAPF
TAQITRGDAEALGLREGETVYVRATRVPEIPGDTEAPKAAVLR
119869572YP_939524.1 hypothetical protein Mkms_3540 [Mycobacterium sp. KMS]MLTAVVGILVGFLVVLAITALTGYFVAQEFAYMAVDRSRLKARAEAGDHA
AARALTVTRRTSFMLSGAQLGITVTGLLVGYVAEPLIGRGLETLLGGAGI
PTAVAVGIGGLVAIAVSTVVQMVFGELFPKNLAIARPEPLARWLALSTTI
YLKLFGWLIWLFDQSSNMLLRLLRIEPVHDVEHSATPRDLEHIVAASRDA
GEIPRELSALLDRILDFPTSTAEHAMIPRSRVDVVRADEAVPDVLERMAR
GHTRYPVTGSGPDDVIGVIDLHDLLGPSTQSTSGTAGARCRPAVVVPETL
PLPNVVRELAQTGDEMAIVIDEYGGFAGIVTVEDLAEELVGEIDDEHDTE
STADIVARDGGWLLAGDLPLDEAERTLGLTLPEGDYETVAGMVIAHAAGL
PDAGDTVVIELPSDNADLLNDGPAPARQIVAEVRAVDRRVPSRVLVTVDT
RTEGGDDE
119869570YP_939522.1 phosphoadenosine phosphosulfate reductase [Mycobacterium sp. KMS]MSDIDLQQLAERGAAELGPNASAIDLLRWTDENFSGNYVVASNMQDAVLV
DMAAKVRPGVDVLFLDTGYHFAETIGTRDAVQAVYDVNVVNVTPERTVAE
QEALLGKDLFAREPNECCRLRKVEPLTKALSGYSAWVTGIRRVEAPTRAN
APLISWDRAFGLVKINPIAAWSDDDMQAYIAANGVLVNPLVDEGYPSIGC
APCTAKPIEGADPRSGRWQGLNKIECGLHQS
119869568YP_939520.1 coproporphyrinogen III oxidase [Mycobacterium sp. KMS]MSLRTAPVRAPELAATAGRPFGLYIHVPFCATRCGYCDFNTYTPAEAGGA
NPEGWLVAMRQELALAARTLGTPPPVRTVFVGGGTPSLLGGAGLTAVLAA
VREHFDLAPGAEVTTEANPESSGPELFDALLAAGYTRVSLGMQSTARHVL
KVLDRLHSPGRAVAAAGEARAAGFGHVNLDLIYGTPGETDDDLRRSADAA
IGAGVDHVSAYALVVEDGTALARRVRRGEVTAPDDDVLAARYELLDARLG
EAGFDWYEVSNWARSGGECRHNLGYWAGGEWWGVGPGAHGFLGDTRWWNV
KHPNAYATALGDGALPVSDFEVLDPAARHTEDVMLRVRLRSGLPLDMLTA
DERSRVGTVVADGLAVVDGAALVLTDRGRLLADGVVRTLLAD
119869566YP_939518.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MSTGFQHVHSDLTDGFVPFPEDRAEQYRRAGYWTGRPLESLLLDAAHRRP
DHPAVVDVDGSLTFAELTARADTVAAALAGLGIRPGDRVLLQLPNSVRFA
VAFFGLLRAGAVPVMCLPGHRTAELGHFADVSGAVALIVPDEVGGFDYRE
MAAQLVADRPTLRHVLVDGDPGPFLSWAALIDSGGVAPEIGPVDTSLPAL
LLVSGGTTGLPKLIPRTHDDYVYTAVSSAQACHFTPDDVYLVALPAGHNF
PLACPGMLGAMTVGATTVFTADPSPEEAFALIDKHQVTVTGLVNALGKLW
AQACDWEPVLPTSLRLVQVGGSRMSPEEARFILDRLTPGLSQIFGMAEGM
LNFTRPGDPLDVVVHTQGRPVSPHDEMRVVDESGVEVAPGEEGELLVRGP
NTLNGYYRADEANARCFSPDGFYRTGDRVRIFADGPLAGNVEVTGRIKDV
IHRGGETVSATDLEDHLLTHPAIYAAAAVALPDDYLGEKICAAVVFRGKQ
LTLAELNAFLDERGASTHARPDVLAAMPSLPLTAVGKVDKKKLVAQLTG
119869564YP_939516.1 thioesterase [Mycobacterium sp. KMS]MTARQLEFAPWVKHFPASGGATAVVFPHAGGAAAAYRALAKSLSGNGIDT
HVVQYPQRADRLRHPAADSIGALAAQLFEAGPWDRLGPLDLFGHCMGAVV
AFEFARVAERNGVTVRTLWASAGQAPSTVAEAAPLPSTDRDVLADMVDLG
GTDPRLLEDEDFVELLVTAVRADYRALSGYACGRDVQIRADIHALRGDRD
HRISREWSQRWASHTAGRFTLSTFQGGHFYLDEHLDEVAALVGGG
119869562YP_939514.1 acyl transferase domain-containing protein [Mycobacterium sp. KMS]MTRPNRWPDGRIPVLLSAHAGDLVAEDARAVLGYLDHDPAASVADVAGHL
LTTRRVRRHRTVVRAGDRDELADGLRAVAHGAEHPLVARSAEGSPSRIAF
VFPGQGTQWPSMGTQAYEELPQYRAAADACAEAFTAAGAASPMRYLTTPG
TAEGFSEAEIEGAQFTHAVALAHVWRSYGVLPDITVGHSLGEIGAAYLAG
AITLADAVAVVIARAEVVDRLSGDHAVAVLGVDPETAQQVIAATPGWLEL
SVVNAATSVAVSGDRRAVSAAVARVREQGRFAREITVGFPVHTSILEPLR
DDFVKQLPQAVFADSPVQFIGGATGDVVPAGAMFGDYWYANLRTMVRFDR
AFESARRCGATTFVELSAHPQLLFAMGDLLGDTTATLVGSGRRDTPITEA
LSDNLAVAAVSDPGHGWRDAVERTAHRLRGFPNAPMRATPLWAQPEPLSE
TADITVAQEVWQPIDDVTPSAHTAPVTVTVLELGATGPFGERLRTAVDAH
PGMALGTPDTADVMVVVAPQPGGADAKTAVTTVTDLVGSGALRYPASAGP
RCRDIWLVTAGAERVRAGEPQALSAAAIAAMHRSLGLENPELGFHHLDLP
ADPTIDTAVVDTLLTGAGELAIRGGDGPVLYRRTVADAPVAPAWSLGSGI
LDEVVITGGAGRIGLHYARHLAERGARRIVLLSRRAVDPAVLAELTAPRG
TEVVSVPCDLTDRESIRTATDFAGIGASLVIHAAGAATFAEGDRLDAAAA
VNTLGAKVTGLAHLADLWPLHPDARIVLCSSVSGLWGGHGHAVYSAANRM
LDAMAGRLRADGHRCVSVRWGLWRSDSGEGIVGAAETARIERSGLRPMAP
LPAIEASLCDHTVDPLVFSADPHRMQMFSAATEPVRDPQTAETTAAPVDT
ADAVRAELAAVLKITDPGGIDLDASLFDLGVDSLLALDLGKRFRRVLGRT
VPLATLLGGVTGAELVAELDEKVEIPRD
119869560YP_939512.1 amino acid adenylation domain-containing protein [Mycobacterium sp. KMMTRTQAAANAIEDVMALSPLQQGLYSMTMLADSEHADGDPRPDPYVIAMA
ADVTGTLDTALLRDCATALLTRHPNLRAGFFRGDLPRPVQVVPARVDLPW
QHVRARTAEKAAELEHRERRRPFDLERGPAIRFLLIELPGPAWRLVIVAH
HIVIDGWSLPLFVGEMLTLYRAGGDPGALGDPPRPYRDYIGWLAGRDQAA
SRALWTEHLAGIDAPTLLTPALSAVEPAAGLPRRTEVALDAGASRRLTET
ARSRGVTVNTLVQMAWAAMLSVFTDRRDVTFGMTVSGRPGELAGVETMVG
LFINTVPLRVRLDPVDTVGSQCLSLQRTAAALREHSYLAHSELRALAGVG
EMFDSLLVYENFPPGGLVGGDHRFEAAGATFIPAALESLSHFPVTIAAHM
ADERLTVLVETLDGALGALTPHDVGQGLLDTVERLIALWDRPLRDVRMLS
GDDPAVPAVTEPPPRTGVHCAFTEAARRTPDAVALSWDGGTLTYREVDAA
ADRLAAGLTARGVGAETPVAVRLSRGPDYVIAMLAVLKAGGMIVPLDPGM
AGERIEEILRQTAAPVVVDDALSAGVGAPDGAWAPATVAPGQAAYAVFTS
GTTGIPKGVVGTHDAVLAYADDHARHVLRPAATRLGRPLRIAHAWSFTFD
AAWQPLVALFEGHSVHIIGDAVQRDAEALVDTIDRYDIDMIDTTPSMFAQ
LKAFGLMSRVPLAVLALGGEAVGSGAWRFIREECARTSMTAFNCYGPTET
TVESVVAAIAEHPQPVIGSPTRHARAYVLDAWLRPVPDGVAGELYLSGAQ
LARGYLDRACETAGRFVADPFLAGNRMYRTGDVVRRDATGALQYLGRSDD
QVKIRGFRVEPGEVCAVLQTHPAVRAAHVTVRRHGAGPRLTAYAATGGTD
VAVAELRHMLSTRLPRYLVPHHIAVLDELPLTAHGKIDDATLATYDAAAA
GPAAAPETPTEAALAEAVAELLGTTAVDVNADLLSLGLDSIVALSVVQAA
RRRGVALRARLMLECGSIRELATAVDAEAGIESSSQATEAASSDPIPVLP
NVHWLYEYGHPRRLAQTEAIPLPDGITADALRTVLRTVLDGHEVLRTRFD
RTAMTLVPQAETPADELLSEVAVSGDLADAVAEHTETAVQRLDPERGRLW
SALWLRPAHGPGVLVVTAHVLAIDPASWRVVIGELDTAWHALRAGRTPTP
TREHTTYRQWSARVRERAHRLDTADFWAAQLDGADPELGARRVRPETDRA
GDLEVSVAITEPDLTARLIASAQAMPTLLTLAAARTVTAWRRRRGQPTPP
PLLALETHGRADSAVSADADTGDTVGLFSAIYPVRVDPDAGPVEIPGEGI
DFGLLRYLRADTAERLCAYRQPQLLLNYLGRADVGGAGTFNVDKGLLRAV
SVLPEPELAVRHEVTVMAAILPQGDAPVLATQWRTLPEVLSADDVAVLQT
LWQDALQEVAR
119869558YP_939510.1 MbtH domain-containing protein [Mycobacterium sp. KMS]MSTNPFDDENGRFYVLVNDEEQHSLWPTFADVPAGWRVVFGEATRAECLA
YVERNWTDLRPRSLREAMASE
119869556YP_939508.1 hypothetical protein Mkms_3524 [Mycobacterium sp. KMS]MIFKGVRDGKPYPEHGLSYREWSRIPPRQIRLDEIVTTTTVLALDRLLSE
DSTFYGDLFPHAVRWQGVIYLEDGLHRAVRSALRNRTVLHARLYDMDVPY
SQQI
119869554YP_939506.1 chaperone protein DnaJ [Mycobacterium sp. KMS]MARDYYGLLGVSKGASDQEIKRAYRKLARELHPDVNPDEEAQARFKEISA
AYEVLSDPEKRRIVDLGGDPLESAGASGGNGFGAGFGGLGDVFEAFFGGG
GGSRGPIGRVRPGSDSLLRMRLDLAECATGVTKQVTVDTAVLCDLCHGKG
THGTSTPATCDTCGGRGEIQTVQRSLLGQVMTTRPCPVCGGVGEVIPDPC
HRCGGDGRVRARREISVKIPAGVGDGMRVRLAAQGEVGPGGGPAGDLYVE
VHEKPHDVYVRDGDDLHCTVSVPMVDAALGTTVSVDDILGGPLELTIAAG
TQPGAVSTLRGHGMPHLRSGVRGDLHAHIDVVVPAKLDHTDIELLRQLKE
HRSRDVAEVRTSSSPAASNAGGLFSRLRETFTGR
119869552YP_939504.1 hypothetical protein Mkms_3520 [Mycobacterium sp. KMS]MLNLGAPMIPRPRAAATAWILGATAYLTAEAVTAAAYRPSYSYVRDYISE
LGAPGQPWAALMNIAFVVQGVLFLSGAVLVSGSRHRMLTAFAVANAVGNI
LVGTVPAGGGVLHIVGAALAIGGGNAAALAGASLRPGRTFRLFSRVIGGF
GLASLGALGVQTWTGIVMLPDPVWERASVYPILTWQVCAAASLVGALPPA
RRQHP
119869550YP_939502.1 putative metalloprotease [Mycobacterium sp. KMS]MSIEVSNESGIDVSEEELISVARFVIEKMNVNPAAELSMVLLDTSSMADL
HMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPAMLGDIVLCPEFAAKQ
AETAGHSLGHELALLTVHGVLHLLGYDHAEPDEEKEMFALQRELLEEWVA
HQVEAYHLDRQTERDRRLLDKSRYFDE
119869548YP_939500.1 hypothetical protein Mkms_3516 [Mycobacterium sp. KMS]MTELDPEDDKLVVLARGAMARAEAAGGAAVRDLDGRTYAGAPVALNALPL
TALQAAVAAAVSSGAAGFEAAVLVGGSADDAGVAAVRELSADAAVIVTDR
SGKVLS
119869546YP_939498.1 amidase [Mycobacterium sp. KMS]MADSSAPRPARTAFPTLTDQLYQLASGAVTADDLVRRSLHAISASQPTLN
AFRVVLAEQALAEAAEADRRRAAGDQRPLLGIPIAVKDDVDIAGVPTRFG
TAGTVRPADADAEVVRRLRAAGAVIVGKTNTCELGQWPFTSGPAFGHTRN
PWSREHTPGGSSGGSAAAVAAGLVTAAIGSDGAGSVRIPAAWCHLVGIKP
QRGRISTSPLAEAFNGITVNGVLARTVTDAALVLDAASGNAAGDRHRPAP
VRVSEYVARAPGPLRIGLSTKFPFTGFHATLHPDIRAALHTVSGHLEELG
HTVRPADPDYTVGMSWNFLSRSTSGLLDWAERLGYGVDFDKRTKANLRMG
RLLSEHVLRKARAKEAAAQRRIGWVFNICDVVLAPTTAQPPPRVHDFDEL
GGLATDRTMIKACPVTWPWNLLGWPSINVPAGFTADGLPIGVQLMGPAES
EPLLISLAAELEAVSGWVARQPKVWWDTPQMSQAAKAPTDDGPSGDPLEL
RETA
119869544YP_939496.1 undecaprenyl pyrophosphate synthase [Mycobacterium sp. KMS]MTSSRRGAERKKSQFPQLDPPADDYPTFPDKSTWPVVFPELPPNTNGRFA
RPPQHTSKAAAPKIPADQVPQHVAVVMDGNGRWATQRGLGRTEGHKMGEA
VLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRE
NLNDMGVRMRWVGSRPRMWRSVSKEFDIAEEMTVDNDVITINYCVNYGGR
TEIVEAARQLAQEAVDGKVNPSRITEAAFARHLHRPDIPDVDLFIRTSGE
QRASNFLLWQSAYAEYVFQDKLWPDYDRRDLWAACEEYVSRNRRFGRA
119869542YP_939494.1 zinc uptake regulator [Mycobacterium sp. KMS]MSPAPVRATRQRAAIADLLDGLDEFRSAQELHDALKRRGEGIGLTTVYRT
LQSMAESGLVDVLRTDTGESVYRRCSADHHHHLVCRACGAAVEIQGGQVE
TWAADIAREHGFSDVSHTIEIFGLCGDCSAR
119869540YP_939492.1 glycyl-tRNA synthetase [Mycobacterium sp. KMS]MAPSSSIIDTVANLAKRRGLVYQSGEIYGGTKSAWDYGPLGVELKENIKR
QWWRSVVTGRDDVVGLDSAIILPRQVWVASGHVEVFNDPLVECLNCHKRH
RQDHLQEAYFEKKGAKDGLAGPDSVPMDEIVCPDCGTKGQWTEPRDFNMM
LKTYLGPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKS
FRNEITPGNFIFRTREFEQMEMEFFVEPSTAKEWHQYWIDTRLQWYVDLG
IDRDNLRLYEHPKDKLSHYSDRTVDIEYKFGFAGNPWGELEGVANRTDFD
LSTHAKHSGADLSFYDQATETRYTPYVIEPAAGLTRSLMAFLVDSYTEDE
APNAKGGVDKRTVLRLDPRLAPVKAAVLPLSRHADLSPKARDLAAELRKN
WNVEFDDAGAIGRRYRRQDEIGTPYCITVDFDSLTDHAVTIRERDTMTQD
RVALSEVSDYLALRLKGC
119869538YP_939490.1 deoxyguanosinetriphosphate triphosphohydrolase-like protein [MycobacteMNPRLQDSYDEFDRQRRVDEPAKSAVLPGTGTEHRTDFARDRARVLHCAA
LRRLADKTQVVGPREGDTPRTRLTHSLEVAQIGRGMAVGLGCDPDLVDLA
GLAHDIGHPPYGHNGERALNEIAKAFGGFEGNAQNFRILTRLEPKVLDAT
GRSAGLNLTRAALDAVTKYPWQRGDRTKFGFYGDDMAAAWWVRDGAPAER
PCLEAQVMDWADDVAYSVHDVEDGVVSGRIDLRVLADDDAAASLARLGAE
AFPTLAPDDLLAAAERLSQMPVVSQVGKYDGTLGASVALKRMTSELVGRF
ANAAITETRSVAGGGALHRFVTELAVPTLVRAEVAVLKMLALQFIMSDHG
HLGIQADQRTRIHEVALILWGQAPSSLDPLFAPEFVAAEDDGARLRVVID
QIASYTEGRLERVHEARSPRPLD
119869536YP_939488.1 hypothetical protein Mkms_3504 [Mycobacterium sp. KMS]MATMIRIRRSVAIGAFAAAAVAAPLAAALSTTPEQVTQAGPACLAWFGNK
DDGKCLSYSNGTPVGVATPGVAFGGAGVGLTTGPLLPGTTISQGIGN
119869534YP_939486.1 hypothetical protein Mkms_3502 [Mycobacterium sp. KMS]MGREKGSRWDVGTRDNAITLERFDDGDERVSEDVLEVEEARALAALLTKH
ADKLESSDRDKSSDSDKSSDDEKSSDDDESDDSDDSEKSEKSDSEKS
119869532YP_939484.1 hypothetical protein Mkms_3500 [Mycobacterium sp. KMS]MAWFLAMQGPPSKLGQSLIYELPESADRAKLAEEMASAATLDRVVPVPAI
FGGQRQEVTLYVRPAAWGVWAFYEMSDEERRQMMAAANPLMSALAQAAKQ
QQTGRGQRQGPGPSQTPLGL
119869530YP_939482.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTTTAEHLRNALDGRWRDVKNDMRDKLSHEVFKPHYTPNTVIARTKVNEQ
LRIMAAEGAAEDGFAKEHGGNGNVGAAITQIEMLAMSDLSLMVKAGVQWG
LFGGAVENLGTERHHEQYVKHIIDCDLLGCFAMTETGHGSDVQSLETTAT
YDPDTQEFVVNSSTPTARKDYIGGAAQTARMAAVFAQLITHEDGKPVNHG
VHCVLVPIRDENGNDLPGVTTSDCDYKGGLPGVDNGRIVFDNVRVPRVNL
LNRYGDVAEDGTYTSPIENPNRRFFTMLGTLIRGRVTVGGSGAAAARVAL
DIATRYALQRKQFSAPDGGEVVIMDYLVHQRRLLPLIARSYALQFAQNEL
VAKCHELQSAEHPDAEEQRELEARAAGLKAANTWHASRAIQESREACGGA
GYLAENRLIGLRGDIDVFTTFEGDNHVLTQLVAKELLTAYADDVKGMSPV
EWVRFAANTVGTRVMKRTAAETIMQTILDTRQDNEEEGSLFNRGTQVQMF
EDREEYLLSSVARRLQGKSKEMSAFDAFNAVQDHVLHTAQAHIDRIVLEA
FVAGIDACEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAV
TRGINERCRSLRPYAELLVDGFGIPEQLRYAAMMDHKELLTAEPA
119869528YP_939480.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MWRQPKAVWAVAFASVVAFMGIGLVDPILKPIADNLNASPSQVSLLFTSY
MAVMGVAMLITGVVSSRIGPKRTLLLGLVVIIAGAGLAGMSGTVMEIVGW
RALWGLGNALFIATALATIVNSARGSVAQAIILYEAALGLGIAVGPLVGG
LLGEISWRGPFFGVSALMVVAVVVTAILLPPTPRPERATTLADPFRALRH
RGLLGTSITALLYNFGFFTLLAFTPFPLDMSAQQIGLIFFGWGVALAFTS
VVVAPRLQHRFGTVPTLIVNLLAMTATLVVMAIGTDSKAVLATCVVVAGL
FIGVNNTLITETVMKAAPVERAVASAAYSFLRFGGAAVAPWLAGVLGEQV
DVHLPYWVGAGAVLAAAVVLTATRGHLRGIDVEEDELTERTDEARAVTVG
SET
119869526YP_939478.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTATPTPSQPRRAGSLQPGELAQASVMAALCAATAIIAVVVPFAAALSLL
GTVPMGLLAYRYRLRVLIAATVAGATIAFLIAGMGGMMSVIDCAYIGGLT
GIVKRRGRGTPTVFVAALVAGTAFGAAAVAALAVLSRLRNLIFDSLTANI
NGIAAVLSRIPNMEDSAERLKRDFATALDYWPLVIGGSGILSITMVTLIG
WWALSRVLGRLVNIPDVHKLEAAAESGPVAPVPTELRDVRFRYPNTGQDA
LGPVSLAVSPGEHLAITGANGSGKTTLMLVLAGREPTAGTVERPGAVGLG
RLGGTAVVMQHPESQVLGTRVADDVVWGLPPGTKTDVPRLLSEVGLSGME
ERDTGGLSGGELQRLAVAAALAREPALLIADEVTSMVDQQGRDGLIQVLS
GLTEHHDMSLVHITHYNDEAGVADRTINLTGNGGAADNAEMVETAAAPTG
TTPVAHTGAAPVLELVGVGHEYATGTPWAKTALRDIDFTVPEGDGLLIHG
LNGSGKSTLAWIMAGLTVPTTGSCLLDGEPVSDQVGAVAISFQAARLQLM
RSHVDREIASAAGFSHHDHDRVRQALATVGLDPTMASRRIDQLSGGQMRR
VVLAGLLARKPRALILDEPLAGLDAASQRGLLRLVTDLRRNAGLTVVVIS
HDFSGLEELCPRTLHLRDGLLAPASATAGGVS
119869524YP_939476.1 C69 family peptidase [Mycobacterium sp. KMS]MTAPRRVDADFLALPRQHLADAALSAALAAGATYADLRIHAITSELVQLR
DGELETAVIDREIGLAVRVIVDGTWGFASHAELDPAVAADTARRAVAVAT
TLAPLNAERIELAPEPVYRDVSWVSDYRVDPFIVPAADKIAVLGEYSGRL
LAADGVDHVSAGLHTAKEQTFYADTFGSSITQQRVRVLPTLDAVAVDSAA
GTFETMRTLAPPTARGWEVVAGDEVWDWTAELAELPSLLAEKVKAPGVTA
GPTDLVIDPTNLWLTIHESIGHATEYDRAIGYEAAYAGTSFATPDKLGTM
RYGSPVMNVTADRTVEYGLASIGFDDEGVRAQSWDLVRDGIFVGYQLDRV
FAPRLGVARSNGCAYADSPHHVPIQRMANVSLQPAAEDVGTDDLIARVED
GLYIVGDKSWSIDMQRYNFQFTGQRFFRIRDGRLDGQVRDVAYQATTTDF
WGALEAVGGPSTWRLGGAFNCGKAQPGQVAAVSHGCPSALFRGINVLNTR
EEAGR
119869522YP_939474.1 hypothetical protein Mkms_3490 [Mycobacterium sp. KMS]MFRQLSALVATSSGDLRLDTVIRLTCGRALRLLPLPVEVDLFDGKSDAES
VVAAFAEQFATDVTGVSDNQRTCFVTALGDRAFRVSAAVFVADFVPRVWA
GLEALGLGHPGRDVPVDWDHETDPAQALLGEFVPAVARLRALDPLTTEVV
RLRGAVAHNCRLCKSLREGHALDAGGSESLYAEIQDYEHSEQLSDDHKAA
LRYVDALVWTPSAIPVEVARGVRSCFSEDESLELTLDIMRNATNKIAVAL
GADTPRVASGTERYLIDDDGQTVFAGAP
119869520YP_939472.1 hypothetical protein Mkms_3488 [Mycobacterium sp. KMS]MNPQLDGSCVSIDLPTSIVELVGGYGFLSNLLCGLALGAVAFLLGKKEAA
PPHTIALLASGVLILAADSFLFASVHSRKPFVIDDVIAPGGEYVCYLVWT
LAMPGFGMLMVGATVLVVSIGWMIVQYAITNDIESPIFAALGGVFSFFIV
LTTTLSLVNVSNQYLVFMMYPDRPSGLAVAAVWIFGLVMAAIACSMIVLR
TAGLYRYRKAQADWGAVADSRFRALALAAISISAYGFLAITVDALIFLFR
ADDSVRAPGVMWSAIVLCLGLPWVIYLPICYALPGPVFRAGRRPPVR
119869518YP_939470.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVRDDWVVGGDRRDAAAERIYASAVDVVVTEGLDALDIDALAKRLHCSRA
TIYRYAGGKAQIRDAVLMRLAAGVIDTVRRAVADRSGADRVVTAITVALG
ELRSDPMRKLLMGAPNAPELGALHSSPVLGQLAADLSGITGDDPLAAQWI
VRVVVSLAYWPDPDPRQEEQLLRRFVAPAFSAASSR
119869516YP_939468.1 hypothetical protein Mkms_3484 [Mycobacterium sp. KMS]MNGSVRAVFTAGVIALTGGALVVSTPLLPTTVEVVRPVVNTAGVATLAPP
VEPPSADELRSALALVGQLAQAPIVADEPPVRVAAAAFDDPAVLDTASTV
IDDVYSVARYWANYVALDLGPWLLNWVPLGYLISDQIYIWYPDLVLPTVD
SFVYDFLDPVVNDALNPAVWLEGINAVIGTAANGVVNGIVDEIDYVLSLG
WFPIPLPPLPTPPLPRLASESAPAVTVTVSSEFDEIVTDTTDGPLADAAP
QASVEQIATEKIDETETDPVAEVQDPGDSGSAAEDVEEPASDSEDEEPQE
VADDKSVDDPSDADQPDADQGEGAEQESAAKTAETSSGENGSGD
119869514YP_939466.1 4Fe-4S ferredoxin [Mycobacterium sp. KMS]MLAALIERGYRVVGPTVSDNAIVLAELTSADDLPRGWGVDVAPGSYRLRR
RDDDALFGHSAGPQSWKQFLHQPRQRLWSSDGAPSDEPPRYAFIGVRACD
LSAIRVLDGVLGGGAHPDRGFTGRLERLFVVAVNCTEPGGLCFCASMGTG
PAVGPGYDLALTERIDGQGRRYVVDVGSDDGADVLAAVAHRDAEPAEVDS
ARADVREAANHMGRQMPELDLRRLLIDSRESPQWEEVAGRCLTCGNCTMV
CPTCFCTSVEDVTDLSGEHAERWMHWASCFEFDFTFVHEGSTRQTASSRY
RHWLTHKLGSWHDQFGSSGCVGCGRCIAWCPTGIDITEEMNRMADGADAA
DD
119869512YP_939464.1 NADH ubiquinone oxidoreductase- 20 kDa subunit [Mycobacterium sp. KMS]MSPPTLGVWKFASCDGCQLTLLDCEDELLTLAGQVQIATFLEASSAILGG
PYDVSLVEGSITTAADERRIKEIREQSRVLVTIGACATAGGVQALRNFAD
VDEFASVVYARPDYIDTLATSTPAAAHVEVDYQLQGCPIDRGQLLETLAA
LLVGRKPRLPAKTVCTECKLRGVTCVMVAEGVPCLGPVTHAGCGALCPTY
HRGCYGCFGPAATPNTAALIPVLRRDGMSGGDVDRVFSTFNVAKFAEHRD
DT
119869510YP_939462.1 hydrogenase maturation protease [Mycobacterium sp. KMS]MSDIVVIGVGNSCRRDDGVGPAVASAVDARGTPGVRVLSVADDPCAILDA
WAGARLAVVIDAAVATPSTPGRIHRCAADQLPASSTVTSHAVDLATVLEL
GRALDRMPGELLVFAVEAADTGVGLGLSATVAAAVPEVVDAVLAEIEHMP
SGRQQGSKCPGRGSPR
119869508YP_939460.1 3-oxoacyl-ACP synthase [Mycobacterium sp. KMS]MGTIIDRVELTRGGWRTRHSALHLAVAAARSCLDAAQRDPDDLDLLVNAG
IYRDRNLGEPALAALIQEDIGANPEDPHGGPFDDAHGTFSFDIANGSCGI
LTGLQIVDGFLRSRAVTHALITASDADPGRGMSRDFPFTPVGAALLCDWT
DDDSGLGRVSWVNDPDGGANFRATVGSADARNVLRFEESPDFDDRLAQAA
VHAVHSCLDDAGLTLSDIDVVVAAPGRHRYGVALAERLDLRAGRLVVAED
ENAHTASLASALQPALAALPPEGLILIVAAGAGITAGAALYRAPARPGAG
GRIR
119869506YP_939458.1 UspA domain-containing protein [Mycobacterium sp. KMS]MNANGSGILVGVDGSAESDAAIRWATQEAVMRRAPLTLAHVVAAVATSSP
IGPILAEINEWQQDNARHVLEQALKTAQACAPESHHPDIHTEVLGASVVP
TLVRESADKQMIVVGNRGTGALGRLLLGSVSTGLVHHAHCPVAVIRPTRG
GSPDADAPVLLGIDGSPASEAATAMAFDEAARRGVDLVALHAWSDVAVFP
IVGPAWREYESQGEEVLGERLAGWQEQYPDVRVHRRLVCDQPARWLIRES
EHAQLVVVGVRGRGGFASTWLGSVSSAVAQSADTPVLVVRDASRGQGR
119869504YP_939456.1 diacylglycerol O-acyltransferase [Mycobacterium sp. KMS]MRGPQGADSGDMDHLSTLDASFLEAEDSDPHVSLAIGSVSVLDGPVPDDD
AFVSGLADRVLAVPRFRQVLRTHPLDLEAPEWADAENFDISHHVHRTALP
HPGDDAALFRLTADVMERRLDRERPLWECWIVEGLPDDQWAMIMKLHHCI
ADGIATMHMLAGLSDSGEGDTYATEIRAAGSTAQRRFRLPQLSPDPRQWV
GTLWRTSTGLVGAAARGVGGAAEIVGGLLRPSPTSLVGSVSTMRRFAGAE
VSLDDAQHVCSAFGVTLNDVVLAAITDAFRAMLIRRGEKPQGNSLRTLVP
VSVRANNAVGKVDNRVSLMLPYLPVDKADPEEQLMTVHARLTQAKNSGQR
QAGHAVISATNIIPFPLTAWAVRAMTRLPQRSVVTVATNVPGPRHHMQIM
GRKVVRMFPIPPIALGLRTGIAIVTYADRLVFGITGDFDTAPDVDDLARG
IEHAMDRLVEISTDAENRRPH
119869502YP_939454.1 HAD family hydrolase [Mycobacterium sp. KMS]MTVPVVIDPRYHDAVIFDLDGVLSDPAPTVTLARELQDVGVKTAACSSNS
HGRDMVKSIGAEGFDVCVDGSAEDRAGAPCLEAARRLGVRPQRAVLIEDS
AAGRTPGRDGGFALVIRVDRTRHPDEPIDGDADRVVAGLAGIAVRTGDRR
VSEVPNALESYGQLIGITGARESVLFLDYDGTLSPIVSEPDAAVLVDGAA
EALALVAAVCPVAILSGRDLADVRTRVGAPGLWYAGSHGFELTGPDGTYH
QNEAAAAFVPVLERAAGDLRDLLGHVPGIFVEHKRFAVAVHYREVGSSDE
VAEIVSTTHRLGRQAGLRVTSGRMLVELRPDIDWDKGTTLRWIRDRIDAA
GSLMPIYIGDDLTDEDAFDAVRFDGVGIVVRHDEDSDRKTAARFSLQSPD
QVREFLQRGSQWLAYKHQVASEAWDLTYEGYDPQSEKLREALCTVGNGYF
ATRGAAPESKAGQVHYPGTYAAGIFNRLVDDVSGTAVDNESLVNLPDWLS
LTFRIDGGDWFDIDEVEVLSYRQTLDLRGATLTREVRFRDDAGRTTSVTQ
QRFVAMHLPHVGALQTKIVAEDWSGRITIRSTLDGNVTNSLVERYRDLGK
EHLELIEKRQLSDDSVLLTVRTTQSGIPIAMAARCIVWRDDAPVGASYRL
VGDGAEIGHEITVEQSVGEALTVEKLVTLFTGRDVATSDPAVDAERWVAR
LGRYAEVREGHLTDWTHLWERLSIEFDDFTDEVRILRLHLLHLLQTVSPN
SADLDVGVPARGLHGEAYRGHIFWDELFIFPVLNLRLPMITRSLLAYRYR
RLPEARHAAREAGYAGAMFPWQSGSDGREESQRLHLNPRSGNWNPDASAR
AHHIGIAVAYSAWKFYQATGDLAYLIDYGAEMLAEVARFWVSLASYDEDR
GRYSIRGVIGPDEFHSGYPDAPYDGIDNNAYTNVMAVWVIMRALDALDLL
PLPNRLDLLETLGLTSGELAHWDDVSRRMYVPFHDGVISQFEGYGELEEL
DWDRYRAHYGNIQRLDRILEAENDDVNRYKASKQADVLMLLYLMSVPELG
EILNRLGYHFPADQVPSMVDYYLARTSHGSTLSGVVHTWVLARANRDRAM
EFFELALKSDVSDIQGGTTSEGIHLAAMAGTVDLMQRCFTGLETRSNRLI
LSPYWPESLGVLAVPIHYRGLHLHLRVSGKGVIISVDPREAAGVVVECRG
RVVQLMPGTTVRFPG
119869500YP_939452.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKAMQLSAWQTPPEIREVPEPEPGPGEVVIRVAGAGACHSDLHLLHDFAP
GMMPWNPPFTLGHENAGWVHTLGAGVSGFSVGEPVAVYGPWGCGRCKRCQ
VGMENYCERAADQPAAGGGLGYDGGMAEYMLVPAARLLVPLGDLDPVEAA
PLTDAALTPYHAIKRSLPLLTPGATAVAIGIGGLGHLGVQILRALTAARI
IAVDNRPEALRLAERSGADHAVRAGDDAAGEIRDLTEGLGADVVVDFVGV
DATLALATAVARPRSDITVVGIGGGTVPFGFFSVPYEASLATTYWGSRPE
LMEVLELARHGRIKTEVHRFPLEEGPQVYERLAAGEFTGRAVITPNS
119869498YP_939450.1 hypothetical protein Mkms_3466 [Mycobacterium sp. KMS]MKRHEPAPRHDTSRRRRDDAMEPFEIRVPRWPLLVRLFDRGPLVRPTDRF
EALVVTLAIVVVLLAVPVAAAIGTAIHDSRSHFYNEQNATRQHVTAVVTD
VPEYRSFTRTGMMTVPVEWWEGDTRHTETVQAHGSVDPGDAVDLWIDADG
ARVLAPAPASRAAVEAVAGAAAIWLSVAAGAAILSTLVQMTCDRIRSAAW
QHDLDTLVDGGGHTTTHP
119869496YP_939448.1 transporter [Mycobacterium sp. KMS]MPNSHVEAGRRLGPPSERTARTGPAKWIRRFAIPIILGWILLVAVLSLTV
PQLEVVSQMRSVSMAPAEAPSVIAMTRAGEVFEEFESDSSVMIVLEGEQR
LGDEAHRFYNDMVDRLEADTVHVEHIQDFWGDPLTEAGALSGDGKAAYVQ
LYLAGNQGEALANESVKAVQDVVTGLSPPPGVKVHVTGGSALAADQQIAG
DRSVRVIEMVTFAVIIVVLLIVYRSITTVLLVLGMVLLGLSAARGVVAFL
GYHELIGLSTFATTLLVALAIAAATDYAIFLIGRYQEARTAGEDRESAFY
TMFAGTAHVVLGSGMTIAGATFCLSFTRLPYFQSLGVPLAVGMTIAVFVA
LTLGPALITVATRFGLLEPKRAMRIRGWRRLGAAVVRWPGPILLLTIALS
LIGLLTLPGYKTNYNDRNYLPDDLPAMEGFAAAERHFSVATMNPELLLVE
TDRDLRNPADFLVIDKIAKAVYRVEGIGSVQAITRPQGKPLENATIPAQM
SLGGVMQAMTRPYLQGNMEMLLLQADEMEKSVDTMTEMIALMEQMSATTH
DLVGKSKDLSVEIAELRDSISDFDDFFRPIRNYFYWEPHCFNIPVCASMR
SVFDALDGVNTMTEDFQAIIPDMERLDALMPQLLAIMPQTIETMQTARAT
MLSMHSTQSALLEQQAAMDVNSTAMADAFNEAMNDDTFYLPPEIFENEDF
KRGMESFISPNGRAVRFIISHEGDPLTVEGIERIDAIETAAKEAIKGTPL
EGSRIYIGGTAAAFKDMQEGNNWDLLIAGIAALSLIFIIMLILTRALVAA
AVIVGTVVLSLGASFGLSVLVWQHVFGIELHFMVMAMAVIILLAVGADYN
LLLVARLKEEIPAGINTGIIRAMGGTGSVVTAAGLVFAFTMMSMVVSELT
VAAQIGTTIGLGLIFDTLVIRAFMTPSIAALLGRWFWWPQRVRQRPATTG
SLIRR
119869494YP_939446.1 hypothetical protein Mkms_3462 [Mycobacterium sp. KMS]MRVTDVPFAVLRFQYQIARIPLQVIEDRVVARLDAEAPARLFYERSLGML
DLAVGNALSAPEVEHRGAALIERSEALRRAAQLDETATEVHQQAEANLES
TREQAKREQMQAEQDREREIKESRETASERKQNAVQTAQKKAADAKQQAD
QIAAQRVKSAEAARRQEEAVISATERSIEKVAQGKLDDAADKAGNAAAKR
AQADRVEDLAETEKEKRQQERAAKNGN
119869492YP_939444.1 hypothetical protein Mkms_3460 [Mycobacterium sp. KMS]MYTNEFPEETLRINFEHWLCEAIRTGVRNAHLQPLTPLSAQTWQAIDEVA
DAAAAVGGQSAHVARLQNVVLAARDQFARQLDGTHRTPHILLGRAAS
119869490YP_939442.1 hypothetical protein Mkms_3458 [Mycobacterium sp. KMS]MTRLPGVVRSKATRASAGVARSVGTLNSAGVSASVGTMNSAGVTGSIGTA
GSAAVAGSALTALSFAISACLACVGCFACARCVACLGCARCSNCVGCVGC
YNCSGLRNAVGLRDVHV
119869488YP_939440.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTPEKAMTEPVLDVADLQVRIGRRDIVRGVSFTVERDKTLGIVGESGSGK
SMTVLAATGLLDAPGAVVGGSSRLGGQTPTQLVGASARTLRSVHGGRIGF
VFQDPGTSLNPLLTLERQITESLEAHRNMTRRQARERALELLTAVGLPEA
DRRLDSYPHQLSGGQRQRVMIAIALACDPELLIADEPTTALDVTTQAQII
DLVRDLQRDFGTAVVWISHDLGVIGQVADDVTVLQNGVAVEQAPVLDVFD
HPQHDYTRELLAARPLVGGDGPPAADPDAPVLLAVDGLDVRFDVSGPTGR
STVHAVQDLSFQIRRGNTLGLVGESGSGKSTVAAALTGLVAPHAGSATLD
GVDVLAVRGADEKRLRRRISLVFQDPFSSLNSRMRVGAAIGEPLAVHKLV
DGRAGRRARVAELLDLVGLPTDFASRYPHELSGGQRQRVSIARALATEPD
LLILDESTASLDVSVQSKVLDLLARLQRDLGLTYLFIGHDLAVIQRMSHD
VLVMRDGAAVEYRPATDLFAAPEQPYTRDLLAAVPPARPRASA
119869486YP_939438.1 binding-protein-dependent transport systems inner membrane component [MTALLTHPVVRFLARRIAYSLVVLIGVLVVVFALVQLVPGDPVRIALGTR
YTPEAYEALRSASGLDRPLIVQFFSYLGNALTGDLGVSFRNGDPVTATLL
DRLPATVSLGLVGIVFALLIAVPAGIWAALREGRVSDAIVRVSSQFGVSV
PDFWLGILLIALFSSTLGWLPTSGYRPLFDDPAGWLRHIVLPGLTVGLVA
AAIMTRYIRSAVLEVASMGYVRTARSKGLAPRVVTLRHTVRNALIPVLTI
TGIQLATILGGVIVVEVVFAWPGLGRLVYNAVAARDYPLIQGAVLLMAAL
FLLINLIVDALYAVADPRIRLS
119869484YP_939436.1 hypothetical protein Mkms_3452 [Mycobacterium sp. KMS]MTTISRVIAAVVLALGVAVGAAGPAQAEQQVLQGIYTYTQADGLSGEWTI
FPSCVPTVGDLREPLYLPVACRLHVTSFEGVQGGDAVLTNGVWAYDTTIA
DGITCSDGSPLQVVEIYEFNTETMSGTRTNTHAPGCNGELPATMIKTPFS
LAYKTELPIPVDKYPLICEPGGLRRCF
119869482YP_939434.1 dihydrodipicolinate reductase [Mycobacterium sp. KMS]MTKRIVVWGTGFVGKMVIAEIDRHPLFELVGVGVSNPAKVGRDAGEICGL
GHPIGVTATDDVDALIALDPDALVHFGPTAAHADANIAVITRFLRAGIDV
CSTAMTPWVWPTMHLNPPEWIMPVTEACELGESSCFTTGIDPGFANDLFP
MTLMGVCSEVKRVRAAELLDYTNYTGDYENEMGIGRPPGHRALLETPDIL
VFAWGATVPMIAQAAGIMLDEITTTYDKWVTPTERTSAKGVIEAGSVAAV
RFTINGVYRGETRIQLEHVNRIGADGRT
119869480YP_939432.1 hypothetical protein Mkms_3448 [Mycobacterium sp. KMS]MTDATGLSIGATALTAVVVDRAAVRRSPVLTLFPHRPPEVGVPSENPRLD
ERGLVITDFVDRVGDPVGILAADGTSHRGATLVADALRALLYALPRGHEP
GAPIGVTHPAHWHAGSVDALRAALAEIAEFGPATPVLPDAAAALTALQAE
PGLPTRGLIALCDFGGSGTSITVVDAADGYRPVAPTVRHLDLSGDLIDQA
LLTHVLAGVPDSADLSGTSAIGSLTRLRGQCRAAKERLSTDTVTALSAEL
PGSAGEVRVTRTELDDVVRGPLAEFVDVLRHTIERTGARPADLAAVATAG
GGARIPIVTTALSENFRVPVVTTPRPELSAAIGAGLTAVRGPDDDHTALA
AAAPLTAAAPAAFENAESGTFGALAWSDADDIPDVAPAAYEADPAADPQD
LRPRLMFGAAESAADDRPAVVPWYRRTPVALAIGAAAVLAALAAAVFLVN
RDDGDAPATTDTTTPVTTTTEGPAPAAPPPVDNPEPQAPAPETVTQQAPP
PAATEAPPPPPAQEPPPPPPAEEPPPPPPAEEPPPPPPTTQPPPVIPTLP
YTTIPGLPFVPAPPGFGG
119869478YP_939430.1 ThiJ/PfpI domain-containing protein [Mycobacterium sp. KMS]MDAQIVLFDGFDPLDVIAPFEVLVAGSDAVGGDLTVELVSAEGPRPVVSG
SRGLVLHATSGLDPHRPGFVIVPGAAGPIEGDPDEGVETIPVLLARFGDT
VAIPLMRRAMADPEVTVATVCGGSLALAMAGLLEGRFAVTHHLGMDMLEA
TGAHAVPARVVDDGDLVTAAGVTSGLELALHLLDRSYGPQIAAAVESLFA
YERRGTVWSNRGRIPVSV
119869476YP_939428.1 hypothetical protein Mkms_3444 [Mycobacterium sp. KMS]MPESSVVVRPQPMDSAYFTAGSRLQAAGLRPAIALFEQAARVVPLPAPPQ
PIAIADYGAATAHNSLLPICAAIAVLRTRTTREHSVLVAHTDVPENDFTA
MFRTLTEDPDSYLRKDGASFASAVGRSFYSQILPSNSVTLGWSSYAIQWL
SRVPAPVPDHLQVAHTAEEALRTAYARQAAHDWHEFIAFRGRELCPGGRL
VVMTMGIGEDGEYGYRPLLAALTDSLTELAGRGLVRQDEVVRMTIPTVSR
RAADFMAPFAPSGRFERLEIEHLEIFDGEDRFFAQYRMDKDAKAFGDNWG
QFARASVFPTMVGALDGGRDDPRAGQFLDRLEAGIAARLAAAPEQTQIPL
AHLVLHKRPKNR
119869474YP_939426.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MSQTVRGVISRSKQQPVEVVDIVVPDPGPGEVVVDIIACGVCHTDLTYRE
GGINDEYPFLLGHEAAGTVESVGEGVTNVVPGDFVILNWRAVCGQCRACK
RGRPHLCFDTHNAAQKMTLTDGTELTPALGIGAFADKTLVHEGQCTKVDP
AADPAVAGLLGCGVMAGIGAAINTGAVGRDDTVAVIGCGGVGDAAIAGAA
LVGAKKIIAVDTDDKKLQWAREFGATDTINARSVDDVVEAIQELTDGFGT
DVVIDAVGRPETWKQAFYARDLAGTVVLVGVPTPDMRLEMPLVDFFSRGG
SLKSSWYGDCLPERDFPTLISLYLQGRLPLDKFVSERIGLDGIEDAFHKM
HAGEVLRSVVVL
119869472YP_939424.1 type 11 methyltransferase [Mycobacterium sp. KMS]MTTLDDTTSTEQFAERIVGAIDSASLTILLSIGHQTGLFDTLAQLPPATS
TQIADAAGLDERYVREWLGGTVAARVVDYDAAAQTYSLPPTHAAVLTRAA
GPDNLARVAQFIPLLGEVEQKIIECFRHGGGLPYSAYPRFHTLMAEESGE
VFDAALVDVILPMADGLPARLAAGVDVADIGCGSGHAINVMAQAFPASRF
TGIDFSDEGLGVGRAEAQRLGLQNAQFVAADVATLDAVEAYDVITVFDAI
HDQAQPARVLANIQRALRPGGVFLMVDIKASSRLEDNVGVPMAPYLYTVS
TMHCMSVSLGLDGAGLGTCWGRQLATSMLADAGFTEVDVREIDSDPLNFY
YVCRK
119869470YP_939422.1 hypothetical protein Mkms_3438 [Mycobacterium sp. KMS]MRASNQFADATTGVVYVHASPAAVCPHVEWALSSTLSARANLKWTPQPAM
PGQLRAVTNWVGPVGTGAQLANALRSWSVLRFEVTEDPSPGVDGHRWCHT
PQLGLWSGPMSANGDIVVGEMRLRALMAAGADVLAAELDTVLGTAWDEAL
EPYRDGGAGAEVSWLSRGVG
119869468YP_939420.1 alkylglycerone-phosphate synthase [Mycobacterium sp. KMS]MKWNAWGDPDAAKPLSDGIRALLEQALGVTEGAAPPALEDVTVRPSALPD
ADRDALGDIVGAPYCLVDDAGRLLHAGGKSTLDLLRRRDRGEQEAPDAVL
LPADEDQIAAILEYCGAQRIAVVPFGGGTSVVGGLDPIRGDFTAVVSLDL
RRLDRLHWLDEVSGEAELGAGVTGPDAERLLGERGFSLGHFPQSFCYATI
GGFAATRSSGQDSAGYGRFDDMVRGLRAVTPAGVLDIGRAPASAAGPDLR
QLLVGSEGAFGVITRVRLRVHPVPEVTRYEAWSFPDFATGATALRAVTQT
GSGPTVLRLSDEAETGVNLATTEAIGEQTITGGCLAVTVFEGSAAHAESR
HAETRALLEEHGGRSLGEGPAKAWEHGRFGAPYLRDSLLSAGALCETLET
ATTWSNVPALKTAVTDALTDALGRSGTSALVLCHISHVYPTGASLYFTVV
AAQRGNPIEQWRAAKAAASEAIMRAGGTITHHHAVGADHRPWMRDEVGDL
GVEILRAVKATLDPAGILNPGKLIP
119869466YP_939418.1 FAD dependent oxidoreductase [Mycobacterium sp. KMS]MTSSRSPVLNASRRATELSALADGAPLDVVVIGGGITGTGIALDAASRGL
SVALVEKHDLAFGTSRWSSKLVHGGLRYLASGNVGIARRSAVERGILMTR
NAPHLVSAMPQLVPLLPEMGGPARALVRAGFLAGDGLRRLAGTPASTLPR
SRRVTAGRAAELVPAVRRDGLAGAFLAYDGQLIDDARLVTAVARTAAQHG
ARILTRVGASHATGTSVRLTDQCTGESFDVAARAVVNAAGVWAADVDETL
RLRPSRGTHLVFDAAAFGHPTAALTIPIPGALNRFVFAMPEQLGRVYLGL
TDEDAPGPIPDVPQPSPQEVTFLLDTVNTALATTLTAADVRGAYAGLRPL
IDTAHARSETGTGAGSTADLSRDHAVTESPSGVISVIGGKLTEYRYMAED
VLDRAIALRGLTAGPCRTRDLPLVGAVGRVPADLPTSLVARYGAEAPHVV
ARARCDRPTAAVADGIDVTRAEFEYAVTHEGALTVDDILDRRTRIGLVED
DRNRALQVAKEFVDALVE
119869464YP_939416.1 UspA domain-containing protein [Mycobacterium sp. KMS]MTIVAGFSASRQGSAPLHLAAEIARCTFDRIIAAAIVERPWPPRGDPVEE
EYLRYVTAAARTSLERVVAEMSGDADVSVVVHKAASVPEGLTELAAHHHA
DVVVVGSSSSGLLGRVALGSVTDRLVHTAAVPVAIAPRSYPPSREPIRRL
TVAYGGHADAVRLIETATELAVRWSARLRIASFSVRPVAVFSGSIEPSAE
SLVVEQWSRRTADEITKQLNEIRAHIAAPDAEVVVGVSHDWRTAVEDVAW
EPGDLLLLGSGAAGPAAHVFLGSAAAKILRHSPVPVMIVPRR
119869462YP_939414.1 propionyl-CoA carboxylase [Mycobacterium sp. KMS]MTVMAPETVGETLDPRDPLLRLRTFFDDGTVELLHERDRSGVLAAAGTVN
GVRSIAFCTDGTVMGGAMGVEGCRHIVNAYDTAIEEQSPIVGIWHSGGAR
LAEGVKALHAVGLVFEAMIRASGYIPQISVVVGFAAGGAAYGPALTDVIV
MAPDSKVFVTGPDVVRSVTGEDVDMVSLGGPEAHHKKSGVCHIVASDELD
AYERGRRLVGLFSQQGHFDRTKAEAQDSDLAALLPESARRAYDVHPLITA
LLDDGVPFEEFQGKWAPSMVVGLGRLAGRTVGVLANNPLRLGGCLNSESA
EKAARFVRLCDAFGIPLVVVVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
ATVPRVTLVTRKIYGGAYIAMNSRSLGATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAAAPEDREALHEELAAEHERIAGGVDSAIEIGVVDEKIDPAHT
RSKLTQALAEAPARRGRHKNIPL
119869460YP_939412.1 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium sp. KMS]MTRPSTANGGFPSVVVTAVEATTSLAADIESTWKGLLAGESGIRVLEDDF
VTKWDLPVRIGGHLVDNVDDHMTRIDMRRMSYVQRMSKLVSGRLWETAGR
PEVDPDRFAVIIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGA
AAVAGLELGARAGVITPVSACSSGSEAIAHGWRQIVMGDADFAVVGGVEG
GIEALPIAAFSMMRAMSTRNDDPAGASRPFDKNRDGFVFGEAGAMMIIET
EEHALARGAKPLARLMGAGITSDAFHMVAPAADGLRAGHAMKRAMETAGI
DPKDVNHVNAHATATPIGDTAEANAIRVAGVEHAAVYAPKSALGHSIGAV
GALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYQYAINN
SFGFGGHNVALAFGRY
119869458YP_939410.1 (acyl-carrier-protein) S-malonyltransferase [Mycobacterium sp. KMS]MPQSHTQIALLAPGQGSQTPGMLEPWLQLSGAAERLATWSEISGLDLARL
GTTADADEITDTAVTQPLVVAATLLAHEEAARRDLFGGAGDNTVVAGHSV
GEIAAYAIAGVISADDAIKLAATRGAEMAKACALEPTGMAAVLGGEEAEV
LARLEALDLVPANRNAAGQIVAAGAVSALDKLAEDPPAKARVRKLATAGA
FHTRYMASALDGYEAAAREVAVAEPTATLLSNADGQPVASAADAIEKLVA
QLTRPVRWDLCTATMRQRFENAENAAIVEFPPAGTLVGIAKRELRGVPTH
PVKSPADLDGLTSL
119869456YP_939408.1 pyruvate dehydrogenase subunit E1 [Mycobacterium sp. KMS]MTTEFVRQDLAQNSSTAAEHDRVRVIREGVASYLPDIDPDETSEWLESFD
QLLERSGPARARYLLLRLLERSGEQRVAIPALTSTDYVNTIPTELEPWFP
GDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGFN
HFFRGKSHSGGGDQVFIQGHASPGIYARAYLEGRLTADQLDGFRQEHSHP
GGGIPSYPHPRLMPDFWEFPTVSMGLGPMNAIYQARFNHYLHDRGIKDTT
DQHVWAFLGDGEMDEPESRGLIHVAALEALDNLTFVVNCNLQRLDGPVRG
NGKIIQELESFFRGAGWNVIKVVWGREWDALLHADRDGALVNLMNTTPDG
DYQTYKANDGGYVRDHFFGRDPRTKALVEPMTDAEIWNLKRGGHDYRKVY
AAYRAAMEHKGQPTVILAKTIKGYTLGKHFEGRNATHQMKKLALQDLKDF
RDAQRIPIGDAQLEENPYLPPYYHPGPEAPEIRYMLDRRRALGGFVPERR
TKSKALALPSSDAYKALKKGSGKQEVATTMATVRTFKEILRDKQIGHRIV
PIIPDEARTFGMDSWFPNLKIYNRNGQLYTSVDAELMLAYRESEVGQILH
EGINEAGSVGTFIAAGTSYATHNEPMIPIYIFYSMFGFQRTGDSFWAAAD
QMARGFVLGATAGRTTLVGEGLQHADGHSLLLASTNPAVVAYDPAFAYEI
AYIIESGLHRMYGENPENVYFYLTIYNEPYVQPAEPENLDVEGLLRGIYR
YRAAAEKKSNTAQILVSGVAMPSALKAAEMLAEEWDVAADVWSVTSWNEL
NRDGVQVEKDLLRHPDRPAGTPYITTALADAAGPVVAVSDWMRAVPEQIR
PWVPGTYITLGTDGFGFSDTRPAARRFYNTDAESITVAVLEGLARDGNID
ISVAVEAARRYEIDDVLAAPEQTSDPGVA
119869454YP_939406.1 hypothetical protein Mkms_3422 [Mycobacterium sp. KMS]MAAADAPNYAQRLGIENDQVVQELGWDEDVDDDIRADIEDACGGELLDED
ADEVIDVVLLWWRDDDGDLVDALMDAITPLADDGVIWVITPKTGKPGHVQ
PADIAESAPTAGLMQTSSANLGDWIASRLVQPKSKAAGRR
119869452YP_939404.1 hypothetical protein Mkms_3420 [Mycobacterium sp. KMS]MSEQERNIEAVKKGYEAFSSGDIETVMSLFDDDVEWVQPGRSAVSGTFHG
KDEIRAYLGKLAEKPLTVKLHRLIGEGDTVVALTELTLAGEHGTDADVFT
LRDGKTVRVEVHGDTALMERVYGSKQAATAQ
119869450YP_939402.1 hypothetical protein Mkms_3418 [Mycobacterium sp. KMS]MSEQERNVEVVKKGYDAFAAGDIETVMSLFDDNIEWIHPGASAISGTYHG
KGELGSYLEKLTSKPIEVRVHRLVAEGDTVVALTDVTVESEHSRDADVFT
LRDGKTVRVEVYGDTALMERVYGKKQVSTT
119869448YP_939400.1 polysaccharide deacetylase [Mycobacterium sp. KMS]MFSPFRRRPDAIRGTDPLTAAPGPVFFDRTGKRLYYFAAGVIVLAVIVAV
LPVRVTPMAFDPLWTVPTNSDSGFPRRVLSTADDRRFPVLGSEDDEVLSR
VVRVDRRGDQWNLVDPFTNQLYRVADDDDKDRIRDSAYAIDHYGRPPDRH
LMLTFDDGPDVEFTTQVLDILSREKIPATFFVLGSQVVLHPDVFRRMIRE
GHMAGNHTMFHVDFDEHTDFRNRQEIIATDRVMRATAAYASRLFRIPRGD
PDNNTLALLQSQQLGYLQVDQDIDTLDWKVSPENEVAVPQLDGRGHVVLL
HDGGGDRSATVRMLEQLIAEAKSKGYTFSTLAPLLSEQELPVSNAEQYPA
DAATYHTLRLMEKAPGAVLGFLFWLGMGSLTVMSLLYLILALVCQYRQNR
LRWNDIGDDQLPMVSVVLAAFNEEKVIARTIAELRRSDYPRSRFEVVAVN
DGSTDGTLRILTELARDWPKLRVVDQANSGKSSAINNGINHASAVSTVMV
TMDADTLFRPDTIRNLARHFARHTHGRQVGAVAGHIKVGNRRNLLTAWQS
LEYISGICVTRMAERLLNAISIVPGACSAWSRTALEEIGGFCDDTMAEDC
DATLALQRRGYRILQENNAIADTEAPETIRALAKQRKRWTYGNIQALWKH
RAMLFRPRYGALGLVALPYAALSLIVPLLFMPLTIVAAGMSLAAGNWQSI
ALFAGFVAALHMIISITAVAMARERAWHLLVVPVYRIIYEPLRAYLLYAS
AYRAIKGTIVAWDKLERRNTVSAFVERHRPMPPILGAQQ
119869446YP_939398.1 glutamine--fructose-6-phosphate transaminase [Mycobacterium sp. KMS]MCGIIACRTHRPAAEYLLTALRRLEYRGYDSVGVAVRTTAGDIARLRTIG
RIGALELQLRQWTGAELDGTGIGHTRWATHGPVTEDNAHPHNDCSGRISL
VHNGTIENADRLRSALAGAGHRFTSAVDSEVLTHLIEDELLVADDLPSAV
RNALAVAEGTWALAVLERGTGRIVVAANGSPLLVARTAHGVFAASDIAAI
ADWVDEFQVVEDGDVMELTPTDPVACTDQNRVQPTMVRCIWRSGDADLNG
YADHMAKEIDEQPEAAMRVLDELAGGVADGTLWGDLGLAPFDRLQVIACG
TSLNAGMVIGNAVHGLAGLPVTRCVASEAGMDLPEPRTLCLAISQSGETA
DVLHAVSTRVAEGCSILAVTNSSHSTLARRADGVVHCAAGPEIGVAATKT
FVCQIIAGVAVTISALVAMSRVSRIQAIGLVDELRRLPDQLARAGTVAKS
VVPPLAEECIDASGYVFIARGTGLPYAAEGALKLKELTYRWAEHYPAGEL
KHGPLALISDGTPVVVVDNGDPKLATNIAEVQARGGRVVRIGPPGSCVPV
VEDPMGPWGPLQSALPLQILARTSALLLGRDVDKPRNLAKSVTVE
119869444YP_939396.1 two component LuxR family transcriptional regulator [Mycobacterium sp.MSVSSGGTGESATSIVVIDRQAVVHAGIEHWLIGSVPPIKIVGHFSDPAE
FLAAYPTADPTVDVVLSALKYDDHGPDFDSLRRICAGGHRVIVYSYLVTD
EVILTCLDEGALTFVAKSESGNHLRDAIYAARTSTPYVAPRMARALLNDK
TGGRPHLTKREREVLVAWFQTENKDVVGRRLFIEPSTVRTHLQRARAKYA
AVGRPAPTKAALVARAIQDGILSVDDL
119869442YP_939394.1 hypothetical protein Mkms_3410 [Mycobacterium sp. KMS]MKRWAFLLRPAWLALFVVVLAFAYLCFTVLAPWQLGKNTTTSRENDQIAR
SVTAEPVPVTSVLPRQDSAAPDEQWQRVTATGRYLPDAQVLARLRVIDGD
PAYEVLVPFAVDGGPTVLVDRGYVTPEQGTEVPPIGPAPTETVTITARLR
DAEPVPAGKEPLRENGTVQVYAINPGQISALTGVPLAGSYLQLVEDQPGG
LGVIGLPHLDAGPFLSYGIQWIAFGIIAPIGLGYFIYAEVRQRRRDKAAA
DSTAPATPEDKLADRYGRRR
119869440YP_939392.1 HAD family hydrolase [Mycobacterium sp. KMS]MTDTLARSTATRPQLVLFDLDGTLTDSAEGIVASFRHALGEVGAPVPDGD
LAGRIVGPPMHHTLRSLGLGEQVDAAIAAYRADYTSRGWAMNRTFDGIPA
LLADLRAAGIRLAVATSKAEPTAQRILAHFGLDGFFEVIAGASPDGTRAV
KADVVASALARLEPLPERVVMVGDRLHDVEGAAAHGIDTVVVGWGYGRAD
FAEPTSVPAFAHVDSVADLREVLGV
119869438YP_939390.1 hypothetical protein Mkms_3406 [Mycobacterium sp. KMS]MSVRLADVIGVLDEAYPPRLAEDWDSVGLVCGDPDEPVESVTVAVDATEA
VIAEVPERGLLLAHHPLLLRGVDSVAASTPKGALVHSLIRTGRSLFTAHT
NADSASPGVSDALADALGLTVEEVLSPIAADTELDKWVVYVPAENADAVR
EAMFGAGAGQIGDYSHCSWSAPGTGQFLPHEGASPAVGSVGSVERVAEER
VEVIAPSARRRDLLNAVRGAHPYEEPAFDIFDIAPIPGDVGIGRIASLPT
PETLSDFVSRVNAALPATTWGVRAAGDPSTVVSRVAVCGGAGDSLLGAVS
RAGVQAYLTADLRHHPADEHRRASPVALVDVAHWASEFPWCEQAAGVLRR
HFSDALPVRVCALRTDPWNLGTGRETSES
119869436YP_939388.1 bifunctional RNase H/acid phosphatase [Mycobacterium sp. KMS]MKVLVEADGGSRGNPGPAGYGSVVWSEDRSSVLAEAKQSIGRATNNVAEY
RGLIAGLEEAANVGATEVAVSMDSKLIVEQMAGRWRVKHPDLIPLYQRAR
ELAEGFDRVTYSWIPRAANARADRLANEAMDAAQGIDPPPRTAAPAASTH
TPTSPAGWTGARGEPTRFLLLRHGQTELSVERRYSGRGNPALTELGRSQA
GAAAAYLAGRGGIDAVITSPLQRAYDTATAAAKTLGLDVTVDEDLIETDF
GAWEGLTFGEASQRDPELHGRWLRDTSVDPPGGESFDTVAHRVRRARNRI
IADHGASTVLVVSHVTPIKTMLRLALNAGEGILYRLHLDLASLSIAEFYP
DGGSSVRLVNQTAHL
119869434YP_939386.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMDDIWDCVIIGGGAAGLSAALVLGRARRRTLVVDAGEPSNAVAHGIGGLL
GHDGRAPAELYAAGRAELTRYPQVQLRTGVVTDVRRGEQFTVELADGTVE
LARRIVLATGMQYRLQEVPGLAQMWGDAVFHCPFCHGWEVRDAPVAVLAD
GARAVHAGLLLRGWSDDIVVLAGDVGDDRVLLEAAGILIEGRPVTEVRAA
GEGLEVVFADGSVLGRRALMVAASVGQRSALAERLGVRFGEPNPLSAEAV
WVDEFGRTSVPGVFAAGDVTVALPQVAAAIAAGSKVAAAVMQSLLADEFG
LPVPAWKEDVNV
119869432YP_939384.1 abortive infection protein [Mycobacterium sp. KMS]MCPAPDAVLQENHPTARAWAEPRGVRRRGVGWFLILAFAGAWIPWFGVHL
AGGSLDDPVIQLLTAAFVPALAACVVRRWVTRQGFRDSGMRLRLRTSWRH
YAAAVTIPWGVLLLAVGIAAATGMWSPQSTDLSASSWLYLAAGPLICIAL
SPVFWGEEYGWTAYLRDRLVPGRPILTTFLTGLIWGLWHWPLPWVGYFGG
DAPVSDAVWGMLLWLPLSILLEFLIGWLWSETGSVWPGAMLHAGANMVAS
LGMMVVFGDAVGITGTTVLLCAALVPFVLAVVLTGHTAGRIRPISGAATG
119869430YP_939382.1 lyase [Mycobacterium sp. KMS]MEVRQDVSLPDVDGMFRWLTVGPPGQDDVSIVLMAVPGRPVMDEATRQQV
LDLTAKGFAGTVFLTTDDCQRSYEELSARGVEFTETPHEMPYGIDSGFRD
PSGNSVRLTQLAEVPVT
119869428YP_939380.1 CHAD domain-containing protein [Mycobacterium sp. KMS]MAAKTPKTSRYTEVERKFEVAEPDSAESTVSPSFDGLSAVARVERLPVQQ
LDAVYFDTPGLDLAAHRITLRRRTGGTDAGWHLKLPAGPDARTEVRAPLD
GAENEVPDELRDVVLAIVRDRPLAPVARISTRRTVDLLHGPAGDAVAEFC
DDEVTASAEGGEEQRWREWELELTGAGDAKLLDRLTNRLLDAGASPAGHG
SKLGRVLDTGQPDDEVKTHTEDPVRRAVAEQVEQLVEWDRAVRADVEDSV
HQMRVTTRKIRSLLQSAEGVFGISDDAWVLDELRQLAAVLGVARDAEVLA
ERYANALDGLAPEMVRGPVRERLVEGAKRRYQSGWKRSLIAMRSQRYFRL
LDALDGLVAAEPPGTGPGEEPKPTTIDSAYKRVRKAARKAAAAADTEADE
ALHRIRKGAKRLRYTAAATGKAKVSERAKAIQSLLGDHQDSVVSRTHLLH
ESEAAHAAGEDTFTYGLLYQMEFDAAEQSRAQVDGALRKLDKSVRKARKK
DK
119869426YP_939378.1 3-methyl-2-oxobutanoate hydroxymethyltransferase [Mycobacterium sp. KMMSEQTVYGAASDQPTPKPRVKVRTTHLQKWKAEGHKWAMLTAYDFSTARA
FDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLVRGVVRGAPHALVV
ADLPFGSYEEGPRQALATATRFLKETGAHAVKLEGGERVAEQIATLSAAG
IPVMAHIGFTPQSVNGLGGFKVQGRGDAAEQTIHDAIAVQEAGAFSVVME
MVPAELATQITGKLTIPTVGIGAGPNCDAQVLVWQDMAGLTSGRTAKFVK
RFGDVGAELRRAASQYADEVAAGVFPAEEHSF
119869424YP_939376.1 tripeptidyl-peptidase B [Mycobacterium sp. KMS]MAACGAMRLRIGVAATVIALPLVAGCSNLVDGRAVIAVPRPGTPIQWAPC
QAGAPSDESRIPAGAECGLLSVPVDYADPDGDVARLAMIRFKATGDRIGS
MVINPGGPGESGVEAAASMLSTVPQSVRERFDVVGFDPRGVASSTPAVWC
NSDADNDRLRADPQVDYSPEGVEYIENETKAFIERCVDKSGKDFLANIGT
VNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEQFPEKVRAMILDGA
VDPNADPLQADIRQAAAFQTAFNDYAADCAKQPDCPLGTDPAKAVEVYKS
LVDPLVENPAKTDDPRGLSYSDAIVGTIQTLYSPNLWRYLTQGLTELEAG
RGDTMLALADLYMRRDAQGHYNNSTDARVAVNCVDRPPVKDRDKIVEQDR
KLREVAPFMSYGEFTGHAPLSTCAFWPVPPTSEPHELDVEGLPPILVVST
TNDPATPYQAGVDLARQLGGTMLTFEGTQHTVVFQGNACVDEIAARYLID
VVVPPPDTRCR
119869422YP_939374.1 L-glutamine synthetase [Mycobacterium sp. KMS]MDRQKEFVLRTLEERDIRFVRLWFTDVLGYLKSVAIAPAELEGAFEEGIG
FDGSSIEGFARVSEADMVARPDPSTFQVLPWADGSGKHHSARMFCDITMP
DGSPSWADSRHVLRRQLGKASDLGFSCYVHPEIEFFLLKPGPNDGTPPVP
ADNGGYFDQAVHDSAPNFRRHAIDALEQMGISVEFSHHEGAPGQQEIDLR
YADALSMADNVMTFRYVVKEVALGDGVRASFMPKPFAEYPGSAMHTHMSL
FEGDTNAFHSPDDPLQLSDVAKSFIAGILEHACEISAVTNQWVNSYKRLV
HGGEAPTAASWGAANRSALVRVPMYTPRKASSRRIEVRSPDSACNPYLTF
AVLLAAGLRGVEKGYVLAPQAEDNVWSLTPEERRAMGYRELPTSLGVALG
EMENSELVAEALGEHVFDYFLRNKRAEWETYRSHVTPYELQAYLSL
119869420YP_939372.1 Fis family transcriptional regulator [Mycobacterium sp. KMS]MKYYVSPAFVDTSEILDIARAADELGYDGLGIPDHVVNLETLETPYPYTR
DGERRWQPFTHWPDPWVLVGALAQVTSRLKFVTTVYVPAMRDPYSAAKAI
GTAAYLAGGRVELGVGVGWCEDEFRLMGQRFDRRGRRTDEMLDLFRALWQ
PGWTEFDGEFYPTPRLEMEPTPPHIPIYVGGLSDVAFRRAARNDGWIGDL
ITTDRAIAVAHRLHELRTAAGQSVDDFTILTPLTDALVRADYDRAEAAGI
THILTMPWMFYTGADATLAEKIDGMKRFRKDLGLDR
119869418YP_939370.1 cobalamin B12-binding domain-containing protein [Mycobacterium sp. KMSMSRHDLELGAEHAATREQLWNAVLDGDEYAAAAAVFAAIDRGVSAEVVLL
EVIAPVQHRVGTEWAANRITVAEEHAATAINDRVIAALAHHPASAPTTTC
GRVTVACVDGEWHALPARLLAEVLRLRGWQVDFLGAQVPTPHLIAHLHRT
GPVAVALSCSIPTRLPTAHAAITACQAAGVPVIAGGAAFAPDGRHARRLG
ADAWGPDARVAADLLGRGLTRDHHTSAHQPIDDLPHLGDQEYTMVGRTAP
QLVKATVGDLEDRFPAMRTYTERQRQHTTEDIAHIVDFLATALYLDDDDL
FTGFVTWTADILAARGVPATSLHPALESLQAQLVEFPRTQRLLNAALTAL
DHTADMEQIV
119869416YP_939368.1 DoxX family protein [Mycobacterium sp. KMS]MATNFDARLANYSSPLLSIFRIIFGLAFTLHGSMKLFGWPLGESVPVGTW
PFWWAGLIEFVLGILITVGLFTRIAAFIASGEMAVAYLWQHLPNGFWPYD
PGVGGNGGEPALLYCFAFLALAGLGAGTLSVDARRRGRMGAAGGVAPNRV
VTGSAAPAGYQTGQPVRRGGLLSRFRRPRY
119869414YP_939366.1 L-glutamine synthetase [Mycobacterium sp. KMS]MADKTADDIIKLIKDESVEYVDIRFCDLPGVVQHFSIPASAFDESVFEDG
LAFDGSSVRGFQSIHESDMMLLPDPETARIDPFRHAKTLNMNFFVHDPFT
REAYSRDPRNVARKAENYLISTGIADTCYFGAEAEFYIFDSVTFDSKING
TSYEVDSESGWWNTGEPFEADGSANRGYKVRPKGGYFPVAPYDHYVDLRD
KMATNLINAGFVLERGHHEVGTAGQAEINYKFNTLLHAADDVLLFKYIIK
NTAWQEGKTVTFMPKPLFGDNGSGMHAHQSLWKDGQPLFHDESGYAGLSD
TARHYIGGILHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSAC
VRIPITGNNPKAKRLEFRCPDSSGNPYLAFAAMLMAGIDGIKRKIEPQAP
VDKDLYELPPDEAASIPQAPTSLSAVIDRLEEDHEYLTEGGVFTEDLIET
WISYKRENEIMPIQIRPHPYEVALYFDV
119869412YP_939364.1 amidohydrolase 3 [Mycobacterium sp. KMS]MLRAAATVAAASAVSACSSPAQQSPAPAGSPGSANAHADFVFRNGAVYTV
DGPAPWAQALAVRGDTIVHVGDEAGAMALAGPATRVVDLGGRLLMPGFVE
GHTHPFLGAFLTSGVDLQVPTLADALSAIEAYAKDNPTGPVRGFGWRVDM
FGPDGPDRAELDRILPDRPAFFFAIDGHSLWANSTALEMAGVKRDTPDPI
PGFSYYARDTNGDPTGYILEVNAVLGLVDAVEPISPDTMGTLMEGWLPKA
SAAGITSVFDAGVPPIGDDQAALLRLYADVEQRGALPFRVVASYSVRSAP
VDGAVDALEAVREQVSGELVSVDVVKIVGDGTQGGYTAWLVEPYADKPDS
TGGSPFTEEQWHQLIGAVDAAGYDVHVHACGERTARVALDAVERAIASNP
RRDRRHAIAHLVFVEDSDNPRFGALGVTAQFSANWMSADPDTLENMGARY
GSPRKDLLYRPQAVLRSGGRISLGTDWPAAGYFSTYKPLDSIQVGVTRQL
IGQTDAPVLEPADQRLSVAEAIYANTLGAAHQLRLDHKVGSLEVGKLADL
IVLDRNILEIDPHDIHRANVTMTMMNGQIRHET
119869410YP_939362.1 lipoyl synthase [Mycobacterium sp. KMS]MTVTPSGSNGAGSAAPEGRKLLRLEVRNAQTPIERKPPWIKTRARMGPEY
KELKSLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQ
IDTGKPSELDRDEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAET
VREIKRLNPNTGVELLIPDFNGDPALLAQVFESRPEVLAHNVETVPRIFK
RIRPAFRYERSLAVLTAARDDNLVTKSNLILGMGETPDEVRTALVDLHEA
GCDIITITQYLRPSPRHHPVERWVKPEEFVEFAQFAEGLGFAGVLSGPLV
RSSYRAGRLYAQAARLKPAATPPVS
119869408YP_939360.1 hypothetical protein Mkms_3376 [Mycobacterium sp. KMS]MSTGAGGPATSGGAVIAIAGSSGLIGSALVSALRAENRRVVRIVRRAPSN
ADELFWNPDSGEFHPDALRGVDAVINLCGVSVGQRRWSGAFKQSLRDSRI
TPTEVLANAVADAGVPLLVNASAVGYYGDTRGRVTDESAPAGDGFLAQLC
VDWEAATAAAAEDGARVVLLRTGLVLSPSGGLLSRLKPLFGLGLGARLGN
GRQYMPWISLEDQVRAMLFAVAHEDLSGPLNLTGPAPVTNAEFTAALGRA
VNRPTPLTVPGFALRTVLGEFADEGLLGGQRAIPAALERAGFTFHHNTVG
EALAYATGPRDA
119869406YP_939358.1 hypothetical protein Mkms_3374 [Mycobacterium sp. KMS]MGLFDKWRGRRAARADGRDPAADLKYLRQWVAEHRGVEAYVEPKTTVTDV
TVVLVAADGEWTRRRAGGDAGARRLSERLKIPVYDVQKVGYPQRMRDYDA
RRRIERKRAARRELEG
119869404YP_939356.1 leucyl aminopeptidase [Mycobacterium sp. KMS]MSSDPGYQAPVVTVSSSIPRRGVGDSVLIVPVVTRDDAAAVLAAAPFLDK
DAVREIEAALKSLGATGGEGQTHRLVVSALPVASVLTIGLGKERDEWPAD
TVRRVAGNAARSLDKVAAVLTTLSALDLEAAIEGLILGSYRFTEFRSAKT
APKDGGLRAITALSQESKSRARDAAQRATDIATAVATARDFVNTPPSHLY
PDEFAKRAKALGEAAGLEVEILDDKALVKAGYGGIVGVGKGSSRPPRLVR
LSHKGAVRTRTRGARPGGSKRVALVGKGITFDTGGISIKPAANMHHMTSD
MGGAAAVIATVVLAAKQKLPIDVIATVPMAENMPSATAQRPGDVLTQYGG
TTVEVLNTDAEGRLILADAIVRACEDNPDYLIETSTLTGAQTVALGSRTP
GVMGSDAFRDRVATLSQQVGENAWAMPLPEELKDDLKSTVADLANVSGSR
FAGMLVAGTYLREFVADGVEWAHIDVAAPAYNSGGPWGYTPKGGTGVPTR
TMFAVLEEIAREG
119869402YP_939354.1 branched-chain amino acid aminotransferase [Mycobacterium sp. KMS]MTDGPLEFTVHRNAEPATDEVRAEILANPGFGRFHTDHMVSIDYTADAGW
HNAQVLPYGPIELDPSAVVLHYAQEIFEGLKAYRWADGSVVSFRPESNAA
RLRSSARRLAIPELPEELFLESLRQLIAIDEQWVPPAGGEESLYLRPFVI
ATEPGLGVRPANEYRYLVIGSPAGAYFPRGIKPVSVWLSHEYVRASPGGT
GAAKFGGNYAASLLAQAQATEHGCDQVVWLDAIERRYVEEMGGMNLFFVF
GSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKK
AAAGEISEVFACGTAAVITPVSHVKHHDGEFTIADGEPGEVTMALRDTLT
GIQRGKFADTHGWMVKLN
119869400YP_939352.1 cobalamin synthase [Mycobacterium sp. KMS]MIGSLAGAFAFGTVLPVPAGSTATLGRGVMTALPGVGIVLGAVAAAVLWA
GSWAFGPHSALAGLLAVAVLLLATRGMHIDGLSDTVDGLGCYGAPERALR
VMRDGSAGAFGAASIVVAVGAQTLAFSMLPGGWSGAVGVVVAVTAGRVAA
LVACRRGIPAAEGSALGGRVAGTQPAAVVLVWLAAVAALAIPATERIWQG
PLTVVVAVGMTALLVRHCVRRFGGITGDVLGAAIEVTTTVVAVGLVIR
119869398YP_939350.1 adenosylcobinamide kinase [Mycobacterium sp. KMS]MRTLVLGGIRSGKSRWAEAVIAAAAQPDPVRYVATGASPGADDEWARRVA
AHRRRRPSGWRTTETTDVPGALRDDPATATLVDDIGGWLTAEMDRCDAWH
GGSVAAGADALVAAVAEFTASLVLVSPEVGLTVVPATAAGRRFADELGAL
NQRLAATCERVVLIVAGQPITVKEPS
119869396YP_939348.1 iron-sulfur cluster assembly accessory protein [Mycobacterium sp. KMS]MTVQDESATATATHGVLLTEAAAAKAKALLDQEGRDDLALRIAVQPGGCA
GLRYNLFFDDRALDGDLTAEFGGVNLTVDRMSAPYVQGATIDFVDTIEKQ
GFTIDNPNATGSCACGDSFN
119869394YP_939346.1 adenosine kinase [Mycobacterium sp. KMS]MTIAVTGSIATDHLMRFPGRFADQLLAEHLQKVSLSFLVDDLVVHRGGVA
GNMAYAMGILGGQPTLVGAVGKDFDDYRGWLTAHGVDCDNVLVSETAYTA
RFVCTTDEDMAQLASFYPGAMSESRNIKLADVVARTGTPDLVIIGANDPD
AMFLLTEECRTLGLPFAADPSQQLARLSGEEIRKLIDGATYLFTNDYEWD
LLLQKSGWSEAEVMRQIQLRVTTLGEKGVDLVGRDGTFVHVDVVPETHKE
DPTGIGDAFRAGFLTGRSAGLSLERAAQLASMVATLVLEAPGPQEWRWDK
DAGITRLADAYGEDAAKEIASALA
119869392YP_939344.1 cytochrome c oxidase subunit II [Mycobacterium sp. KMS]MTPRGLKAVARKAALVVVLGATALVLSGCSWTEALALGWPKGITPEAHLN
RELWIGSMIAALVVGGIVYFLIFWVSAFHRKKASDTELPRQFGYNMPLEL
VLTVIPFLIISVLFYFTVVVQEQMVGKEDNPEVVVDVTAFQWNWKFGYNK
VNFADGTMNYDGVDEERSAAVASRPSEEGAGAVGEPEAAHTEHGAIAGQN
PEDRSYLAFDEIETLGTSDEIPVLVLPSEKRVEFRIASADVAHAFWVPEF
LFKRDVYPNPEQNNSDNVFQVSEITETGAFVGRCAELCGTYHAMMNFEVR
VVPPNDFKAYLNQRMAGKTNAEALIAINQPPTAVTTKPFDTRRGEMAPQA
SR
119869390YP_939342.1 hypothetical protein Mkms_3358 [Mycobacterium sp. KMS]MSGPNPPGPDSPGPDQPEREGGRHSAPDEATEQVGAAEQPAAATGATEAY
SQAYSAPESEQFSSGPYVPADPALYDYDSYEPVSDVGEEQAPPRWPWVVG
VTAIIAAISLVVSVALLVTKTDTDQLATPATTTTTPPPPVQDEITTTTPP
PPPPPPPTTEPPPPPPPETVTVTEPPPPPPSAEAPPPPPPETTTPPPPPP
PTTTTPAGPRQVTYSVTGTKAPGDIITVTYVDASGRRRTQRNVYIPWSLT
VTPISQSEVGSVQASSLFLVSKLNCSITTSDGTVLSSNTGNAAQTSC
119869388YP_939340.1 cytochrome b/b6 domain-containing protein [Mycobacterium sp. KMS]MSAQSGSKMAARLAAQGNAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIA
LYSFIILLITGVWLTLFFDPSMSEVVYDGVYQPLRGVEMSKAYESALDIS
FEVRGGLFVRQIHHWAALLFAASIMVHLARIFFTGAFRRPREANWVIGSL
LLILAMFEGFFGYSLPDDLLSGTGLRAALSGITMGIPVVGTWMHWALFGG
DFPGTIIIPRLYALHILLIPGIMLALIAAHLALVWFQKHTQFPGPGRTEK
NVVGVRVMPVFAVKSGAFFALTVGILGLMGGLLQINPIWVLGPYKPSQVS
AGSQPDFYMMWTDGLIRLWPAWEFYIGNYTIPQPVWIAVLMGLILGLLTV
YPFLEKRLTGDDAHHNLLQRPRDAPVRTAIGAMAIAFYILLTFACMNDII
ALKFHISLNATTWIGRIGMVVLPVIVYYVTYRWAVSLQRSDREVLEHGIE
TGIIKRLPHGAYIELHQPLGPVDAHGHPIPLEYQGAPLPKRMNKLGSGGA
PGSGSFLTADPIVEHEALTEAAHASHRRALTALRERQGTNGSNGAANGDG
DGSPNGHH
119869386YP_939338.1 cytochrome c- class I [Mycobacterium sp. KMS]MRRGSMISKSRRRFRRRLSAAVLLLVGLGVAGGVAATLTPAPQVAVADES
QSALLRTGKELYDMSCVSCHGSNLQGVQDRGPSLIGVGEAAVYFQVSTGR
MPARRNEAQAPNKPADFDEAQTDALGAYVQANGGGPVVPRDENGEIANQS
LIGDNVARGGDLFRLNCASCHNFTGRGGALSSGKYAPELQASPAQVYTAM
QTGPQNMPKFSDRQLSPEEKRDIVAYVEESRKTPPPGGYGLGGFGPTSEG
MAAWIIGMVAVIGAALWIGARA
119869384YP_939336.1 anthranilate phosphoribosyltransferase [Mycobacterium sp. KMS]MAWEHLRVTDTPTWPSILGRLTTGQNLGTGQAAWAMDQIMTGTATPAQIA
GFAVAMKLKRPTSAEVTELADVMLKHARRIPTDIIGNETVDIVGTGGDGA
NTVNLSTMAAIVVAAAGVPVMKHGNRAASSLSGGADTLEALGVRIDLGPE
QVAASVAEVGIGFAFANQFHPSYKHASAVRRELGVPTVFNLLGPLTNPAR
PRAGLIGCAWAELAEVMAGVFASRNSSVLVVHGDDGLDELTTTTTSTIWR
VQAGTVERLTFDPAAFGFQRAHLSELVGGDAEYNAAEVRAVLGGAKGAVR
DAVVLNAAGALVAHAGLSSDAKWVPAWEAGLARATETIDSGAAEKLLARW
VRFTQKL
119869382YP_939334.1 hypothetical protein Mkms_3350 [Mycobacterium sp. KMS]MAQGHQPRGHQPRGADPHADTDPDTVIIDCDDCAVRGPGCQDCVVSVLLG
VPDTLLVDERRALEVLAEAGMAPRLRLVPIHRQNNSGVA
119869380YP_939332.1 hypothetical protein Mkms_3348 [Mycobacterium sp. KMS]MATGPGSTRPRRVLLALLLAEFVSAVLMLDRSQPPAAPPMAAEVAVEQPT
ATGTPTIDTQLPDGRRAQFVALGGTRSAGLLSRIAGELPAAAELVTDFWG
PDWRQEIVIVATGSDPQFAALAGGGVDIAAATTADRIVFAPGAAAMTDED
LRIVLRHELFHHAVREQTAADAPRWLTEGVADHLARPRTTPAPDAETALP
TDSDLDTPGAVRSQAYDRAWRFATYVADRYGPERLRALYLRACGPGHPDV
ATAVRDTLGAGLDEVLAGWRHWPQG
119869378YP_939330.1 purine catabolism PurC domain-containing protein [Mycobacterium sp. KMMPHLGLGVLSGAAGLDRAVSWTHTSDLPEPWRWITGGELLMTNGLSFPKS
AADQETLLTRLDESGVAGLAIGDKMYCPRLTQRFTRCSDRLGFPVLQIRY
PLPFVAISRAVAEATLLDQSSRLSRTVRIYDLLRRHIGSASSSADLVAAL
ARELGCELHVCDRRTGDPWFPQTPPLDPVLRQAVVGLSDSSTNVAAGVYG
LPGDGARQAMLTDIARHPDVALVVIPRAADRVDPIRLQHIATVISLELSE
VQSVLEHDRRERAALLERLLENRVDRHAVESRLGELHLDPARTVLVAARN
SDEARALTVHNSLWRNDIPYLCTLREGLLYALVPDRSGFEAVLSRALGPS
ARIGVSARLDSISRFPEAVREASWACSLAGRRGIPISRYGSEEPWLGLSN
VGDAQALVDRVLTPLRTYDEQHHSNLVATLEAYLRHQRSLQLTATALCVH
RQTVLYRMKRVADLTGLNLAETDAVAALWLALRAAALLDAED
119869376YP_939328.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MPEFSVPAPFTVGERDTVVSAVFDHERDDPDHVIFRRLVDGDWTDVTCGQ
AAAQIRSVALGLIASGVQPGDRVALLSATRYEWPIIDFAILAVGALTVPI
YETSSAEQVRWVLSDSGAVLAIVENDAHADRVEQLRADLPELRTVLRIEG
SGTGAIDALAEAGRDVAPAELDDRLAGIRSAEPATMIYTSGTTGRPKGCQ
LTHANLVFEIRGAKSCFRTQLTKGERMLVFLPLAHVLARAITIAAFANKV
TLGFTSDIKNLVPTFGVFKPTLVVSVPRVFEKVYNTAEQNARNDGKGRIF
DIAAATAIEYSQAEGGPGLLLRAKHAVFDRLVYGKLRAALGGECRAAISG
GAPLGARLGHFYRGVGLTIYEGYGLTETSAAITVNRVDDIKIGSVGKLLP
GNSMRLGDDDELLVSGGVVFGGYWRNEEETAKAFTDGWFHTGDLGAIDDD
GFLTIIGRKKEIIVTAGGKNVAPAVMEDQLRAHPLISQAMAVGDARPFVG
ALITIDPEAFEGWKQRNGKDSGASVGDLATDPDLLSEIDTAVKEANQAVS
KAEAIRKFRILPVDFTEDTGELTPTLKVKRAVVAEKFADHIEALYTG
119869374YP_939326.1 cyclase/dehydrase [Mycobacterium sp. KMS]MADKTAQTIYIEADPATVMDVIADIGSYPEWVKEYRETEVLDTDADGYPK
TARLVLDAAVLKDTMVLAYQWPADRTSVTWTLVSSSLLKSLEGAYRLAPK
GSGTDVTYELAVDLMIPMIGLLKRKAERRLTETALKDLKKRAEAE
119869372YP_939324.1 hypothetical protein Mkms_3340 [Mycobacterium sp. KMS]MSADHPDLGPELRALAQAILNRVDPAIRFAAARAAGSGADRPGSCQQVWC
PVCALAALVQGEQHPLLNVVAEHSVALLGVVRALVDDIDAAGPPPQPPQP
PQPSPPPPSGEPPPRPGPGRYQHIPVTVQE
119869370YP_939322.1 hypothetical protein Mkms_3338 [Mycobacterium sp. KMS]MSTRRTPAWAPTLAWRTFCLLTLAALGWAGWRLLGETPYRIDIDVYRMGG
RAWLDGSPLYADGAMFATEGGLDLPFTYPPLAAIVFSPFAVMSLPAASAV
ITAITLLLLIVAVLIVLTRLDVWTPGRRIWLAAAIVAPAVVLLEPIRANF
DFGQINVVLMTLVIADCVPRRTPWPRGVLLGVAIALKLTPAVFLLYFLLR
RDTRALLVSAASVVVMTLLGFALAWRDSWEYWTETVRNTDRIGTATLNTN
QNIAGTLARFGVGEDLRFILWVVGCFAVLGLTVWAARRALRADEPVLALV
CVAMFGLVVSPVSWSHHWVWSLPTVLVTLVVAYRTRHAVLAVAGALGCAL
MVWSPITLLPEHQETSAPLWRQLAGGSYVWWALLVIAAAGTLSARSTHRT
EPVTAAQPAAASGSRAAG
119869368YP_939320.1 hypothetical protein Mkms_3336 [Mycobacterium sp. KMS]MRYFYDTEFIDNGRTIELISIGVAAEDGREYYAVSTEFDPERAGSWVRKH
VLPKLPSPASKSWRSRREIRSELEDFFGIDGDEPIELWAWVGAYDHVVLC
QLWGPMTALPPAIPRFTRELRQFWEDRGSPRMPPRPRDSHDALVDARHNL
LRYQVMTGSAGMDGRSRP
119869366YP_939318.1 serine/threonine protein kinase [Mycobacterium sp. KMS]MCSVEAYPQSDPLAGAVLDGRYRVDAPIATGGMSTVYRGLDVRLDRPVAL
KVMDARYSGDQQFLTRFQREARAVARLKDPGLVAVYDQGLDGQYPFLVME
LVEGGTLRELLRERGPMPPHAAAAVLAPVLSGLAVAHRAGLVHRDVKPEN
VLISDDGEVKIADFGLVRAVAEAKITSTSVILGTAAYLSPEQVGTGNAGP
RSDVYSVGVMAFELLTGVTPFNGDSALAVAYQRMDNDVPPPSSVISGVPS
QFDELVLRATMRDPADRYADALDMGAELEEIIEELRLPPFRVPAPRHSAQ
HASAVLYHSQPPDQQATTDTTARPPASAPRQHTRVFTRDSGEIAYPAGQF
AGIDIDEFYWARQRAKRALLFWVVAVITLAGLLAAGAWTLGSNLVNLI
119869364YP_939316.1 hypothetical protein Mkms_3332 [Mycobacterium sp. KMS]MVTPTPTETPKPGSAQHVSRLIAFASSPSGRPALLGFLGATLITAGGLGA
GSTRVHDPLLESLHLSWLRFGHGLVLSSVLLWGGVAIMLAAWLWLGRRVV
GDDPGRTADEYTMVATTGFWLAPLLLSVPVFSRDTYSYLAQGALLRDGFD
PYVVGPIANPNPLLDDVSPIWTTTTAPYGPAFIMVAKFVTMIVGEHVVEG
TMLLRLCMLPGLILLIWAAPRVARHIGASGAAALWICVLNPLVIIHLMGG
VHNEMLMVGLMMAGLALTLNNRPAVGVAVIVVAVAVKATAGLALPFTVWI
WMRQLRDRRGYGAPRAFATATAAGLAIFVAVFAVLSWVAGVGLGWLTALA
AGNVKIINWLTLPTAAANVINAVGGLFLPVNFYAVIDVTRIVGLAIIVVA
LPLLWWRFRHDDREALIGIASVMLVVVLFVPAALPWYYTWPLAVVSALAQ
SRRSIALIAGFSTWIMVIFKPDGAHGMYSWLHVLLAAGCAVVAWYSLAKV
RERAPTAGGQ
119869362YP_939314.1 protein LppM [Mycobacterium sp. KMS]MTSVLARRQRTRLVAWVLLLLMLPMVVGCVRVRASITVSPDDRVSGQIVA
AAKPRGPDDKGPQLLNNLPFATKVAVSDYNRDDYVGTQAVFSDLTFAELP
QLANMNRDAAGVDISLRRAGDLVILEGRVDLTSVSDPEADVSLSVAFPGE
VTSTNGDQVSTEVVEWKLNPGVVSTLNAQARYTDPSARSFTTAAIWLTVA
TLVVAAIIGGLAWSSRDRSPTLADPNPNDERGTR
119869360YP_939312.1 hypothetical protein Mkms_3328 [Mycobacterium sp. KMS]MPLSDHEQRMLDQIESALYAEDPKFASSVRGGTLRAPSARRRLQGAALFV
VGLAMLVSGVAFKATMIGSFPILSVIGFIVMFGGVVFAITGPRVAGGRDR
SAPPVGGGARQKRPKGSGGGSFTSRMEDRFRRRFDE
119869358YP_939310.1 S-adenosyl-methyltransferase MraW [Mycobacterium sp. KMS]MEHIPVLLDRCVELLTPALTRRNPDGRGAVLVDATLGAGGHAHRFLSDLP
GLHLIGLDRDPQALQIAGERLAPFGDRVSLVRTRYDGIDDALAQTGVAEV
SGFLFDLGVSSMQLDRTERGFSYSADAPLDMRMDSDAPLTAADVVNTFAE
KDITRILREFGEERFAARIAKHIVRRRPLNTTGELVELLYDAIPAPARRT
GGHPAKRTFQALRIAVNSELDSLRAAVPAALAALETGGRIVVMAYQSLED
RIVKTEFAAATASRTPPGLPVELPGHEPEFVALTRGAERATPEEIERNPR
SAPVRLRALEKVAGRPTTARRDAR
119869356YP_939308.1 peptidoglycan glycosyltransferase [Mycobacterium sp. KMS]MSPRRDPRGGAPRRARGPKAASAQGRPAKARRTRKAVAGESGLRSSSFVF
RHRAGTAVMLVLLLVAAAQLFNLQVPRAEGLRAEAAGQLKVTDVQKAVRG
SIVDRNDDKLAFTIEARALTFQPVKVRKQLEEARAKSEEAPDPKRRLVEI
ADEVAARLNNKPDAKTVLRKLNSNETFVYLARAVDPVISDAITEKFPEVG
SERQDIRQYPGGSLAANIVGGIDWDGHGLLGLEDSLDAVLAGTDGSVTYD
RGSDGVVIPGSYRNRHDAVDGSTVQLTIDDDIQFYVQQQVQMAKDASGAK
NVSAVVLDAKTSEVLAMSNDNTFDPSQDIGKQDNRQIGNLPVSSPFEPGS
VNKIVTAAAAIEYGLTNPDEVLQVPGSINMGGVTVGDAWKHGTMPYTTTG
VFGKSSNVGTLMLADRIGPERYAEMLKKFGLGQRTGVGLPGESAGLVPPI
HQWSGSTFSNLPIGQGLSMTLLQMAGMYQAIANDGVRIPPRVLKATIAPD
GTRTEEERPEGVRVVSPQTAQTVRNMFRSVVQRDPMGEQQGTGPAAAVEG
YQIAGKTGTAQQINPACGCYYSDVYWITFAGMATVDDPRYVIGIMMDAPH
RAADGSPGSSAAPLFHNIASWLLQRQNVPLSPPGAPLTLQAT
119869354YP_939306.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacterMIELTLARVAEIVGGRLADITPEDAAATRITGTVEFDSRAVTAGGLFLAL
PGARSDGHDFAAAAVAAGAAAVLAARPVGVPAVVVPPAAGPEGSGVLEHD
TDGAGAAVLAALARLAAAVAAELVDGGLRIVGITGSSGKTSTKDLVAAVL
APLGEVIAPPGSFNNELGHPWTVLRADRSTDFLVLEMSARHPGNIAALAA
IAPPSIAVVLNVGTAHLGEFGSREAIAATKSELPQAVPESGVVILNADDS
AVAAMAEVTAARVVRVSREPGADIWADAVTLDELARPRFTLHAAGGEVPV
NLAVHGDHQVSNALCAAAVALECGATLDQVAAALAGAGPVSRHRMQVTTR
EDGVTVVNDAYNANPDSMRAGLKALAWMSRGGAAKRRSWAVLGEMAELGD
DSISEHDSIGRLAVRLDVSRLVVVGTGRSASAMHQGAVMEGSWGAEATRV
DDADAALALLSDELQPGDVVLVKASNSAGLGALADSLTAGRDGTATR
119869352YP_939304.1 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Mycobacterium spMARAVVEPLTPGVRVLITGAGLTGRSVSAVLEPTGVRLTICDDDPLALQR
LITPAAVVTTGEAVAGIADYALVVTSPGFPPTAPVLAAAAAAGVPIWGDV
ELAWRLDRAGWFGPPRRWLVVTGTNGKTTTTSMLYAILRAADRRAMLCGN
IGNPVLDVLGESPRTRGDEEPELLAVELSSFQLHWAPSLRPDAGVVLNVA
EDHLDWHGSMTAYARDKARALDGRVAVAGLDDPVAAELLTTAAAPVRVGF
RLGPPGAGELGVHDGWLVDNAFADGLRLARADDIRVAGPVGVLNALAAAA
LARAVDVPAEAVAAALASFEVGRHRAEVVAVSGGVTWVDDSKATNPHAAR
ASIAAYPRVVWIAGGLLKGVSVDALVAEVADRLAGVVLIGRDRAVVAEAL
SRHAPDVPVVELVTGEDSGVHGTTESAVNHVTRVIDTGGRPLPDAVMRAA
VDAARHLARPGDAVLLAPAGASFDQFSGYTQRGDAFAAAVRADLG
119869350YP_939302.1 undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltMNGTISVLLAGGGTAGHVEPAMAVADALAALEPGVRITALGTERGLETRL
VPERGYALELITPVPLPRKLSGDLARLPMRVRRAVRETREILDTVHADVV
IGFGGYVALPAYLAARRNRVPIVVHEANASAGLANKVGARFARRVLSAVA
DPGLGRVEVVGTPVRSSITELDRAALRAEARAHFGFADDARVLLVFGGSQ
GARSLNNVVSGAAKALAAAGISVLHAYGAKNTLELPDPAPGDPPYVAVPY
LSRMDLAYAAADLAICRSGAMTVAEVTAVGLPAVYVPLPIGNGEQRLNAR
PVVETGGGLVVDDADLSPQFVADTVVPLLTDTGRLQTMTAGAALSGHRDA
ARHVAHVALDVAREAAGGRKGVR
119869348YP_939300.1 polypeptide-transport-associated domain-containing protein [MycobacterMTVPPENPEPPEEPTPPPAAPPAEDPTAPAPSADDEEDREGPRRRARRER
EQRRAVKDRAMAIEEARREAKRRATSGPVREATPIPRRAVRGLKVLVWSA
LLSVAAVGVGLLLYFTPIMSVRDIVVVGLEAIPQEEVLGAAAVVPGTPLL
QVDTDAVAERVATIRRVASARVQREYPSSLRITVVERVPVVVKDYPDGPH
LFDRDGVDFATAPPPPNLPYLETATPGPNDPATEAALQVMLALPPEVAGQ
VGRIAAPSVASITLTLVDGRVVVWGTTDRTDEKALKLAALLTQPGRTYDV
SSPDLPTVK
119869346YP_939298.1 hypothetical protein Mkms_3314 [Mycobacterium sp. KMS]MRRVTTTRAGGVSAPPYDTFNLGDHVGDDPAAVAANRERLAKATGLDGRL
VWMHQVHSDRVVRVTGPHDGPVDDADGLVTTTRRLGLAVVTADCVPVLLA
DARAGVIGAVHAGRVGARDGVVARAVETMCEAGARVEDISVLLGPAVSGR
NYEVPEAMAADVEAALPGSRTTTARGTAGLDLRAGIARQLTDLGITAIDV
DPRCTVADRNLFSHRRNAPTGRLASLVWME
119869344YP_939296.1 hypothetical protein Mkms_3312 [Mycobacterium sp. KMS]MSTLHKVKAYFGMAPMDDYDDEYYEDDDRAERGAARGYARRPREDRFEEE
GYIDRAGREYDDRPAPREYDEPPIYRGGYDEPRFDPRLRGPREFERPAPR
LGALRGSTRGALAMDPRRMAMLFEEGSPLAKITTLRPKDYSEARTIGEKF
RDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPAD
VDVTADERRRIAEAGFYAYQ
119869342YP_939294.1 DivIVA family protein [Mycobacterium sp. KMS]MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENTDLR
QRVAELDQELSSARSGGGVSQPQAAPVYEPEPEPTPPPQPVYEAPPAAPA
PTAQQSEDSALRAAKVLSLAQETADRLTSTAKAESDKLLADARAQADAMV
SDARQTAETTVTEARQRADAMLADAQTRSETQLRQAQEKADALQADAERK
HSEIMGTINQQRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA
APVDSSANNDGGGFNQFNRGNN
119869340YP_939292.1 phosphoribosyltransferase [Mycobacterium sp. KMS]MAMSGWERLGGRSAGRTFRDRRDAGRVLAEKLSAYRGRDDVVVLGLARGG
VPVGWEVAHGLGAPLDVFLVRKLGVPQWEELAMGAIASGGGVVVNDELVS
RLNITEEALQRAIERETVELRRRETAYRQGRPPPELTGATVVLTDDGIAT
GASMLAAVRAVRASEPARVVVAVPVAPPSACRAVDAEADAVICATTPAGF
EAVGQVYADFHQVTDDEVRDLLATPTR
119869338YP_939290.1 glutamine amidotransferase [Mycobacterium sp. KMS]MTSRVLFLYNDPVATEALLGEAFVDAGYDVDTFTVVPPERAANPAVDVVF
PDPTGYDVIVPLGARWPVYDDALRRTWVGAEMAMLREAAEAGVALLGVCF
GGQILAQAFGGTVGRAPAPEIGWYDIGTDRPDLVSTGPWFQWHFDRWTVP
PGAVEIARTAGASQAFLLDRCLALQFHPELDHGLLTDWLADDRDGEALAF
GLDHDELLTRTKELEGDAATRIRGLVDAFLSYVGGVPCPS
119869336YP_939288.1 phospholipase D/transphosphatidylase [Mycobacterium sp. KMS]MADVSDWFLTADERGNPDTTLPAWCAGNRVEPLVHGATYFDRLATEVEAL
RDGDPDEKLRDDGPTIRELFCRAAERGVVVKGLVWRSHLDKLAYSEEENR
HLGEHIEEAGGEVLLDQRVRIGGSHHQKLVVIRHPGAPERDVAFAGGIDL
CHSRRDDASHRGDPQAVQMSKQYGDRPPWHDVQLQLRGPVVGALDTTFRE
RWNDPASLDMLNPLAWLRDKFGGADMTADPLPEQPPDPPACGPHNVQVLR
TYPDAHFAYDFAPHGERSIARAYSKAVPRARRLIYLEDQYLWSKRVAALF
ARALRANPDLHLVAVVPRHPDVDGRLALPPNQVGRWQAIATCREAAPQRV
HVFDVENHEGTPVYVHAKVCVIDDVWACSGSDNFNRRSWTHDSELSCAVL
DDEGVFARDLRLRLMREHLDRADDQGLVDPSDAVREIVSAADDLDAWYEG
GRVGPRPPGRLRPHRTEQLGRLTRLWAAPVYRMVYDPDGRSYRARIRGKM
VISVRRRRPAVTSPGR
119869334YP_939286.1 hypothetical protein Mkms_3302 [Mycobacterium sp. KMS]MSVSFTITRRLRRVPLAVLAVAGLVGGMCWSAPSAQAFYIHNHAAVTRAA
LPPDQVNEIAILQILNGPPPGGGAMGSDAFATDQWRHIDNAKNPGDICAR
AQQAWSTLSPVILRGSQPVGPGANALRDGPGARAAFGGLMHAQQDFYSHS
NWVETNIAAGQPERPAPALFPACNPSAFPADLHTGYFNALYSAQFPLDGC
PPAGPPPGFQECHAVLNKDGPNTARGGQPVPGTSMNMYDLAARLSTATSA
DLYRHVRGLIASTVSAQNPGVDGECIASKFFRPDLLGPCAKFVSPFGGPG
FMPR
119869332YP_939284.1 signal transduction histidine kinase regulating citrate/malate metabolMSSRWSATVRGFGARSLAGRFLVFQLLVVAVVLPAVAAVSIAQSTREFRE
TRSQRMIAVAENVASTPIVRDRLADPFAARVLAPEVDRAVALSGAALAEI
VAADGTVLVSSDPSRVGNRVDLSVTRADEGRAWYGDDDIDGVHSLIGHVP
VLTNRGEVLAIASVSEPYPSVWQLLSGAGERLVLYLGLAAALGLVASWLL
SRRIKRHTRGLEVAEIAGLADHREALLHSIREGVVAVNTDGVITLLNDSA
QELLGLSGAAVGRRADAVGLDPAVVEFLLSGEDGRDVVIATRTRVLALNR
RTASSGGEWIGTVTTMRDSTELAALQAQLSSHKSVTDTLRAQTHEFANQL
HTISGLVQLGEYDAVRDLIGELTRRRAEISDAVTRRIADPAVAALLIAKT
TLAAESGVTLWLDPDSHLGALDPAAATDVITLLGNLIDNAVDVSVGSGAA
RVSVRIDDADGLSITVADTGPGVPEHLREEIFARGVTSKPESPGGRGIGL
ALVRLVTAQHGGVVDVSDRADGGAVFTVRLPPSRVAAHA
119869330YP_939282.1 integral membrane protein [Mycobacterium sp. KMS]MTTTDKPARVDRAQYLICAVLVAVGAFLIVDALRLTAGFAKVDPVGPRAF
PIVVGAVLIVLAVILAIAIPRGSVGEADAGEDVDPEAPSDWRTVGLLVGL
FVAVILLVQPLGWVITGTLLFAGAVAVLGNRHWVRNIAIGLALSLASFYA
FYSGLGIPLPVGILDGIL
119869328YP_939280.1 UspA domain-containing protein [Mycobacterium sp. KMS]MIVVGYTADRFGEVAVEHGITEANRRGTGLLVVNSTAGDSYVDAAFAQPK
DVSGLEAQLADCGVPYEVQQPVGVYAADALLTAMERDDAELLVIGLRHRS
PVGKLLLGSVSQQVLLECPKPVLAVKPDEG
119869326YP_939278.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MSDVELGAVDEIPVGEGRTFTVDGDQIAVFRLRDGSLRAVDAVCPHRGGP
LADGLADERVVVCPLHGHTFDLCSGAEAGGAELSVRSYPVTAVGGAIRLS
RS
119869324YP_939276.1 hypothetical protein Mkms_3292 [Mycobacterium sp. KMS]MSDGSTPRFLQGAFEFEGNGLDKPMPIDPGLRYVVPAGAVAQPVYFRGGN
STAEMVTVVLFRDGKPMRYFPIAAKGSTHVALRVVEDLLGDTVLELFVAA
PAGCAGTLIVDLGLVEI
119869322YP_939274.1 integral membrane protein TerC [Mycobacterium sp. KMS]MNISPVLWGLTVAVIIALVLFDFFFHVRKAHIPTLREAAVWSAFYVGIAI
LFGLGVLVFGGTKPGLEYFAGYVTEKALSVDNLFVFLVIIGSFAVPRADQ
QKVLLFGIVFALIARTGLIFVGAALINAFAWVFYLFALILLLTAGQLIKP
DDDDRGADNLVIRLARRFLRTTDDYDGDKLFTVENGKRMLTPMLLVMVAI
GGTDLLFALDSIPAIFGLTQDVYIVFTATAFSLLGLRQLYFLIDGLLDRL
IYLHFGLAAILAFIGVKLFLHALHENNVPFINDGEPVNVVEVSTPVSLGV
IITLLLVTTVASLVSPKGRVKNAIGSAQRHATTYLNKTYYGEDAAEREKA
FAKLCAEEQQIKQMPPKYRAMIRREDDLMDLLRRAHAEHDRYLAEEKST
119869320YP_939272.1 carboxymuconolactone decarboxylase [Mycobacterium sp. KMS]MAERVPMLDREQAQLRAAECGLPEELADLSVFRVALHQPRVAVALYGLLD
ALLFRGSLDARLRELVIMRIGWITGSEYEWTQHWRIATLLGVPEHDLLAV
RDWQNSESLGPVERAVLAATDDVVRDGVISEENWAGCQKAFNSDHAVLVE
LVGAIANWRLFSILLRSLNIPLESGTDGWPPDGRAPQGCD
119869318YP_939270.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MDPIDLAVEAARRAVKDASRPVERRIDTVATPGILVIPRDNPASRIAEAM
HISPARRISCPVGGNTPQYLVEVLGGEIGEGRADVVLVVGAESGHSARKL
QGGALLDSPPPPRSDDESLGDARPGLSQAELSVGLSWPHEVYPIFESAIA
ARHGRDFDAQREWLGTLMAPFTAEAARHPEQAWFPRARSATELSEVTAEN
RMVCLPYPKLLNSIMSVDMAAAFILMAAEVADELGVARDRWVFPWSAATC
NDVYFPVERPDLSRSSGIEVAARKALDAGRLTTDDIRWFDLYSCFPSAIE
MAAEALDLDPLDDRGLTVTGGLPYHGGPGNNYVSHSIVEMVRRCRRDPTD
AGLVTGLGWYSTKHSVGVWSATPPPAGWRLLDTAVEQAQIDSSRLAVAGA
DEATGCATVDGYTVVYDRDGQPRWTPIIAHLSDGQRVVARSDDPQIAEAM
GAEMYVGKTVCLRNTGSFTGFELP
119869316YP_939268.1 hypothetical protein Mkms_3284 [Mycobacterium sp. KMS]MQFTTFNEQVAEQLKSAAETTGGLAGYLGFRHTEFTAGRLVAEMDARDDL
KTPFGNLHGGCLSAMVDHCLGVVFYPVIPLGSWVATTEFKLNLLRPVSSG
TCVATAEIISLGRTSGVARIDICNDGRAVCAAQGTVTVVAPKTSS
119869314YP_939266.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPTEPARVSFRRHVREKVLRATRELAIEKGWDQVRMSEVAESVGVSRPTL
YKEFGDKQGLGDALVVSEGQRFMEGILAVLAEHVGDVRGGITAAVQFTLC
EAEDSPLLKAVLTSNPSGNDRGGSSSTGVLPLLPTSASLLQLCSAALITW
FNDHFDDLDPEDVEEVADVLVRLTVSHVVLPAADIATTGERISRVALRYL
GVVHSL
119869312YP_939264.1 cytochrome P450 [Mycobacterium sp. KMS]MSIPAAVAAKAQSAVPLELQIRGAHLYDKTRRWVTGTNGKKIFTETPIPP
VEDVDIADIDLSNPFLYRQGRWKSYFERVRNEAPVHYQAHSAFGPFWSVT
RHADIIAVDKNHEAFSAEPFIIIGRPPRFMDIAMFIAMDPPQHDLQRASV
QGVVAPKNLREMEGLIRSRVQEVLDDLPVDQPFNWVHHVSIELTARMLAT
LLDFPYEQRHKLVEWSDLATSMEQANGGPSDNDRVFRGMVDMAKGLSALW
HDKAARTANGERPGFDLITMLQANEDTKDLIDRPMEFLGNLVLLIVGGND
TTRNSMSGGVLALNQFPDQFEKLKANPDLIPNMVSEIIRWQTPLAYMRRV
AKKDIMLNGQFIRKGDKVVMWYASGNRDERVFERADELIIDRSNARNHIS
FGFGVHRCMGNRLAELQLRILWEELLPRFENIEVVGEPEYVQSNFVRGIS
KLMVRLTPRPSA
119869310YP_939262.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MKLDDSGMPALAFLQMLDSEALGHDASIALRSIMVREHVTESMLVGRDAQ
VPLRWFREIYSDFDCDQGTRLGFAFAEHAKLTSFGALSVPLVSAGSVAEV
VELLAYLPVITTALSPTFHSTERGLTIGLTGRTGDAGLNCLAVTYGGLAL
LRLLDMLAGAVPNIELHLSHSAPESWVLHDEVLAGRIFFDAPSSFVHVPA
ASLEEVCRFSDPVAYRIAVTDLQRTLDQRRDTSVSEKVRDLLEKDPGKTN
ISRTAGELSISPSTLKRRLREEGTTFRELRQSFLRERAILRLLDRSLSVS
EIAAELGYAELTNFTHAFKRWTGRSPRHFRKTRD
119869308YP_939260.1 hypothetical protein Mkms_3276 [Mycobacterium sp. KMS]MTAASSSLDGLHDPEALPPLTDVNRPYFAAAARGVLVFQRCANDHPFLYP
RLVCPVCHDGELAWETAAGTGEIVSFAPVYRPPWDSFPRSEPYVVVLVRL
DEGPQLLASLEGVAPDEVAIGARVRAVFERVNEDLGLVRFRLAAS
119869306YP_939258.1 dehydratase [Mycobacterium sp. KMS]MADASLIGTQLGRTTFPVDRSKVREFALSLGDRDPIYQDVAAARAAGFGA
IPAPPTFVVSSAHWRADDDMFGALGLDLRRVLHGECGWEYFAPVFVGDEL
TETRRVSNVTSREGKRGGIMTIVTIETDFTNQRDELVVRQTDVLIETGGS
TQ
119869304YP_939256.1 hypothetical protein Mkms_3272 [Mycobacterium sp. KMS]MSAPTSDVTGLGMTFGTFDEGRAWVGHRSEPRHAWFPIDRSMVLYYCSLV
EDANPRYWEGEDCPPGLLMSLGFAPQWVPGYLARADMMFALSVPLPGHHI
INASTTTEFERRPRVGDHVSIVEEIASISEPKTTRVGTGVFITTVSTFSD
QHGEVIGRNTNVLFRYDTADSEGAS
119869302YP_939254.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MAEQPVRYEVVDSVAWLTINRPEARNALNNAVRTGLFDAVRRFNDDDAAK
VLVLTGVGDKAFCAGGDLKEMAQNALKVPPKDFAPQFGRNIDVAKPTIAA
VNGVAFAGGFLLAQQCDLVVAAEHATFAVSEVKVGRGSPWAAPLSWLVPP
RVAMQILLTGDPITAERAHQVGLVNEVVPADQLRERTRQLALSIAANAPL
SVLASKRTVYLSAQHHLAAAYDLADEIWEPVYLSDDAQEGPTAFREKRAP
QWKGR
119869300YP_939252.1 hypothetical protein Mkms_3268 [Mycobacterium sp. KMS]MSVPVRIGNCSGFYGDRIAAAREMVEGGPIDVLCGDYLAELTMLILAKAQ
AKDPSGGYARTFLTQMEQVLGTCLDRGIKVVANAGGLNPAGLAAALRELS
ARLGLTARVAHVEGDDLRGDLHAITPPVGDIKPVSANAYLGAWGITEALH
SGADVVVTGRVTDASLVVGPAAWWHAWARADWDRLAGAVVAGHVIECGPQ
ATGGNYAFLDEITDRRYPGFPIAEVAEDGSSVITKHPGTGGLVSVGTVTA
QLLYEIAEPAYLGPDVVAHFDTIRLAQQGEHRVAISGTKGSPPPDTLKVA
LNEVGGFRNTMTMVLTGLDIEAKAAFAEQQLFDVLGGRDAFDEVDVRLLR
FDVSDAPTNEQACAHLRVTVKDADPRKVGRAFSGGVMEIALAGFAGFHTT
TPPSSETAFGVYRPAYVPRSALTHVLVDADGNRHVIPDPPTGAVPPAGIA
PPAKLPAPSGPTRLAPLGSVLGARSGDKGGNANLGLWARDDPGYAWAREY
LSVERLRTLLGPETAHLRIERFELPNLRALNVVVHGLLGDGVASSTRPDA
QAKGLGEYVRSRVVDVPESLLDTH
119869298YP_939250.1 o-succinylbenzoate--CoA ligase [Mycobacterium sp. KMS]MQLGIGQWVSRRAFLNGGRTALISNGAHITYADLDRRTNQVAAALIALGV
RKGDRVAMLLVNSTEFIEVLLGCAKIGALAVPLNVRLAGPEIGYILADSG
ADVLVFHEPFAAQARSAVTESGVRVRHVVRAGGVPAPGELGYEDVVSGAA
PEPLNGDVDGRDPAFIMYTSGTTGRPKGAILTHDNLLWNAINVLGTDIGL
RGEDVTVAVAPMFHIGGLGVHTLPLLYVGGTSVIMPSFEPRATLQAMADH
HVTVQFMVPAMWTALTQVPDFDSFNLSALRFAMGGGSPVPLTVIDFMRER
GVPFTEGFGMTETAPLVTVLDAENVSTRAGSIGRVAMHVDARIVDDDDRD
VATDTVGELIVRGPNVFTGYWMKAEASAEALRGGWFHTGDLGRMDAEGFI
TLVDRKKDMIISGGENVYPIEVEQVLFRHPAVFDAAVIGGKDAKWGERVV
AVVVADPATQAPSAEEIVAWCRERLAHFKCPRDVHFVAELPRNATGKLLK
TELRAQFTGIEGGVVLR
119869296YP_939248.1 carbamoyl-phosphate synthase subunit L [Mycobacterium sp. KMS]MPKIRKVLVANRGEIARRVFRTCRDLGIATVAVYSDADADAWHVADADEA
VHLPGSSAAETYLDIHRIIAAASLTGADAVHPGYGFLSENAGFARACAAA
DLVFIGPPPGAIDAMGSKLQAKKTMSDAGVPVLPGGDTTGLSAEQLAKLA
ADVGYPVLVKASAGGGGRGMRIVASPDELDEAVTSASREAAAAFADGTVF
LERYVQRPRHVEIQIMADTHGNVVSLFERECSVQRRHQKVIEEAPSPVVD
DALRARMSEAAIAAARAVGYVGAGTVEFVYDAAQDGKADSFAFLEMNTRL
QVEHPVTELITGLDLVRAQLLVAMGRPLPEEMHNPRIRGHAVEARLCAED
PADDYRPCTGTLRTLDVPALAGVRVDSGFRAGSVISHYYDSLLAKVIAWA
PTRDEALASLSAALAGARIHGVTTNRNLLVRVLRHDEFAGRGTDTGFLDR
HDVAQLGAALPDTQSERLHAVAATVAGVAARRAVATLQATLPAGWRNNPS
QPQTTTWQTQGGREVRVGYTLGSTGTCLQVDDEPLADVEVVEGSSERVVL
RVDGVRRTYDVVLDGDVAHLDSVAGYSALRLAPRFVDPSTLNPPGSLTAP
MPGSVIRLPVAEGETVSAGQTLVVLEAMKMEHTVASPIDGVLSALPVQVG
HQVSSGDVLAVVEAVDGGEVASDATEL
119869294YP_939246.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MSPARVYGGLSATQRDAQRRVMLIDAAVSIMGTHGATACTVTAVCAKSGV
TSRYFYQQFRDRDALLRAVFAKISTTFQAVITSAIPDDTVAPQELAYAPI
KALVQVIENDPRMARILFVESGAEPLLRQLRSDLMTDFAELVLREARLHL
DIPSDVLQVADLAATYGVGGLFEILRRWIDGQLNLSTEMLIEHCAGFLGI
LGLYTLGQAPDQAAPPLAKAEETR
119869292YP_939244.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MDVCCGETLIWGHQPPLVSHATSLVVERAPCQDGEVRSRNKRWGGRTGAE
RRAERRQQLIEAATEIWSESGWAAVTMRGVCARTGLNDRYFYEGFKTRDE
LLVAAWDGVRNDMLGEVAALFNERANRPPIETITAAITIVVDRIARDPGR
ARILLAQHVGSSPLQDRRAVALQEATQLVVEASRPHLRQDADEIALRMDT
LIAVGGFVEVITAWHSGLLAVTEKEVVAHTSRLAETLAQRYVISD
119869290YP_939242.1 hypothetical protein Mkms_3258 [Mycobacterium sp. KMS]MAFAYSDMLETIKNKQWALADIDWNAPGAELITDEQRPKLKQFMSDVVWI
EHVGARAFAAMAPKAPFEALGDIYRYFHAEEQRHANAELALMRRWGMLEE
GEKPVPNKNIRLVIEWLDRYAEALPLTVIGAAIPALETALDGALLKFLLD
EVDDPVCGEVFNKVNSDESRHLAVGFQVLNDLGASPMRIHAIQTAGALVD
PRILTGALLYIPLLTRMLMNLNAMGLSEEKLYNAVTRYANVGDRSEHTRR
VPGYHILKAHMSSSIKRSQPLHFVSQRLGNAIDVFPVQIFGRPPSWTDEL
TYEPVAK
119869288YP_939240.1 putative monooxygenase [Mycobacterium sp. KMS]MDRKSDRNYEIIIIGAGFSGIGSGISLMKAGFTDFLMVDDADGVGGTWHW
NTYPGIAVDIPSFSYQFSYEMRPSWSRTYAHGNELKAYAERCVEKYRLWD
HIRFNTTITEACFDENATRWHLTSANGEEFTARFVINCSGVLSRPKWPEI
KGVRDFAGVTLHTARWDNAKDLSGKRVAVIGTGASAVQLIPEVAKKAESL
TVFQRTPIYCLPKPDFPIPTWGGRLLHFLPGAQLATRTASQAFVEITFPI
AAHFHTVIPFADVMESAAKRYMRREVHDPTTREQLIPRYSLGCKRPSFHN
SYLATYNRSNVSLETSGITHIDHASVHTRDGKAHPIDVLILATGFKVMES
GNMPTYVLKGRGGLEQATWWDEHRLQAFEGVSVPGFPNHFNIFGPYGYNG
SSYFTLIEAQSRHIVRCLRRARALGANCVEVKKEANDRYFAEVLRRRHRQ
VFWQPSCSNANSYYFDRHGDVPLRPSTTLETYWRSRTFRLSDYRFENRPE
EVCPR
119869286YP_939238.1 flavoprotein involved in K+ transport-like protein [Mycobacterium sp. MSSNFATACRAYDPSIVIIGAGFAGVAMAHRLKKDGFTNFTILEKAADIG
GVWRDNTYPGAACDVPSALYSLSYKPNPRWSRRYAEQPEILKYLQQLVES
GGLAAHLRTQTEVVAMTFDDQLGRWGLAPM
119869284YP_939236.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
119869282YP_939234.1 cytochrome P450 [Mycobacterium sp. KMS]MTNHLLAPAHHVKERLSSVIMVPAPHAVDDRWRRWSRDWPVRELAPAPAG
SGLKAVRGDAGLPFVGHTLDYIRFGSDFSRERYDRLGSVSWMGAFGTKMV
VIAGPDATREAFTSEAKAFSQDGWSFLIDAFFHRGLMLMSFDEHLMHRRI
MQEAFTRPRLTGYVEQVTPCVRSAVPAWPVGPSVRIYPLLKELTLDIATD
VFMGGRGKDESDAVNKAFVATVRAASSLVRAPLPGTRFRAGVQGRRVLED
YFFRHLPAARAGETEDLFAALCQATTEDGERFSDEDVVNHMIFLMMAAHD
TSTITTTAVTYFLAKYPQWQEAAAAEAAAIGDGLPDIEALEKMTVIDLVI
KEALRLLAPVPLVMRKTVRDVAIDGYHIPSNTLCAITPAVNHFDRTIWSD
PERFDPSRFDEPRREDQHHRFAWVPFGGGAHKCIGMQFGTLEVKAILHRM
LRSFTWKVPENYHVRWDNTSLPIPVDGLPLEMKRR
119869280YP_939232.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. KMS]MQSTMQNVPLTVSAIVQHAAAIHGDSEVVTPTGNGYRRTPYRIVLARVAR
LANALRSLGVTADQRVATFQWSNQEHLEAYCAIPSMGAVLHTLNIRLAPE
QLAYIANHASDQIVLVDASVAPLLARALPAMASVHTVIVTGEGDLAPLQG
CGKTVLRYEEVLAGQEESFDWPELDELSAAAMCYTSGTTGDPKGVVYSHR
STYLHSLTACTANALSVSEADRVLAIVPMFHANAWGLIYAALMSGADLVL
PDRYLQAEPLVSIIEDTRPTLAGAVPTIWNDVDRYLDSHPERDISSLRLV
ACGGSAVPLSLMRAFEEKYDVPIVQAWGMTETSPLATVARPAHRADATRR
WELRASQGRPICGVEIRLRDDDGKDVPWDGQSVGEIQARGPWITGSYFGN
NDTEKFDEGWLRTGDVGKIDAEGYLTLTDRSKDVIKSGGEWISSVELENT
LIGHPAVYEAAVVGVADDKWQERPLALVVVHPGTDVDIDQLRSFLADKVA
KWWIPERWSFVSDIPRTSVGKYDKKVIRARHSAGEYLIEIETS
119869278YP_939230.1 hypothetical protein Mkms_3246 [Mycobacterium sp. KMS]MASMVVPYRHDMGGHCGSGALRDLTEWAGIRWGDDTPDEGIVFALGGALD
FSYVRSAHLRPPIYLVGRSADLEDEYLTRLGARFECRSTDDPDLGWKWVT
EQIDAGTPVMVWTDIAELPYLRTRLSMSRHDVVIVGYDDDEELAFVVDND
RDTPQAVPYENLRKARASTGFPVPTRHTTYVVEWPGAAPDLGNAARSAFR
RSADAMQGSCVSAPITEDSDCEIQVRGLPGVSTFVEDLKRWPKIFDDDTL
DGALFALSAFIEKAGTGGGLFRDLQARGCRRVAEELSFEPAFKAAEAAKT
ASELWTAVAHAAYDRGADPHRRASGAASVAAQLPTAERRLAEALREAGDL
LL
119869276YP_939228.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKTRAAVLWGLEQKWEVEEVDLDPPGPGEVLVRLAATGLCHSDEHLVTGD
LPIPLPVVGGHEGAGTVVECGEGVEELSEGDSVILTFLPSCGRCSYCARG
MGNLCELGAALMMGPQIDGTYRFHARGEDVGQMCLLGTFSEYTVVPQASV
VKIDGGIPLDRAALIGCGVTTGYGSAVRTGEVRAGDTVVVVGAGGIGMNA
IQGARIAGALAIVAVDPVKFKREQASGFGATHTAASMDEAWSLVSDMTLG
KLADVCILTTDVAEASYTAEALALVGKRGRVVVTAIGHPDDSSISGSLLE
MTLYEKQIRGALYGSSNAPHDIPRLVELYSAGLLKLDELVTREYSLDQIN
EGYQDMRSGKNIRGLVRF
119869274YP_939226.1 putative transposase [Mycobacterium sp. KMS]MIVGWRVASHMRTTMVLDALEMARWSRGNTLPGLTCHSDAGSQFTSIRYG
ERLAEIGAVRSIGTIGDSYDNALETVNGYYKAELIYGPVRTRPWKTVEDV
ELATLSWVYWHNTSRLHSYLNDIPPTEFEAAFHDAHGTDQPLAGIQ
119869272YP_939224.1 integrase catalytic subunit [Mycobacterium sp. KMS]MTRRVLKLARQPYYRWRANPITNAELVEAYRANALFDAHGEDPEFGYRYL
VEEAREAGEPMAERTAWRICSQQQLWSVFGKKRGKNGKPGPPVHDDLVQR
DFTAETPNMLWLSDITEHYTGEGKLYLCAIKDAFSNRIVGYSIDSRMKSR
LATAALRNAVGRRGVVAGCVVHTDRGSQFRSRKFVQALHHHGMVGSMGRV
GAAGDNAAMESFFSLLQKNVLDRRRWATREELRIAIVTWIERTYHRRRRQ
GALGRLTPVEYEAIMTTTASQAA
119869270YP_939222.1 hypothetical protein Mkms_3238 [Mycobacterium sp. KMS]MTGTASVQIACTAVADDNGMRALRDVAAVTADIEYRVIGGHMVRLLRHVY
NVSGIPRLTSDADTGIDVNVASTGNLHDRLTALGYTAECGNRYERGEQAV
DLLVPTAAKPGKRIIGERAFDGAPGLRLALALPPIEVAVTARLTDGDTVE
FEIPVPDVEAAFVLKMLARTVRDSERDLQDIETLLEIVASQPDYHASPWR
LGDPKITKAGERGDAARVAAQMISSPPTRVPARVRALLRRHVAIVSR
119869268YP_939220.1 hypothetical protein Mkms_3236 [Mycobacterium sp. KMS]MQLADHFNVLLKDTVNLSQFKLDLLNQRVEAIYKALKADVEIGALITGKT
PQGSWAHRTIINPVGDNEFDADFMLDMSQNPDWADNPKTYIDEVYAALHR
HSTYGTMPHSRKCRCARLVYANSMHVDIVPHLNLADGREVIVNRDDNEWE
LTNPQGFTDWMKKQDSIASGNLRKVIRLMKYLRDHKNSFTGTRSVLLTTM
LGEQVTDLRKLLDPSYYSNVPTTLLHVVQDLDTWLQANPIKPSIADPSGS
GVTFDHRWGPDPESAQATYSYFRDRIHVHAADIEAAYEEKDKDRSVQLWQ
NIFGDGFKAPATTTASAKFPAATSAADSTVGRSGRAG
119869266YP_939218.1 hypothetical protein Mkms_3234 [Mycobacterium sp. KMS]MRATERQRNAPSEGVIVERLRTEATNWINAVALQSGRIDRRFNKRHADHV
ELQTLERDLHFFLLAAVRLRRCIEQVSRYQ
119869264YP_939216.1 NUDIX hydrolase [Mycobacterium sp. KMS]MRTDYYNDPNAPAPNSVVPSASAIVTDEQGRILLIKRRDNTLWALPGGGH
DIGETIADTAVREVKEETGLDVEVTGLVGVYTNPHHVVAFTDGEVRQQFS
LLFATTVLGGTLAIDHESTDIAWTAPDDIAGLDMHPSMRLRVEHYLQRRD
SPYLG
119869262YP_939214.1 regulatory protein [Mycobacterium sp. KMS]MRLRIDTSGTRFIVTRAPEPRLNFETGAPKVDTATGMPMYATQVLALDDS
GGEVLNVTVAGDPKVTVTQSISVVGLVAIPWAQGDRSGVAFRADALTPAT
ASGAAPSEQTRPQK
119869260YP_939212.1 putative plasmid replication initiator protein [Mycobacterium sp. KMS]MTSAQLALPGVPDTVDTTRVVEQMVRRAASMGYQSWWRRAESVGFCAHPI
QLIGTDEYGRQRVVWTRCNNRRAHICPSCSDLYARDTWQLVHAGAAGGHH
GMPTAVGDHPQVFLTLTAPSFGAVHTATTSGDKKAQVCRDQHRIGGYRRC
PHGKQLWCSMSHDHGDERVGQPLCPECYDYAGHVLFAWHLPELWRRFTIT
MRRTLRKELKATGVDPDAVRVSFIKIVELQARAIPHIHALIRLDPQDDPD
QTDWESPIGAVELATIIQHAARTVTLTIDDPTADTDARTMRFGTQIDTQP
LAASAKPVKSAPPEPEPEPGSGSGRSMSGRLVARYLAKYVTKSLVDLGIS
ARRLSTEAIPDLDVSEHVRTILTTISDLADKGLSGIGRWLHTLGFRGHIT
SKSRRYSTTMTVLREQRAIWTREERLKSTAYQYDPNCDFAGRDDLVAWEF
ERAGLGSLGDRSLVYSAALQRIHSRLIGLVEARRQAHNEQWDPLGASDG
119869258YP_939210.1 hypothetical protein Mkms_3226 [Mycobacterium sp. KMS]MVVVTGPADEVVELVSSLIRFDTSNTGDPATTKGEGDCARWVAAQLEEVG
YECEYLEAGAPNRGNVFARLPGADPSRGALMIHGHLDVVPAEPADWSVHP
FSGAVSDGYVWGRGAVDMKDMCGMMIAVARHFKREGIVPPRDLVFAFVSD
EEHGGTYGADWLVDNRPDLFNGVTEAIGEVGGFSLTVPRRDGGERRLYLI
ETAEKGLSWMRLTARGRAGHGSMVHDDNAVTAVAEAVAKLGRHRFPLVLS
DTVQQFLTAVAEETGYSFDPDSPDLDGTIAKLGGIARIVGATLRDTANPT
MLKAGYKANVIPQTAEAMVDCRVLPGRKEAFEREVDALIGPDVVRSWERD
LPSYETTFDGDLVDQMNASLLALDPDARTVPYMLSGGTDAKSFQRLGIRC
FGFIPLRLPPELDFAALFHGIDERVPVDALEFGAQVLQHFLEHC
119869256YP_939208.1 dihydroorotate dehydrogenase 2 [Mycobacterium sp. KMS]MTGYHALRRVLFLISPERIHTWVFALLRAVTTPDLLRRALQGRLAPRDPV
LASTVFGVRFPGPLGLAAGFDKDGRGLHTWPALGFGYAEVGTVTAHPQPG
NPEPRLFRLPEDRALLNRMGFNNDGAARLAQRLTRHTSDAPVGVNIGKTK
ATPADRAVEDYAQSARQLGPLATFLVVNVSSPNTPGLRDLQAVESLRPIL
TAVRAQTSTPVLVKIAPDLSDADVDEIADLAVELGLAGIVATNTTISRAG
LKTPGVEELGPGGVSGAPVAARSLEVLRRLYRRAGDRLVLISVGGIETAD
DAWERITSGASLLQGYTGFVYGGGLWAKHIHDGLATRLRAEGFTSLSDAV
GSAMRQ
119869254YP_939206.1 hypothetical protein Mkms_3222 [Mycobacterium sp. KMS]MPLRLNPRSRPLAAAVAALAIAAAGCSSNPVDAPPPTITPATAAVSPPVT
GAPAGTVRPLTVDPRAALFEPATRSLVVLGSGPGGRSALTVLTASAPPRT
VPTPATATAMAGTDDGVLYLSTRGGYLRVDVAAGAVDRIDVEGEADTDFT
AITRRDDGRLVLGTSDGAVLTLDSDTTVGARLGIFARVDALVAQGNTTVV
LDRGQTSVTTVDASGTKAAQALRAGEGATTMAADSQGRVLVADTRGDELL
VFGTDPLIMRQRYPVPGAPYGLAGSSGLAWVSQTATNTVIGYDLSTGIPV
EKVRHRTVQQPNLLAYDDTSGTLYVVSGTGAGVQVIGDAAEPR
119869252YP_939204.1 undecaprenyl pyrophosphate phosphatase [Mycobacterium sp. KMS]MSWLQVIVLAVVQGLTEFLPVSSSGHLAIVSRVFFDDDAGASFTAVTQLG
TEVAVLVYFARDIGRIATAWFRGLRNPGRRDADYRLGWYVIIGTIPIGVI
GLLLKDEIRTAARNLWAIAIALIVFSAVIAAAEYFGRQVRHVEQLTWRDG
VIVGVAQCLALLPGVSRSGATISAGLFLGLDRELAARFGFLLAIPAVFAS
GLFSLPDAFAPVGEGMSATGPQLLVATVIAFVVGFAAVAWFLRFLVRHGM
YWFVGYRVVLGVVVLILLSTGVVAAI
119869250YP_939202.1 hypothetical protein Mkms_3218 [Mycobacterium sp. KMS]MARAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDKRVVSVVLEKQQVAVL
AERIAALLQEINRRFGTPIPPDTGEVDDLSPLVTPVDAEFRVGTMGLGWD
SEAQTIVVELLAVSDTEFDASVVLDDAEDGPDAVRVFLTPESARQFATRS
NRVISAGRPPCPLCDEPLDPEGHICVRTNGYRRGALAGTDDDTDI
119869248YP_939200.1 inositol monophosphatase [Mycobacterium sp. KMS]MQTDAELAAAVAAEAGEMLVALREEYDWYHPYDLGDAGDKRANVLILDRL
REHRPHDAVLSEEAVDDLARVEADRVWIVDPVDGTREYSLPPRSDWAVHI
ALWQRTGGPGGGLTDAAVALPARGEVYRTDTVSPPPPRRDGPIRITASAT
RPPAVLWWIRDHLDIEMVRIGSAGAKAMAVVRGDVDAYIHAGGQWEWDSA
APAAVVRAAGLHASRLDGSPLVYNRRDPYLPDLLMCRTEVVDVLLAAIHS
AY
119869246YP_939198.1 short chain dehydrogenase [Mycobacterium sp. KMS]MRRMTSVHGKVVLITGGARGVGEELARRLHAKGAKLVLTDLDDGPLSALA
ADLGAERVLTVVADVCDLETMQSAAEQAVSRFGGIDIVIANAGIASYGSV
LVVDPDAFRRVLDVNVVGVFNTVRAALPSVIERKGYILVVSSLAAFAAAP
GMAPYDASKAGVEHFANALRLEVAHHGVTVGCAHMSWIDTPLVQDTKADL
PSFRTMLDSLPGPLSKTTSVQKCGEVFVKGIERRRERIYCPGWVGLIRWA
KPILTTRIGQASVLKTAPKVLPQMDAEVTALKRSLGARTHGLKK
119869244YP_939196.1 hypothetical protein Mkms_3212 [Mycobacterium sp. KMS]MTPSDFGPEKGPDLPPLRDAVVVAAFEGWNDAGDAASDALEHLDAIWEAE
TIAEIDDESYYDYQVNRPVIRQVDGVTRELVWPSMRISHCRPPGADRDIV
LMHGVEPNMRWRTFCAELLNIADKLNVQTVVILGALLADTPHTRPVPVSG
AAYSPESAKFFGLEETRYEGPTGIAGVFQDACVQAGIPAVTFWAAVPHYV
SQPPNPKATVALLRRVEDVLDIEVPLADLPTQAEEWEEAVTEMTAEDDEI
AEYVASLEQRGDAEVDMTEVLGKIDGDALAAEFERYLRRRGPGFRS
119869242YP_939194.1 HAD family hydrolase [Mycobacterium sp. KMS]MRAVLWDMDGTLVDSEKLWDVSLAALYDRLGGVITDELRTALVGSSAENT
IKTIFADLGLEPDPAAMAEADRWLHDHTGDLFATHGLPWCDGARELLEAL
AGEGVPMALVTNTQRALTEQALDSIGRHFFSVTVCGDEVPNGKPEPDPYR
RAAALLDLDPGHCLAVEDSVTGTLAAELAGCPVLVVPNDVVVPPSPRRRH
VDSLRDVAVDDLRAFHAEIAAASGKRSA
119869240YP_939192.1 phosphoribosyl-ATP pyrophosphatase [Mycobacterium sp. KMS]MGESQPVKTFDALFDELTERARTRPEGSGTVAALDGGVHGLGKKILEEAG
EVWLAAEHESDEALAEEISQLLYWTQVLMIARGLSPDDVYRKL
119869238YP_939190.1 hypothetical protein Mkms_3206 [Mycobacterium sp. KMS]MQYSPQWVQYDNYYRPRICNPYRNPLRVVYYYEGAPRVSIIPPLGNIVVE
AAAVGAYNFTAMVLDAVGAATNVAVGSFFGGGYFPGLDSPAQAPLPGDYA
LELVSDEASGLSLRDKFLIGLAGTLGALALAAVGLNVHLSRRRPRV
119869236YP_939188.1 mercuric reductase [Mycobacterium sp. KMS]MDTEPTTFDAIIIGAGQAGPPLAGRLTEAGQTVAVIERKLVGGTCVNYGC
IPTKTLVASAHAAHLARRGAEYGVGTGDVTVDMAKVKARKDKIMLGDREG
VESWLQGMDGCTFIRGHARFEDPHTVRVDDQVLKADRIYLNVGGRAVAPD
LPGLSDIDYLTNVGILDLDTLPEHLVIVGGSYIALEFAQMYRRFGARVTV
LEHGPRLTSREDEDVSAAIKDILEAEGIDIVLDAKDIRFTKRDNGFDVVP
RDGAAPIAGSHLLIAVGRQPNTDDLGLDAAGVQTDERGYVVVDDQLRTTA
DHIWAMGDCNGKGAFTHTSYNDFEIVAANLLDDDPRRVSDRVTTYALYID
PPLGRAGMTAEQVRKSGRKALVGKRPMTRVGRAVEKGETQGFMKVVVDAD
TEEILGAAILGVGGDEVVHAILDIMTAKKPYTAISRTMHIHPTVSELVPT
LLQDLKPLT
119869234YP_939186.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MDTIDLLWRHDRPLPSRRGRPPRFTADQVVTAAIAVADRLGLRFTLRDVA
DALEVPVMTLYSYVRNREQLLELMVDHCRAAMQFTDPAGDWRARLATVVA
DNMRLFDEHPWLADLESERAVLGPGTLAKYDRELGAVDSLPLGDADKDAA
LTLVLDFARSCARALAHARREREQESPGQWWAREGARLAALGVAERYPLA
SRIGAAAGAAHGAAHDAEAALAFGLNVLLNGLAATPPAASEAVRSPRRSS
119869232YP_939184.1 hypothetical protein Mkms_3200 [Mycobacterium sp. KMS]MIGHLYHRLPDDPSAGEGLAAFESTADTRSNWDPTIQHGSPPLALLTRAV
EDLAAGSGLRVGRLALDILGAIPVAPVLVRSEVLRPGTRISLMAAEMLAS
RPDGSHRAVARVTAWLLAPSDTADAVTDRYPPLAEGEVTGLAHAWEGAPG
YLETVNWRRQADDGNSAVAWLTPLVPLIDNEPTTALQRLAMVVDSANGIG
AALDPTEFMFMNTDTVVHLHRLPEGSDFGLRTRGSIGPDGVGVTTAELFD
RRGFIGASAQTLLVQRQR
119869230YP_939182.1 tRNA (adenine-N(1)-)-methyltransferase [Mycobacterium sp. KMS]MPRTGPFAVGDRVQLTDAKGRHYTMLLTPGGEFHTHRGMIALDSVIGLPE
GSVVKSTSGDQFLVLRPLLVDYVMSMPRGAQVIYPKDAAQIVHEGDIFPG
ARVLEAGAGSGALTCSLLRAVGPQGRVTSYEVRDDHAVHAARNVETFFGE
RPANWDLVIADLNDYNGGEVDRVVLDMLAPWEVLDTVSRNLVPGGVLMIY
VATVTQLSRAVEALRQQQCWTEPRAWESMQRGWYVVGLAVRPQHTMRGHT
AFLISARRLAPGAIAPIPLRRKRQLAAPPAEPSD
119869228YP_939180.1 protein LppK [Mycobacterium sp. KMS]MTADVRSAVTLVVAAFGLSLGLSGCGSDNPPAPPPSPVASSPAAPPAPPV
PAPLPPPSALTDVLYRLADPNVPGAEKLVLIEDSGPGDAAALDRFGKALA
DNGYHPMTFDAADLAWTASGVDVVATVIARTPPGRTGGDFTFPMEFARTP
DGGWQLTRDSADTLLEVDAGQSPPR
119869226YP_939178.1 vesicle-fusing ATPase [Mycobacterium sp. KMS]MSESQRHEAREDGFTTPHESGLSSEDAAELEELRREAAALREQLENAVGP
QSGLRSARDVHQLEARIDSLAARNAKLMDTLKEARQQLLALREEVDRLGQ
PPSGYGVLLASHEDDTVDVFTSGRKMRLTCSPNIDVKALKQGQTVRLNEA
LTVVEAGTFEAVGEISTLREILSDGHRALVVGHADEERIVWLAEPLVSVE
HLPDNEVAGPELDDDRPRRLRPGDSLLVDTKAGYAFERIPKAEVEDLVLE
EVPDVSYSDIGGLTRQIEQIRDAVELPFLHKDLYREYSLRPPKGVLLYGP
PGCGKTLIAKAVANSLAKKMAEVRGDDAREAKSYFLNIKGPELLNKFVGE
TERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVP
QLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEA
AQDIFSKYLTEELPVNEDDLAEFGGDRSLTIKAMIEKVVDRMYAEIDDNR
FLEVTYANGDKEVMYFKDFNSGAMIQNVVDRAKKYAIKSVLETGQKGLRI
QHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSS
ANRAIDTESNLGQYL
119869224YP_939176.1 hypothetical protein Mkms_3192 [Mycobacterium sp. KMS]MAQEQTKRGGGGGEDDDLSGGAGAGQERREKLAEETDDLLDEIDDVLEEN
AEDFVRAYVQKGGQ
119869222YP_939174.1 20S proteasome- A and B subunits [Mycobacterium sp. KMS]MSFPYFISPEQAMRERSELARKGIARGRSVVALAYADGVLFVAENPSRSL
QKVSELYDRVGFAAVGRFNEFNNLRSGGIRFADTQGYAYSRRDVTGRQLA
NVYAQTLGTIFTEQAKPYEVELCVAEVAHFGESKAPELYRITYDGSIADE
PHFVVMGGATEPIIAKLNDSYTENAELADAVRIAVDALESGGNGAERRTL
GPSTLEVAILDANRPRRAFRRITGSALEALLPQRDAEASADAGAADKPAE
119869220YP_939172.1 hypothetical protein Mkms_3188 [Mycobacterium sp. KMS]MPVWLIWLVLAIVLAGAEALTGDMFLLMLSGGALAATGTSWLFDWPIWAD
GVVFLLVSVLLLGVVRPVLRRRFYAGTGLPEPAKALEGKTALVLDRVAQH
AGQVKLEGEVWTARPLDDNDVYEPGDQVTVMRIDGATAVVWKNP
119869218YP_939170.1 hypothetical protein Mkms_3186 [Mycobacterium sp. KMS]MSALGSKRTYAALAAMQAADAAACVKPIAPIKKAFDDVGLPEEIRPLIPV
VKAASAVGLLSVFGWPPLARLTTFMLTVYFVLAAGSHVRARDWSPGLAAA
SSLLVLFGAMTVKGPDVRTP
119869216YP_939168.1 methylmalonyl-CoA mutase subunit beta [Mycobacterium sp. KMS]MSVQGASAVESGLEQWRSAVAGVLAKSTRKDPADLPAEPDRLLDSPTYEG
FAIRPLYTSLDELPEPPLPGQWPYVRGGDALRDVKSGWKVAETFPAVPSS
ADEANGAILLGLTEGVSALVLRVGADGVAPSDLGRLLESVFLDLVPVQLD
AGTEYAAAAAALLPLLTDLDAEQRERLSVDLGADPLTAPFSDRPAPEVAD
VVSIAAGVTGHGGHVRAITVDGPALHNRGASASWELAGAVAAGVSYLRLL
DQGGLDIVDAVRQISFRFAADDDQFMTIAKLRAARLLWARVCEVVGAADA
GAATVHAVSSLPMMAQRDPWVNMLRTTLAAFSAGVGGADTVLVHPFDVAI
PNGFPGTSSTFARRIARNTQLLLLEESHIGRVLDPAGGSWFVEDLTAQLA
ERAWKHFQDIESRGGFVAAHDHIAEQIADVAARRADDIAHRRTALTGVNE
YPNLDEPALPPGEAFTAVARYAAGFEALRDRSDAVLESTGARPKVLLLPL
GPLAEHNIRATFATNLLASGGIEAVNPGSVGAADVARAVSAAGNPSVAVI
CGTDTRYGTDAAAVVAAAREAGVTRVYLAGPEKAVAEADPKPDDYLTAKI
DAVAALSNLLTRLGA
119869214YP_939166.1 arginine/ornithine transport system ATPase [Mycobacterium sp. KMS]MAAPTVAELSAAIRSGDRSALAKAITLVESTRADHREQAQELLLELMPQA
GSAMHVGITGVPGVGKSTTIEALGMYLIEQGHRVAVLAVDPSSTRTGGSI
LGDKTRMAKLAVHPDAYIRPSPTSGTLGGVAKATRETIVLLEAAGYDVIL
VETVGVGQSEVTVSNMVDTFVFLTLARTGDQLQGIKKGVLELADIVVVNK
ADGEHAIEAKSAARELTAALRLIYPRETLWRPPVLTMSALHGDGLRELWD
KVLEHRDVLREAGQFENRRRAQQVEWTWSMVRDAVLDRVLNNPEVRRIRA
EVERQVRDGELTPALAARRILDAAH
119869212YP_939164.1 hypothetical protein Mkms_3180 [Mycobacterium sp. KMS]MVNITAVGQMGLGHTRCAEYVRTTRLPDYGNSGTNNDVHVIQATSKGSTD
PTHQWDVSAETVTAKANSPAGQPFPGTTNVVTRGGEIPHKPHPQGV
119869210YP_939162.1 condensation domain-containing protein [Mycobacterium sp. KMS]MVAIKAIHDWTGAPGTLVSWNPSATSLAKMQDAPISPVPVSYQQEQHIRG
YRKHLSQGTDMARLNIPAWDMPGQCDLRAMTHVINAYIRRHDTYHSRFEF
TEAGEVVRRTIRNPRDIKFVPTQHGEMTADQWRRHVLLTPDPLQWNCFGF
GIIQRADHFTFYISVDHVHTDAMFMGLVLVEIHMMYATLVGGGAPLKLPD
AGSYDDYCLRQREYTDSLTLESPEVQDWVRFAKSNGGTLPHFPLPLGDPA
EPCSGELLTVRLLDKHQGERFEAACNAADARFIGGVFACAALTDHEFTGD
SDYHIITPTTTRRTPEEFMTTGWFTGLVPVTVSVDRNSFGDTARSAQKSF
DSGLDLAHVPFERVLELAESVGVRPADPGVPMVSYLDAGLPPLSPSVIAQ
WEGMNGKVYSDARAAFQVGMWVNRTERETTVTVAFPDNPIARESITRYLQ
VMMSWYLRVADGGAAGPLAGRHGAAVRRRDELVPVVGG
119869208YP_939160.1 hypothetical protein Mkms_3176 [Mycobacterium sp. KMS]MAIQMRPATLRAGRGEDGGLRDDHLAYIDQAAYLQQRATGVGKLAQAVWV
YEHPLNMDALKRFHANLDHSLIGRRVETSVLPFGRHRWVSAEGAPIAVSA
PRSRADLSDWIDERSAVPTDPEIGPSWHLGVLPMDDGSVAISLAASHVVT
DGIGLLRSIADAAEGRTRHLGYAPARSRSTLTALRADLRQTARDMPEVGR
TVAAAAKLAYRRRHELRQPASPRAAAATVAEGGKPVIIPAITAFIDAKHW
DSCAEMRNGTTYSLLAGFAARLAERTGRHRPDDGAVSLLIAISERTPDDT
RANAVAITNACVDPARVTADLSESRIAIRQAITTLREVPDETFALLPLNP
FVPKRAVKRAADIMFGDLPVSCSNLGEIDPAVGRVDGTDAEYFMLRGVDQ
NLTREQIERAGGQLVVASVRLGDMISLGIVSYEPGRTNTKRRLRDLTTLT
LAEFDLYGEIV
119869206YP_939158.1 transport protein [Mycobacterium sp. KMS]MFDRTKLRGAFADGGLPQLGRFIVRHPVLIIVAWVAAAAVLFLLIPPLAV
VSQKNPPEFLPKDAPVMVDSKKMSDAFKGAEETNTSNLNVVILSNPNGLS
PDDEQTYEELVERLKADEEHVISTQDFVTTPQLREVMTSKDGKAWNLPVS
LVGSMGTPKGQAAYRAAGKIVKETTADTTLQANMVGAAATLEDINAIGAR
DQRVIEIATVGTILAILLVVYRSIIGMLIPLLTIGLALGVANQAVAGLGE
LGLGLGPQTIVLMTGMLMGAGTDFSIFFFSRYHELVREGMESDDAMIGAL
VTIGKVVAGSAATTAIAFLGLAFTTLGVFATVGPALSVTIAIGFLASITL
LPSLIVLAGRRGWVNPRKDLTGRFWRRSGIHIVRRPVVHLVGSLTVLIAL
AACAGFIKFNYDDRKALPADSESNRAYQAMDDHFPISTTMQQFVVIHAPD
QDLRSPRSLAVMEQMAQRIAALPDIDMVRGITRPTGEMLEQAKATYQAGE
VGGKLDEASTLIEDNDANLNRLSGGAHQLADVLDEIRDGVVGAVGSVRGL
AGALDDMSRKYGGAKTLDEIDRTARLVTNMRDLGNAIGVDVNRMTDIYAW
ADPVLRSLDTSPTCDADPECVQSREDMRRIVSTRESPYLNSISDLGSQLQ
NTEGYQTLDETIQGLSKSLKTATAAARELGLDEPNGVQNKIREVTQGANT
LADSSRQLAEGVQLLVDQTKNIGGGLDQASDFLLAMKRDASEPSQAGFYI
PPQILTQPEFKKAANLFVSKDGHTARYLVQTALDPFGTEAMDQVDDIVGA
AEGARPDTTLANADISMVGFSPVQSNLREYYNGDIRFIIGFTLLVVFLVL
CLLLRAVVAPIYLVASVVLSYVSAIGIGVLFFQFILGQELAWTVPGMAFL
VLVAVGADYNLLLIARIREESRDGIRTGIIRTVGATGGVITSAGLIFAAS
MLSLTVSSIGTVIQLGFVIGVGLLLDTFIVRTITVPAAAVLIGNANWWPT
KPKYEKRVPRADVADAVTAPLLPRSPRARVRQRLAEITQEYRALREDRPP
EQVPEATARTDV
119869204YP_939156.1 polysaccharide pyruvyl transferase [Mycobacterium sp. KMS]MTDFVERIRDRLMNDLRRVFAGVPEWDLVDFPHHFNCGDSAIWLGEVKIA
EELGIRVASATSSQMYRRDKLRANGPVVIHGGGNLGGLYPQHDDLRIRIL
TDFSTRPIVQLPQSIEVTNAAGLERLKRAIGSHRDFTLLVRDRRSLDIAR
REFYCRIELVPDAAFALGNLERRPAVEEAVVQARRDKEASGEQISGHPTV
DWNTASILSLRNLGRSAVTAAGKLPVPALTSTLADSFARQNLRWAIRTLS
RGHVLVTDRLHGHVIATLCGIEHIVVSDRYGKVRALWETWTQDAPMATFA
PTWSAAETALAERISRRYAS
119869202YP_939154.1 glycosyl transferase family protein [Mycobacterium sp. KMS]MPEPTIEVIIPVRDMAEHLPKLLRPLYDQMSDGDRVTVVDDASRDDTEAV
ARSLGAGVVALKDSRGPYYARQVAASRSTADVLLFTDARCRPLPGLLEAH
RDLQERPGVALSCTNVRTLSGPRLAARLAASMQPFMLPRGGGAMKATIGM
VPPRPDYYPTANLGIDRIAFAKVGGFRSMRGGGDTDICWRIQEQSLGTIA
TDTRVLMEWEPRTSMRDLASQWKRYGHSNAYMRWVHRNDDVSKGDDSPRR
HSPMEAWATLRAELRRPPAELAATALVGLAFQYGYFSAKFKSSQFEMPAY
FDVAPNLDSA
119869200YP_939152.1 hypothetical protein Mkms_3168 [Mycobacterium sp. KMS]MTRTSKRTVRIVFAATFVWIALLQYGLFAIDRMEPYPALVLPGFPAHCPG
CLLETGEPATQEPELLVRFADGTTQRVPTETVLPPGPSVRLIAFTTAYKN
DGFTSDPEAVAWLKSRIAERFPGEAVSGLDIVWRKATYKAADESAIEYEP
SHTIHVNFGTTR
119869198YP_939150.1 ABC-2 type transporter [Mycobacterium sp. KMS]MTAIALLTRRTLVRGRVDLVFAVLMPTFVLAGLVLLLQDVIATGQMSYTQ
YVLPAVVVQAMLFGALTTTDRAAWDTISGLSTRMRTLPISPYAMLTARMI
YCLIRGVLAVIASVLAAHWFGFRFTTGFGYGAAFVLMALTLTLALSLGAD
VTGTKAGRTEVASQLLLVPQLLLVLLSTGLAPLEAFPSWLQGFVQYQPVS
QITEAMRGFTSGHVDAGNLGVSLAWCVGLLLVFGTMAVRLQGRTP
119869196YP_939148.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MRVLGIGCLMLGRIVRYRKDEGPAMTASTLPTVLRERASLQPNDTAFTFI
DYEKAVEGVHESLTWAQLYRRTVNLAHELSEHAQPGDRAVIVAPQGLDYL
VAFLGSLQAGLIAVPLSTPMPGVHDERISAVLRDAAPTVVLTTSSIGAMV
TEYVAPDDAETAATLIEVDLLDLESRRKSAARRVERPETAYLQYTSGSTR
TPAGVMVSYRNLSANFEQIMASFLAHYGGIAPPGTTAVTWLPFYHDMGLL
LGVFAPILAGWPTVFTTPLSFLARPARWMQMVAGSPLAITAGPNFAFELA
VGKTSDDDMAGYDLGNTCIIISGSERVHDATLKRFAQRFRKFNLPEEVLR
PAYGLAEATLYVATNSPGKPPTIVHFEPEKLSAGHAKRTETGTPLVSYGS
PDSPAVRIVDPQTRRELSAGAIGEIWVRGENVCLGYWGKPEQTEEVFNAF
LDSPSPGTDAGPWLRTGDLGFISDDELFIMGRLKDLLIVRGRNHYPDDIE
GTIQEISGGRVAAISVEQDRTEQLVAIVEVKKRGDTDEDVAAYFADLKNR
VTSAISTAHGISAADLVLVPRGSIPITTSGKVRRASCAELYRDGAFTRLD
A
119869194YP_939146.1 hypothetical protein Mkms_3162 [Mycobacterium sp. KMS]MPRTDENGRQLKALLDYLLDGDVEAKAIYDALGISSSTYYRRIKEQDYPD
AEELRRVADRFELSYPDLQIRFGLMSRQEVWHYVESAPFTVATVADAAPT
TRRRPKLSELAPRPDAPPL
119869192YP_939144.1 isoleucyl-tRNA synthetase [Mycobacterium sp. KMS]MTAYPKPAGGAPNFPELEADVLDYWAGDDTFRASIAGRDGAPEYVFYDGP
PFANGLPHYGHLLTGYVKDIVPRYRTMRGYKVERRFGWDTHGLPAELEVQ
RQLGITDKADIDAMGIEKFNDACRASVLKYTDEWRSYVTRQARWVDFDND
YKTLDLSFMESVIWAFKQLWDKGLAYQGVRVLPYCWNDETPLSSHELRMD
DDVYQSRQDPAITVGVQAVDGPLAGSHLLVWTTTPWTLPSNQAVAVNPDV
TYVQVAVGDRRYVLAEARLAAYAREIGEEPEVLATMTGSELLGTRYLPPF
PYFTDKPEAQNAWQVLRGDFVTTEDGTGIVHMAPAYGEDDKATTDTVGIT
PVTPVDSKGRFDASVPDYQGQHVFDANPQIIRDLKNGTGSAGANGAVLVR
HETYEHSYPHCWRCRNPLIYRAVSSWFIKVTEFRDRMVELNQEITWYPEH
VKDGQFGKWLQGARDWSISRNRYWGTPIPVWMSDDPAHPRIDVYGSLDEL
ERDFGVRPTNLHRPFIDELTRPNPDDPTGKSTMRRIEDVLDVWFDSGSMP
YAQVHYPFENRDWFDGGPDEDAHFPGDFIVEYIGQTRGWFYTLHVLATAL
FDRPAFKTCVSHGIVLGNDGQKMSKSLRNYPDVTEVFDRDGSDAMRWFLM
ASPILRGGNLIVTEQGIREGVRQVLLPLWNAYTFLALYAPKKGTWRTDSS
HVLDRYILAKLAQLRDDLTESLDVCDISGACDELRQFTEALTNWYVRRSR
SRFWDEDPDAIDTLHTVLEVTGRLAAPLLPLVTEVIWRGVTGGRSVHLTD
WPSADELPKDPALVAAMDQVRAVCSTASSLRKAKKLRVRLPLPKLTVAVT
DPAQLEPFADLIADELNVKAVELTDDIDTYGRFELTVNARVAGPRLGKDV
QAAIKAVKAGEGVVNADGTLTAGPAVLQPGEYTARLVAADAEFTAALPDG
AGLVVLDGTVTPELEAEGWAKDRIRELQELRKSSGLDVSDRISVVMSVPQ
THEEWARTHRDLIAGEILATAFEFGEPADGSEIGDGVRVAIAKA
119869190YP_939142.1 carotenoid oxygenase [Mycobacterium sp. KMS]MRVERLQTFASTLPADDDHPYRTGPWRPQVTEWRADDLEVVAGEVPADLD
GMYLRNTENPLHPAATAYHPFDGDGMIHIVEFGGGKAAYRNRFVRTDGFL
AENEAGGPLWAGFIEMPSAAKRADGWGARTRMKDASSTDVVVHRGTALTS
FYMCGDLYQVDPYTADTLGKETWHGDFPDWGVSAHPKIDPVTGELLFFSY
SKEAPHLRYGVVDKDANLVHHTDVALPGPRMPHDMAFTENYVILNDFPLF
WEPSLLKQDIHAPVFHRDMPSRFAVLPRRGDQSQVRWFETDPTYALHFVN
AYEDGDEIVLDGFFQDNPSPSTKGAKSLEDAAFRYLALDGFESHLHRWRF
NLATGAATEERLSDSLTEFGMMNGDYQTRRHRYVYAATGKPGWFLFDGLV
KHDLRDGTEERITFGDGVFGSETAMAPRQDGTAEDDGYLVTLTTDMNDDA
SYCLVFDAARIADGPVCKLRLPERICSGTHSTWVSGAELRRWHSPR
119869188YP_939140.1 RNA-binding S4 domain-containing protein [Mycobacterium sp. KMS]MAAHEVPIGDDTIRLGQFLKLASLIDSGADAKSVIADGAVTVNGEVELRR
GRQLHPGDTVTLGGESARVTRG
119869186YP_939138.1 asparaginase/glutaminase [Mycobacterium sp. KMS]MSLVVITTGGTIATSTDADGVRRPTRRGADLTAGLDVTVVDVLNKDSSQL
TPADWDRIRDAVLAGTAGGAADGVVVTHGTDTMEETALWLELTYDGTTPV
VLTGAQRGADAPDADGPANLRDAVTVAGDPEARGLGVLVSFAGTVRRPLG
LRKVATEDLDGFDGPVVGRVADGRFTVTGPKVRPYLGDVSAERAPRVDIV
TTYPGGDAAALSACAAAGARAVVLEALGAGNAAQPVIDGVRRLCADGVLV
AVSTRVPGGRVRPAYGPGRDLADAGALMVPTLRPAQARVLLMAALAADVP
AAEVLAEWG
119869184YP_939136.1 ribosomal large subunit pseudouridine synthase D [Mycobacterium sp. KMMPVPEGLGGMRVDAGLSRLLGLSRTAAAAIAEDGGVDIDGAPAGKSDRLT
AGAWLEVRLPEAPPPVENTPVEIEGMAVLYSDDDIVAVDKPPGVAAHATV
GWHGPTVLGGLAAAGFRISTSGIHERQGIVHRLDVGTSGVMVVALSERAY
TVLKRAFKQRTVEKRYHALVQGHPDPSSGTIDAPIGRHRGHDWKFAVTEG
GRHSVTHYDTLEAFQAASLLDIELETGRTHQIRVHFAALHHPCCGDLTYG
ADPTLARRLGLERQWLHARSLAFAHPADGRRIEITSPYPADLQHALDVLR
RHAR
119869182YP_939134.1 DGPFAETKE family protein [Mycobacterium sp. KMS]MQYCLIMHYPEGPEIGLTEEDMAPTRAAFARYAEDLDAAGVLVGTQVLHS
AALTTTVTARDGTVDIQDGPFADTKERLGGIFVIDVPHLDAALDWAKRNP
AAAFGAVEVRPVAVTYSTGQGWFSPE
119869180YP_939132.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MQRKGRARAAARARGRPVGADSAETRRQIVRAGRVVLIERGYSGMTFQAI
AERTGLSRPTLHYYFATREEVYEGIVTEMREIVVDCVEHSLRHDRLLDRL
AAFVAAVRRVDHRDPSVVPFLISARLEPQRNPELQAISESPVRAFLMRLV
SDAIRRGELDDDTDVEGVSDMLHVILYGMAFYSGFTNGPAELGTIAKQLI
ELFAHGLVAGPRGPDPAGGGEDTLRDTPKGVGPRS
119869178YP_939130.1 hypothetical protein Mkms_3146 [Mycobacterium sp. KMS]MSHPESRHIAVWVAAPPNVVYDLAADPATWPRWAAGLARGGLRQGPQGWV
ADSPMGEVVVEFSPPNEFGVLDHVVRMPSGEAVYNPLRVVPAGAGEPRCE
VVFSLRRRDDMTDEQFEQDAAAVTADLEALRDLVEG
119869176YP_939128.1 hypothetical protein Mkms_3144 [Mycobacterium sp. KMS]MPLTGEYEPSTSDWAREQAEKFMESGGTEATELNGKPIILLTTVGAKSGK
LRKTPLMRVEHQGEYAVVASLGGAPKHPVWYHNIKKNPRVELQDQTVTKE
YDAREVFGEEKAEWWDRAVEVWPDYADYQKKTDREIPVFVLTPVE
119869174YP_939126.1 malto-oligosyltrehalose trehalohydrolase [Mycobacterium sp. KMS]MPEFAVWAPLPERVRLDVEGSLHPMTCGDDGWWRIEVDAAPDARYGFVLD
DDPKVLPDPRSPRQPDGVHERSQLWQPAPDAWTDGAWAGRKIEGSEKGQV
IYELHTGTFTPEGTFDAAIGKLDHLVDLGVDFVELMPVNAFGGTHGWGYD
GVLWYAVHEPYGGPDALIRLIDACHSRGLGVLIDAVFNHLGPSGNYLPKF
GPYLSSGSNPWGESINIADAGADEVRRYILDCALRWMRDFHADGLRLDAV
HALVDTTAIHILEELSAETDALADELGRPLSLIAESDMNDPRLITPRDQG
GLGMTAQWDDDIHHAIHAAVSGETQGYYGDWGTVEALAQTLRNGYFHAGT
FSSFRNRRHGRPLDTATIPATRLLAYTLTHDQVGNRAVGDRPSQNLDTGQ
LAVKAALALGSPYTAMLFMGEEWGSSSPFQFFSSHPEPELARATAEGRKR
EFAEHGWDADEIPDPQDPQTFLRSKLKWDEIDDGDHGRLRALYRELIALR
HNEPDLADPWLDHLRIDYDEAQRWIVMHRGSLSIACNLGADAVTVPVTGD
VVLAWGEPAPEGDGMSLAGHSFAVVRTQSR
119869172YP_939124.1 glycogen debranching protein GlgX [Mycobacterium sp. KMS]MVTPGSGPTSPTLHTVWPGEAYPLGATYDGAGTNFSLFSEVAERVELCLI
AKDGSEERINLDEVDGYVWHAYLPTVTPGQRYGFRVHGPWDPSAGHRCDP
SKLLLDPYGKSFYGDFRFGQALYSYDLDAEDLASGGDPPRIDSRGHTMTS
VVINPFFQWGSDRAPRTPYHDTVIYEAHVKGMTRRHPAVPAELRGTYAGL
CHPAIIDHLKSLNVTAIELMPVHQFMHDHRLLDLGLRNYWGYNTFGFFAP
HNEYAANQHAGGAVAEFKAMVRSFHAAGIEVILDVVYNHTAEGNHLGPTV
NFRGIDNAAYYRLLDGDLRLYKDFTGTGNSLNARHPHTLQLIMDSLRYWV
LEMHVDGFRFDLASTLAREFYDVDRLSAFFDLVQQDPVVSQVKLIAEPWD
IGEGGYQVGNFPGLWTEWNGQYRDTVRDYWRGEPATLGEFASRLTGSSDL
YEATGRRPSASINFVTCHDGFTMHDLVSYNEKHNEANGEDNRDGESHNRS
WNCGVEGPTDDPDVIALRGKQMRNMLATLMCSQGTPMIAHGDEIGRTQQG
NNNVYCQDSELSWMDWSLCETNADLLEFTRKVVAFRKNHPVFRRRRFFEG
KPIRSADQVRDIAWLTPAGTEMTPEDWGTGLGKCVAVFLNGEAIPAPNAR
GERVVDDSFLLCFNAHDHVQDFVTPDGDYAEMWTADLDTADPTGHTDVVV
PAGEKISLQPRSLLVLRKTA
119869170YP_939122.1 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [MycobacterMSIPVPALTPEQIRALDAAHVWHPYSTIGAGALPPVVALAAKGVWITIDH
PAGGGPVDVIDAMSSWWTAIHGHGHPVLDAAITRQLATMNHVMFGGLTHE
PAVRLAQLLVHITPPGLDTVFFSDSGSVSVEVAVKMALQYWRAAGRPGKT
RLMTWRGGYHGDTFTPMSVCDPDGGMHSLWTDVLTRQVFAPPVPRDYDPG
YVAAFERRLAEHADELAAVIVEPVVQGAGGMRFHDPRYLSDLRTLCDRHG
VLLVFDEIATGFGRTGELFAADHVGVSPDIMCVGKGLTGGYLTLAATLCS
AEIARVISTGEAGALMHGPTFMANALACAVGVAAVELLLAGDWRSTIATI
ERGLTEGLAPAREVSGVADVRVLGAIGVVELDRPVDMATATAAALSHRVW
LRPFRNLVYVMPPYICTPEEIAQITSAVVGVARALA
119869168YP_939120.1 dithiobiotin synthetase [Mycobacterium sp. KMS]MSVLVITGTDTGVGKTVATAALACAARVAGIDVAVCKPVQTGTGPVGGTG
DDDLVEIGRLAGVDALHPGWRYPDPLAPVAAAERAGAALPTRDELIGMVR
AADAPGRLTLVEGAGGLLVELGQDAVTLRDVATELDAPVLVVVAPGLGTL
NHTALTLESLAAQHVPCAGLVIGAWPAQPGAAEIDNRDTLARLAPVRAAL
PAGVGSVSPVDFERISATAFDPNWLAGLL
119869166YP_939118.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MQLHKRDVVDAATVILDSHGIADLTMRRLARELNVSPGALYWHFANKQQL
LGAIADRILTPARGLPAEADWRDRIVAVCSALRDALLSHTDGAELVSASF
AAGQSEAAGEILAVLSAAAADAGVAAGEAELAARTVIYYVLGFTVDEQSK
LQWDSAGVLDPDESVATIDHDRRFGFGLRLLIDGLGVISPVR
119869164YP_939116.1 hypothetical protein Mkms_3132 [Mycobacterium sp. KMS]MAPKFNVYTGEPAGGVVPTAAQLGLEPPRFCAECGRRMVVQVRPDGWWAK
CSRHGVVDSHDLETQR
119869162YP_939114.1 triacylglycerol lipase [Mycobacterium sp. KMS]MDLGSVARETGAEWIGQPHHEHVARGARPSVPAKDQFYDPPAGFEHARPG
TVLRSRDVELAFLGLVPQQFTATQLLYRTTDFRGDPQATVTTVVAPTERD
PKKPCPIVSYQCAIDAIAGRCFPSYALRRGAKALGALAQFEFLLIAAALA
EGWAVSVPDHEGPRGIWGVPHEPGYHVLDGIRAAQNFDRLGLSAEAPVGL
WGYSGGGLASAWAAETCGGYAPELNIVGAVLGSPVADLGNAFRRLNGSIF
SGLPAMVVAALTQSYPGLDRVIHEHATDDGKAMLLRIQKMTTAHAVLRWI
GMDMGKLVDRPLEDILQTPEVQHVFDSIKLGTATPTPPVLIVQAVNDRIV
SVDDIDALIDTYSDGGAHVTYHRDMFSEHMLLHPMSAPMTLRWLRDRFAG
RPLSEHLVRTKWPTLLNPSTYRGMLRLAVISAKVIAGQRVERRPLSQFDR
119869160YP_939112.1 quinolinate synthetase [Mycobacterium sp. KMS]MTLLDETASAQFGDDVAPTEEWAAEVRRLARQRGATLLAHNYQLPAIQDV
ADHVGDSLALSRIAAEAPEDTIVFCGVHFMAETAKILSPDKTVLIPDARA
GCSLADSITADQLREWKAEYPGAVVVSYVNTTAAVKAETDICCTSSNAVD
VVASIPADREVLFCPDQFLGAHVRRVTGRTNMQIWAGECHVHAGINGDEL
ADQARAHPDAELFVHPECGCATSALYLAGEGAFPADRVKILSTGGMLDAA
RESRASQVLVATEVGMLHQLRRAAPEIDFQAVNDRASCRYMKMITPAALL
RCLTYGTDEVDVDHETARLARRSVQRMIEIGQPGGGE
119869158YP_939110.1 nicotinate-nucleotide pyrophosphorylase [Mycobacterium sp. KMS]MLLSQLSETEIAEARAVVARGLEEDLRYGPDVTTQATVPADAATTASMRT
REPGVAAGVDVALLVLDEVIGPDGYRVVDRVEDGTRLEAGAALLTLDAPT
RGLLTAERTMLNLVSHLSGIATSTAMWVDAVAGTNAKIRDTRKTLPGLRA
LQKYAVRVGGGVNHRMGLGDAALIKDNHVAAAGSVVAALRAVRAAAPGLP
CEVEVDSLEQLDEVLAEDIELVLLDNFPVWQTQIAVQRRDSRSPATKLES
SGGLSLETAAEYAGTGVDYLAVGALTHSVRVLDIGLDV
119869156YP_939108.1 helix-turn-helix domain-containing protein [Mycobacterium sp. KMS]MVRSPLTPQQRAAGKRLGAHLRQARGDRKLVEVAEAASISPETLRKIESG
RLATPAFATVAALSVVLEIPLEDLARICLPELGGQLTSATNTAMLRA
119869154YP_939106.1 histidinol dehydrogenase [Mycobacterium sp. KMS]MNVSPVTMARIDLRGRTLSTAQLRSALPRGGVDVDAVVPKVRPIVEAVAE
RGAEAALEYGEAFDGVRPASVRVPAERLASALAELDPDVRAALQVAIDRA
RAVHADQRRTDTTTTLAPGATVTERWVPLERVGLYVPGGNAVYPSSVVMN
VVPAQTAGVDSLVIASPPQADHGGLPHPTILAAAALLGVDEVWAVGGAQA
VALLAYGGTDIDGTGASGAPGDGTGASGAPGDGTGASGAPGDGTELAPVD
MITGPGNIYVTAAKRICRSQVGIDAEAGPTEIAVLADHTADPVHVAADLI
SQAEHDEMAASVLVTTSPDLADAIDRELRRQLETTVHRERVSTALTGEQS
AIVLVDDLDAGVRVVNAYAAEHLEIQTVDAAEVAGRIRSAGAIFVGPYAP
VSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVDYTEAALKDVSG
YVITLAQAENLPAHGEAVRRRFES
119869152YP_939104.1 imidazoleglycerol-phosphate dehydratase [Mycobacterium sp. KMS]MTDMLTGTRRARVERKTKESDIVVDLDLDGTGIVDIRTGVPFFDHMLTSL
GSHASFDLTVHATGDIEIEGHHTVEDTAIVLGQALGQALGDKKGIRRFGD
AFIPMDETLAHAAVDVSGRPYFVHTGEPDYMVEFTIAGSSAPYHTVINRH
VFESLAFNARIALHVRTIYGRDPHHITEAQYKAVARALRQAVELDPRVTG
VPSTKGSL
119869150YP_939102.1 phosphoribosyl isomerase A [Mycobacterium sp. KMS]MSEKRPLILLPAVDVVEGRAVRLVQGKAGSETEYGSALDAALGWQRDGAE
WIHLVDLDAAFGRGSNRELLADVVGRLDVAVELSGGIRDDESLEAALATG
CARVNIGTAALENPQWCAKVVAEFGDKVAVGLDVKIVDDQHRLRGRGWET
DGGDLWEVLDRLDSEGCSRYVVTDVTKDGTLQGPNLDLLGRVADRTDAPV
IASGGVSSLDDLRAIATLTDRGVEGAIVGKALYAGRFTLPEALAAMGQ
119869148YP_939100.1 imidazole glycerol phosphate synthase subunit HisF [Mycobacterium sp. MAADRGLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAVYDAEGAD
ELTFLDVTASSSGRSTMLDVVRRTAEQVFIPLTVGGGVRAVADVDALLRA
GADKVSVNTAAIARPELLAELARQFGSQCIVLSVDARTVPQGEQPTPSGW
EVTTHGGRRGTGIDAVEWATRGAELGVGEILLNSMDFDGTKAGFDLPMLR
AVRGAVTVPVIASGGAGAVEHFAPAVHAGADAVLAASVFHFKELTIGQVK
AAMAAEGITVR
119869146YP_939098.1 alpha/beta hydrolase domain-containing protein [Mycobacterium sp. KMS]MKRSAAAVIGGATAAVAAGRYLLAREALSAVARDLRSPVLPYVAAPSSRR
SMLVTRAFTRLPTPAGDGVTVTESRVGETAVRVVITAPAGGGTSRPAVMW
IHSGGFVVGSPQLERFITGQIARELGATVVSPDYRLAPEHAVPAALDDCM
ATLRWMRTNADRLGIDADRIVVGGASAGGGLAATVAQRSLDEGCPLRGQA
LAYPMLDDRSVLRADHGGRGRFVWTPASNRFGWTAYLGHPPDTSEAPAYA
AAARRSELSGLAPAWIGVGQLDLLHDDCVSYAERLESSGVPCELITVPGM
YHAADAIAARALSMQTFCASMLNFMRARLS
119869144YP_939096.1 anthranilate synthase component I [Mycobacterium sp. KMS]MQTTAASAFDSSRERSSLATTTSREDFRALAAEHRVVPVVRKVLADSETP
LSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPSALTVRDGEAVWL
GVTPKDAPSGGDPLQALRSTLALLETAPLPGLPPLSSGLVGFFAYDMVRQ
LERLPSLAVDDLGLPDMLLLLATDIAAVDHHEGTITLIANAVNWNGTDEN
VDGAYDDAVARLDVMTKALGQSLPSSVATFARPAPTHRAQRTVEEYTAIV
EKLVGDIEAGEAFQVVPSQRFEMDTVADPLDVYRMLRVTNPSPYMYLLNV
PDETGGLDFSVVGSSPEALVTVADGKATTHPIAGTRWRGDTEEEDLLLEK
ELLADEKERAEHLMLVDLGRNDLGRVCEPGTVRVEDYSHIERYSHVMHLV
STVTGRLAEGMTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYG
GVLGYLDFAGNADFAIAIRTALMRDGVAYVQAGGGVVADSNGPYEFNEAT
NKAKAVLAAVAAAETLREP
119869142YP_939094.1 indole-3-glycerol-phosphate synthase [Mycobacterium sp. KMS]MSSATVLDSIIEGVRADVAAREAVVSLTEIKERAQRAKPPLDVMAALREP
GIGVIAEVKRASPSRGALAQIGDPADLARAYQDGGARVISVLTEQRRFNG
SLDDLDAVRAAVSIPVLRKDFIVRPYQIHEARAHGADMLLLIVAALEQPV
LESLLERTESLGMTALVEVHTEAEADRALQAGARVIGVNARNLKTLEVDR
DCFARIAPGLPSNVIRIAESGVRGPADLLAYAGAGADAVLVGEGLVTSRD
PRSAVADLVTAGTHPSCPKPSR
119869140YP_939092.1 tryptophan synthase subunit alpha [Mycobacterium sp. KMS]MSRLGGLFDACRAERRAALIGYLPTGFPDVPASISAMTALVESGCDIIEV
GIPYSDPGMDGPVIAAATEAALQGGVRVRDTLTAVEAISNAGGRAVVMTY
WNPVLRWGIDAFARDLAAAGGLGLITPDLIPEEADEWMAASDAHDLDRIF
LVAPASTPERLAKTVQATRGFVYAASTMGVTGARDAVSSAAPELVARVKE
VSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKDGVPAVRALTE
ELAEGVRQRVTA
119869138YP_939090.1 hypothetical protein Mkms_3106 [Mycobacterium sp. KMS]MFEGSQTAARSLVDRIAGSSRAANQATARMLVAVGDLYRLRLREVGDSAY
AACDTVDSVSAEVAAALTISTGLAASHLRHALAMEERLPQVGAAFVAGDL
DYFMFQTIVSRTKLVIDPEALRSVDGQVAAGVARWRGLTQKQLAARVDRI
VNRVDPDAVRRRKEAAARREVSVADRIDGLSEICATVFTTTAHAFDRRLS
ALAATVCANDPRTTEQRRADAIDAMVAGADRMACRCDSPDCAAGGLSASP
TVIHMVADRSTLDGVGDREGSLIGADGLIPAEVVAELAHTAKLRPLILPG
DAAPEPHYTPSRALAEYVRCRDLTCRFPGCDRPAMRTDVDHTVPYAGGGP
TQAANLKCLCRLHHLLKTFGGWKDQQLPDGTVIWTSPSGHTYITTPGSAL
LFPGLCAPTTPAAAAPTTGTVTGDRNAKMPQRRRTRAQNRAAAIAAERAH
NRAMRQVRRQELHAYLFGNEPDPSDEPPPF
119869136YP_939088.1 hypothetical protein Mkms_3104 [Mycobacterium sp. KMS]MEPDAPAPSRTPVYLTLGAGALFAGALTYIGVADPHRPGFLAPLCPFKAL
TGWACPACGGLRMTHDLLHGDLAAAVADNVFLLVGIPLLALWVFFRRRHH
QAVLPVTAIVVIAVATITWTVVRNLPGFPLVPTLLDG
119869134YP_939086.1 glutamate synthase (NADH) small subunit [Mycobacterium sp. KMS]MADPTGFLKVPKVEAAKRPVDERVGDWHEVYERQSLPERAEEVSQQARRC
MDCGIPFCHSGSAGCPLGNLIPEWNDLVRRGRWDAASERLHATNNFPEFT
GRLCPAPCEAACVLSISEDHTGGSVTIKRIENTIADQAWALGLVDPQPAS
IRTGRRVAVVGSGPAGLAAAQQLTRAGHDVTVFERDDRIGGLMRYGIPEY
KLEKRTLDQRLAQMRAEGTRFVTECEVGVDLTVEQLRERHDAVVLAVGAL
RARDNDVEGRHLDGVHLAMEHLVPANKECGGDGPSTLSARDKHVVIIGGG
DTGADCLGTAHRQGAASVTQLDYNPEPPETRDDTRTPWPMWPLVLRTRLS
PAHAEGGQRRYQVAVQRFLGDEQGRVRGMEIAEVKVERDAEGRRQIVPVG
ETLEIPCDMALLAIGFEGVEHMPLLDGLGLSLNNRGALPCGSDWQTDAPG
VFVCGDAHRGASLIVWAIAEGRSAAHAVDAYLMGESDLPAPVRPGALPLA
VV
119869132YP_939084.1 acyl-CoA thioesterase [Mycobacterium sp. KMS]MSAADFDELLALLDLRRVDDDTFAGSHPSKNPVRTFGGQMMAQAFVAASR
AVDHRISPSALSVHFVAGGDPARELEFRVTRLRDERRFANRRVDVCQGQD
LLATAMVSYMNGGRGLEHGVAAPDVPGPEELPKIGELLRGYEETVPHFVN
ALRPIEWRYTNDPAWVMRDKGQRLDHNRVWLKTEGAMPDDPVLHTAALVY
SSDTTVLDSIITTHGLSWGFDRIFAATMNHSVWFHRPVRFDEWVLYSTSS
PVAAESRGLGTGHFFDRSGALLATVASDAVVKYFPGR
119869130YP_939082.1 ABC transporter- transmembrane region- type 1 [Mycobacterium sp. KMS]MSTTDPLLRLTLDLLRPRLGRLLLAIGLGVLSLGSALALAAVAAWLITRA
WQMPPVLDLSVAAVAVRALGISRGLLGYCQRLAAHDTALRAAGNARTGLY
RTLAEAPQEVAMRLPGGQLVARIGASVDDLADVLVRAVLPIAVAAVLSVA
AVAVLAVISPASAVLLAACLIVAGVVAPALSARAVTAAESAAVTHHADRD
VAAMLALDHAAELRVSGRLDGVVAEAQRRQRDWGDASDRAAAPAALAAAV
PGAAMGVSVLGAAVAGIALAGSVAPTTVAILMLLPLSAFEATTALPAAAV
QLTRSRIAARRLLDLTEPAATDRRRPVVAPVPLRAGDRVAVTGPSGSGKT
TLLMAMAENADATDDFTGARGFFAEDAHLFSTTVRDNLLVARGDATDDEL
RSALTKVGLRRWLDGLPDGLSTVLVGGAAAVSAGQRRRLLLARALISPFP
VVLLDEPTEHLDADDAARLLTELLTPGSLFPADRTVVVATHQLPGDDVAC
LRLNLAASR
119869128YP_939080.1 cytochrome d ubiquinol oxidase subunit II [Mycobacterium sp. KMS]MGLQELWFILIAALFLGFLVLEGFDFGVGMLMAPMGIVGEGTPETRRRAV
LNTIGPVWDANEVWLITAGASMFAAFPVWYATVFSALYLPLLAILFGMIL
RIVGIEWRGKIDDPTWRRRADWGIALGSWLPAILWGVAFAVLVRGLPVDA
EQQVVGLTFGDVVNAYTLLGGLATCSLFLFYGSTFLALKTSGPVRDDAFR
FVRILSAPVIVLAGGFGLWTQLAYGKPWTWAALAAAVVALLVAVALMWTG
GREGWAFVSTVVVVAAVATLIFGTLYPYLLNSTLNPEWGVTIFNGSSTPY
TLKIMSWASLTLLPLVLIYQGWTYWVFRQRISADRIPESVGLSKQAP
119869126YP_939078.1 hypothetical protein Mkms_3094 [Mycobacterium sp. KMS]MQTTAAPSMLRHLWIYTVVSGLLAVLLGVLIFVRPGAAILVTAIFFGAYL
LVTGVAQLVLAFSVRSSLGGRVLLFIGGAAALVLAVLCFLNLSESIDLLA
IWIGVGFIFRGVATAMSAFSDHSLPGRIWEIILGVISVLAGIIMFVAPLE
GLVALTQVTGIILVVIGIVEVIAGIRIRREAPATGARTSDPVT
119869124YP_939076.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMTDADSSPRTDAAPIDAVPLRHPWRWVAAVVIVVLVGLFLYGAATNEAYS
WSTYRKYLFDQRISEAAWNTLQLTILSMVLALVLGVLLAVMRLSPNPVFK
SVAWVYLWIFRGTPVYVQLVFWGLFPTLYQNIRIGIPFGPSFFEMNLQGL
SISFTLAIIGLGLNEAAYMAEIIRAGISSVPEGQSEASTALGMSWTMTMR
RTVLPQAMRVIIPPTGNEIISMLKTTSLVTAVPYSMELYGRARDIAGVIF
QPIPLLMVAATWYLAITSVLMVGQYYLERYFSRGASRKLTTKQLEALAKA
QRVGEHP
119869122YP_939074.1 putative signal transduction histidine kinase [Mycobacterium sp. KMS]MPQRADPATPLWRAAQVFRLLSWVYALGFQLSVNDDLDRRAVAWALFAVL
TVFSVVWAVAYLRGFGRTPVWVAAEVGVVAALMLSTGLVADAQWVADNQS
WPTTLWATNAVISAAILRGPVAGMATGLVVMAAYAVLKGHVSINVFRNAT
IVIELAVGLVVGMAAQTARRAHAELERATRLAAALEERERLSRHVHDGAI
QVLALVARRGREIGGPTAQLAELAGEQERALRRLVSDADTADALGADADI
GAMLRRRASDRVSVSLPPEPVLLDADVAAELCAAAVNALDNVAAHAGPKA
RAFVLVEDLGDAVTVSVRDDGVGIPPGRLAEAAAEGRMGVAKSIVGRIDS
LGGTAELYTEPGRGTEWELTVPRRRQDGGRG
119869120YP_939072.1 hypothetical protein Mkms_3088 [Mycobacterium sp. KMS]MTESPHAVIARLSADFAAISRQLARVSSDLTELDRLLAGRSPAPQPAPQP
APQPAPQPFYLPPPPPPPRPVVPPPPPPAPRVPRERSEGWIGKVLAVAGV
AVTLIGVVLLLVLAAQAGILRPEIRVGAGALLAAALVAVGCRINSRDGGR
VGGIALAATGIAAAYFDVLAVTTIYEWIAAPVGLVLAAAVGGGGLTLARR
WDSEHLGLLVLVPLIALAPVLTEGVALLLVSFMLALSAATLPVQLGKDWL
WLHAARTAAVTLPLLAALAGAAFDGDHDLLLAGACGVAALLSLAGALLVL
PQTTRRAAMALLTAAGVAPVLCVSATADRVVASLMIAALAAALLAIVLSG
QWLPAVSGAVRQIWSALSAVSALIAVTVAFDGEVAAPLLLAMAAVVAVAG
RHDDVARWSALGFAVFGGGLYIAYAPPSMLVRAVAISGPDAVGVLVSSLL
SIAAAAAIARSWSGGTGLGDDTVRALWAGAAAVATYAVTVFSVTAGVMIG
GIGGGFFGGHVAATVCWIGAAAALFGYAARRPKAERTPFLGAGLALVSAA
MAKLFLFDLGTLDGIFRVTVFLVAGLILLGIGAGYARLLAVQDRRPV
119869118YP_939070.1 hypothetical protein Mkms_3086 [Mycobacterium sp. KMS]MTVTRDIAAPRQRVWDVIADGWTYSQWVVGNSRMRAVDPDWPASGSTIHH
SIGVWPVLLNDETVVEEATEPERLVLHAKGRPFGGARIILELSDIPDGCR
ISMQEFPVSGIGKLMPERISDAAVWPRNNETLRRLAFLAERRDDRDAG
119869116YP_939068.1 adenylate cyclase [Mycobacterium sp. KMS]MAVRDASRAVCVPDVALQSRMPARTRHYAEAVVRRLRVLTIATWIASAVS
ALFGLFQLVLGGSGWWIGLFNIVCATLFLGIPLLYRLGELIAPLTFFVLA
YLSVTFICYSIGTDSGLQFYYLVSASLVVLVLGIERIVMSALIVTVGLSA
CVAMELTVPQDRGLGPPWVLTVGFILSAVSATLMVFATVWYALRETDRAE
RAMEDEYQRSETLLSNILPASVAERLKDPAHDIIADRYDDASILFADIAG
YTKRASDTSPTDLVRFLDRLFTDLDALVDRHGLEKVKTSGDSYMVVSGVP
RPRADHVEALACLALDMAEAVADLKDPLGRAVPVRIGLASGPVVAGVVGA
RKFFYDVWGDAVNVAARMETTDEEGRIQVPHNVYERIKHSFVLEERGDVD
VKGKGLIHTWYLVGRRNDTAVRRAVELPTNGRAATSPAD
119869114YP_939066.1 hypothetical protein Mkms_3082 [Mycobacterium sp. KMS]MSVRLPARLRAINMRIPAGVGSPGSRGAGQIASKGIKMRKSARGVAASLP
LAVAAAAAWGLATAAPAVADPGDSADTSPAIADSTALPLMRAVDPVITRV
DGIWAEFVPPNANVPSPVAAFDQFVEPIIPTTAQIGDLGRFVEQFRPTAM
ITLPAG
119869112YP_939064.1 secreted metal-binding protein [Mycobacterium sp. KMS]MTRITKLLSSLVLCAAVLTACGGTNESPPDPALTTPNGQSSMTGMPAPES
PGAQPSESQIVISNMAYTVPTSVRPGQQLTIVNRDDPNHTVTADDNSLFD
TRISGGGGIKSFTAPTTPGTYPFHCKYHANMHGMLTVE
119869110YP_939062.1 phage major capsid protein- HK97 [Mycobacterium sp. KMS]MATETTAANPELLQEQVANILVQPLEAASVVLSSGVRIFDTSGPLRIPKL
TAGASVGFVAEGGLIPEADVDFGEISLMPSTLKSLKVLIRFTNELLRQSV
IGLDATLRQRLVTDVSNALDTALLTGAGTSNTITGLINQTGVQTGELDVA
DADSLLDAIALASAAEVTPNRWFINGADFIALRKLKEAPTGSSKYLLESD
VTAGPTYRLFGIPVTVTNKLAEGKAVLADTTQIAVARDLAPSVKLLDQRY
AEYDEQAIRVVTRYDLGLLHPEAVVVLTAAAP
119869108YP_939060.1 hypothetical protein Mkms_3076 [Mycobacterium sp. KMS]MTAVENYQTATAALSARTQTEVQAIYARLAAGEITQDTAAVLIAATVNRA
NAAATALADVWLVAQIEELSGIATTTVGLPAVDDSDRLIQAAMTILGDRD
SVDMRLDRLARAEPLESAHRATVDAIKEQPLVQGWTRAMDGDPCQLCRWW
WRQGRVWPKAHPFQRHKGCNCQPRIVLAENIQSTGYTRQLERNPA
119869106YP_939058.1 phage terminase [Mycobacterium sp. KMS]MRSGNKGKLLNQHVPLPFRPVSEVESERFVKFCEKFLRTPKGTGAREVFR
PREWQMDIVRDVLDSGARTVGLMMPRGQGKTTLSAAILLYIFFTRGEGAN
VVLFAVDERQASLAFRVAARMVQLSEDLSSRCYVYADKLVLPLTDSTYQV
MPASAAAAEGLDYVACLCDEAGVINRDVFEVAQLAQGKRERSVLIAIGTP
GPDPNDQVLADLRAYAAEHPDDKSLVWREFSAAGFEDHGADCPHCWELAN
PALDDFLHRDALHALLPPKTREATFRRARLCQFSTDTDGAFLPAGVWEGL
STSSPVPPGVDVVLALDGSYNGDTTALLVGTVSAEPHFDVVQVWDPKGDP
DYRVPVAEVEDVIRRSAKEWQVVEIIADPFRFTRTLQALEAERLPVVEFP
HSPSRLTAATTDLYKACVNGQLTHSGHPTLAAHVAAAVIREDPRGMRLDK
ASRSRHARKIDCAACLVMAHSRATWRATHKKRKRAVSFK
119869104YP_939056.1 hypothetical protein Mkms_3072 [Mycobacterium sp. KMS]MDKRRSRSRLCKHCRAARTGHSTRLCVLCRPSAPIAERILAAYQLKDTKD
TMNIRILRVIGRRSHSPSVVALADDHLVKWSPRDDWTCSCDEATFPDCPH
IPAVEEVLDPRVTEEPAL
119869102YP_939054.1 hypothetical protein Mkms_3070 [Mycobacterium sp. KMS]MTEPIEPTMLIRTIGGEPMLSADAMSLLFGVTPEAITEHSTDPITVFPAE
WIKAGRRRTREAQAATGRDDILAVLAYWARKDRDMVITVEEGDQ
119869100YP_939052.1 phage integrase family protein [Mycobacterium sp. KMS]MKRNRRASVEDRWTKTVHDSDGNAKTLPSANHGKGSRWRARYVDDQGREH
ARGFSRKVDAQAWLNGQVSDQVTGTWTDPKLSGVTFGVIAERWIQTKATR
APKTVAGYRSLLDVVVLPRWRDVPLRDVSFEDLQQWVSGLSVNGSTRFEG
RGLSPSRVIQAHQVVSQVLRYAVKAKHLPANPADGIELPRKPEVEQRYLT
HEQLQRLAVASGRFRTFVLVLGYCGLRFGEAAALRVGDVNLSSRRIRIRR
SVTAVTGQGLVEGPTKNHSARTVPVPKFLAPLIETEVGGRVDDELLFPSR
RGGYLTEGEVRWVFDAAAVAVGVTGLTPHELRHTCASLAIAAGANVKVLQ
TLLGHKTAMLTLDRYGHLFPDDLGRIADAFDDAAGFTADGLRTVAMLKAV
PEAGNST
119869098YP_939050.1 extracellular ligand-binding receptor [Mycobacterium sp. KMS]MRGRVARNAFAFGSAGLLALALGACSQSTPEEEAAQTNLKIVEQVQIDEN
GAEVKAAEGAAPADPAGDGKATCPPLSIAMAGALNGPDAALGINIKNGVQ
LAVDKHNAANPGCQVQLKTFDTEGDPQKASAIAPQIVDDQYTIGLVGPAF
SGETNATGDVFNQAGLVAATASATNVTLSEKGWRTFFRGLANDGVQGPSV
ANYLKNTLGHQKVCVVDDSTDYGLGLAQAVRETLGPVADPACNISVKKGD
KDFSAAVTQVKGASPQSVFFSGYYAEAAPFVQQLKDGGFEGTFVSADGTK
DPEFVKQAGEASKDALLSCPCGPATGGFADEYNQKFGQEPGTYSTEGYDL
GTILVKGIDSGAITRQALLDYVRNYNGQGVARNYQWTPQGELTTTLIWMY
KVQ
119869096YP_939048.1 inner-membrane translocator [Mycobacterium sp. KMS]MSGQRANVWQALVMRVRAVWAVLVERTRPVWERLRPVWRWVLRTRDRLRE
WWANLTRVQKWVVGAVVFLAIGLLPIFTPSWLDTPGISFGGTMAQFAMVA
IIAIGLNVVVGQAGLLDLGYVGFYAVGAYTVALLTSPSSPWNQAGPGGWF
TTDWAWLACVPLAMAVTALAGLILGTPTLRLRGDYLAIVTLGFGEIIRLL
ADNLSDVTNGPRGLNEVEYPRVGESERLPEGVFSRANSTGEANYGTWWFW
LGLLLIVGILLLVGNLERSRVGRAWVAVREDEDAAEVMGVNTFRFKLWAF
VIGAAIGGLSGALYAGQVQYVAPPTFNIINSMLFLCAVVLGGQGNKLGVI
FGAFIIVYLPNRLLGVHFLGINLGDLKYLFFGLALVVLMIFRPQGLFPAR
QQLLTYGRAARDMLRRAPGENEGAMR
119869094YP_939046.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTKSIEDRKVLLEVRDIVVHYGRIRALHGVSLKVHEGELVTLLGSNGAGK
TTMMRAISGLRPLTSGSVWFDGRDISRVKAHRRVTDGLIQAPEGRGVFPG
MTVTENLEMGCYARKFDTKAEHREQLDWVFETFPRLAERRSQVGGTLSGG
EQQMLAIGRALMARPKVLLLDEPSMGLAPMVISQIFKIIADINSQGTTVL
LVEQNAQQALSRSDRAYILETGEVTRTGNARELLHDDSVRAAYLGVA
119869092YP_939044.1 hypothetical protein Mkms_3060 [Mycobacterium sp. KMS]MSAASTQPAIDGWFATDGSGEAYLIGGKCHQCGTYVFPPRANNCPNPACD
GDDLAQVPLSRRGKLWSYTENRYAPPPPYPSPDPFEPFAVAAVELADEGL
IVLGKVVEGTLAADLKVGMEMELTTMPLYTDDDGVDRIVYAWRIAR
119869090YP_939042.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MELRQLEYFVAVAEEANFTRAARRVHVAQPAVSAQIARLERELGQPLLDR
SRRQVRLTGAGEAVLPHARAALAAVTDVRTAVDDLTDLVRGSVSIGTVTA
HNVDMPAMLAAFHRAHPAVEITLSTADSESLVDGVRTGRLDLAIASVGSG
EVPDGLAVEVTTDEAIDAAVHLADPWRRRRSVPLAALAERTLIALPVGTG
IRRRLEEAFTAAGLMPRIAFEASTPQELADLAARGLGVAVVPQSLARNRA
DLHAVSITPQLRGRLVLAWRASGPVSPAARVLIGMAREHLRVGGGA
119869088YP_939040.1 lysine exporter protein LysE/YggA [Mycobacterium sp. KMS]MVAHLLDVLPAFLLAAAILAILPGPATALFVHRAIRDGRAAGLAAVVGNE
IGIFGWTMAGGAGLSVLLLANRALSIALHIVGAAVLVWLGVSAWRSANRP
EMIAVPVEPRAGTPVAAFRAALLSIAANPKAAAFGIVVVPQFLPSSGPVL
LTLLVLALIQLVIDTAWCAGVVWGAARARELLSRAHIRRRIDRVMGAILV
ALGLGLAAEMR
119869086YP_939038.1 hypothetical protein Mkms_3054 [Mycobacterium sp. KMS]MNESDRRDRAHQAIDRLQQALLAHDMSAFADQWAPDGTMSFPFAPPGWPE
LAGRDAVREYLANYTDTVDVRAVTRMVRHDTADPDTVILEWAVSGVVVKT
GKPYDIDYVAVITVGPDGIVTYRDYWNPFAVASALGGIDELFTAFDAQAQ
R
119869084YP_939036.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTAGRPRDARVTEAILDAVFAELADKGFGGLTMDAVARRARVGKSALYRR
WPSKVEMTADLMRALSVTTDPAPDTGSLAGDVRALLENVLTWLTDDRVRR
VYPDLIAEAQRTPALGDALMAYVGLPRRARAFEVLDRAAERGELAVEADQ
EVIVDALAALVFWRLIALGKPVSARHLDRVAAAVCAMASGTGWR
119869082YP_939034.1 dephospho-CoA kinase/protein folding accessory domain-containing proteMLRIGLTGGIGAGKSTVSATFADCGGVVVDGDVIAREVVEPGTEGLAALV
EAFGDDILLPDGALNRPALAAKAFQDDEQRAKLNGIVHPLVGKRRQEIID
SVAEGTVVVEDIPLLVETGMAPFFPLVVVVWADEETRVTRLIERGLPEHD
ARARMKAQAADEQRRAIADVLLDNSGTREELVEKARQLWFDRILPLAENI
RAGEVVRVAPRLVPHNPAWAADAQRIVNRIKAAAGGKALRVDHVGSTSVD
GLDAKDVVDIQVTVASLEDADEIAGALAAVGYPRVPDVDSDVAHDDSGRW
GKRLHGAADPGRPANIHLRVDGWPNQRFALLFPAWLAAHPEVRDEYLQVK
RAALSAPDYAGAKEPWFAEVYPKASAWAEASDWRP
119869080YP_939032.1 hypothetical protein Mkms_3048 [Mycobacterium sp. KMS]MEPWGLYMARPTPGRAQFHYLESWLLPSLNLRASVFHFNPGFEREQDFYL
DIGSYTPGPHRWTAEDHYLDLVVRSGIGAELCDVDELLTAVRHNLITPEV
GERAVQTAVSTVDGLARHGYDLHRWLAGNGMVLTWQT
119869078YP_939030.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MTDTSRVSVGTWRDLLGPAHLGASTVLAGGVALYATNEFLTISLMPSAVA
DIGGQRFYAWVTTVYLVASVIAATTVHPLLMRLGPRQAYWSGLSVFAAGS
LGCALAPTMEWLLVGRTVQGGAGGLLAGLGYAVINTALPSRLWTRASALV
SAMWGVGTLVGPAAGGLFAQFGSWRWAFGVLVGLTVAMGVLVPFALPDRV
DGTDAERPRLRIPLWSLLLLGAAALVVSMAGIPHDVRATAGLLLAGVAIV
MVFVVVDRRATVAVLPPSAFGRGPLKWIYATLGLLMAATMVDMYVPLFGQ
RLAGMTPVVAGFFGAVLSVGWTGGEITSASLSRARVIVRTVACAPLVMAA
GLTLGMFALRDEMSPGWAALWAVGLLVTGTGIGIAWPHLSAWAMSRVDDP
AEGPAAAAAINTVQLICGAFGAGLAGVVVNLTDAGNATAARWLFAAFAGF
VAVGVLASTRSCRTR
119869076YP_939028.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSRAQLALNVDDLDEAVAFYSKLFDTAPAKVKPGYANFAVANPPLKLVLI
ENPGRGGTLNHLGVEVEDSRTVHAEIARLAGEGLFTEEEIGTTCCFATQD
KVWVTGPAGEKWEVYTVLSDSETFGSNSPALTEDGEVVVCCSNNAGTASS
TAS
119869074YP_939026.1 hypothetical protein Mkms_3042 [Mycobacterium sp. KMS]MTLCDDDVTGALGTGGRGGVAAAVPLSEPAGGIATDGGVAEAVPLSEPAG
GIPTDGGVAEAMPLVDPAGGIGPDGGAVLVKAEFAPGSVWGSRPGTVSSC
CMMFTHGTPGLTAPGSAIAVAGLNS
119869072YP_939024.1 gamma-aminobutyric acid A receptor- epsilon [Mycobacterium sp. KMS]MAASGCSPQSTHLPAVPEAPAACPRSPWPNHRREARAERAASRRGPSWQP
GHPGPGAPAGRRRQPVPPPRQAVQAVPAARQRQQAEPRQPAGPEVQAERP
RRRVALPQRAAQAEPEALQRRRAGPRRPAARAVQAGRPLRRSHHPVRRDQ
PQRRVQHLQRAQPHPPEDQPEPEAQHPQQAQPHPPEDQPEPEAQHPQQAQ
PHPPEDQPEPEAQHPQQAQPHPPEDQPEPEGSLRQQVPPPQQAAREAPEA
SPHQQAPPPQQAAREAPEASPHQQAPPPQQAAQEAPEASPHQQAPPPQQA
AQEEPEA
119869070YP_939022.1 acyl-CoA thioesterase [Mycobacterium sp. KMS]MMPRVVARTLSDILTTLDVEQIADDEFLATQMDNAAHHIVGGHIAAQALM
SASRTVSADRTPHSMHVYLLRAGDARRPVHFEITRLRDGGVLSSRRVLAR
QDDQVLLEALVSFTAPLDSFEHQQPIPDVPGPESLPSVQEQLSPYADEHD
GHWVRPQPLDLRYVDPPARLALDRPDPSPRIRLWWRPAEPMPDDPILNSC
LLTYVSGTALLETAMVVRRTTPLTSFSALIDHAVWFHRPADFSDWVLSDA
VAPSGVHGRALATATMYNRTVALVCTATQEIYFGRDRR
119869068YP_939020.1 UspA domain-containing protein [Mycobacterium sp. KMS]MSAYRTVVVGTDGSDSSLRAVDRAGQIAAGSGAKLIVTTAYFPQSEDQRA
ADVLKDEGYKMSGNAPIYAILREARDRAKAAGAENIEEKAVVGAPVDALV
ELAEEVKADLLVVGNVGLSTIAGRLLGSVPANVARRSKTDVLIVHTTP
119869066YP_939018.1 hypothetical protein Mkms_3034 [Mycobacterium sp. KMS]MAGRPVPVTPGPGQESVWDYPRPPRLEAFRGSITVDFGGRTIASTSTAWR
VLETSHPPTYYLSVDSFTPGALRPAAGSSWCEWKGRAAYYDVVFGERVAP
RAAWAYPHPTPGFKAIAGAVAVMAAPMDRCTVNGEQVVPQPGGFYGGWVT
SWIVGPFKGVPGSMGW
119869064YP_939016.1 excinuclease ABC subunit A [Mycobacterium sp. KMS]MSEAWERTELADRLIVKGAREHNLRSVDLDLPRDALIVFTGLSGSGKSSL
AFDTIFAEGQRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKST
NRNPRSTVGTITEVYDYLRLLYARAGTPHCPVCGERIARQTPQQIVDQVL
AMDEGLRFQVLAPVVRTRKGEFVDLFEKLNSQGYSRVRVDGVVYPLTEPP
KLKKQEKHDIEVVVDRLTVKATAKQRLTDSVETALTLADGIVVLEFVDRE
DDHPHREQRFSEKLACPNGHPLAVDDLEPRSFSFNSPYGACPECAGLGVR
KEVDPELVIPDPDLTLAEGAIAPWSMGQTAEYFTRMLTGLGESMGFDVDT
PWKKLPAKVRRAILEGCDEQVHVKYRNRYGRTRSYYADFEGVMAFLQRRM
EQTDSEQMKERYEGFMRDVPCPECDGTRLKPEILAVTLAAGDHGAKSIAE
VAELSIADCADFLNALTLGPREQAIAGQVLKEIQSRLGFLLDVGLDYLSL
SRAAATLSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIDT
LVRLRELGNTLIVVEHDLDTIAHADWVVDIGPAAGEHGGRIVHSGTYQDL
LRNPESLTGAYLSGRESIEVPAIRRPVDRKRQLTVIGAREHNLKDVDVAF
PLGVLTSVTGVSGSGKSTLVNDILASVLANKLNGARQVPGRHTRINGLDQ
LDKLVRVDQSPIGRTPRSNPATYTGVFDKIRSLFAATTEAKVRGYQPGRF
SFNVKGGRCEACSGDGTIKIEMNFLPDVYVPCEVCHGARYNRETLEVHYK
GKTIAEVLDLSIEDAAEFFEPISSIHRYLKTLVDVGLGYVRLGQPAPTLS
GGEAQRVKLAAELQKRSTGRTVYILDEPTTGLHFEDIRKLLKVINGLVDK
GNTVIVIEHNLDVIKTSDWIIDMGPEGGAGGGTVVAQGTPEDVAANTDSY
TGDFLAEMLDVPAPTRKRRKVSA
119869062YP_939014.1 hypothetical protein Mkms_3030 [Mycobacterium sp. KMS]MVGLHATDPATPYLTLWARVAGFDPTHLDTALYDCRTVAKHLAMRRTLWV
VGSGALPVIQSVASDRVAANERRRLIADAEKSGVADDGAEWLDTACAAVL
DHLRRNGPTSARGLRAALPELAGSHDPAPGKQWGGATPLAPRVLTVLGVR
GDIVRGPNDGGWTVSRPRWTLRDDWLGAGDDARAPADEAAIEAVGRWLRT
FGPATVTDVKWWFGHTLTWARRTLQALGAVDVDLHGTPGVALPDDLDVEP
EPEPWAALLPGLDVTTMGWFDREWYLGGHRAQVFDRNGNGGPTAWWHGRI
VGGWGQDADGRVVLRLLEDVGRDGEKALQQRADDLTAWLGGTRVSPRFPS
PLMKA
119869060YP_939012.1 putative esterase [Mycobacterium sp. KMS]MVVGPAHTLHHVSLMHGWLPVAVQVAAVVALVTAIGWRTRRWRLVWIPWA
VVVGGAFAVAAYEFVASEGWAEDPAPHSLWVWIGVFGIAVVVLVVGWRGA
GWWRRAVSVATVPMCLLSVLLVVNLWTGYFPTAQTAWDQLTFGPLPDQIT
LATLSSLQQRHAILDKGTVVPVQTGDAASGFRHRGELVYLPPAWYATNPP
PRLPAVLMIGGEFNTPADWVRAGNAVTTADAFAAAHHGYAPVLVFVDAGG
TFRNDTECVDGSRGNSARHLTEDVRPYVISHFGVSADRSGWGVVGWSMGG
TCAVDLSVMHPELFSTFEDIAGDLTPNTGTKEQTIARLYGGNTAAWAAYD
PTTVMTRHGRYRDVEGWFDSNTAGPEQTAAASTLCALGAANGIDCTVVVQ
PGMHDWPFAEQAFATALPWLAGRLRTPEVVATPLPGPQVATPVVQVAAK
119869058YP_939010.1 hypothetical protein Mkms_3026 [Mycobacterium sp. KMS]MTDQQAQPDPTAPPSARELADIPAVEVITRSAVMLMSAAAEKLGLSHEDP
DESPHRDLDEARRLITALAGLVTASAEYLGPHAGPVRDGLKTLQLAFREA
SAAPDEPGKGPGEKYTGPVW
119869056YP_939008.1 50S ribosomal protein L35 [Mycobacterium sp. KMS]MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLMEHKPTKRTRRLAGRTQV
SANDAPRINKMLNG
119869054YP_939006.1 tRNA/rRNA methyltransferase SpoU [Mycobacterium sp. KMS]MAAAVKLHRHVGRRRAARFLAEGPNLVEAALRRGVVSEVFATEDAAARFA
ALLAGADVHLVTERAAKALSDTVTPVGLVAVCRMPEVSLDEVLGASPRLV
AVAVETSEPGNAGTLIRLADAMGADAVILAGNSVDPYNGKCLRASAGSIF
GVSVVEAPDTAGLVAALHGAGLTVLATMLDGEVSLDDAELSGPTAWLFGA
EAHGLAPDVAALADARVTIPMAGSAESLNVAAAAAICLYQSARALRSS
119869052YP_939004.1 hypothetical protein Mkms_3020 [Mycobacterium sp. KMS]MTARTSPKTARTALHSSKAQPDPLGPDSLTWKYFGDLRTGMLGVWIGAIQ
NMYPELGAGVADHSVLLREPLQRVARSVYPIMGVVYDGDRAAQTGEQIKS
YHTTIKGTDPAGRRYHALNPDTFYWAHATFFMLIIKTAEYFCGGLTEAEK
RQLFDEHVQWYRMYGMSMRPVPESWEEFCEYWDRKCREELEINQATLDIF
SIRIPKPWFVLMPTPVWDQMFRPMVGAQRWIAAGLFDPAVRERAGMRWTP
GDEVLLRLFGKFVELAFVAVPDEIRLHPRALAAYRRAEGKLPSDAPLVEA
PAFMGPPADRRGLPMHYVPRRKTLLDKAGSLVHTTFSLAGLRLARGRHKA
A
119869050YP_939002.1 phenylalanyl-tRNA synthetase subunit alpha [Mycobacterium sp. KMS]MAGNLSEEALTEAVDAARLAFDSAADLDALARAKTEHLGDRSPIAVARQS
LGSLPKTERADAGKRVNVARSDAQRSYDERLAELRAERDAAVLVAERIDV
TLPSTRQPVGARHPITILAENIADTFVAMGWELAEGPEVETEQFNFDALN
FPPDHPARSEQDTFYVAPDGSRQVLRTHTSPVQIRALLERDLPVYIISIG
RTFRTDELDATHTPVFHQVEGLAVDRGLTMAHLRGTLDAFARAQFGPQGG
TRFRPHFFPFTEPSAEVDVWFPGKKGGPGWVEWGGCGMVNPNVLRACGID
PDEYSGFAFGMGLERTLQFRNGIPDMRDMVEGDVRFSLPFGVGA
119869048YP_939000.1 N-acetyl-gamma-glutamyl-phosphate reductase [Mycobacterium sp. KMS]MQTLCMTSVAVAGASGYAGGEILRLLLGHPAYSDGRLTIGALTAAGSAGT
MLGEHHPHLLPLAGRVLEATDAETLSGHDVVFLGLPHGHSAALAEQLGDD
TLIIDCGADFRLTDAAAWERFYGSAHAGSWPYGLPELPGAREKLTGAKRI
AVPGCYPTAALLALLPAVAEDLVEPAVTVVAVSGTSGAGRAAKPDLLGAE
VIGSARAYNVGGKHRHTPEIAQGLRAVTDKDVTVSFTPVLIPTSRGILAT
CTARTSASLSQLRAAYEKAYDAEPFIHLLPEGQLPKTGSVIGSNAAQIAV
ALDEDAQTFVAIAAIDNLTKGTGGAAVQSMNLALGWPETEGLSIVGVAP
119869046YP_938998.1 acetylglutamate kinase [Mycobacterium sp. KMS]MTAATHTKAQVLAAALPWLKQLHGKIVVVKYGGNAMTDDTLKAAFAADMV
FLRNCGVHPVVVHGGGLQISAMLKRLGIPGDFRGGFRVTTPEVLDVARMV
LFGQVGRELVGLINAHGPYAVGITGEDAHLFTAVRRDVVVDGVATDIGLV
GDVEHVNTEAVRDLIAAGRIPVVSTIAPDANGVVHNINADTAAAALAAAL
SAEKLLMLTDIEGLYTDWPDRNSLVSQINTDELTELLPTLEAGMVPKIEA
CLRAVTEGVPSAHVIDGRVEHCVLVELFTDEGTGTKVVNP
119869044YP_938996.1 ornithine carbamoyltransferase [Mycobacterium sp. KMS]MRHFLRDDDLTPAEQAEVLALAAELKKDPLLHRPLAGPRGVAVIFDKNST
RTRFSFEVGIAQLGGHAVVVDGRSTQLGREETLEDTGKVLSRYVDAIVWR
TFAQERLTSMAAGATVPVINALSDEFHPCQVLADLQTLIERRGALPGLRM
AYFGDGANNMAHSLMLGGATAGMHVTIAAPQGFEPHPMFVAAAQERAAQT
GASVTVTADPHRAADGADVLVTDTWTSMGQENDGLDRVRPFRPFQVNTGL
LDRAHAEAVVLHCLPAHRGHEITDEVIDGPHSAVWDEAENRLHAQKALLV
WLLERSG
119869042YP_938994.1 argininosuccinate synthase [Mycobacterium sp. KMS]MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMDVVRQR
ALDCGAVEAVVIDARDEFAEDYCLPAIQSNALYMDRYPLVSALSRPLIVK
HLVDAAREHKGGIVAHGCTGKGNDQVRFEVGFASLAPDLEVLAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWNAPTKD
VYDYTEDPTLNWSTPDEVIVGFDKGVPVSIDGRDVTVLQAIEELNRRAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RTTDQKWGELVYDGLWFSPLKTALESFVAKTQEHVSGEIRLVLHGGHIAV
NGRRSQESLYDFNLATYDEGDTFDQSSAKGFVHVHGLSSSISARRDLGIK
119869040YP_938992.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MTERVEFAVDGTSAVGYLSGVGRGGPRPCVVMCPGFGGTQDTPALVATAD
DFVRGGYAVLTFDYRNFGESGGTPRQLADIEGQLDDIAAAVARVRQIPGV
DADRIVLWGTSLGGAHAVVATSRDPRIAAAVAQIPFNGFPKKVEGRSRAA
TLRLLAAMTVDAVRGLLRLPPAYIKAVGGPGELAVMASVEALQTIRGLSS
RNWRNEVAPRALFDMMRYRPAESAGDVAVPVLVCAGDRDREVPPELTAAL
AHAIPQGELRTYPHPHFAFYQADIRRQVTADQLAFLHRVVGPGPR
119869038YP_938990.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MDLSAITRPVGRLVATAQNGLEVLRYGGLETGAVPSPFQIVQSVPMYRLR
RYFPPDVRPGAKPPGPPVLMVHPMMMSADMWDVTRDDGAVGILYRAGLDP
WVIDFGSPDKVEGGMQRNLADHVVALSEAIDTVKQVSGHDVHLAGYSQGG
MFCYQTAAYRQSRDLASIIAFGAPVDTLAALPMNLPAGVAVGAADFMADH
VFSRIDIPGWLARTGFQMLDPVKTAQARVEFLLQLHDREALLPREQQRRF
LSSEGWIAWSGPAISELLKQFIAHNRMMTGGFAIHGQLVTLSDITCPVLA
VVGEVDDIGQPPSVRGIKRAAPQADVYEYLIRAGHFGLVVGSKASHQTWP
TVADWVKWLEGDGDMPDGVEPMALQPKEHIESGVSLTSRVAHGATAATEM
AFGVARSAAGALVSANKSARTLAVETARTLPRLARLGQINDHTRISLGRI
MSEQARGAPDGEFLLYDGRVHTYEAVDRRINNVVRGLIDVGVRQGTRVGV
LMETRPSALVAIAALSRLGAVAVLMPPDVDLVAAARLGAVSEIIADPTHL
EAARTLPMRVLVLGGGDIRDLHVPDDADVVDMEQIDPDQVALPGWYRPNP
GLARDLAFIAFSTLGGELVARQITNYRWALSAFGTASAANLGRTDTVYCL
TPLHHQSGLLVSLGGAVVGGTRIALSRGLRPDRFVQEIRQYGVSVVSYTW
AMLREVIDDPSFRLSGGHPVRLFIGSGMPTGLWERVIDIFAPAHVVEFFA
TTDGQAVLANVSGAKIGSKGRALPGGGQVELAAYDADDDLILEDNRGFVR
RAAENEVGVLLARPRGPVDPTASVKRGVFAPADTWVSSEYLFRRDADGDY
WLVDNRGAVIHTVRGPVFAMPISDAVGRIGAVDVAVTYGIEARGRQLAVT
ALALCPGGSITTAELTEALAELPVGNPPDLVHVVPDIELSASYRPLISPL
RAAGVPRPSRRNSWYLDPDTNGYKRLTVAVRAEITGGQDRDASPEDSPLP
PRAQQ
119869036YP_938988.1 hypothetical protein Mkms_3004 [Mycobacterium sp. KMS]MLDEKLRAILVCPQDRGPLLLVGDEMLYNPRLRQGYRIDDGIPVLLVDEA
VAVTDDAEHQRLLDRAES
119869034YP_938986.1 multidrug ABC transporter inner membrane protein [Mycobacterium sp. KMMILLVPSVIITLIYFMFADVPHAPGTPSPFTNACLIMLGVFPLIVMFLIT
SITMQRERVSGTLERILATPLRRADLLAAYGTAFSLAAAAQASLACVVAF
WFLGFETAGSPLLVIGIAIVNAVLGVGLGLLCSAFARTEFQAVQFMPLVI
APQLLLCGIIVPRNALPEWLQWVSNVMPASYALEALREVSAHPEPTATAV
RDIAIVVAFAVVAMFLAAATLRRRTP
119869032YP_938984.1 3-methyladenine DNA glycosylase [Mycobacterium sp. KMS]MVSVELLRVDPLTAARRLLGAVLTCRGVSATVVEVEAYGGPPDGPWPDAA
AHSYRGPGPRNQVMFGPAGRLYTYRSHGIHVCANVACADDGVAAAVLLRA
AVIESGHDVVQRRRGEAVRESAFARGPGNLCSALGITMADNGIDVFAEDS
PVHLRLGEEQPCIAGPRVGVSKAADRPWRLWLAGRPEVSAYRRSPRAPAP
GGSD
119869030YP_938982.1 hypothetical protein Mkms_2998 [Mycobacterium sp. KMS]MYVSEDRQPGGRDERRPRRTSNASAPRRPRDQRAAPRNSGPNRARSTQPR
SGSDTPRFDGPVVPPEIEAKQLAPEIRGELTTLDRHTADAVARHLVAAGE
LLDEDPEAALAHARAARARSGRIAAVREAVGIAAYHCGDWAQALAELRAA
RRMGSKSPLLPLIADCERGVGRPERAIELARGPEADQLSGDDADELKIVV
AGARSDLGQLEQALAVLSTPPLDPSRRGPTAARLFYVYADTLLALGRTQD
ALQWFLNAAAADVEGVTDAEDRITELS
119869028YP_938980.1 hypothetical protein Mkms_2996 [Mycobacterium sp. KMS]MAVDMSNDPDQLRTRVAALLADLPEPDHAGDLADCDIDTVAARLEEAHDL
LVQALAAVEKG
119869026YP_938978.1 inorganic polyphosphate/ATP-NAD kinase [Mycobacterium sp. KMS]MTSERTILLVVHTGREDATDVARRVQKMLGDNDIGLRVLAAEAVDRGPVH
LSPDDMRAIGVDIDVVDADERAAEGCELVLVLGGDGTFLRAAELARNVEI
PVLGVNLGRIGFLAEAEAEAIDRVLEHVVRRDYRVEERMTLDVAVRAEGE
LLTRGWALNEASLEKGPRLGVLGVVVEIDGRPVSAFGCDGVLVSTPTGST
AYAFSAGGPVLWPDLEAILVVPNNAHALFARPMVTSPDATIAIEIEASGH
DALVFCDGRREMVVPAGGRLEVTRCGTPLKWVRLDSAPFTDRLVRKFRLP
VTGWRGQ
119869024YP_938976.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MHVTERPPDPRIDHSRRIICRAALEEFAASGYAGFRMDAVATRAGVGRST
VYRHWKNKGALIVDALRTLNTQPDPARDLPTVSARQQVELLLGHLATALS
DSAVSSVIPALIHAADHDPDLREHLHAYSAQRRRRLTDTIASAVSAGEVR
AVDPEVASVLLSGAVFYRKLMTADAPDPGDITALVDTVLAP
119869022YP_938974.1 hypothetical protein Mkms_2990 [Mycobacterium sp. KMS]MKMSALLTRNASSRPGITGTARVDRDIDRLLRRIGPGDIVVIDALDLDRI
TADALVEARVAGVVNASPSISGRYPNLGPEVLVANGIALIDETGPEVFKK
VKDGHRVRLHNGGVYSGDRRLIAGSERTDQEIHELMHEAKSGLVAHLEAF
AGNTIEFIRSESPLLIDGIGIPDIDVDLNRRHVVIVAEEPHAADDLKALK
PFIKEYQPVLVGVGTGADILRKAGYRPALIVGDPDRMSAEVLRSGAQVVL
PADADGHAAGLERIQDLGVGAMTFPAAGSAADLALLLCDHHGASLIVTVG
HTASIEEFFDRNRQRSNPSTFLTRLKVGEKLVDAKAVATLYRSRVSGGAI
ALLILAMLVAVIAALWVSRADAAVIEWIQQYWNQLVLWAQGLVS
119869020YP_938972.1 CTP synthetase [Mycobacterium sp. KMS]MPALRKHPQTATKHLFVTGGVVSSLGKGLTGSSLGQLLTARGLQVTMQKL
DPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRNLSGSANVT
TGQIYSSVIAKERRGEYLGDTVQVIPHITDEIKSRILAMAAPDEHGNRPD
VVITEVGGTVGDIESLPFLEAARQVRHEVGRENCFFLHCSLVPYMAPSGE
LKTKPTQHSVAALRSIGIQPDALILRCDRDVPEALKNKIALMCDVDIDGV
ISTPDAPSIYDIPKVLHREELDAYVVRRLNLPFRDVDWTQWNDLLKRVHE
PHETVRIALVGKYIDLSDAYLSVTEALRAGGFFHHAKVEMRWVASDDCEL
DSGAAAALADVDGVLIPGGFGIRGIEGKIGAISYARKRGLPVLGLCLGLQ
CIVIEAARSVGITGANSAEFDPATPDPVISTMADQRDAVAGAADLGGTMR
LGAYPAVLEEDSIVARAYQATEVSERHRHRYEVNNAYRDRIAESGLRFSG
TSPDGHLVEFVEYDAEQHPFLVGTQAHPELKSRPTRPHPLFAAFIGAALD
YKAAERLPVEIPEQRSNGVELLQEPASRG
119869018YP_938970.1 site-specific tyrosine recombinase XerD [Mycobacterium sp. KMS]MAPSAVRRSALDDQLQGYLDHLTIERGVAANTLSSYRRDLRRYSEHLTGR
GVEDLAKVTESDVSDFLVALRRGDPDTGAQALSAVSAARALIAVRGLHRF
ATAEGLTDVDVARAVKPPTPGRRLPKSLSIDEVLALLDGAGGDSEADGPL
TLRNRALLELLYSTGARISEAVGLDIDDVDTHARSVLLRGKGGKQRLVPI
GRPAVSALDAYLVRGRPDLARRGRGTPAIFLNARGGRLSRQSAWQVLQDA
AERAGITSAVSPHTLRHSFATHLLDGGADVRVVQELLGHASVTTTQIYTM
VTVHALREVWAGAHPRAR
119869016YP_938968.1 cytochrome P450 [Mycobacterium sp. KMS]MRTRFALSAPALVRAASAAADPVGFFTNRATDRRPFVLHFPGLGQVVFHG
TSPAARDILAAPSHACRAPLPNPIEPVVGPASLILLSGERHRRERALLTP
ALHGEQVKSYAEVISAATSEQIDGLRAGQWVDVYDLAVGITLDVAIRVVF
GVTDPARRTRYTHAVKDLLAANTAPLMLLPALRRDIAGIGPWAKLLRFRD
DLDRLLAEDMASRSRADVPGGDMLDLLLSATDDVGRGHTDAETLDQLRTL
LAAGHETTASSLTWALYHVHRDDDVRDRLHAELSTCATALELAALPYLGA
VIKETLRMHPPVPIVLRRLTEPLTVDGVIHPAGRVVGVALYALHFNPDIW
STPHRFDPDRFLSRRPTPFEYAPFGGGYRRCVGAAFATSELAVALGTILM
RLDLRMSQRDSAAPAPRSVARGIAVAPAGRIRLQVAGLRDGGGISTPSPR
119869014YP_938966.1 thiamine pyrophosphate binding domain-containing protein [MycobacteriuMNDSTVGTAFRSRVVDHIVNYLSAGGVRYLFGVDGANIEDVYDAAHLSGD
VTAVLAKHEFSAAAMADGYSRSGAGLGVVMATSGGGSLNLVPGLGESLAS
RVPVLALVGQPPLALDGRGSFQDTSGCNGSLDALALFSTVSVFCERITEP
ADILTALPRAVRAAFSGGPAVLLLPKDVQQAVLDVRHSTEGHERAPVTRQ
IGDPRPIARALQKVDGPVTIVVGSQVIHDDARAELEQLRAVLRARVAVTP
DAKDAAGTPGMGSSSLVGVTGVMGHPGTAEAIGDSALCLLVGSRLPVTAR
AGLDAVLAGTRTLSIGSAPPFVPCTHIHSDDLRASLPLLTRGLIGRRRPR
GLQVADTIPRKELSPPIFDGEGVRFRDAMKALDRLLPADVDIVVDAGNTG
ASAVHYLPVRRRGRFLVALGMGGMGYSFGAGIGVAFGRRRRTVVIAGDGS
FFMHGLELHTAIQHRLPVTFVLFNNNAHGMCVTREQLYYDGTYSYNRFAP
SHLGAGLNAMFPGMPSVDVADVTELAGAVTSALDAHGPSVVSVECSADEI
PPFAPFLAAGPPAAPDPATVHEEESIDVPASA
119869012YP_938964.1 3-oxoacyl-ACP synthase [Mycobacterium sp. KMS]MTVSLLDVSTYLPGEPISADYYADFASADDLREHLMFRAPKFRHHVAEDE
TAIDMVERATAGLVQRHGHDTIADIDILITHTQMPDMPFYGGGGGMAHRL
GMKPRTVIDLHNGGCAAFILGLQLARTLIQAGEGRTAMIALAQNAAGQIF
DQPLTRQKAQSCVPGDGAAVGLVALSDESPVLDVECRTYGEYAGDMTIAV
EPFRKWWQPGPGEGCIGFTEAKITKVLARGNRQVPEVSFAVCDRLGIKPK
ELDLFVTNQPNRVFLRNWRDALELPKERHRDTFDECGNLFAVGVPMNLDR
AISDGQLKRGDTVLMAAFAHAGDFAGAAAVRWGGRSA
119869010YP_938962.1 FAD dependent oxidoreductase [Mycobacterium sp. KMS]MRDHQVVVIGAGPSGVAAALSLRDRGLRPVLIDRADHVGSSWKARYDRLK
LNTGRRTSHMPNRPFPDGTGVFPTRDQVVAHLDRHAHEDGIELLLETTVT
RIDRHPAGWCLSTSTGDLTARQVVVATGYEHSPRIPEWPGMRSYPGEVSH
SAQYRNPRPYTGRRVLVVGAGSSAMEIVHDVATGGAESAWLAVRTVPHIM
IRSLPGGFPSDYLATPLFDAPTWLADAVSRVGQRIDVGDLAEYGLPTPSE
GVFARGKRLGRAPVIVDREVVRAIRARVFEVVPTIARFDGATVELVDGRR
LQPDAVICATGYTRGLDAMVGHLGVLDDKGLPRSCGVAAAAPGLRFVGFL
SRPGLISYVAKQSQHVARHIADELDRTPTLIR
119869008YP_938960.1 cobyrinic acid a-c-diamide synthase [Mycobacterium sp. KMS]MTDDAAGADAPVATGLTGRPYRSIPEPAPRSTHGPAKVIAMCNQKGGVGK
TTSTINLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELDHTVHNLLVE
PRVSIDDVLISTRVRNLDLVPSNIDLSAAEIQLVNEVGREQTLGRALHPV
LDRYDYVLIDCQPSLGLLTVNGLACSDGVIIPTECEYFSLRGLALLTDTV
DKVRDRLNPKLDISGILVTRYDPRTVNAREVMARVVERFGDLVFDTVITR
TVRFPETSVAGEPITTWAPKSAGAEAYRALAREVIDRFGA
119869006YP_938958.1 condensin subunit ScpB [Mycobacterium sp. KMS]MTDEITDGNLGIDVATAPELDDSELRNVLEALLLVVDTPATVDQLAEVTD
QPGYRIATMLTEMAADLAARDSGIDLREAGGGWRMYTRSRYAPYVERLLL
DGARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLI
TEAGTDPDSGAVTFATTGLFLERLGLSSLADLPDIAPLLPDVDVIDDLSE
SLADEPRFMKLGGVPAPTGQPMSYDVDKDDR
119869004YP_938956.1 cytidylate kinase [Mycobacterium sp. KMS]MTDGTVIAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIVTLAVLRAG
IDPSDGDAVAAAVDGVELAVGYDPDEDRSLLAGEDVSAEIRGDAVTRAVS
AVSAVPAVRARLVDLQRRLADGSGSVVVEGRDIGTVVLPAADVKIFLTAS
AEERARRRNVQNVANGLPDDYDSVLADVRRRDHLDSTRAVSPLRAADDAV
VVDTSDMNETEVVAHLQDLVHQRAGVRR
119869002YP_938954.1 hypothetical protein Mkms_2970 [Mycobacterium sp. KMS]MRSLLIIALVGVGAQLVDGALGMAFGVTASTLLVLSGVAAAQASAAVHLA
EVGTTLASGISHWRFKNIDWSIVAKLGVPGAVGAFLGATVLSALSTEDAA
PLMAAILVCIGAYVLLRFSLRTPPVIGGNGTKHGAKFLTPLGLFGGFIDA
SGGGGWGPITTSTLLSSGKTAPRTVIGSVSASEFLVAASASVGFLVGLRD
EFFDNLGVVAALAVGGVIAAPIAAWLVSRISPALLGTGVGGIIVLTNSQK
LVHYFGIEWPWSTLIYSVIAVAWAVFLVLAWRIMRAPAYVPQELEAEVAV
VERPAETADEVR
119869000YP_938952.1 deoxyribodipyrimidine photolyase-like protein [Mycobacterium sp. KMS]MRIRTRHAEDSVWRRTLEPTQRPPRSLEEVTGTRDDTPLWLFADQLGPAV
HGGEHAHRDVLLIEADHALRKRRYHRQKLHIVLSALRHADRDLGDRATLL
RSETYTDALERYGRPVLVHEPTSFAAERFVHRLKQRGLVADILPTPTFAL
PRKDFEQWAGNRTRFRMEDFYRDQRRRFDVLMSGADPVGNRWNYDEENRH
SPPKKRRTLDVPAPYKPREDDIDEEVRRDLDRMDLDTVGADGPRLFAVTP
AEAKRALTRFIEHRLPTFGDYEDAMMGEDWAMSHSLLSVPLNLGVLHPLD
AVYAAEQAYRDGTAPLAAVEGFIRQILGWREYMWHLYWHFGERYVDSNEL
DARTPLPDWWADLDADAVTAECLRHALMGLRDRGWTHHIQRLMILGSHAL
QRGYHPRELTEWYATAYVDGFRWVMPTNVVGMSQHADGGMLATKPYTSGG
AYINKMSDHCGDCAYDPRKRLGEDACPFTAGYWAFVHRHRDRLERNMRTR
RAVQGLNRLGDLEDVLAQEDKRTRF
119868998YP_938950.1 hypothetical protein Mkms_2966 [Mycobacterium sp. KMS]MPGDSLPDGDTHHRGAYYADPNDENAPFCYYRVSKAFAVIDGRRMPLWLE
VEQSDVVSTPAWGSRVELVKGVPRIVSLGFETRHGFALGREVKTSDFQVI
RPVIYDFYAVFCAEIGTDGEPIYRRNDDAANRRIADFLEQRRTGRQRLKT
PDYQRAAQIYRENFDGTPTQAVGEAFGVRLRQAGNIVAECRRRGFLPPTK
QGRKKA
119868996YP_938948.1 hypothetical protein Mkms_2964 [Mycobacterium sp. KMS]MRLENEVGPDVTTAEANRKPEPHHAAGTADYIAGLRRRRAATYRLPVLAC
GCADPWTCRHHTKHGSVTDQFVDGYRDAAEHLLASGLTPPPNLPAMRAMW
KRGGHDQRLAVRIAELWQVAAA
119868994YP_938946.1 hypothetical protein Mkms_2962 [Mycobacterium sp. KMS]MTDVTDAETVSLLEGMVNGEWLDAQVFPPLEWAVEGIVPEGFGLLVAPPK
AGKSWMVAGIGLACAIGGYAFGKIPVKQRPVLYLALEDGHRRLQDRFRTI
TEGDPIPAGINVMVTARTYEIPGIIAEYLALHHGKQPLIILDTLGKVKPP
KRPGEESYSADYAIGGRLKELIDSEPGATLLCVHHTRKAESADFVDAVSG
TQGIAGSADFVLVLTRKRQDDKAVLAVTGRDVPENEYALTTAAGRWVLDG
MDLMDAAAAVAKRKDSENLGDRSIDALMFVNSRPLGTRQADLATHLGIDN
DTAGRYLRRLHDAGRIGKRTRGIYTPLSEVSEVSVLDVPARQPDQEEHPQ
TDTTDTTDTPFDGCES
119868992YP_938944.1 hypothetical protein Mkms_2960 [Mycobacterium sp. KMS]MNINAGDFRRAAALITQHTSRDDTGCNAVLQEAAEAGRITELIVGILDVY
ETLTPILHSPLGIAALRNIIADLARREENEK
119868990YP_938942.1 phage terminase [Mycobacterium sp. KMS]MRAGPKASVDPSPLPWRPQSTGSARFAKFCEKFIRVPKGTGARTPLRLRE
WQQELAGSVLDADPRPRTAGWMLPRGQGKSTLLAAYGLYDFFTGDEGAVV
CVVAVDERQAGIIFGIARRMVELSDELASRCQVFKERLYIPERDAHFHCL
PAEPKRLEGLDYTTALLDEAGVASRDSYEVLTLAQGKRAQSTLIAIGTPG
PDPNNQVLADLRNYAADHPEDASLVWREFSAAGFEDHPVDCTHCWELANP
ALDDFLHRDALYALLPPKTREATFRRARLCQFASDTDGAFLPQGVWDGLS
TGRPIPDGTEVVVALDGSFSDDTTALLAGTVSAEPHFDTIHVWQRTNGDD
SYRVPVAEVEDEIRAACRRWRVAEIIADPFRWTRTLQALEAEKLPVVEFP
HSPARLTAATGDLYSAAVNGKLTHSGDRRLAEHVAAAVITEDARGIRLAK
ASRSRAARKIDLAACLVMAHSRATWRATHKKRKRAVSFR
119868988YP_938940.1 hypothetical protein Mkms_2956 [Mycobacterium sp. KMS]MTAAVDLYQLDTGRLSEGTERAVLGVYAQWVTGELDYDTAAVVIAGIINR
ANAAATAVADSWLAVQIEQQARLPVPTVGIVPADDSDRLLRAATTVLDDR
ETGEMRLARLGRAEPLEAAHQATTEAIRHQPLVEGWTRAMDGDPCQLCRW
WWRQGRTWPKAHPFQRHKGCNCQPRIVVAENIQSTGYTRQLERNRA
119868986YP_938938.1 phage major capsid protein- HK97 [Mycobacterium sp. KMS]MATETTAANPELLQEQVANILVQPLEAASVVLSSGVRIFDTSGPLRIPKL
TAGASVGFVAEGGLIPEADVDFGEISLMPSTLKSLKVLIRFTNELLRQSV
IGLDATLRQRLVTDVSNALDDALLTGAGTSNTITGLINQTGVQTGTLDVA
DADSLLDAIALASAAEVTPNRWFLNGADFIALRKLKETTGSAKYLIESDV
TAGPTYRLFGIPVTVTNKLAEGKAVLADTTQIAVARDLAPSVKLLDQRYA
EYDEQAIRVVTRYDLGLLHPEAVVVLTAAAP
119868984YP_938936.1 transglycosylase domain-containing protein [Mycobacterium sp. KMS]MVKGLGVALTAVALSTTSIAVATPKANASTVNWDAIAQCESSGNWAINTG
NGFYGGLQFLPATWREHGGVGSPDKAPREYQIAIAERVLRTQGIGAWPVC
GAYALSPRSSAPPGTGSACRVMSGLVLGVVNLNRMCAALTSQARAVASAL
AR
119868982YP_938934.1 integral membrane sensor signal transduction histidine kinase [MycobacMTAGIGARLFAAQAIVLTVGAATTSMAAAIVGPPLFRDHLHQAGVPPNSL
EEMHAEEAYGYATAISITGALAVSVLAALAVSWYLSRRLQRSITEVASAA
TAVADGRYDIRVSPPHLGEDFDALAHAFNQMASQLQSVEVTRRRLFSDLA
HEIRTPLAVLEAYFEAIEDGVRSLTPETAAMLRDQTGRLVRFAGDLGALA
RAEESSASMELEPIDIHSLVQRCAAAAQSGYSRKGVELCTAVDVDLPPLW
GDEQRMSQVLANLLDNALRHTPSGGRVEISARRDGHRVLIRVSDNGEGIA
AEHLPHVFERFYRADSARARQNGGAGIGLAIAKAVVEAHGGTIAADSAGA
GRGTVFTVTVPVRASAPDLARRPPPTPVA
119868980YP_938932.1 hypothetical protein Mkms_2948 [Mycobacterium sp. KMS]MRSRSTITIHRIGAESPCRTASDSRVLRMGWTISANGMGRWVALATSLAV
SAAMVYAQDTEDAPRVAEAPLAAAAAPTSVPAAPPSVARADEAELLAASA
PVAARDFKFELPAGVAPEGGLQVKTIWAARAIGVMFPEIKTIGGYRQDPL
KWHPNGLAIDVMIPNHGSDEGIELGNQIAGLALANARRWGVLHVIWRQGF
YPGIGAPSWTADYGNETANHYDHVHIATNGGGFPTGRETYYLESMSPVPR
P
119868978YP_938930.1 type 12 methyltransferase [Mycobacterium sp. KMS]MSDRAHWDRRYDRLGPSAAGSIGLPDIFTTHSDAFPTAGSALDVACGQGR
VSIWLAERGLDVRGLDISSVAVEQAAATARERGVADRCRFDVVDLDCGLP
PGPPVDVVVCHLFRDERLDRAMVARLRPGGLLAVAALSEVGAAPGRYRVA
PGALTHAFADLQIVAAGERSGTAWLLGRRTASC
119868976YP_938928.1 glutamine cyclotransferase [Mycobacterium sp. KMS]MSLMSALRVLTGLGVTAVMLAAGCADAHDAGAAPIVPSQFRITVLDEVPH
DTSAFTQGLEFDGAALFETTGLAGQSQLRELDPGAGAVRRSTPLPGGYFG
EGMTAVGNRIWQVTYRDGVAIEWDKTAFVPIREIPIEGEGWGVCFDGGRI
VRSDGTDRLRFVAPADFTEIGSVTVTRPGGEAVAGLNELECVDGQVWANV
WPTDEIIRIDPGAGTVNASVDAAPLRRGEPDVNVLNGIAYAGDGQYLITG
KNWSTMYRVRFDAM
119868974YP_938926.1 anti-sigma-factor antagonist [Mycobacterium sp. KMS]MIDVGTVRVFRPDPSAAESPQQRGRAVFSIRSLPPTLSVVTAVGEIDATN
GRDLGRYVECHTASATQLIVDLTGVTFFGSQGFSALHYMSVSCTRIDVDW
VIVPGGEVRRLLRICDPQGELPLADSVDAACARLDRVTRRRQPFSWAG
119868972YP_938924.1 SOUL heme-binding protein [Mycobacterium sp. KMS]MLDSVFRIAGQVAEGAGAVVGIRHGTEEPPHTTQPLSASVEIRRYDQRIA
AETTVSADEEASRNEGFRRLARYIFGGNHGGTEIAMTAPVTQQRGTKIAM
TAPVAQSSDTAGEWTIRFFMPSKWTMDTLPTPNDDRVRLTVVPAETVAVL
TFTGDRGPRTVAERTEELQNTLRDSAFEPIGEPAAWFYDPPWTLPFRRRN
EIAVAVRQRSGG
119868970YP_938922.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MLLHDLVTSAAAADPDRPAVIGPDGAATSFAQFDRQIRSVAGWVATHSEP
GDRIAVIADNSTAYARLYYAVPRAGRVLTLVNQRLRADEQYTQLALTEPT
VVIGDQTYVDALTELRSQVPSVRHVIAAGSPELTAEPGEPGVDVACAPED
PAWLLFTSGSTGTPKGVVHSHRSILAAVQGSVIGRAVPRGGVYLLPFPMC
HIAGYNMLVQHAVAATVVLAAQFRADAIARTINDCAVTACSLAPTMLHAL
LDHLRATGATLPTLRSIAYGSAAIPAELLRTALERLDVDFHQGYGMTETG
GNVTFLGPGDHRRGLAGHPAILAGAGRPHPHVEVRIGDDGEILVRGPQVA
TSYWRGRSAVDGEGWLATGDIGRIDADGNLYVVDRRRDIVVTGGENVSSR
EVEDVLTDHPEVESAAVVGVPDEYWGEAVCAVVVAAEGRHPTESALIEHV
RARLTGFKRPRHVLFVDALPLTTNGKIDKNRVRRLARSALT
119868968YP_938920.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MDVRSRNNVRIVGAEHGPTIVLAHGFGCDQNLWRLVTARLAPEFRVVLFD
HVGSGASDPAAWDADRYSSLDGYAEDILELLRELDLRDVVFVGHSVAAMM
GVLAVRADPGRFAKLVLLTPSPCYVDDGDYRGGFTRADIDELLESLESNY
LGWSRAMAPTIMGAPEQPELSEELAESFCRTDPTRARVFARATFLSDNRD
DLDGVGVPTLIIECAHDAIAPRGVGEFVHGRIAGSTLVTLDTSGHCPHLS
APAETAEAIAGFARST
119868966YP_938918.1 hypothetical protein Mkms_2934 [Mycobacterium sp. KMS]MFRELFVAVSIAGAAVGLAPGALADPSNDYHDDPGRYPTDVPGMSYEAKL
GAPCYSWERNVFGRGRGGEPLQCKWIPNQWPPVYTGFWTATYALYGVQDI
GAPCPGPQSTAQAPDGRPLLCVGARGWQPTVLTGSGLHPA
119868964YP_938916.1 nuclear transport factor 2 [Mycobacterium sp. KMS]MTFTQADLLSAVERSPRLAAAHDRAGWVSLYTPDAVIEDPVGSRAHRGTD
RIDRFYATFIAPRDIAFHVRSDVVVDQTVVRDVDLEVRMSPRVTMTIPAV
LQYDLAPVGGRPKISRLQAFWELPGMVGQFLRSGPRAVPVGGALGVALLR
NQGPAGAAGFLAGLRSVGATGKRGVERFLRDAAGGDEVAVRRRLGRGTRV
TVGEHRPLSGTDLLALLAGGRCDRLIAAGRHVVAAVRTPDGEPAVLIADV
GTRPFTIARLRVFAGPGLTGVDGG
119868962YP_938914.1 hypothetical protein Mkms_2930 [Mycobacterium sp. KMS]MTTMSDRQHMTYEDFGRRFFEFAVTEERVGAAIGDIAGDAFEMGPMGQGP
GGIAKVTARVKIQQPRVTRHVGEMITFAIRIPLEIDMVVDLRIDKPKFVV
YGEISLRASALAAHPLLLILDVKKPRPSDISIHVTSKSLRAEVVRIIGGI
DSEIKRFIAAHVAGEIESPESKQAQVINVAEMIDESWTGI
119868960YP_938912.1 GDSL family lipase [Mycobacterium sp. KMS]MSGYTRYVAIGDSQTEGLWDRDGDGGLIGFADRLAAHLDTLYPGIAYANL
AVRGRRIAHVLDDQLPLALSMRPDLITVCIGMNDVTRPGRSFGAALADLD
ALYAKLAASGATVVTTMFPDITAILPVGRLIAGRVRRVNGVIETAAQRYG
FRLVDLYHAESMREHDTWSADRVHGSAKGHRLFAAAAAEALGLPGSDHSW
ASAGACAEQPSFRTRAASQVSWTRNMFVPHLWGNLRGVSSGDGLAPRRPV
LAPVIR
119868958YP_938910.1 PfpI family intracellular peptidase [Mycobacterium sp. KMS]MPKELQGRKIAILAADGVEKVELEQPRAAVETAGGQVELLSLEPGEIEAR
NHDLEPAGSFSVDRPVGEARVEEFDALVLPGGTVNPDKLRLDESAVAFVR
DFVRSGKPVAAICHGPWTLVEADVVRDRTLTSYPSIRTDLRNAGATVVDQ
QVCIDGNLITSRSPKDLPAFCQAITDQFANTPAHT
119868956YP_938908.1 hypothetical protein Mkms_2924 [Mycobacterium sp. KMS]MATYRVLDPKGEVVSTTDIESADDAHAWFVEQVPGNELGYRMEVKVEEDR
WDFVDDSEGDRSY
119868954YP_938906.1 hypothetical protein Mkms_2922 [Mycobacterium sp. KMS]MTLAVADRLALADLVHLYAAAVDDRRFDDVAQLFTETAELRLPDPPRVLT
PVRHLHGRDGVRAAMSALSDVERTEHAIVGEVYAETADRAYALGRITCIA
HHWSVADREVTDVVWHLRYDDEYQHTPAGWRIHGRALTVNAIDVGPTRVL
RRQQPSTDRVRDADPRAASPGPPPPETMPPGRSRGTP
119868952YP_938904.1 hypothetical protein Mkms_2920 [Mycobacterium sp. KMS]MATLHVGGQQLPGTFTNRFLAHLQAATAARFASGKGFFLTTSQVGEEGAE
QTVSHWIHPGLPVSFGYDVTDGSGGRVAPEALQDNEIEEITAAMDTPYGV
RGSDGLWWPFTEHA
119868950YP_938902.1 hypothetical protein Mkms_2918 [Mycobacterium sp. KMS]MLRPRRFDVEVDPGPVQIQARRVAFDVTGSDLHWIPGHPVGSNVVSLLNI
VLPAAERWFVDTFNEALPLVRDPRLAEDMRGFIGQEATHADVHEQVLHDY
LETHGIDPKPVLDQIEYVFGRMLAPGTSTDPKRRLNHLCDRLWLIAAIEH
YTAVMGDFALNCAWDDFGADPTMVDLFRWHGSEEVEHRSVAHDVAVYFHD
SYLDRIRAMSIAVVMIFVFFQRAAWYLVKRDPNTDIGWWRFNRLRMRDSK
LGLLPRYRKLFGANTLMYFRPGFSPEEMGSTAQAVAYLASSPAARAAHL
119868948YP_938900.1 cyclase/dehydrase [Mycobacterium sp. KMS]MRLERRCVLDADRETVWKVVSNPDCYPEFMASLERWETVTEGPPDVGSRF
TAHWKVGSVPIGGIVELVEFDPQRDLAWIGITGVTLRGRFRLRDNGDGRA
KVTFRLSYEAPGGLLGLIADRVAARQVGRTMSETLKRLKTMVEG
119868946YP_938898.1 hypothetical protein Mkms_2914 [Mycobacterium sp. KMS]MSRDVTPEGSSPVSHSSPLRYVRTAPQPTEAMLKKLVTLGAGILAAGAAA
VIGTGVAASQPGGSYNVVGEPYNKALQILRAQGVKATFGGSFGSVLPQAS
CLVDTQKLTSAGKMLLMLDCSQAAADRLKASQPAGGPRVGSNGITTVTPT
PIVPIQGAPGAGTPPPVG
119868944YP_938896.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MASGVLDVTAVRARRARVAVAAQFLTNGALFANLLPRFPEIKTDLALSNA
VYGLTIAAFSAGAFVAGLTAAALIRRFSSARVAVGGTIAIAVFVFAAGLA
PSAVLVACALFLAGASDAVTDVAQNAHALRVQRIYGRSIINSVHAVWAGG
AVLGGLMGAAAIALHIPRPVHLGVAAVVFTGVVLVAYRFMLPGADQDDHP
ASGYAEGERAGRRVYLVLVALAVIAIAGAMVEDAGSSWATLYLRDSVGAP
GAIAAFGYIALAAFMFVGRLIGDRLVDRFGETAVARAGGALAAAGMGVAL
AFPSVPATIAGFAAAGLGVATAIPAAMHGADQLPGLRPGTGLTIVTWLLR
IGFLASPPLVGLIADWTSLRIGLLTVPVAGLVIMVLAGALNVRGRPVRS
119868942YP_938894.1 small multidrug resistance protein [Mycobacterium sp. KMS]MRRSVLLIAAIATEVTATLALRASHDDSWWLIVVVAGYLGAFLLLTAVLR
AGMAVGVAYGIWGASGTAATAILAAGIFGDPFTWPIAAGIALIVGGVLLV
EFGSRPRPEPGGAR
119868940YP_938892.1 sterol desaturase-like protein [Mycobacterium sp. KMS]MGATGEAVSAFLQFLPPQLREPVLFAVPFFLLLLILEWTAARKLEHLESG
DQPPAGAYVARDAWTSLAMGLVSVGTMAVWKFGALIGYAALYAYVAPWQL
PSNQWYTWVIAIVGVDLLFYSYHRIAHRVRLVWATHQAHHSSEYYNFATA
LRQKWNNSGEIVMWLPLPLLGVPPWMVFAGFSISLIYQFWVHTERIGTMW
RPIEFVFNTPSHHRVHHGRDPEYLDKNYGGILIIWDRLFGTFQPELFRPH
YGLTKPVNTYNIWRLQTHEYAAIARDVRGARRWRDRLGYAFGPPGWKPVE
NRHVAEKAAVRA
119868938YP_938890.1 sodium/hydrogen exchanger [Mycobacterium sp. KMS]MEVSATLLLELGVILAALTVLGTIARRFALSPIPLYLLAGLAVGEGGLAP
VPAAGDFVETGATIGVVLLLLTLGLEFSIGEFATSLRRHLPSAGVDLVLN
AAPGAIAGWLIGLDGVGILALAGVTWISSSGVIARLLSDLRRLGNRETPA
VLSILVLEDFAMAAYLPLLAVLATGGTFLQALLGMAIAVSALGFAFVVSY
RWGHHVGRLVVHPDNEQLLLRILGLTLIVAALAEFIHASAAVGAFLVGLT
LTGEAAERARTVLTPLRDLFAAIFFLAIGVSVDPAALIPMLPVATALAVA
TAATKVLTGQFAARRDGVGRPGQLRAGTALIARGEFSLVIIGLVGASVEA
LEAVATPYVFILAMVGPVLARFTGGRAPARRRPG
119868936YP_938888.1 hypothetical protein Mkms_2904 [Mycobacterium sp. KMS]MRRHLLNVVAAVAAPLAALLAPLAPAGADPGVLVSPGMEIRQDTNLCTLG
FVDVQQRVAYTAGHCRGSGPVSDRGGAFIGVQSAFEDNTPDGTTVDVNHQ
ISDWQTISLAPEVQVNNLLPSGRALVVDPSVVPTKGMPVCHFGVVTGESC
GTIEAVNNGWFTMANGVVSKKGDSGGPVYFNAPDGRAVIIGMFNSTWGQF
PAAVSWQAATQRAGQGVVITAGAA
119868934YP_938886.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MEARIIEVGRRHLITDGPAGLSLRAIARDLGVVSSAVYRYVSSRDELLTL
LLVDAYSELAARVDDAATAGEPDWRTQILRMAHAAREWAVSQPARWALLY
GSPVPGYRAPAERTTGPGTRVVAALFRAVADGIAAGDIFELKDDVPESLS
TDFEGLRQEFDFSGGDGAVAKTLTLWAGLIGAISLEVFGQHGADTFTDPK
TVFDLHIRALVELLGSP
119868932YP_938884.1 hypothetical protein Mkms_2900 [Mycobacterium sp. KMS]MSTEIPETVEAGSVHEWSDEVDVVVVGFGIAGGCAAVSAAAAGARVLVLE
KAAAAGGTTSMAGGHFYLGGGTAVQQATGHDDTAEEMYKYLVAMSREPEH
DKIRAYCEGSVGHFEWLENLGFQFERSYYPGKVVVPPGTEGLSYTGNEKV
WPFCEQAKPAPRGHSVPVPGELGGAAMVIDLLLKRAADLGVQIRYETGVT
NLVVGDGGVVGVKWKHFAETGAIKAKAVIIAAGGFAMNPEMVAEYTPALG
HKRKTKHHGEVEPYILGNTNDDGLGIRMGISAGGVAKNLDQLFITAAAYP
PEILLTGVIVNKDGQRFVAEDSYHSRTSAFVLEQPDQTAYLIVDEAHMQM
PEMPLIKFIDGWETVAEMEAALGIPEGKLAATLERYNEHAARGEDPDFHK
QPDYLAAQDKGPWAAFDLSLGRAMYSGFTMGGLAVSIDGEVLREDGSPIP
GLYAAGACASNIAQDGKGYASGTQLGEGSFFGRRAGTHAAQRG
119868930YP_938882.1 ABC transporter [Mycobacterium sp. KMS]MEMFAPSLDWSSELWTSLLWIGRAWVVAAVITLVILVLIVRFTTWGSQFW
RVTRGYFTGPESVLVWAWLAGILLLVIVSVRLSVLFSFQGNDMMTSFQVI
ASGVGAGDDAVKESGRDGFWMSMAVFTILAVSNVAIIMFDLFVTQRFMLR
WRTWLTDRLTGDWLDGKAYYRARFIDDTIDNPDQRIQTDIDIFTAGVGSL
PNTPNNTSTSTLLFGAVSSIASMYAFTSILWNLSGPVTLPFVGVELPKAM
FWIGIVYILFATVVAFWIGRPIITLSFNNEKFNAVFRYALVRLRDASEAV
AFYRGEIAERTGLRRRFTPIVENYKKYVNRMAGFLGWNLSITQAQELIPY
LVQFPRFYNGELTLGQLTQTASAFREILSGLSFFRNAYDQFAGYRAAIIR
LHGLVVADEQARALPSIDVQSSQDGRVELDDIEVRTPAGKQLIEPLDLTL
QPGDALVITGQSGTGKTTLLRSLGSLWPYTSGTLKYPDAENATMFLSQMP
YVPLGDLRAVVSYPQSEGAVDDAALREVLNRVALPHLADRLDEEKDWAKV
LSPGEQQRVAFARILLTKPKAVFLDESTSALDEGLELMLYQLVRSELPET
ILVSVSHRSTVEQHHTRQLQLLGDGQWQLGEVAARS
119868928YP_938880.1 pentachlorophenol monooxygenase [Mycobacterium sp. KMS]MPDTLNTEVLIAGAGPVGLTAAIELTRRGVDCFVVDPLPDPPQYAKAVGV
QPRTLEVFENMGVLRAVLDAGIEMNGQCVYVNGEPVTRLDLSLPANVPFR
FLCIPQYETERILREEFAARGGSIQRGWGLTGFAQDDDGVTATVSTDSED
RTVRARYLVGADGAHSVVRKSLGLTFDGAAFEEQYMLGDVEVDWTQPRGY
AIRSMHQTDGVTDDLLVCIPLPGRNRYRMSMLVPDHLSTRSHGEVEHGFE
AGRAPELHHIQAVLDRLSPQPTTARNLRWSSVFRISHRIVDSYGSGRVFV
AGDAAHIHPPTGAQGMNTGIQDAHNLAWKLALAVSGNAAPTLLDTYDIER
RPVGEEVVGRTVRSARQGIGADSDDLDHVMLREAQLLIDYADSPIVASAG
PVSEPLPGGRAPDATGLSRAAVSGPLRLYSLLGRNHTALFYADGDATVTD
VARFEAAAEAAATVARGALDVYLVAAPTAEVDSTVLPLLRDNDGDFARSY
STAGTSVFVIRPDGYLGFAAHRLDTEVFEGFLHNTFG
119868926YP_938878.1 preprotein translocase subunit SecA [Mycobacterium sp. KMS]MPKTTTRTPGRLSGKFWKLLGAATEKNQGRSLAQVKASADYETKAADLDD
EQLRKAAELLRLEDLSESADIPQFLAIAREAAERSTSLRPFDVQLLGALR
MLAGDVVEMATGEGKTLSGAIAAAGYALGGRSVHVITINDYLARRDAEWM
GPLIEALGLTVGWITAESTAEERRRAYTCDVTYASVNEIGFDVLRDQLVT
DVADLVSPNPDVALIDEADSVLVDEALVPLVLAGTSHRETPRVELIRMVG
ELTPGRDFDTDTDSRNVHLTDEGARKLEAKLGGIDLYSEEHVGTTLTEVN
VALHAHVLLQRDVHYIVRDDAVHLINSSRGRIAQLQRWPDGLQAAVEAKE
GIATTETGEVLDTITVQALINRYPTVCGMTGTALAAGEQLRQFYKLGVSP
IEPNKPNIREDESDRVYVTAAAKIDAIIEHIEEVHKTGQPVLVGTHDVAE
SEELHEKLVKRGVPAVVLNAKNDAEEARVIAEAGKLGAVTVSTQMAGRGT
DIRLGGSDEGDHDEVAELGGLHVVGTGRHNTQRLDNQLRGRAGRQGDPGS
SVFFSSWEDELVQAHLEPNKRPMQADENGRVLTDKAAALLDHAQRVAEGR
LLDVHANTWRYNQLTAQQRAIIVERRDALLRTPTAREELAELSPKRYAEL
AEELSEERLERICRLIMLYHLDRGWCEHLAYLADIRESIHLRALGRQNPL
DEFHRMAVDAFASLAADAIEAAQQTFETAPSFEDEPGVDLSKLARPTSTW
TYMVHDNPLADDTMAALSLPGVFR
119868924YP_938876.1 hypothetical protein Mkms_2892 [Mycobacterium sp. KMS]MAEPNRLLGGFDPEAGLKHHDAAGPQKIPVPSLLRSLLSEHLDPGYAAAA
AARREGARRPRAVEWGWQLAAALTVATVFGVAAAQAQTAAPATREAQQVL
AGSVRAAEAADQQLTAQRNALTTQVAAERRSRLEGDERGRQLLADLDVAD
VAAAATPVIGPGLTVAVTDPGLSNDLSDVSKQRVAGSRQVILDRDLQLVV
NSLWVSGAEAVAVGGVRIGPNVTIRQAGGGILVDNQPVSSPYLVQAVGPP
KSMVDTFDRSAGLQRLRLLETSYGVGVSVSTADALTLPAGSVREVNFAKQ
IGAR
119868922YP_938874.1 hypothetical protein Mkms_2890 [Mycobacterium sp. KMS]MTESPGTGSEHHADHHGRHELPSRPPRRPLGGLLRRGRSQVLFGALGALL
CVLLGVAIVTQVRQNESGDSLETARPADLLVLLDSLQQREAALNTEVGDL
RRTLEQLAASGSNDQAAIENAQARLAALSILIGAVGATGPGVVLTITDST
PGVPPETMIDVVNELRAAGAEAIQIQGSPGAQPVTVRVGVDTWVLGRPGA
LNVDGATLNPPYTVAAIGDPPTLAAAMNIPGGAMDSIERVGGTMEIQQSD
RVDVTALRQPKDRQYAQPVK
119868920YP_938872.1 FHA domain-containing protein [Mycobacterium sp. KMS]MTEKDINSGGDQTSEEVTVETTSVFRADFLNELDAPPAAGSDSAVSGVEG
LPVGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAE
FRLESGEFQVVDVGSLNGTYVNREPVDSAVLSNGDEVQIGKFRLVFLTGP
STENGPSS
119868918YP_938870.1 hypothetical protein Mkms_2886 [Mycobacterium sp. KMS]MAEVRVVGIRVEQPQNQPVLLLRESNGDRYLPIWIGQSEAAAIALEQQGV
EPARPLTHDLIRDVIAALGHSLKEVRIVDLQEGTFYADLIFDRDIKVSAR
PSDSVAIALRVGVPIYVEEAVLAEAGLLIPDENDEEAAGAVREDEVEKFK
EFLDSVSPDDFKAT
119868916YP_938868.1 glycine dehydrogenase [Mycobacterium sp. KMS]MLDSHQPRFADRHIGPDSDAVAVMLDTIGVATLDDLAAKALPANILDALS
ADGVAPGLECLPAPASETEALAELRALAESNTVAVSMIGQGYFDTLTPPV
LRRNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVSDLTGLEVANASM
LDEATAAAEAMTLMQRAGRSKSNRLAVDADLYRQTAAVLATRARPLGIEI
VTADLRHGLPEGDFFGVIVQLPGASGALVDWAPLVADAHDRGALVAVGAD
LLALTLVTPPGEFGADVSFGSTQRFGVPMGFGGPHAGYLAVHTKHARQLP
GRLVGVSVDADGSPAYRLALQTREQHIRRDKATSNICTAQVLLAVIAAMY
ASYHGAEGLTSIARRVHGHARAVATGLAEAGVDVVHDAFFDTVLVKVPGR
AAEIRDAAKSHGINIWLVDADHVSVSCDEATTADHVAAVLSAFGATRGGK
PFAGPEIATRTSAFLTHPAFTRYRTETEMMRYLRSLADKDIALDRSMIPL
GSCTMKLNAAAEMEPITWPEFARQHPFGPESDAPGLRRLIADLQTWLTGI
TGYDEISLQPNAGSQGEYAGLLAIKAFHDANGAPERDVCLIPSSAHGTNA
ASAALAGMRVVVVGCRPNGDVDLDDLRAKVTENAERLAALMITYPSTHGV
YEHDVAEICAAVHDAGGQVYVDGANLNALVGLARPGRFGGDVSHLNLHKT
FCIPHGGGGPGVGPVAVRAHLAPYLPGHPLADELGDDYTVSAAPYGSASI
LPITWMYIRMMGAPGLRAASLTAIASANYVARRLDEYYPVLYTGENGMVA
HECILDLRTITKQTGVTVDDVAKRLADFGFHAPTMSFPVAGTLMVEPTES
ESLSEVDAFCEAMIAIRAEIDQVGSGAWPVDDNPLRGAPHTAESLLVTEW
EHPYTREQAAYPLGKGFRPKVWPPVRRIDGAYGDRNLMCSCPPVEAFA
119868914YP_938866.1 thioesterase [Mycobacterium sp. KMS]MNSATPLSATAQAAVETLFIFPHAGGSAAGYKPFARAFTMDAKRIAVQYP
GRAGRHDVPDLASISALADDIYPLLRPKITGSRVAFFGHSMGGLLAFDIA
RRLERDGDCPAALFVSASPAPGHGGYEQLHQGSDDELLEMVASMTGTDSR
FVGGEFGATVLKTLRNYGAITSYSCPPGTTVSCPVYAYAAADDAAVTYES
MRAWSEFTTDDFALRTVAGDHFFITEHVDEIVTDIEARLTGCTVREQG
119868912YP_938864.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MTLTVYPTDGSGTLRADLGRTRRDAGPLAASSRDEHIRTSQRTATEETSR
TMTESSVTALLQERALHQPDEPAYTFIDYDVDPKGYAETLTWAQLHNRAQ
VLAEELMLFAGAGDRAAILAPQGLDYIVAFFGALQAGLIAAPLSVPAYGV
HDERISSVLRDCAPSVILTTSSVAGEVGRYALGGGGRAATVVEVDSLDLD
APAQSAAPPAQKSKIAYLQYTSGSTRVPAGVVVTHDNVVVNVDQAFTDYF
GHSGATPPGMTFVSWLPFYHDMGLIKGVCAPLVSGRSAVLMSPMAFLQRP
ARWIQQIAINPGSFTAAPNFAFELAVRRTTDEDMAGLDLGAVLGICSGSE
RVHAATVNRFVERFSRFGLNAASVKPSYGLAEATVYVATSDRGHAPNIVR
FDYEKLSSGHAMRCESEAAGGTDLLGHGTARSTTLRIVDPESGTENPAGQ
VGEIWVHGANVARGYWQRPKETERVFSGRLVKPSAGTASGPWLRTGDLGV
ISDGELFIIGRIKDLLIVDGSNHYPDDIEATIQELSGGRVAAISVPSGET
EHLVTIVEVKKRGSDDEHRERLRTLKRRITAAVSTTHRVRAADVVFVAPG
AIPITTSGKIRRSTCVERYGRGEFERLDQSA
119868910YP_938862.1 beta-ketoacyl synthase [Mycobacterium sp. KMS]MVAGSSDRRAIITEALRKIDDLSARLAVAEQADTEPIAVVGMGCRLPGGV
SDPDGFWQLLQDGRSGIVRVPPERWDAEALYSADNGVPGTICTREGGFLT
SWQPDEFDAEFFGISPREAAAMDPQQRLLMEVSWEALEHAGIPAQNLRGT
QTSVFVGLTTNDYSLLFAGKLRREDIDPYVPFGNAANFAAGRLSYFLGVR
GPAVVVDTACSSSLVSVHLACQSLRRRESDTALAAGVNLMLSPENTIACS
RWGMLAPDGQCKTFDAGADGYVRSEGCGVVVLKRLGDALRDGDRVLAVVR
GSAVNQDGASSGQTVPNGPAQQALMRQALAASQLGPADIDYIEAHGTGTA
LGDPIELDALSAVFGDRGDAAPLVLGSVKTNLGHLESGAGITGFIKTVLS
VRYGYIPKHLNFTRLTPHAGPCASQFTIATDGMEWPAVTRARRAGVSSFG
VSGTNAHIIVEQAPAPEPARWEPDPAVCTLVVSGKSEERIASTAGALAEW
MTGAGAGVALAEVAHTLNHHRARHAKFATVCARDRGQAVAGLRALSVGHH
AVGLVNPHDGPCGSGTVFVFSGQGSQWAGMGRRLLADEPVFAAAVAELEP
VFVEQVGFSLAQVLADGEAVTGDARVQPVIVGLQLALTKLWRSYGVTPDA
VIGHSMGEVTAAVVAGALSVRDGLRVIGIRSRLMSRLAGQGAVALVTLDA
ESAAALIAGFDDVGIAGYLAPEQTVIAGPPAAVDAAVEAALAGGTIARRV
NMEVASHTALMDPILGELRDELADLTPQTPEIPFFSTVDDTTTAPVLNAD
YWVANVRRPVRLHQAVSAAAAAGHTTFVEVSPHPVLTRAVGDTLVEGHHH
VVGTLARDTDDTHTFHTNLNTTHTIRPPATPHAPEPHPLLPATPWHHAHH
WIKVDPTAGIDRTPAVQRAEVTARSAADLADGTWLVIADGRPSWLDDEKT
TTTSTSVLAEDASSAGLLDALTAARNVLFVPDLPADGFDAESGYRLFSGI
RRLTSVLAAMAAPPRLHISVPPADPADGIAEASAALVTISGLAGALARDH
ARSWGGLVVVESAGAAAADTDDDGALPDGDILDVWRTYPVDRRRNLLHRH
VSVLIAAVMGLPSPESLDPEADFFELGMDSMMSVVLQRALLATLGVEVPS
PALFDNPTVESLADHLVALGEIDGDSLRDLATVPLPEKVS
119868908YP_938860.1 beta-ketoacyl synthase [Mycobacterium sp. KMS]MNAPATPGDVPPNAVAVIGMAARLPGANSVSAFWDNLRRGEESIVTLSEE
ELLAAGISEQTLANPFYIRRAPIVDGIDEFDNDFFGFPPQMARMMDPQHR
LFLQTAWHAMEDAGCDPAGFDGSIGVYATSGSSIYLLHNLLTHHDPNTIL
GQGATFDLVNMSLLNDKDYLATRVSHQFNLRGPSVTVQTACSSSMVAIHT
ACQSLLNGESDIVLAGGVSLRVPHHVGYFHEPGSMVSGVGHCRPFDSRAD
GTVFGSGVAVVVLKPLATALEDGDRIHAVIRGSAINNDGSMKMTYAAPNG
AAQADVIAEAHAVADVDPATINYVEAHGTGTPLGDPIEIDGLRRAFGVSD
TPRPGPCAVGSVKSNIGHLAEVSGIAGLIKTILSLQHKAIPATLHYTEPN
PALDLDRGPFVIQSEYTPWEWDGIRRAGVSSFGVGGTNVHLVVEEAPTRP
VTAPLDGPKVLRLSARTEESLSALRTALADELADNDALDLDDVAFTLAGR
RTDQVRMAAVVHDRADAAAVLRSPDSDDVFVGEGVDARDESDRVVFLFPG
QGAQHADMARGLYDREPVFAAAFDECAAGFDAELGIDLKASVFGPTTPEL
ERTDLAQSSLFTVEYALGRLIESYGVTAGAYAGHSIGEYAAAALAGVFDL
PTAVKVVAQRARLMHASPSGAMVAVGAGLEDIGDLLTADLDVAAINELGG
CVISGSQEDVKTLQNELRRRRILARRVRTSHAFHSRLMDAVVPQFAEFLS
GVKLNAPRIPLLSNVTGTWMTDAEATDPQFWARQIRATVRFADELSTVLA
TPHRVLVEVGPGGTLTGAAVRHPRWSEDHRAVRLMRHQVQTRDDHDTFLL
ALGQMWAAGVDLDWSRLSKDKPGLITLPGFQFARHRHWVEPNRNLEWSQG
VPSTDASRPVSEPAAAVAASTSGQSIEQRLQQIWCECLGVASIDPAENFF
EIGGDSLIAIGVAMNATNKGLDLTPQDLYEYPTVSALAGALGARFSTGGL
AEMPAADAINPPVPPAVAHFLEYGIQDAGRWRVPLLLAIRPEVGVDDVRA
VLTAVTNHHDALRVRIDARAGSWEQRITPAVEAVDPEILTLPAGTGHGTA
REREAVLDLIADHLSADDLSVSPLRAAYILDADGTARFLALSVHEMVVDS
TSREILLTDIITAFGQRLAGQEVSLPPATTSWQAWSQRCAELTTHPAVLA
GREYWVETATKTTMHIADRHVADPPRSEHLVRMGTTLPAGQTEEVDRARR
MYQYTLDELLLAALSRTVGDTLGDGVLAVGVCGDARPVLKPELDPRRTVG
AFATLYPLALACAGTQATPAVEVLNAVHNTLDGVPHHGIGYGLLRFLYGP
TARTLSPVPPPDILLCNEGVVPEVDLGDSPIQLDADVASSLRDKIPGLGH
PIELRVFRSSGELHLDWWYDTRRVPQETVEVFAARFPAALNDLVAESSAS
AGANAELADAIEELALVDLSAE
119868906YP_938858.1 multidrug ABC transporter inner membrane protein [Mycobacterium sp. KMMTAALTDPRPEPRTVGQWWVLTNRLVSPTLRNGEVATALVASVVFTVGWY
IPLNNILGPRSGMSSYAQFLMPLVALQGISFAAITGALRAATDSVKGINR
RFDSMPIPAFTPLAARMSAGLYRCAVGTFAALVSGHIIGFRFHGGLVNAV
LFCVLLLAIGLVLSFLADLLGSNSKNPEATSQWLMLPQLIFGLISVGIQP
AENFPEWIQPIVRNQPISQFIYALRALGGDTTPGAGEVSWPVIGPSVAWL
VGVMVIMVPVSVMLLRRRS
119868904YP_938856.1 acyltransferase PapA5 [Mycobacterium sp. KMS]MAYSTSVIRRLAPSEKFFAETQTFTSITVLLDGTVDIDAMADAFDALLEA
YPVYAGHLEPDSDGGFELVADDLLHPGLWVQFEGDPAPTDQLDQGVALIY
LLVKPDSTPVEVTLFIHHSLADGTHMAGLLFELFARYTEVVTTGSAGPVS
PNPAPEPIETVLEQRGIRKQQRSGLDRFIPAMFAYELPPKRVTTRSAAER
PAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQVRRTPH
IPIPYVYNVNLRALVEPPVSATGCTLAIGVATYLAHITPQTTMVELARGI
ADMFQADLADGVVQQSLLHFNMQYEGAIPGLPDVVLSTNLGNAVAMSTPP
GLEVVGVQSQFYRASSAVIDVYSFGVVGGELLIEHHVDAAETTIDLIRSL
LRSVVSEHQH
119868902YP_938854.1 hypothetical protein Mkms_2870 [Mycobacterium sp. KMS]MDSEVLDVIIVGAGFGGMGAAIELNRLGYNDIAILDREDDLGGTWYVNHY
PGLAVDIPSTTYSYWFEPNPYWSRLHAPGAELKTYADHIADKYDLRRFMR
FNTTVDGARWDEDAQLWRVALAGGRSMSARFLITATGYLSQPRIPDIPGV
DTFGGTMVHTAQWDPASPVEGRRVGIIGTGVTAVQLIPELAQQAAELTVF
QRTPIWVVPKVDFPIPAAAQRMFARFPVAQRLLRLVTDAFAEIGVSSAVV
HYKQVRLLNIAAAGLSKLHLFASVRDRATRRKLTPAYEFGCKRTTFNNDY
YRIFNQSHVRLETAGIDRIEPDGIVTADGHKRPLDTLVLATGFDLWEANF
PAIEVVGRGGRNLGKWWRENHFQTYEGISVPNFPNFLNLASPYAFTGASF
FTMMEIQMRHMRRLFGELRRSGHETFEVTEQANARYYEQMSAKLDNMVYF
RGNCAGSRSYHFRGDATIVRPVSRRRAVRESTRFPVSDYAFS
119868900YP_938852.1 hypothetical protein Mkms_2868 [Mycobacterium sp. KMS]MEIALIIVSVGLAIFMAVAGFLNVFFVGDARENQVHLRISVGLTRFIGWC
QWASVVGLIGGLFWRPLAIAAAIGLLLLLIGAVLAHRRVNDPLKEMLLAI
AVFVLTAFVLAGHLSQLAADQGPTLAGELLQGDRYTQSPQ
119868898YP_938850.1 hypothetical protein Mkms_2866 [Mycobacterium sp. KMS]MPRTFETAVDSPATVAQIVSAFSDERYWSARLGQFAGGTAAVESLRTDAT
GTVAVTIALGLLRDRLPKVVTQLHPGDIEMIREERWCWLEDGRVRGDIEV
TVTGAPVCAAGQCMLTSTATGSRMTYAGSVKVNVPLVGGRIESYMGRQTV
DEIARLQEFTNDWIAENHRLSWP
119868896YP_938848.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MRDFSGAVAIVTGGGGGIGAAQVKLLRDRGARVCAVDIDEDAAARSGADL
AIGADVADREAMAAAVDRVVDQFGKLDVVFCTAGITHLPATLRSLKPGEA
QRVIDVNLVGTLNTIHPALEALIASRGHIVVVSSMGWPPNTEYGTLLPAV
GGVAYSTSKTAVEMLGRGLRMELSPHHVGVTIAYFGPIDTAMLEQSLTPP
SRAKRRLTIGPEKAAAAVIRAVEKGKVRVIIPARWNFLNVVRPLGVQLDN
LLLRSKTQREFIETYDSV
119868894YP_938846.1 hypothetical protein Mkms_2862 [Mycobacterium sp. KMS]MGRHSIPDPEDSDDDAGVPDDRIDDGGYGSDDGPSGRHSGEFPAQPEGAD
ARQGDYTTDEYADGDYADSEYADEYADEYADDHPVTAGAQPPAEPSGPAH
GGTWDGGEWTGSHRAVTPGRRGLSIGVIAALVTVVVVVGGVILWRFFGDA
LSERSDAASARCVDGNLDVAVLADPSIAETIGGLADQYNENAAPVGDRCV
KVGVKPAGSEQVINGFGDTWPGDLGERPALWIPASGVSAARLEAATDQKT
VSDSRTLVSTPVVLAVRPELKPALAQQNWGTLPDLQTNPTALDGLGLPGW
GALKLALPRSGNADASYLAAEAVAAAASPDGAPVTDGISAINTLSAGAPE
LPADTADAAMKALLTSGDPAKAPVHAVATTEQQVVARAASSPDAKSELAS
WLPPGPVATADYPTVLLSGDWLSREQVTAASQFARFMREPDRMNELAKAG
FRTQGGTPPPSDVTDFPKLAAPLSVGDDAARVKLAEALTSPAQASTTTIM
LDLSMPGAEGDNTRMGNVVNALIPRVDALPPTTALGLWTFDAAAGNSQIT
TGPLSEPVDGQPRSAALTTTLDTLSSTSGGAVSFTTLRLVYNEAMANFRA
GQPNSVLVITQGPHTDRTLDGAGLEAFIRDAFDPARPVAVNVIDFGDDPD
RGTWETVARTTGGQYQNLATSDSPELTAAITTLLR
119868892YP_938844.1 hypothetical protein Mkms_2860 [Mycobacterium sp. KMS]MDAFCAPHQARRRAGRTHPVWDFLFTYYSLRPRHLRCWHPGFGMVLSGDA
ARPYLARSGYDAVPGGVAVTAEHLRSRADAVEFVAALLRATAARPARLNC
FGLHEWAMVYRSPDTRHDAVPLRLGRAGTDAVVESMSLRCSHFDAFRFFT
EAAVGRNAEPLSRERQIDTEQPGCLHAAMDLYKWSYKLSPLVASDLVMDC
LELAADARLLDMRASPYDLRGYGFDPIAIETPAGRAEYVRAQQDIADRAT
PLRATLAARCDALRAALAGDGGASVHAGFVAVTDG
119868890YP_938842.1 hypothetical protein Mkms_2858 [Mycobacterium sp. KMS]MSVAYTLLSLLAIVVLTAGTAVFVAAEFSLTALERSTVEANARSGHRRDQ
LVRRAHRTLSFQLSGAQVGISITTLATGYLAEPVVARLLQPGLDAIGLPE
QAASGVALFLAILIATSLSMVFGELVPKNLAVARPAPTARAAAPPQLLFS
TIFTPLIRLTNGTANMILRRLGIEPAEELRSARSVQELISLVRNSARSGS
LDPVTAVLVDRSLQFGERTAEELMTPRTEIEALQADDTVADLIAAAIETG
YSRFPIVEGDLDETIGVVHVKQVFSVPRDDRDRTRLAAIAIPVATVPSTL
DGDAVMTQIRANGLQTALVVDEYGGTAGMVTVEDLIEEIVGDVRDEHDDA
TPDVVAAGDGWQVSGLLRIDEVATGTGFRAPEGEYETIGGLVLQELGHIP
EVGDSVELTAFDPDGPLDDPIRWQAKVVQMDGRRIDLLELVELGRRGDTD
DDHIDNDDHHNKDGAAPEEDR
119868888YP_938840.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. KMS]MSSSEKSTAGTAQIGVTGLAVMGSNIARNFARHGYTVALHNRSVAKTDAL
LAEHGSEGSFVRTETIPEFLAALEKPRRVLIMVKAGEATDAVINELADAM
EDGDIIIDGGNALYTDTIRREKAIRERGLHFVGAGISGGEEGALNGPSIM
PGGPAESYESLGPLLEEISAHVDGVPCCTHIGPDGAGHFVKMVHNGIEYS
DMQLIGEAYQLLRDGLGKSAPEIAEVFDEWNRGDLDSFLVEITAQVLRQI
DEKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSG
SVAQRQATTGLASGDLGEKPSDAEQFTEDIRQALYASKIIAYAQGFNQIQ
AGSAEYDWGITPGDMATIWRGGCIIRAKFLNRIKDAFDNDPDLPTLIVDP
YFRDAIENAIDSWRRVVVKATELGIPIPGFSSALSYYDGLRTERLPAALT
QGLRDFFGAHTYGRIDTDRDKRFHTLWSGDRSEVEA
119868886YP_938838.1 CopY family transcriptional regulator [Mycobacterium sp. KMS]MAKLTRLGELEREVMDHLWSAREPQTVRQVHEALAARRDLAYTTIMTVLQ
RLAKKNLVVQHRDDRAHRYAPTHGRDELVAGLMVDALDQAADSGSREAAL
VHFVERVGADEAAALRRALAELEGKQGLTKPAGGPGTA
119868884YP_938836.1 hypothetical protein Mkms_2852 [Mycobacterium sp. KMS]MTTQVPDGLGDGYDKELGLTYLEVTPDGSRAQLTIHDKLLQPWGIVHGGV
YCAIVESLASVSGHVWLTEHGGGTVVGVNNNTDFLRAISSGTVTAVSTPI
HRGRRQQLWMITITDENDKLVARGQVRLQNIADA
119868882YP_938834.1 urease subunit beta [Mycobacterium sp. KMS]MVPGEIFFGEGDVEINAGARRLEMEIVNTGDRPVQVGSHVHLPQANAALD
FDRTAARGHRLDVPAGTAVRFEPGVAQRVRLVPLGGSREVHGLSLNPPGR
LDGAS
119868880YP_938832.1 urease accessory protein UreF [Mycobacterium sp. KMS]MTTLTTLLALADSRLPIGGHVHSGGVEEAVTSGLVTNLETLHAYLVRRVR
TQGLVAASIAAAVHAGTLTVAAADRETDARTPAPAARTASRAQGRGLARL
ARRVWPGHDWTALGRAPHLPVASGAVGAVAGLTPGQTALSVVYTTMTGSA
TAAQRLLALDPGDVAALTFGLAPLCDDVAAAAAEEPADLSDPLLDVLAQL
HSERERPLFAS
119868878YP_938830.1 putative urease accessory protein [Mycobacterium sp. KMS]MRSDVVIVACAGRGPRIEHTGGIAVRRTGSDTVYLVSAAATPLGGDVINV
RVVVEPGARLVVRSAAATVTLPSAATPESQTCWDIESAGALDIDPQPTVV
AGASRHLTTTRIRLTDAGSIRLRERVQIGRSGEREGFWSGALHADVDGAP
LLRHRVELGTGSVTDDALGRPLACVSELRYPEPSFASDGTVLALAAGGCL
ATWQGERLTN
119868876YP_938828.1 luciferase family protein [Mycobacterium sp. KMS]MTIRLGLQIPNFSYGTGVAELFPTVIAQAREAEEAGFDSVFVMDHFYQLP
GLGTPDAPMLEAYTALGALATATERVQLGTLVTGNTYRNPTLLVKAITTL
DVISQGRAILGLGTGWYELEHDSLGYEFGTFTDRFNKLGEALQIILPMLE
GERPTVEGKYYRTKEAMAEPRFRDHIPLMIGGSGEKKTIPLAARHFDHLN
IIAGFDELPRKIEVVKQKCEEIDRDPATLETSMLVVAIIDENVTGDVIPD
DFKQQAVFGSAEQIVDQIKTKVLDAGVDSVILSPVTSLNGYQPGGITDVA
ALLKPVLGV
119868874YP_938826.1 NifC-like ABC-type porter [Mycobacterium sp. KMS]MHRVTVTEGSALPRWIYVPAVAGALFVGLPVVSVAAKVDWPRFTALVTSE
SSVAALVLSLQTAAASTVLCVLLGVPMAMVLARSPSRAVRAVRPVILLPL
VLPPVVGGIALLYAFGRLGLLGRYLEAAGIQIAFTTAAVVLAQTFVSLPF
LVIALEGAARTAGTDYEVVAATLGARPSTVWWRVSLPLLAPGLVSGSVLA
FARSLGEFGATLTFAGSREGVTRTLPLEIYLQRESDPDAAVALSVLLVVV
AAVVVVSLGSRRLRAQGWT
119868872YP_938824.1 fibronectin-attachment family protein [Mycobacterium sp. KMS]MDEPDVMSTRRRGLSKTLAIAAVAGATAAALAMPSVAGAQPTPPPPPPAP
SPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPADPNAPPPADPN
APPPPAPEPGRVDNAAGGFSYVVPGGWKVSDATNLSYGQALLTRIPPEGV
TNPPNDTSVLLGRLDLKLFAGAETDNTKAANRLASDMGEFFMPFPGTRVN
QSTTPLDANGMPGVASYYEVKFTDTNKPNGQIWAGVVGNPVAPGTPRGQR
TPERWFVVWLGSATNPVDREAAVTLANSIRPWAPPPPPPPPAPGDPNVPP
PPADPNAPPPRPEVGVAVPVAPENVPPEMRPQG
119868870YP_938822.1 abortive infection protein [Mycobacterium sp. KMS]MTAVHAQPSTMPRMRVYLDIAIVVAVLAATNLIAHFTTPWASIATVPAAA
VGLLILVRRRGLCWTELGLGREHWRSGAGYALAAVAVVVSVIAVGLLLPW
TRPMFMNNNYATISGALIASMVVIPLQTVIPEELAFRGVLHGALNRAWGF
RGVAAAGSLLFGLWHIATSLGLTSSNVGLTRLFGGGVLGTVIGVVLAVVA
TGIAGFVFTWLRKRSGSLLAPIALHWSLNGMGALAAALVWQLSA
119868868YP_938820.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MPSPAHTPVLVGYGQVNQREDRPDLEPVDLMEAAAREAADARVLEAVDAV
RVVNLLSWRYRDPGLLLAQRIGADKAATRYTGIGGNVPQSLVNQACLDIQ
SGRHNVVLIAGAETWRTRTRLRAKGERPNWTRQDESVPIADGADENVPMA
GDAENRIQLDRPSYVYPMFEQAVRIAAGETPDEHRRRIGELWAQFSAVAA
DNPHAWRRDALAADAIWQPSPENRMISWPYPKLMNSNNMVDQGAVLILTS
VETARQLKIPSERWIFPYAGTDSHDTYAIGERAEFHRSPAIRIAGQRVLE
LADTAIEDVELIDVYSCFPSAVQVAATELGLPVGDPARPLTVTGGLTFAG
GPWNNYVSHSIATMAERLAANPGQRGLITANGGYLTKHSFGVYGTEPPQH
EFRWEDVQSEVDREPTRTLAVEWSGTGTVESWTTPFNRDGVPEKAFLAVR
TPEGARTLAVIHDAQDAAATVEGDIAGAAVTVHADGTARLAI
119868866YP_938818.1 DeoR family transcriptional regulator [Mycobacterium sp. KMS]MGPDELFQRAVIARRYYLEGRTRIQIAEEFGLSRFKVARMLDEALESGMV
EIKIHNPGAVDVDLSTELQRRYGLEHAYAVACDTSTAADRIEAVAKAMAE
LLQSILRNGDVVGVDCGRTLTHIAAHLTSLPPCDVVQLTGMAGAITSNGA
DLVRRISEISGGRSWPMYVPLVVPDARTAESLSGNQQLQETVARHRDVSC
AIISVGAWSPGASQVYQSLTPEEIGALDAAGVCAETCALLLDADGNRVPG
LDERRMGIAEDTLRSIPTRIALATGPEKIDATRAVLRSGLVSSLVTDIDV
AAAVLN
119868864YP_938816.1 xylulokinase [Mycobacterium sp. KMS]MTAVLGVDSSTQSCKVEIRDLTTGELLGCGSAPHPPAFPPCSEQHPLDWV
SAFVAATRTALADCARPPAVCAISVAAQCHGLVLLDDHGNPLRAAKLWND
TTGAPALRALADRIGVPSWIRRTGSAPTAAFTIAKLAWVAEHEPEVLDRA
STILLPHDYLTYWLTGRPVTDRSEASGTGYFDVGTGQWITEYLDLAGGAR
DWPSMLPTVLAPCEPAGALRPAAAEILGLDGDVVVAPGGGDQHAAYLGLG
LRDGDQYIGIGTSGVVATSSRTPVFDPQGMVDGVADLTGGYLPLVSTLNA
ARVSDVAARLLGTDLVDLADLALSAGETQGPVLVPFLDGERKPDRPDARG
AFADLTSRTTRAELARAFVEGPLLSLMSARDSLRACGVDVSGAATAVGGG
ARSPATLQLLADLLDGEVTVLDTDEATARGACVQAAAVATGRDVAGLVDL
AKQWQPAVRHRVSPRHTGRDLGALRARWAQLSASPLLENGIRP
119868862YP_938814.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MTETVDGTMRASVMTGVGTLRIEERPVPSPGPHEVLVEVAAVGVCGSDVH
YYRHGRIGDFVVEEPMILGHELSGRIAAVGEGVDPGRVGERVAVEPQHPC
RRCRQCKSGRYNLCPEMKFYATPPIDGAFCRYVVIDDDFAHPVPESMSDD
AAALLEPLSVAIATMRKAGVVPGSSILIAGAGPIGVICAQAARAFGAARI
VVTDLVPSRREMALKFGATEVLDPAAVDVSAIEPVDAFVDATGVPAAVVS
GIKAVGPAGRVVLVGMGADEYALPVSHIANLEITVTGVFRYTDTWSAAIH
LVNSGAVDLDAMVTGRYDLEHVADALDSDTDPASLKSIVNP
119868860YP_938812.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MVTRRVVVSSLDDVVVETETTDTPQPGEVRVGTSLVGICGSDLHAACGRH
PFIDLPYRPGHEAVGVVDAVGAGVDESWLGTRVTIEPNLACGHCTQCRAG
RYNICRELLVFGCQTAGALADSFTIPVDRVVALPDELDDRHAILIEPLAT
PVHTVRRAAGLVGDLRDRAVVVIGAGPIGLFTLLAARHAGARVVVADLLE
SKRARAERLGAVGSFDPTGDDAVATAQRLLGGPAAVVVDCVSRESTVALA
VDLVDKGGAVMIVGVAEGSTPVPLGLIQDRELALVGNLMYVREDFTAAMD
LLASGIVPVDEIISADFDLDHAAQAFRASADPENVKVLVTVGS
119868858YP_938810.1 inner-membrane translocator [Mycobacterium sp. KMS]MSTKEDIAPESGGAVVASPITGEPVKLFSREWLGAMALRYAMFIILLMVI
FYFSYRSARFSTVENLITILVAAAPFALIALGQTLVILTGGIDLSVGSVI
AVSAMAGAATAKANPGQVWMTVLVAMGVGLIVGSLNGIMVSRLNVPPFIA
TLGTLTAGSGAAYVIGGGAPINGLPAEFGSIANTKILGLQIPVLLMIIGI
IALAVIMKRTTYGMRVYAVGGNRNAAEIAGINAKNVLFSVYAFSGLLAGL
SGVMLASRVISGPPNLGQGYELDAIAAVVIGGASLMGGRGTIWGTALGLL
MIQTLNNGLDILVVPAYWQDVIKGVLIVSAVAIDVWSSKRRT
119868856YP_938808.1 periplasmic binding protein/LacI transcriptional regulator [MycobacterMTLTTKFGAIAAAGVLGLGLTACGAGDTEANSDTTRIGVTVYDMSSFITE
GKEGMDTYAKAKNIELVWNSANNDVSTQASQVDSLINQGVDAIIVVPVQA
DSLGPQVASAKEKGIPLLAVNAALETPDLAGNVQPDDVAAGEQEMQMMAD
RLGGRGNIVVLQGPLGGSGEINRGKGIDNVLAKYPDIKVLAKDTANWKRD
EAVNKMKNWISSFGPQINGVVAQNDDMGLGALQALKEAGRTDVPIVGIDG
IEDGLNAVKSGEFIGTSLQNGTVELSAGLAVADALVKGEDVKTDPVYVMP
AITKDNVDVAIQHVVTERGKFLEGLVELTEKNLETGDIAYEGIPGQEQPQ
P
119868854YP_938806.1 hypothetical protein Mkms_2822 [Mycobacterium sp. KMS]MIRIGTSGWSYDHWTDVLYPQRTPVAKRLGLYVAEFDTVELNASFYRWPR
DATFEGWRQRLPEGFTMSVKAHRGLTHFRRLTNPEPWVDRFERCWTALGD
RREALLVQLHPAIERDDALLAHFLSVMPDWIPVAVELRHPSWDDPAVYRL
LEDHRAAYVVMSGAGLRCVPRTTSDLVYLRMHGPSQESLYAGSYPDDALS
RWADRIAGWDAEGRRVLVYFNNDLGGHAVRNARTLRHLLAARVG
119868852YP_938804.1 hypothetical protein Mkms_2820 [Mycobacterium sp. KMS]MAYDADLADRIREIVSAERGVTEKRMFGGLAFLLDGNMAVAASGHRGLMV
RVPPDQTEELLQREHVAPMIMSGREIKGWLRVDDDGVRTMRQLRSWVRRG
VDYARALPPK
119868850YP_938802.1 hypothetical protein Mkms_2818 [Mycobacterium sp. KMS]MADDGDAVTHIELQQRVDPGALALATVGGAVAFIFAGDDWDVLAVVIGLL
LLIILLAHHRPAPTVRTPRALLLRGAFGATTGLAFCIAVAPAIQFGVIGP
FFHSEDDDGYSFDAWNTTVALSVLWFAVAVLLAIFEPRLARWLDRPRGPG
PSRMTGER
119868848YP_938800.1 hypothetical protein Mkms_2816 [Mycobacterium sp. KMS]MVSTSDPFDLQRFVDAQDPVYDTVIAELRAGRKRTHWIWFIFPQLRGLGR
SPTAQHYGIASREEAVAYLAHDVLGPRLRECTRLVLAIEGRSIGEAFGSP
DDLKLRSSMTLFARCADDNADFLAVLDKFYGGEPDPATVSRL
119868846YP_938798.1 zinc-binding CMP/dCMP deaminase [Mycobacterium sp. KMS]MAISDSDLEHLRRCVDLAREALDAGDEPFGSLLVDSAGQVRFADHNRVSG
GDHTRHPEFAIARWAAEHLDPSERAAATVYTSGEHCPMCAAAHAWVGLGR
IVYATSSAQLSRWLAEWGAPAPPVATLPVNTVAPGVPVDGPAPELADAMQ
ALYREKFGS
119868844YP_938796.1 integral membrane protein [Mycobacterium sp. KMS]MAKHAAAPRRESGMRTRLAATAAAMAALALFVVAMIASYSGAFANPTLRH
LDVAVAAPPQVLDAIRGQDALAVTEAPDASAARDLVYQRRADAGFAVGAN
RDLTIFVAGGGGRSVVSAAESVGRAIATEAGLTPLVEDVAPTSAADPSGT
VEFYAVIFLSIGASVGATILSRLMGPVRTPRTLGLRTLSLAGYSALLAAG
VTAYVDGGIGALTGHTWQLLGALWLYAMAVGGAITGVAAALGTVASLALT
LFLVIVGNAAAAGPVGRPLLSGFYRTFTHIVPQGSGVDLLRSLQYFDGNG
ATTAVVTLAVWAAAGAVLATLATVASRAYRSRHDGFARS
119868842YP_938794.1 xanthine/uracil/vitamin C permease [Mycobacterium sp. KMS]MSTDVTDPPAEPVRTESLSIPWWTRGDLNAFFGLGFNILVNVLTLTGLMI
GVISVPASDVLGTVLPALGVALILGNLYYTFLARRLARRENRDDVTALPY
GPSVPHLFIVVFVVMLPVYLNTDDPIQAWQAGLAWAFLIGVIVMIGAFVG
PYIRKLTPRAAMLGTLAGISITFISMRPAAQMWEAAWIGLPVLAIILIGF
FTNVRLPGNIPVGLVALLVGTAIGWAGGYMSAPDVGQAVSDIAVGIPDLR
LDLLLNGLADLAPLLGTAIPLGVYNFTEAMSNVESAAAAGDNFNLRSVLL
ADGAGAVIGSAFGSPFPPAVYIGHPGWKDAGGRAGYSLASGVVIGILCFI
GLFGVLDALLPVPAIVPILLYIGLLIGAQAFQAVPRLHAVAVVAAILPNL
AQWAHGLVDNALNAAGTSAADVGMEALNGAGVVYEGLKTLGEGAVLVGLI
LGAMVTFILEKKFVYAALASAVGAVLSFVGLIHAPEVDWAANPQVALGYV
FFGTVCAACVFLPGAREPVLVDESDVVAGH
119868840YP_938792.1 amidase [Mycobacterium sp. KMS]MPGETRGPSVGPSVAEILASHAGGTGSPTKTAARVADAIAARGDDGTWLS
TVPREELLAAAEAVENRPGARTLPLYGVPFGVKDSIDVAGVPTTLSCPDY
AYVATATAPAVRRLLDAGALYVGKTNLDQFATGLNGTRTPYTVPRSVYGG
ELISGGSSSGSALAVALGQVPFAVATDTAGSGRVPAALNGVIGYKPSRGL
ISTVGLVPACKSLDCLSVMAGCIDDVDRVADVMIARDDADPWSRDRGPRH
DGSAIRVGLPPVEQLEFFGDHAMRDAHLRFRDHLARRHTVVDVSLEPFLA
AGALLYQGPWVAERLVEFGDFLAGQPDSIHPVVRDILRGGQRYTAVDAFA
ALQALQELKAVVGRQWQQMDVLVVPTIGTTFTVDEVLERPIETNTVLGHY
THFGNLLDLLAVAVPVGSTADGRPAGAMLLGAASTDDLVLHLAAQLLDEP
RERSVPAESAEPAEEHV
119868838YP_938790.1 hypothetical protein Mkms_2806 [Mycobacterium sp. KMS]MMDTVRLTTPGVGAVVRSLLGALALTALALYAVSPTAAMWTAGAGIIAGA
IALQDTPGRRLPIVVIASAEVGAAALLGSLSTEYDALFVVVVAGWCFMAG
MQWALGANAGFVAAAAAGLLVITPQESMSVAAVLATTALTVATGLVQAAL
VWLRPPQRWRAQQRALTRAHRSLAQDARKLAGDPGTPLDPAQLTWLREVF
SNIPQHQRPKAYQLGYQLPERIAATLVALRRTDADLTELSSAAGEFLDAI
AEHGVAAHRGADRALHRVDAAAAAVTGPGAPAAQRFSEQLHEAAVLRFGR
LRGPDLRGSLSGSASVLRRHLASTSPVLRHAIRLAAATAVAVAVARYSDL
REPYWIALTVLLVLRPESAHTYTRCAGRLAGIAGGILVASAISVLWPPTG
MVAAISAAAFIGVAYAVWGFGYIAVSAALAAAVVFLIGIAEPVQATAVLH
RLLAVAIGGGLALITHVTLPDDALIRLRQRAGELLMTEIDYAAMVVRAFV
HELDRPADALAAAWQRAYRARAAFEAASGATRLQDPMQRQWLRSLRTALN
AITGACTTMESNLPTQPVRLSPEFVAAVDDYVDALRGAPPNPAALWTVDL
PEVIAADRRVREVAHTVTAGSGARVLVTELAAITRSLAAITPLPAPTWA
119868836YP_938788.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MTLQINDADGVRTVTLDRPEALNAFNEALYDATTVALREADADPAVAVVL
LTGAGRAFSAGNDLHEMAARVTDPDFKAGEYGFPGLMEALLDLRKPLVCA
VNGLAVGIGTTILGYADLVFMATTARLKCPFTSLGVAPEAASSYLLPQLM
GRQNAAWMLMSSEWVSAAEAQRMGIAWQVCEPDDLMAEARRHAAVLASRP
IPSLMAVKETIVEPTRAEVKAALTREYAKFEVLLGGAANTDALAAFAERG
VS
119868834YP_938786.1 FadD16 protein [Mycobacterium sp. KMS]MGEYDLHSFILACDFRVDDPERMWAWLQTKKAGLSSIGAHHVVVYKSIWE
PGRILTTIGIRHPRSIREVLRSPAIFEWFDIAGVDDIPPVFGGEVVEKID
LDGPSSERHVAGVIVGAMAAVDDVEALMIKVHDGLDRFREAGVRKVWVYQ
ALDDGQEVMILQEIDDERSARQWIDHPDASAEWMSRAGLGAYPTLFVGKL
AHVMAVDDEG
119868832YP_938784.1 EmrB/QacA family drug resistance transporter [Mycobacterium sp. KMS]MASSPAPTAAPPEAGSSLISPQRRNLIFVAVLLGMLLAALDQTIVATALP
TVVADLGGAGHQSWVVTSYLLASTIVTAIVGKLGDMFGRKTVFQAAVVFF
LAGSVLCGLAGSMGMLVAARALQGVGGGALMVTAMALIGEVIPLRDRGRY
QGALGAVFGVTTVIGPLLGGFFTDHLSWRWAFWINVPVGIVVFFVAAAAI
PALSRVGRAKIDYAGIVFVGLGASGLTLATSWGGAEYAWTSPVIIGLFVA
SALALAVFIQVERRAAEPILPMRLFASPVFTVCCILSFIVGFAMLGALTF
LPTFMQFVDGVSATESGLRTLPMVAGLLITSTGSGAIVGRTGRYKIFPVL
GTAIMTVAFVLLSRMDATTHLLQQSLYLFILGTGIGLCMQVLVLTVQNTA
TFEDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDDRIGAALLSSGAPP
VAAESPQALHRLAPDVAAPIVDAYADSLGLVFLCAAPIAAVGFLVALLLK
EVPLREMETGAAVDLGEGFAMPGAESSEQMLESAVGRMLRHSPDIRLRSV
AGRPGCELDVARLWALLQIYRHNQVFGSARLSEIADRLRIPCEVVEPVFD
DLVAGGYAVRTGDLLWLSQSGVRQVDAVSSAFVGMIVDKLAQSPTFEGRP
DRLQVEAALERITHRMLVQRDWDWDDELERAQ
119868830YP_938782.1 glutamine synthetase [Mycobacterium sp. KMS]MAAKPLAAAAIAQLESDGVATLIGTVVNPAGLTHAKTVPLRRMGTFADPG
LGASPVWHAFTIDQAGIVFGDAISVVGDQRIRIDLGALRILGDGLAWAPG
GFFDQTGGPDPYCSRGALRRVEDRLAAAGLTASVGHEMEFVLVAPDGSRL
PSTLWAQYGLAGVLEYEGFVRDVTDAANSSGVPIEQFHPEYGANQFEISL
PPMPPVDAADLLVLMRIIVGRVARRHGLRVSLSPVPFAGSVGNGAHQHFS
LLRDGVPLFSDGSGAHGMTAEGESAVAGLVAGLPEAQGVLCGSLLSGLRM
QPGHWSGAYICWGTENREAAVRFLQGCQGNVYGGNVEVKVIDPSANPYLA
TAAVLGLALDGVEREATLPPETGVDPASLTEAQRTQAGTVLLPARQLDAL
RALEGSATMRRILGDEVVDAVVAVRRYEAEHFGALSPEEQADKFRMAWSL
119868828YP_938780.1 hypothetical protein Mkms_2796 [Mycobacterium sp. KMS]MTVVTYDTIIANGRWFDGTGAPSAIRNIGIRDGHVVTVTQEDLDAAGCPE
IIDAAGKWVIPGMLDIHTHYDIEVLEGPALTESLRHGVTTVMLGSCSLST
IHVDGTDAGDLFGRVEAIPREHVIAAVDRHKTWTTCEEYVSALESRPLGP
NVCAFIGHSDMRTAVMGLDRATRGTERPTRSEQARLEKMLEEALVAGFVG
MSSQQLLFDKVDGDTCRSRTLPSTYAKPRELRRLKALLRRSGRVLQSAPD
IANPLNLGSQVAQSLGVFRNPLKTSLLSAADVKSNPYAIKILGPVARAAN
RLGGNFRWQHLPVPFEVYADGIDLVVFEEFGSGAAALHLRDEVERNALMR
DEAYRRRFRKDYENKMGVRVWQRDFFDAEIVECPDASIVGRSFGEVGVER
GLHPVDAFLDLVLEYGRELRWRTTISNHRPDVLKKLAREPGIQMGFSDAG
AHLRNMAFYNMGLRLLRHVYDAQQAGRPFMSVEQAVHRLTGELADWYRLD
AGHLRVGDRADLVVIDPAHLDASLDDYAEDRVDFYGGLERMVNRNDSTVS
AVLVSGHTVFRDGSPTGLVGKQRTGRFLRAAHRAPAVPASTTEFASVS
119868826YP_938778.1 dienelactone hydrolase [Mycobacterium sp. KMS]MTPLQRYIAEEIATDHVDGLLSRREALRRLSLIGIGTAGATALFAACSEN
KQEEAEAPVTSSGAATVSAPPPGSQNAVPTEPVTWAGPRGELQGAWAAAD
QPRGAVLVIHENKGLNDYIRSVAGRFGGIGYSALAIDLLSGQGGTATFAD
PAEATAALSKLPPEEAVADLRSGIDELSRRVPDRKLAAVGFCMGGGMVWR
LLAAGEPRLAAAVPFYGPTPENPDFSGSKDVAVLGIYASQDQRVNASEPV
ARAALEKAGMVFELVTEPDANHAFFNDTGERYNAAAAADAWKRVQEWFSR
YVD
119868824YP_938776.1 group 1 glycosyl transferase [Mycobacterium sp. KMS]MRGRATHRSDRFPRGMRVVQVANFYGPRSGGLRTAVDRLGAEYCAAGHEV
YLVVPGHRTEHQRLATGVTRITLPARLIPFTGGYRAVLPGPVTALLHELQ
PDAIEVSDRLTLRSLGGWGRRHGVATVMISHERLDRLVGQVVPGRVARAV
ADIANRRTASNYDTVVCTTAFARREFDRIDATNVVTVPLGVDLDQFHPRR
RSDQMRRRWAAPDQTLLVHCGRLSVEKHAHRSIDAVAALRHSGVDARLVV
VGEGPLRQRLERQATGLPVDFTGYIGCRDTVAGILASADVALAPGPHETF
GLAALEALACGTPAVVSRTSALAEILTADSGAAADNDPQAIADAVGRVIR
VPETVRRINARRRAEQFTWPRAAEGMLGAMCAGDVGTV
119868822YP_938774.1 HAD family hydrolase [Mycobacterium sp. KMS]MTNSHSTAGSAPAVLFDIDGTLVDSNYLHVHAWHRSFADEGLTVESWRVH
RCIGMDGSTLLDNLVPDADDDTRKRLKDGHSRYYLDDRGLLRLLPGARAL
LERIKELGLQVVLATSAPEDELDVLREVLDSEDVYSAMTSGEDVDTAKPQ
PDIVHIALERAGVDAEHAVFVGDAVWDIEACRRAGLTSIGVLSGGVSRGE
LTEAGARAVFENAEDLRVHIDESPVAALLSRADTNSQAKA
119868820YP_938772.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAEHVKRRYRSDLRAAQAQETRRRIVAAAARLFVENGYGATTMDGIADAA
RVSRKTVFTSVGGKIELLRLAMDWAVAGDDADVPVSDREEMRRVLAGDDP
AEILRGSAAVSAGINARVADLFRTLEVAAGAEPEAQALLTATREQRLADA
RTVARRLRSLGLLTGRKAYEEAIDLIFLATDPHPFDVLVRQRGWSPTRYT
RWLGDSLIRQLSGG
119868818YP_938770.1 cytochrome P450 [Mycobacterium sp. KMS]MGIAARENGSVPPDVPLADIDLGSWDFWALDDDIREGAFATLRREAPVRH
FSEFVADGMEAGRGHWALTRYDDVFYASRHPEIFSSASGITIGDQTPELN
EYFGSMIAMDDPRHSRLRNIVRSAFTPRVLSRIEDSVRDRARRLVAEMVA
ANPDGTGELVTDFAGPLPLQIICDMMGIPEEDHQRVFHWTNVILGFGDPD
LTTDFDEFVGVAMEIGAYASALAEDRRAHPGDDLTTSLVQAEVDGQRLTS
GEVASFFILLVVAGNETTRNAISHGLLALSRYPDQRRIWFSAYDELAPTA
VEEIVRWASPVSYMRRTLTCDAELGGVKLVAGDKVSLWYGSANRDESKFL
DPWTFDVRRHPNPHVGFGGGGAHFCLGANLARREITVAFEELHRQIPDIT
ASEEPSRLQSAFIHGIKRLPVTWTPPR
119868816YP_938768.1 hypothetical protein Mkms_2784 [Mycobacterium sp. KMS]MRNPHAGQPFTDPDERIADALLDVSIPTLMMSLVHMSGDASLIRGALRPA
GLFLNEVQGYMSEEDKAAVRALALPIIADYRDRGCPEPAPIRPELLHEMM
QWLVCEEVPAEYVPMLLEEMELDGRDDRAVPPPADPARAEFPVLVIGCGE
SGLLAGIRLKEAGIPFTIVERNTGVGGTWWQNTYPGARVDVGNHFYCYSF
EPSDRWTHFFAEQPELQAYFQEVFDRHEMSPHVRFGTEVTELVWDEDTGT
WTAHMRELEGAVTSVRARAVISAVGQLNRPHTPAIEGQHDFGGPAFHSAE
WDHSVDLRGREVAMIGAGASGFQIAPAIAPKVNRLTVFQRTAQWMFPNPN
YHAPVGDGVRWALRHLPFYGRWYRFLLFWPGCDKGLAAARVDPDYPDPQR
AVSEVNDIARMMFTEWITSQVGDDADLLAKVLPDYPATGKRTLQDNGSWL
RTLTRDNVELVRTGIARIEPDAVVTEDGTRYPADVIVYATGFHANRMLWP
MRVVGRGGAVLGEVWGERPSAYLGITVPEFPNFFCMYGPGTNLAHGGSLI
FHSECQMRYIAQCLELLIDGGHRWLQPREQCAQDWCRRTQEELGRLVWSQ
PSVEHSFYKNSHGEIYTLSPWRLVDYWTWTRRPEPRDFEFG
119868814YP_938766.1 short chain dehydrogenase [Mycobacterium sp. KMS]MTPPTQTPGTTKSIFITGAGSGMGRAGAQLFHDRGWRVAAVDRNEAGLAE
LTAERGGDRLWTRQVDVTDKAQLEAALADFCGDGGLDMMWNNAGIGESGW
FEDVPYEAAMRVVDVNFKAVLTGAYVALPYLKRAPDSLMFSTSSSSATYG
MPQIAVYSATKHGVKGLTEALSVEWQRHGVRVADVLPGLIDTAILRETPN
RSGRAPSDGPGADVTASAPRRGPFRLMPAVSVAEAAWAAYRHPTRLHWYV
PNSIRWLDRLKAVSPELVRGQIRKALPRLIER
119868812YP_938764.1 hypothetical protein Mkms_2780 [Mycobacterium sp. KMS]MSTPDRPVFGDDAPEADVVEQLIPVDVDDEDEGGLDPARVSLSRNLEADE
ADLIEQSIAVPLSDDDPDLDR
119868810YP_938762.1 agmatinase [Mycobacterium sp. KMS]MGHAHDREPQRDVPPGMAEQLDLPHSGMATFGHRPFLTETAQLDSWRPDV
AIVGAPFDVGTTNRPGARFGPRAIRATAYEPGTYHMDLGLEIFDWLEVVD
FGDAYCPHGQTEVSHANIRERVAAVASRGIVPVVLGGDHSITWPAATAVA
DVHGHGNVGIVHFDAHADTADTIEGNLASHGTPMRRLIESGAVPGTHFVQ
VGLRGYWPPQDTFEWMLEQGMTWHTMQEIWERGFQEVMRDAVAEALARAD
KLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRRLCYEHDVAGVDV
VEVAPAYDHAELTVNAAHRVVFEALAGMAARRRDAAGAQPGPPAR
119868808YP_938760.1 hypothetical protein Mkms_2776 [Mycobacterium sp. KMS]MTPSDPASPGSGRLTICDRAQIPGAVDGAWWPRSADLGDELPDLVAVLSR
LIGPIRRVVYDPSSWTSAPSRVIHRNHAVAVDAYRLVANDTIYLVGSHSR
DALLYVIGAHVPPPAARTVLDTVDGGRESIGVALLRRLTHREPAAAGERQ
DDTAL
119868806YP_938758.1 hypothetical protein Mkms_2774 [Mycobacterium sp. KMS]MRAAILAEVTASDVSRAAPLLRTALRLSIIAAVVAAVVLVELTSRSGVLW
RLVTFTYQANLLAAGFYVMTLLSPRADTRSALRGAVVLYVVIAGLVWNLF
LTDYSMGYTPANFLLHVVVPVLALAEWGLATAGRSDLRWWHPWAWLAYPG
CYVVIALAVLNQAGRRAPYYFLDPGSVGTFAVGVNIGLLGAIFLVLGYVL
MAFGRTRRRVDPMRG
119868804YP_938756.1 fatty acid hydroxylase [Mycobacterium sp. KMS]MTTHHASRPARRAFTLADAAREFRRHPSPWLIAGTLIAATCARLAVGDWQ
ATEILVPVAMVAVFPFVEWVVHVCILHWRPRRIGRLRVDPLLARKHREHH
VDPRVVSLIFIPWQALMWVLPVALAVALLAFPRLGMGLTFLVSLTVLGLV
YEWCHYLIHSDYRPKTTAYRAIWRNHRQHHFKNEHYWFTVTSAGTADRVL
GTCPDPAAVATSPTAKNLHATPGR
119868802YP_938754.1 hypothetical protein Mkms_2770 [Mycobacterium sp. KMS]MNNRIVMVLGAVSVVTLSACSPPEPALGTRTAQVSVNGQETAKIPVECSQ
AGWTWLISDFGEETPGFSASVSTGENVAAHSVEIRDLEGFTGAYWEGTVG
DGKATIDKSVITITGTAKGSFADNPTGAAEAKYEITTRC
119868800YP_938752.1 hypothetical protein Mkms_2768 [Mycobacterium sp. KMS]MKTAGQEIPRWLRFVLASDRAGSAWYIGAGFFFAPALALVSPWPALTTAL
WVLIGLAGLWLGLLGIAMATGLAIVLRSNTEIPEDYWRSIIDYPATPTVR
QEVSRQSRCSRPASV
119868798YP_938750.1 hypothetical protein Mkms_2766 [Mycobacterium sp. KMS]MAIEIRRTAACAALGMGIGLGIFVAAPTAGAEPVPAPAPAPGPAPAPAPA
PIAAASAAPGDVAALAAPAPADAGVPHLYSPDNPPPGTTTTPTAPTGSRG
LSYLRDLWHAVQTQEVSGSDAIFLLTQRPLDPAATPPPGVPAGPQAPVAP
APEPVPPPAPAPAPAPAPVP
119868796YP_938748.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MATPRERMVRSAALLIRERGAHPTAIADVLAHSGAPRGSAYHHFPGGRTQ
LLCEAVDYAGDRVAEQIEQAPDSLALLDGLFAGYRELLTRTDYRAGCPVV
AVAVEAGDPDKPEQSEPVIARAATAFTRWTALIADRMTADGIDAERAAEL
AMLLLTSFEGGIVVARAARDVGPLDVIHRQLRTLLQDALGKDRS
119868794YP_938746.1 hypothetical protein Mkms_2762 [Mycobacterium sp. KMS]MSDSPRPRRTFLHRTAIGFVTAAGAIAIAPSAGAQPSEPATDHNGYVGTA
AYCQGSAAAVAFGRTADALVAICKVPDGQLQYRGVRLSDESALMLTATAD
DSGGFTAENGSVVYDVSSAELVVTDGDTTLYRQSMVQYYAPAD
119868792YP_938744.1 HAD family hydrolase [Mycobacterium sp. KMS]MVPRSLTLAESVDEIAGGPGGPRVGVFFDLDGTLVDGFTATAHAGDRIRR
RQASLGEVLGVLEASVRYRLGRMQFERLVGRAAGYLRGESLAELDELGQR
LFVERVAARVFPHMRQIVVSHQRRGHTVVLSSSALTIHAEPVARFLGIDH
VLCNHFAVDDAGRLTGDIVRPVIWGPQKAVAVERFCGANEIALTDSWFYA
DGDEDVALMELVGFPRPVNPRPRLATTAAVHDWPVLQLTRMRRRG
119868790YP_938742.1 anti-sigma-factor antagonist [Mycobacterium sp. KMS]MARQVQSQPGEHELRARSARRATHAGGGPLEEQREAAAGATSAADSTNCE
INERWVDRNVVVSVAGVVDMLTAPQLEQAIRAGLAKEPAGLVVDFSAVEF
LASAGMGILVAIHDELSSGVTFCVVAEGPATSRPLKLLGIADIIPLYASV
DEALAALSA
119868788YP_938740.1 dihydrodipicolinate reductase [Mycobacterium sp. KMS]MAIRVAHVGTGNVGRLALAALLGNPAYELTAVGVSTDAKVGKDAGELAGL
DVVTGITATKGLDEVLATAPDCVVYCAMGDTRLPEAMADCRRILEAGINV
VGSAPGVLQYPWGVIPDKYIDRVQDSARQGGASIFINGVDPGFANDLIPF
AFASTCSSIEQIRCMEIADYATYDGAEVMFDVMGFGKEIGDLPILFQPGV
LSIAWGTAIRQLAAGLGVEVTEIRDSVEQEPAPEDFDVAVGRIAKGTVAA
VRFLIEGWIEGGEGRPAIVIEHITRLRDDLRPDWARPAQPGGSYRVEIVG
EPSYTVDICPTSRKGDHNHAAIVAAAGRIVNAIPAVVNAEPGIRTPLDLP
LITGSGLFATRG
119868786YP_938738.1 hypothetical protein Mkms_2754 [Mycobacterium sp. KMS]MGAPLGDVARSLTALGACLVPPAELNRALGVTSEVWNTFGRHWDDLRPDR
YAAELGTRRLRRYGYFCFRTADGVLERLPHGVFVQPEQSNHLYVDRDRLF
EPLTESFAADQVLHAVMGLLGGVAQALDDPPRWHVKVTPFRVVAGADVHG
DPTPEGLHRDGVTLVSSLMINRRNATGGESSVFDTAGNPVLTATLTEPGT
LLVGDDRRTLHRVTPIHPDDPGLPAHRDVLVVTFAS
119868784YP_938736.1 hypothetical protein Mkms_2752 [Mycobacterium sp. KMS]MTTTLTRIRPDLFQTRTDSPFPGLTTHAYLWTGGPTGNVLFYSTATDSDF
DAIADLGGVTDQYLSHLDEAGPMLGEIAQRFGSRLHAHAAEAPAIARHAT
IDVELSARGIDANGVEVIPTPGHSPGSVCYLVRGAAGATYLFTGDTVFPT
EKGTWSTFLPPGRGDAEALRSSVALLGTLEPDLVIASAFGGPDAVQAVDR
ESWSTIVAQALASVPSVSASTSC
119868782YP_938734.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MTPPIARPKLEGNIAVTADRQIGFAEFGHPQGRAVFWLHGTPGARRQIPA
EARAFAEEQRIRLIGIDRPGIGSSTPHQYENVLAFADDLAVIADTLGIDR
MAVVGLSGGGPYALACAARMPERVVGTGVLGGVAPTVGPDAIGGGLMTLG
TRVAPFLEIAGGPMRLAAGTLIRFVRPVADPALYLYAAVSPAPDRRMLVR
PEFRAMFLDDLLNGSRKQLSAPFADVVVFARDWGFRLEEVKVTVRWWHGD
VDHIIPFAHGQHCVARLPDAHLYHLPGESHLGGLGQAQAILGSMLELWDR
ADRT
119868780YP_938732.1 fructose-1-6-bisphosphate aldolase [Mycobacterium sp. KMS]MANQQQTDKLAAGKGFIAALDQSGGSTPKALRLYGVEENEYSSETEMFDL
IHKMRSRIITSPVFTGDRVLGAILFEQTMDREIEGKPSAAFLWEDKGVVP
FLKIDKGLAEASDDVQLMKPMPQLDDLLKRGVEKGIFGTKERSVIGGANA
KGIAAVVAQQFEVAKQVLSHGLVPIIEPEVTISIDDKAAAEDILRDEIAK
NLETIPSGQQVMLKLTLPSTANHYRPLVDHDKVLRVVALSGGYSRDDANK
KLAENSGVIASFSRALTEGLSAQQSDEEFNATLDAAIQSIYEASIAG
119868778YP_938730.1 pyridoxal-dependent decarboxylase [Mycobacterium sp. KMS]MPDRTAGLHAAVRHAETYLAGLDERPVGAAATAAEVRDRLGGPLPEHPTD
PAEVIEALATGAEPGLVASAGPRHFGFVVGGALPAALAADWLVSAWDQCA
AFHALSPAGSAIEDVAAGWVLDLLGLPATASVGFVTGGQGANTTCLAAAR
QAVFAAAGWDVERDGLIGAPPLRVFCGEQAHATIHTALRLLGLGADTAVR
IPADGQGRMDPEALRHALDDGAGPAIVCAQAGNVATGAFDAFEPIAEACA
AHGAWLHVDGAFGLWAAAAPRTRHLTHAVERADSWAVDAHKWLNVPYDCA
AAIVAHPDAHRAAMRLTGPYLVADPGQRDNTTYVPESSRRARSVPVYAAI
RSLGRTGVADMVERNCAQARRMAEHLRAIPGATVLNEVVLNQVLVALPGG
DEANRAAVAAIQRDGTCWLGGTTWQGAHVLRVSVSNWATTDDDIDRSAAA
IAAVAATGQMPTM
119868776YP_938728.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MTVSALSAKGLAEPANLSERVIDLRRGGRALAGSYLYQGDGLITGWHSHD
VHQIEYAIGGVVEVETPSGHYLVPPQQAAWLPMGLEHQATMNADVRTVAV
MFDRALIPDGGNRARILAVSPLIREMMIYALRWPIDRRAGAVRDEAAADA
FFQTLGNLVIEALDHEAPLSLPSSEHPIVAAALAYTREHLQAVTADEVSR
AVAVSERTLRRLFAEELGLSWRTYLLHARMLRAMALLAAPGQSVQETSAA
VGFDSLSSFTRAFTQFCGETPSAYRRRAATTAV
119868774YP_938726.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MRSLRKIGRELAATARSPTVSYAGRSRRVRPVDFDLDLPSGRVHARSWGA
DDAPILLCVHGISANLTAFTYLADRLAGPDRRVVAFDLRGRGRSEITPPG
SYGLDSHARDVLAVADALGADAVDLTGWSLGALIAMRVARDDGTRVRSVS
LIDHIGPAQRAALAPVRAGFARLDAAVPDPAAYLDSVRAAGIVDPWTPFW
DEHHAYELAEQPDGTWRPTTSRAAAEEDLFQRWPTDWTDHWRALTMPAVA
VRAMRPLNGAVLIGDEAVADLRATNPAVRVVETPDSNHFTCIVDPVTAEA
VGSVLR
119868772YP_938724.1 hypothetical protein Mkms_2740 [Mycobacterium sp. KMS]MLVLLPPSETKRDGGDGPPLRLDRLSFPDLDPVRKALLDELVDLSADREA
SRGALALSPKQDAEIERNAVLHTSPTLPAIDRYTGVLYDALDIGSLRGAA
AARARQRLAIGSALFGLLRADDPVPAYRLSASAKLPASAPLSARWRPVLE
PVLADIAAQEVVVDLRSGSYAALGRLPDAVRVDVLAEHPDGRRTVVSHFN
KAHKGRLARALATTRAEPSDAAAVATVARRAGMRVERDGADLVVFVPA
119868770YP_938722.1 type I phosphodiesterase/nucleotide pyrophosphatase [Mycobacterium sp.MQLPQSNPDLPHLADVVPSVLAAMEVPGFDARIDLPTGIGSACVLLIDGL
GAELLARHADDAPVLSGLRGDTLQVGFPSTTVASLASVGTGCRSGAHGMV
GYTFRMPGTGVVNPLRWRPHPWGEDLRESMPPETVQPMPTAFERAASAGV
AVHVVSNAEFAGSGLTRAVLRGGRFIGVHGLGDLAASVRRALTDGGFCYG
YHGDLDLLGHLYGPGSTAWRLQLRQVDRLVESVVTGLPPGALLAVVADHG
MVEVDPGRTLDLDACAPLFDGVEAVAGEARARYVYVAEGATATVLAAWRE
TLGDRAWVTTRDEAIEAGWFGARVADEMRPRIGDIVVAARDSAALVRRTV
EPMESALRGQHGSLTDAEQRVPLLLAHA
119868768YP_938720.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MDEVFKALADPSRRRLLDSLNLRDGQTLRELSAGLEMTRQSVSKHLTVLE
AAGLVTTQRRGREKLHHLDAEPINALFDRWIRQYDRGRATSATGPEASPV
PPEIDTQAFTYTTYIRTTPERLWQALTGPSFSGRYMGHAMVSTWQRGAPY
TWVDGDLEVDDPGLVVLEADPYRRLAFTFPAAVPSTVDVDADALPPEPNS
RVSIELDSRGDQVELTLTHDGFIANSVVRQYMSKMWPRKLADLKSGLEHR
119868766YP_938718.1 response regulator receiver protein [Mycobacterium sp. KMS]MMTPSTRPIDVLLIEDDPGDELITREAFEHNKISNTLHVAHDGQEGLDFL
YRRNGYENAPRPDLILLDLNLPKYDGRQLLETVKSDPDLNHIPVVVLTTS
SAEEDILRSYKLHANAYVTKPVDLDQFMNAVRQIDEFFVQVVRLPQS
119868764YP_938716.1 response regulator receiver protein [Mycobacterium sp. KMS]MLAPHDSELRPVPDSAVAPMTQFDTLTVLLVEDDRGDALLVEELISDAVA
DIRLRWAESMADAAREIRSGRPDCVLLDLNLPDANGTDAVDKICGLDPTL
PIVVLTGNVDDHYGVSAVASGAQDYLVKGNVEPEMLRRSLLYAIERKRSE
LTAVDLHASHLRAQENARLERGLLPSPLLLENPGVDIVAKYRPGRPNALL
GGDFYDFVQTPDRTVHVMVGDVSGHGPDEAALGVALRIGWRALTFAGLRG
NERMQQLERILRAERPGPGIFATVMSLAFSPRDRSFTAVRAGHPGMLLHN
RTGNSVDWLEPPAGPALGLGGAAWPLTELELPAGHGLLLLTDGLFEGHSG
EGNERLGEEGLLGLARTVAGLPGPQFVEALIDRAEDRARRHGGLTDDIAV
VRVERTT
119868762YP_938714.1 acyltransferase 3 [Mycobacterium sp. KMS]MRSGEIKALSGLRIVAAVWVVLFHFRPLLAQAAPDFTAALAPLLDCGAQG
VDLFFILSGFVLTWNYLDRMGQSWSTRTTLRFLWLRLARVWPVYLVTMHL
AAAWIIFTRNVGHVPSPAVDQLTATSYLRQLLLVQLWFEPYFDGTSWDGP
AWSISAEWLAYLLFGVLILVIFRVARVSRARVLLWVAIAASLPPTLLLLA
TGEFYTPWSWLPRIVMQFTAGAFACAAVRKLRPTERTRRAFGWLALLIGA
TIVGSLYYLDANPPASVRDASGLVDVLFVPLVVALAVGAGTLPRLLSARP
MVYCGHISFGLYMVHELVHTAWNWAVVQFEITVTPGWTGTTVVIGLLGVA
VVGAVALYHGVEEPARLWMRRMVDVRDSTSSSVGGRSAPTPDAEREEHTD
HVPVRVG
119868760YP_938712.1 catalase/peroxidase HPI [Mycobacterium sp. KMS]MSSDTSDTRPPHSDSGTQSNSESENPIIDSPEPKAHAPLTNKDWWPEQVD
VSVLHKQNDKGNPLGEDFNYAEAFAQLDLEAFKRDVIEVIQTSQDWWPAD
YGNYAGLFIRMSWHAAGTYRIFDGRGGAGQGSQRFAPLNSWPDNANLDKA
RRLLWPIKQKYGNKISWADLIAYAGNAALEQSGFKTAGFAFGREDIWEPE
EMLWGQEDTWLGTDKRYGGTNEDKRELAEPFGATTMGLIYVNPEGPEGKP
DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGAADVNVGPEPEG
APIEEQGLGWKCPFGTGNANDTVTSGLEVIWTGTNSEWSNRYLEILYGNE
WELTKSPAGAWQFEAKNAEATIPDPFGGPPRKPTMLVTDVSMREDPIYGQ
ITRRWLDHPEEMDEAFAKAWYKLMHRDMGPISRYLGPWVAEPEIWQDPVP
DVDHELVDESDIASLKSKVLESGLTVQQLVKTAWASASSFRGTDKRGGAN
GARVRLEPQRSWEGNEPAELAKVLPTLEQIQQDFNASASGGKKISLADLI
VLAGSAAVEKAAKDAGYEIDVHFAPGRTDASQEQTDVESFAVLETKADGF
RNYIRPGQKTSVEKLLVEKAYLLDLTAPEMTALLGGLRVLNVNHGGSKHG
VFTNSPGALSNDFFVNLLDMNTAWKPSENTENVFEGRDRATGEIKWTATA
NDLVFGSNSVLRGIAEVYAQDDSKDKFVEDFVAAWVKVMNNDRFDLEKF
119868758YP_938710.1 hypothetical protein Mkms_2725 [Mycobacterium sp. KMS]MVAKLELTRELSLDPDDAWTHASNLAELGDWLVMHEGWRSELPDELTVGT
TIVGVAGAKGMRNRVTWTIKQVDPPTLLQVDGKGVGGTKYGMKMAVRPTS
SGCAFTVTLELGGAPLFGPIGAAAARAVKGDIERSISRFEELYV
119868756YP_938708.1 hypothetical protein Mkms_2723 [Mycobacterium sp. KMS]MHDMTIDGLTPEELSAESAIALPDKEVVSILDLNADVDVAIDAASPIDLA
AAANLNVAAPIDAAAGANVLSYGSGAQAVVDQGAMIDQNLEADAYASSTQ
VSGIDQGGMDTDADEVPPTDGTGTGTDTGTDGTGTTVDTSPAALLDGNLL
NVNVNVDLDADLAAPISGAVAANANVAAPINAGVAANIGSVDSDAISVAE
QDAIITQNLEGSATAISNQDSEISQGDSDAGDTTGGTADAGTDSGTGGTS
SADSGGSSDSGGSGSTGSSGDGGGSTAG
119868754YP_938706.1 hypothetical protein Mkms_2721 [Mycobacterium sp. KMS]MGASCASGGVQRRVMRYLLIALYLGGWLLTTVLLLRRQFGDDERGRRDRL
VFNTVSVLCAVALAAVWPLSGWFLPLIRAALGRRDEE
119868752YP_938704.1 MOSC domain-containing protein [Mycobacterium sp. KMS]MIVVALHTAKARRLPVRSVDEVVAEAGLGLVGDRYHGTRHRHVSIQSAEL
LDLAARDLGRDFDYGATRRNITVDAGDIPTRPGTRVRIGEVELEVVRILA
PCRLLDDDIGAGAAAALRRRAGSACRILTSGTIRIGDAVTITEPPAEG
119868750YP_938702.1 NLP/P60 protein [Mycobacterium sp. KMS]MRRIYAVVICLALSLATAGTASAELFPLPTRNQQAVDLVIARALSQRGVA
FAYGGGNTAGPTLGNPGGSSAPAPAAPPPGAIPVDGTNGAIPIAGLPAAA
PALVLPEPPRPQVVGFDASGLMVYAFAGAGLKIPRTSGDQYLVGRKVLPS
QALPGDLIFYGPNGTQSVAMFIGGGQMVEATDPVVQVSPVRTNNMAPYLV
RYID
119868748YP_938700.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAVPKGVETDADASVAPPRGRRRDPRTQQDILSATRRLLVRDGYDQVSVD
AVAREAGVSRPTVYRRWPSKAHVVFDAAFQVNGSSEIAAGTGDFTADLRR
FLRSVVEFWREPVVYAATLGILAERHRSPELRIRAQQLLDEATRTRFTAL
VRDGIAQGAVAADMDADSLYDTVIGSTFYAVYVRDVTDGADLQAYLTHLC
SLATQGAADRDENR
119868746YP_938698.1 hypothetical protein Mkms_2713 [Mycobacterium sp. KMS]MTARVARPAPIAFDDLAAPVYPEAARPLRDGLAAYGATLDLSPQALMSTA
VDRAGLTDFGEDGFRDRLGVLCDALDTEAALSDAGRAVAFEQLTQHLVNR
LRLQDLITRHPEILTVPIERPIIICGLPRTGTTHLHNMIAADPAIRYLPY
WESLEPVPAPGEDDPQGRRERCAAGLDLVHTVMPEFRRMHDMTVDHAHEE
IQLLANDIGGMLFETTFHVPRFADHYKAHDQSASYAYLKRTLQALQWQGG
GTRWVLKSPQHLEQFPALASTFPDATFVLTHRNPAEVIQSMATMISYAAR
MSCEHPDPIERTRYWVERSADLLTACVRDRDVLPADRSIDIRFEDFMADE
EATLAAIYAVAGQPFDDRARSAMAEFRADHPRGRHGGVIHRPADLGLDVD
QVAARLSDYQRRFVAS
119868744YP_938696.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MDQPPARPRGGRCDPVGEDRQVIPPRPTIPALLARSAREFGDQAYVISPT
ERLTYGDAERRSAEVARWLLGRGVGKGVRVGLFFPNGVDWIVWWLAVSRI
GALAVPLSTMYTPAELAKVVRLADVALVVGPSAVLGIDVAQRFEEAFPGL
ADQPAGRLALTQAPYLRSVVLTGGADRPWVTPHDSSEATVSREVLAAVED
EVSPADLAVMVHTSGSTADPKGVLHTHGTVVRQTSGWPAAVRAVTGSAGP
VRILCAMPFFWIGGLLAATGALHEPVTVLVLPRLDAQTALDLIERERATG
LVGWPAFTQRLRDHPSFAARDLSSAPMLRDGPLDIAMTDVPDGYPVHRTM
SETAGGFAFTEMAIVDDEGQAVPEGTVGELLVRGIGVMAGYNKRERAETF
DADGWYHTGDRVYRREGDPRLFYVGRTSELIKAAGANVSPLEVEAVVEQF
PDVVQCVVVGVEDPERGEQVCAAVVPARGEIDVTDLSARARTQLSAYKVP
TRWAVVGADQLPVLASGKLDRKAVKKMIADGVLPSVAPT
119868742YP_938694.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MTLVTYELADHVATITLNRPEARNAINGALREDLNAAWNRFREDEDAWVG
ILTATGDVFCAGGDLKDGAGSVGTFAGTFWEKPTINSFESGMELFKPTIA
AVHGPCVGYGLTGVLFCDFVIASTAATFSFPEVSLGVPTIVGAIRLPERV
RWADAMELLLTGKPMTAQRAKEVGLVWRLVEPENLQAEAQAWARTLTEAA
PLAQRATKEVAWRTANMGWIESVRFGETMRKVAAATDDVVEGIQAWRDKR
KPQWKGR
119868740YP_938692.1 aldo/keto reductase [Mycobacterium sp. KMS]MSGDLLIGDAPFSHDPWVARRERYDSMPYRRVGDSGLLLPAISLGLWYNF
GDNRPFDVQREVLRYAFDRGITHFDLANNYGPPYGSAEENFGRMLRRDFK
PYRNELIVSTKAGWDMWPGPYGQLGGRAYLLASLDESLDRLGLDYVDIFY
SHRIDPTTPLEETVGALDTAVRAGKTRYVGVSSYSAAKTAEAAAIARRLG
TPLVIHQPSYSLLNRWIEGDLTTELRNAGMGAIAFTALAQGLLTDRYLQS
DPSEIDRATARPTFNDEHITDRVREQLRGLAGIAERRGQSLAQLALAWVL
RDPTVASTLVGASSVAQLEENLGALDNLDFTADELAEIDRYATESGIDLW
RESSDV
119868738YP_938690.1 hypothetical protein Mkms_2705 [Mycobacterium sp. KMS]MRRLDLVIGPNGAGKSTFVAFTLAPLLPGSPFVNADEIARQRWPDDAEQH
SYEAARIAAATRSALIRSGRSFIAETVFSHPSKLDLIAEAHGRDYTVVVH
VLLVPEDLSVERVRHRVLAGGHRVSEDKIRERYRRLWDLAAQAIESCDSA
TVYDNSRRRGPRIVAQFTGGEPIGAPAWPEWTPAPLVQHWPA
119868736YP_938688.1 hypothetical protein Mkms_2703 [Mycobacterium sp. KMS]MQRDQLDAVVTADRARSGVLMAITAQVSVQMGMAVAVGLIDRIGSDGTAW
LRLAWAGVLLLVVVRPRPSAFTWRTFGMCVVLGCVSAAITLLFMASLDRI
ALGTATALEFLGPLAVAVVHGSGRHRVVWPGLAAVGVVLLCRPFDGGIDV
KGALLAIAAGVCWAIYILLTQRVGDQVSGVNGLAVSMPVAGVVSSLFVST
AVFERMTPQLLLIGLGMAVLLPVAPYVLELLALRRLTTAAFGTLMSLEPA
FAMVVGFVLLDQAPGVAGILGIAAVVVAGIGAARGGGREMAVPLEVG
119868734YP_938686.1 acetamidase/formamidase [Mycobacterium sp. KMS]MDHVRFVPSPEQFAYTFGGAAPVMRITPPTVLTLWTEDAYGGRITSTSDV
ATRALDTLDLNPQTGPFWIDGAEPGDTLAIHLVDLTPARTWGASTLIPFF
GGLTSVPVSPTLQDPLPERTYIYEYDSAAETLAFSAQGSDFELALPANPM
LGTVGVAPGRREVRTSLVPDVFGGNMDTPEMAAGATCFLRVNVPGALFSL
GDGHYRQGEGESCGTAVEGAMHVTVIVDLIKGGGPAWPRLETDTHLACIG
SGRPLEEAWRAGQVEMITWLGELHGLDRIDAYQLLTQISLAPIANVVDTN
YSSVTKIDKRLLPTVAVYDGIHAELRSAAASFGTITY
119868732YP_938684.1 FKBP-type peptidylprolyl isomerase [Mycobacterium sp. KMS]MADLLPPSAPVTSAAASTCPTAAPADGEPEWTFSGATGSVSVTGSTDAAA
PAVEVQAPFSVTETQVHTLKAGDGPVVAETAAVTVCYMGVNGRDGSVFDS
SYERGEPVDFPLDGVVPGFQKAIAGQKVGSTVAVAMTSADGYPEGQPAAG
IQPGDSLVFAIKILDASG
119868730YP_938682.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTKSDGVDTAARPRGAVVTGSILSAARDLIDQHGLESLTAEAVAAHAGVG
KTTVYRRWPNVWALVVDAFLEDVSAVAPITEGDTVRESFRTSMRSLIKAY
RGPTGTLLRAVIGRAQVDDVLREEVRNRWVEPRRESARELVRRGMDHGEL
RSDLDIDVVLDTLYGPIYHRILVPYRDADLTEGFVDRIVDHVFTGIERAR
119868728YP_938680.1 hypothetical protein Mkms_2695 [Mycobacterium sp. KMS]MTSVGRRLVATSSVAAVAVFLAACGQDNSEAAPPSPSAIATGPAPISGPP
EALVVEMVIKGGTVTPANARMQGTVGEPIVLRVDSDTTDELHVHSVPEHS
FTVEPRSGQEFQFRTEVPGNVEIELHDLNQVVATVQVGPGS
119868726YP_938678.1 hypothetical protein Mkms_2693 [Mycobacterium sp. KMS]MLSRAGVAEAVRSRLWPLPMFALAAALACGIAMPEVDAALDTRLPGAVER
ILFGGGADAAREVLSAIAGSLITVTSLTFSLTLITLQLASSQYSPRLLRT
FAADQVVQRTLALFLATFVYALTVLRTIRSNDESADFVPQLSVTIAYVLA
VVSVGALVMFLAHLVRQIRVESLLDQVCGDTVATAARMLRRREDGDAGTG
DPQAVTPPGRGVVIESGTSGFLVEIDEADLLATAVRHDVVLRMDRPVGSP
LTAGVPAARCWPGPGTQLDDQALRDIRQHVSAALRTGPERTSAQDPEYGL
RQLVDVVIRALSPGINDPTTAVHGLHSCTVALSELLGYHLGPHMVTDEHG
DVRVVIIRSSFAELLALVCAQPRLYGADDPAVRYAMLTLLHDLAWKATLP
DHRAAIAEQLTHLRRVAPQDVGTVDAQRTELLYREVLSVLDRQRDEDQER
S
119868724YP_938676.1 hypothetical protein Mkms_2691 [Mycobacterium sp. KMS]MSAHNRTARARRFAVLAAAVAAASAATGCSDGYSALGTHTAEVLINGVDI
GERPRIRCEQVEWVWYVETLRETPGFGAQVKTGATVEPRAVRIDDLGNFT
GSFWEGTIGAASASIVEGTLILTGTAEGYFHDAPKEKATARFAIRTDC
119868722YP_938674.1 hypothetical protein Mkms_2689 [Mycobacterium sp. KMS]MGLTPTHHFNTSLVIITAVALATSGCGEDPPLGSSNRGSGSETERTSVEN
AFIVPTFLPGRCAIQLDAGAEMRFTVANGDPTESERLLSVSTSASSDGDI
ASGVEIPAESTVSFGQPTTAAVDGGGTVSAVQLGRLAPNLTPGMSASVTF
HFDRAGDIEMPVPVEACPTQQK
119868720YP_938672.1 FliA/WhiG family RNA polymerase sigma factor [Mycobacterium sp. KMS]MTVHAHPEATSTPGIDTPYDGNDVDVDRLFDRLAESADDSERERWRRHII
TACVPIADHIAYRFVGRGEPSEDVIQVARIGLIKTVDRYDPDKGHFLAFA
VPTIRGEIRRHFRDNTWTVRVPRKVQETQLRMRDAVNTLSQRLNRTPTGV
ELADELDVGSEELGDCQAATTAYRPVSLDAPLLTAQNDGDTVGSMQGGDD
PGYGRVEDLILLQEAISDLDPRRRAIVGMIFFDCLTQREVARRLHVSQVQ
ISRLLNDALARIRQRVNLDAAAALCVVGPFIGTV
119868718YP_938670.1 hypothetical protein Mkms_2685 [Mycobacterium sp. KMS]MIGLGLWTALIPFIGPGVGFAYAPDDESVWTALRGWLQVLPGVVTVAGGV
LLLLSRNRATALFGAWLGVVAGAWLVVGRAAAEPLGLGSVDAPVATGGAR
EFWLEMTHFTGVGALIMFLAALSMGRLSVRSLRDIRYEHASAGTLDTTDE
HRHDPHTDPVRASKSAETEQRPMRKRLEHLIGTNTSTAR
119868716YP_938668.1 deaminase-reductase domain-containing protein [Mycobacterium sp. KMS]MGLIDIELFATLDLVGQSPGSPEEDPVGFSFGGWQAPLLDEVSGAQVDTA
YEGTDALLLGRRTYDIFAAYWPHQQGGEDGAIAALFNSIPKYVASRGRPD
LSWDGTTQLGPDLVGEVRRIRDRHERIKVVGSLNLVQTLLREKLFDRLDL
WVHPIVLGVGKKVFDGGAVPTNLRLLQPPAASPTGTVYLRYGVADGIPAT
GDMSAPDRGVGDQPATA
119868714YP_938666.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAIEDRRERERAARRRLIVTTARRLAEAEGWDAVTTRRLSTEIEYSQPVL
YKHFTGMDAIADAVATDGFGELAEAIRAVRSQASTPSDALARIARAYLDF
ARENNAVYDAMFTRATALRFAAEDTPSQLASAFGELREAVALVAGEEDAD
TLTELFWAALHGLVTLGRAGRLRADHGTERLRLLVDQFTGRQRTNL
119868712YP_938664.1 NIPSNAP family protein [Mycobacterium sp. KMS]MFQLRIYTLRSPESLYRYASVHWARHSATFDAFGVTTHGVWAERGGGANR
LVALIRYPHGADPEQVTREVMASPEFAADMTGFDVDEIVDVESILLDPAA
FSPIR
119868710YP_938662.1 hypothetical protein Mkms_2677 [Mycobacterium sp. KMS]MAKRKWSDLSPKQQRAVVVLGGVETLATTAMLVDLARRPASKVRGPKLLW
RTLSVVQPVGPLAYFTVGRLS
119868708YP_938660.1 hypothetical protein Mkms_2675 [Mycobacterium sp. KMS]MLSRGVTEYDQDRFVSDAGYVNELNQNIIAEFRANAGVVAAYGGSAVLLL
HTTGAKSGQPRLSPLAYSLVGGRMLVTGSYAGAPRDPAWVHNLRAIPRAR
IEVGTEAYDIDARELLGEERDTAFREITDQAPVFADYQARTARTIPVFEL
HRV
119868706YP_938658.1 hypothetical protein Mkms_2673 [Mycobacterium sp. KMS]MTRPVRVAVQIQPGGAPDYRTWRDAVLAADDLGVDVIFGYDHFHRPAMKA
LVDGKPVLFDEQPDVANFEGWTALASWGEITSHAEIGLLVTGVGYRNADL
LADMARTVDHISGGRLILGLGAGWYEKDYTTYGYDFGTFGSRFDLFDESL
IRIENRLAALIPPPVRKLPILIGGTGPKRSLPAIARHADIWHAFQDLDAF
RRSSDRVDELAATFGRNGADIERSTLWGNPDGADAFREAGVTLFQTELTA
DDGYDLTSLKEVLTWRDNG
119868704YP_938656.1 hypothetical protein Mkms_2671 [Mycobacterium sp. KMS]MNKNTDMMDTTSAAADAALAVWLEMWNTDSEIARRICSEDFRIHFLNSDQ
DGSNPGDDVLGAQSFARFLDSYRDLHPDVVFTEVARAVDGAHGRMLWNVR
DGEVAAGGVDVFDFTEDGLIREVWSVGGTRAHLT
119868702YP_938654.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MARIALVTGANRGLGRATALALARNKIRVVAASRNGASGVVDDIVEAGGE
AIAVQLDVADLSSVEAARVAALAGIGQEWNASTIDVLVNNAGVGLFAPLG
AITVEDFDATFAVNVRGPLFVTQAFLPHLSEGASIVNVSSSLSRHVSPAA
SVYAASKKALEALTRSLALELGPRGIRVNSIAPGPTATDFNGGAMRDSEA
MRAELSGQTALGRVGDPDDIAEAICALVSREFRWATGERLEVSGGVLL
119868700YP_938652.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MLYIGLKSLCRRPDQRERRHVINSKFATQAELFGLSGKRALVTGGTRGIG
MMIARGLLQSGARVVISSRNAEACAHARKELSVYGDVWAVPADLSRHDEC
ERLADLVTAESGKLDILVNNAGAMWDEPLETFPDEAWNTVIDLNLKSPFW
LVQALLPALRSAGTADDPARIINIGSIAAIHIPARPNYSYSSSKAALHQL
TRVLAKELGPQHITVNAVAPGPFPSTMMAATLDEFGEAIAASAPLRRIGR
DDDMAGVAVFLASRAGAYLTGAIVPVDGGIATTA
119868698YP_938650.1 dienelactone hydrolase [Mycobacterium sp. KMS]MVVTREVTYEVDGLTMVGHLARPDGEGPWPAVLIGHDGIGLDDYQRGRAD
NLAEHGYITLAMDYHAGRTFFGDPQAMLDRVMPLMADPARMQAIGRAALD
VLLAVPGADHDRLAALGYGAGGRIVLELASAGVPFKALAAIHPGLPVART
EDWMNVGGAFLLCTGSEDPLCTPGQLFTFASALQNAGVDWRVNVYGGAKH
AFWAAPMQPDGSLTGGTTHVLATVPGVEYHAVHATRAWQAVLDLLDETLG
SLTRTGWRLSHLPGA
119868696YP_938648.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MTTATASQTWIITGASKGLGRALAEAALAAGDQVVAAVRNPDAMADLITN
FGDRVTSVQFDARDTTKAAGLVQAAVERYGRLDVLVNNAGRAIVGAAEEV
TDAQLRDLMDLHFFGPAALVRAALPIMRAQGGGTIVQMSSQGGRTSFPGV
SAYSASKFALEGWSEALAGEVARFGIGVMLVEPSRFRTAFNTADVLDFTA
VSPTYREILADVRADMAGADGNQEGDPVKAAQIIVSLAHSEEVPLRLPLG
AEAVERLTAAYRRSLEEVSQWAELARSADFADVPASMRPI
119868694YP_938646.1 4-hydroxyphenylacetate 3-monooxygenase oxygenase subunit [MycobacteriuMQHDPRYQDQLTFTSPTTGDLVNASFLVPRSVEDLKRRRAAIQTWADETN
GFLGRSGDYMNSSLTALGAAQTWFAKADPKFGERITAYYEYARENDLLAT
HTLIPPQVNRSLTGSQQGGGQLAARIVEERPDGIVVRGARMLATVAPIAD
ELLVFPSTVLRGTPEDAPYSYAFAIQNDAPGLRYLCRGSLHNGGSTFDEP
LAARYEEMDAVVVFDDVFVPNDRVFMLGHPDLCNAFYAETGAGALMTHQV
VTRTVAKTEFFLGLASEIGAAIGIEGFQHIQEDLAELIVDLEIGRALLRA
AEADGAINDWGVYLPRWETLNAARNWYPKVSQRFPQIIRKFSASGLMALP
GEADIASDARADIEQYLQGATVSGTDRVQLFKLAFDASISGFSSRQALYE
YFFFGDPVRMAGALVNGYDRDPARERIRKLLNEGRANLPHDTCSERVATL
AL
119868692YP_938644.1 hypothetical protein Mkms_2659 [Mycobacterium sp. KMS]MTIEPDSAKVSTGVAISVAEVIERSRKVIAVHLNYRSRAAQRGRLPGHPS
YFLKPPTSLALSGRPVERPAGTRLLAFEGEIALVIGRRTRRVSPENSWDC
VQFVCAANDLGVYDLRAVDKGSNLRSKGGDGFTPIGPQLLSARGIDPARL
RVRTWVNGRLAQDGDTSDLLFPFTQLIADLSQLITLEAGDVILTGTPAGS
SVVAPGDTVEVQVDSVEDPRLSTGRLCTPVVAGTDAFADFGAQPDADEAQ
IVDAWGSRVAAGLEPEFVLTESLKAKLASVGTATLSAQLRKRGLNTVTID
GLTPTHPDKRMVGRARTLRFVPLREDLFKARGGGYNAQKRAFDSLEPGDV
LVIEGRGEKGSGTVGDILALRAQVRGAVGIVTDGGVRDVAAVSALDICTF
HGGPHPAVLGRRHVPWDVDIAVACGGATVEPGDVLVGDADGVVVIPPGLA
EDIADSAIAQETEEQYIADRVAEGAALEGLYPMNDSARADYEQSRHGRHA
DTTPKGSTP
119868690YP_938642.1 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase [MycobactMTANRRPEGVPQRIQHFIGGKLVDSLADTWFDVIDPVTNQPYAQAAAGQA
DDVDRAVAAAKVAFRTGPWPNMQARSRSRVLNRIADAIESRDARLAELES
FDSGLPITQALGQARRAAENFRFFADLVVAQADDAYKVPGSQINYVNRKP
KGVAGLITPWNTPFMLESWKLAPALASGCTVVLKPAEFTPLSAGLWADIF
RDAGVPDGVFNLVNGIGEEAGDALVKHPDVRVISFTGESATGEIIFRNCA
TGLKGMSMELGGKSPAVVFADADLDAALDSTLFGVFSLNGERCTAGSRIL
VEEEIYDEFVERFAARAAGIVVGDPQDPRTEVGALVHPEHFAKVMSYIDV
GKTEGRLLCGGGRPAHLPQGNFVAPTAFADVEPNARIFQEEIFGPVVALS
RFQTEEQALALANGVKYGLAAYIWTNDLKRAHRFAQNVDSGMVWVNSHNV
RDLRTPFGGVKASGLGHEGGYRSLDFYTDQQAVHITLGDVHTPRFGITAR
119868688YP_938640.1 putative 3-4-dihydroxyphenylacetate 2-3-dioxygenase [Mycobacterium sp.MVPSWYTEASLVLDLDGVPQPVQVRTDQSEMAVTIGADGFSYTRRDDEEH
GFKLGAQL
119868686YP_938638.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MTVGFTLKQLEYFCAVAEHGSFSAAGARLHVSPSAVASSVGDLERVLATQ
LLVRRKAHGVSLTAAGSHTLKRARILLAEAREVELVRGEDGSRLAGPVSI
GCYSTLAASVLPGLLEEFSALHPDDDLSFVDGGMDDLVPMLRRSALDLII
TYRINLPVGVQEAVLYECDLHALLPGGHRLAEESAIDVQELAGENLILLD
LPPSGRHTLDLLSAAGITPTIRHRTQNFELVRSLVARGLGYSLLIQKPRI
THSYEGLSLVTRPSNPGCRGRPSCASGPRRPG
119868684YP_938636.1 AMP-binding domain-containing protein [Mycobacterium sp. KMS]MSTTSVELWPALTGPADLHKVEATPLAVRGVPTSGYAALERAAALWPDRL
AVTALPGGTNLEQSTSRTYGELLADVCRCANALTELGAQRSTAIALLSPN
TGELVSALLAAETTGIAVPLNPRMSPGHLTELMTRAGVEILVAAGPEFDA
DAWRTACEVASSAGVRAVLALRPVVTSPSAPDLGTWSGLTVDYLETVASR
QVDDHLCATPPNADDLAAFFHTGGTTGLPKLAAHRHGAQMADAWMIASGD
QLDDDAVVFAALPLFHVNALIVTILAQLLRGRHVVWAGPLGYRDPELLAG
FWSLVEQLQISAMSAVPTVYAALSRIPVDSDVSSLRLAIVGASPLPPAVR
ESFRAATGVELNEGYGLTEATCASTRSFLEHPRPGWVGQRLPYQQARVVH
RDPDDGRPLDVPYGGVGTLLLKGPNIFAGYVTGRDGGRPCLDYLGAVSDD
GWLDTGDLARMDDQGFIQVCGRVKDLIIRGGHNIDPAQIEDALLAHPDVT
AAAAVGSPDTHAGEVPVAYVTVQLDAAVSAPELRDWCRDRVAEPAAAPRH
VVIVDDLPITDVGKPNKVALRADAIRTVADTALRDNGIQASVSGVAVDGI
PTAVIERSGDGPLDDGAVAAVLRGFSFAWKTIPDDPPQ
119868682YP_938634.1 acyl-CoA dehydrogenase type 2 [Mycobacterium sp. KMS]MTVTTQRTSTLADRVRDILPGISARADEAERIRKVPVQNVDALREIGFFR
AFVPAKYDGLSVLPSEFGEATRVLATACPSTAWACGLMAVHAHTVANYSP
VLQEEVWGSDPDTLICSSVAPMGQPTKVDGGIRLTGDFSWSSGSEHAHWI
IVGMMMPGSSEAPEPHFAIVPRSDFEIKDTWFAMGLKGTGSQDISIKDVF
VPEYRLETLISLNIGTATGFGTHDAPVYRLPWQPVFALNFSAVNLGASEA
LRDLYPARLSTRVRAYTGAKVGETAPALMRLAESTHELDAARSLLESDWR
AMDSRANSTDPTTPDEMAGWRSNQAYITRLAVRAADRLFDASGGSAVRDE
NPMQRYWRDLHTGAAHTYSDYDIAAQVYGAHLAAVQPQEGLF
119868680YP_938632.1 hypothetical protein Mkms_2647 [Mycobacterium sp. KMS]MHDMTLASAASTAALTVGLAAYAGLIFAGIAVAIYDVRRHRRGRAIAAAV
MVGVLTLGGLVIAIVSSVA
119868678YP_938630.1 hypothetical protein Mkms_2645 [Mycobacterium sp. KMS]MSEDQNTDVPPNHLSIDPRSAFYSEEVLRRDVGIRFNGTERTNVHEYNVA
EGWVRVEVPTAKDRHGNPMVVKLSGTVEPYFRGPE
119868676YP_938628.1 hypothetical protein Mkms_2643 [Mycobacterium sp. KMS]MAEQRRIGFHWHLRRVMAAHNLWKSTELRPLLRSRGINLSDAQVYRLVTG
EPQRIPSRTFAALCDIFDCTPNDLFEPYVEMQAAASANAPQPRELGVTPG
NPVAKRIRIVQDDVDGTTPEA
119868674YP_938626.1 hypothetical protein Mkms_2641 [Mycobacterium sp. KMS]MAGFKMNPNFEREFARQFNAQLQKVFDSVYSRHAGQAVEEVKAALKREAG
RIGLTLDDAKLTELATAISAGTRLKVRAA
119868672YP_938624.1 integrase catalytic subunit [Mycobacterium sp. KMS]MAPSTYYDAKTRPPSARAQRDAVLGPALRQLWKDNYCVYGAHKLWKTARR
AGYDVGRDQVARLMRAAGIQGVRRGKRVRTTKPDPVAARHPDLVKRKFTA
TAPNQLWVTDLTFVPTWAGVAYVCFIVDAHSRMIVGWRVASHMRTSMVLD
ALEMARWSRGTTLQNLICHSDAGSQFTSIRYGERLAEIGGVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARSGPWKTVEDVELATLSWVYWHNTSRLH
SYLGDLPPAEFEAAFYDASRSGQPLVEIQ
119868670YP_938622.1 hypothetical protein Mkms_2636 [Mycobacterium sp. KMS]MFRLWSRDQSIETTLKQIEHRVLDDVYLPLWVRRVAWVATIVLLMTGITA
WVVGVGLPLAASALGAGAAICSIMSLRRRRFRWCVAAAYLSGVSTVAGVG
AFWWSRTSSAGPVLASSTAVATVAAATLTAVWVSVTITPVTDSHPDMRQP
SKRKWGVRESGATITWPPPCAGPHHPNPK
119868668YP_938620.1 hypothetical protein Mkms_2634 [Mycobacterium sp. KMS]MLAQPDLCTFVAIDCFAGRSVQAKQDIYPEIVNELIRLGIPAVHVTIVLR
ESALENWGIRGGQAACDVDLGFTVNV
119868666YP_938618.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. KMS]MDIGFIGLGHMGFEMAGRLIDAGYAVTVYDTRREPIDELVGRGAAAASSP
KDTAARAETVMASLPSLQASIEVATGPDGVIQGHRVKRFVDLSTVGAPTA
ERTAALLAERGVAQIDCPVSGGVGGARNGTLAMMVSGPHDHVDSVRPALD
VFGRVFFIGEKAGSAQTMKLANNLLAATTLAATAEAVVLGVKAGLDPAVM
IDVFNAGSGATHASRDKFPRAVLPRTFDFGFATGLMVKDVRLCLEQVAEL
GLSLDIAQAVALVWEATIDATGPDSDFTSVIKPIEEAAGVIVGDPGGP
119868664YP_938616.1 nitrate/sulfonate/bicarbonate ABC transporter periplasmic component-liMLRHLARTALTLAVLASAVACSSTDDNSGGYTLRIGATSPTGTPAGSLGW
GDKQGILAEQLKDAGVDNIEYSFFQSGSDVASALFAGAIDVAAIGDNPAL
RARSRDPKVVLLALDSISSDAWLVGAKGGPTDIQGLVGKTVTAPQGTIRD
RAAKQLIDAAGLTGKIQVRDVPTPESIAGLSSGQIDATVVTGASAIELQH
KGFPIIDSLSRHGLGSTGTNIALTTFTDEHPEFADAWRQAVTAVNSDIQK
NFDEYATWVAQTDGTDVEFVKESTRPDEFNTEPFPAQGVDQLEAAYDFLN
ADGSLENQYSVREWAGAQS
119868662YP_938614.1 ABC transporter-like protein [Mycobacterium sp. KMS]MSAAVVTVRGLRRAFGAQQVLDALDLDIADGEFVAMLGLSGSGKSTLLRI
LAGLDHQADGSVVVPRSRAVVFQNPRLLPWRRALANVTFALADAGPDAPS
RTARGRAALDEVGLADKADAWPLSLSGGEAQRVSLARALVREPDLLLLDE
PFGALDALTRLKMYRLLHDLWARRHMAVLHVTHDVDEAILLADRVVVLSD
GRVSLDRRVDLPFPRSRGDEGFDDLRRVLLAELGVREEVGHDRGR
119868660YP_938612.1 4Fe-4S ferredoxin [Mycobacterium sp. KMS]MIEIVHTAACVACDVCVKVCPTDVFERGEDGVPVIARQSDCQTCFMCEAY
CPVDALYVSPVSAPVGADSPHADVDAVLRNGLFGGYREMVGWGRGRTPGA
LLDRNPVLKAVPPLPESRLPPPSTMAGSPWNHPAD
119868658YP_938610.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MSSSTATDLDPLTLERQVCFALAVANRAVLGVYRPLLEPLGLTHPQYLVM
LVLWDHRKSADSPLSVKQIAKALQLDSATLSPMLKRLETLGLITRTRSTV
DERAMNVELTEAGIALRERALAIPPAVVARLGGDLAELEELHRALTRINS
AAQAAGALDL
119868656YP_938608.1 hypothetical protein Mkms_2621 [Mycobacterium sp. KMS]MPATIRSSHGCRRRTTSRGARRRTLPPMAGQAFEIVVTRDATGWSVTVPE
LSAVTHRADRAEAEMAARELISRHTGIPHGYVAIWSRD
119868654YP_938606.1 anion transporter [Mycobacterium sp. KMS]MTADNPVKRTDVDKALLGSATYRSLGEQRLTPAEERFEKGRRTVGLFLAP
ALTVVFLLLPLDLPPQQQTLAAVLLGVIVLWVTEAVPIPIGGLLGVAVVV
FLGVAPADDVLAPFGSSTIFTFIGAFILAQAMLKHGLARRFAFRILALPR
AGQSTTGVILAFGAITCLLSAFVSNTATVAMLLPTAIGILGVIAKLLQKQ
GKVADDFDPLRLRVGAALMLMLAYSASVGGLLTPVGSPPNLIGRGLIEEA
TGERISFGQWMVMAAPICLLMFAILAVVLLLLNKPELKHIDGVADYVARE
REEMGRLSRAEKNTLIAFGVTVFLWILPGIIALAFGNDSDIYSSVSDRLD
EGTVAVFGAALLFLLPTEWEQREFTLRWRDAAAIDWGTIVLFGTGIIFGS
LLADSGLAETIGNSVADALGLSSVVAITIFAVLLAIVVSETTSNTASAAV
VVPIVIPVAIAAGVNPFVPALAATFAASFGFMLPVSTPQNAIVYGSGAVP
ITTMIRSGVTFDVAGAILIILFLPLMIALLGLGA
119868652YP_938604.1 3-isopropylmalate dehydrogenase [Mycobacterium sp. KMS]MATEDPLRLGVVAGDGIGPEIVSAAVQISERALAAVSVPVDWRRLRMGAE
AITAEGTPLPEATLAELDRLDAWLLGPHDNAGYPAPFRDALSPGGTIRKR
YGLYANIRPARRLSGAIPAVCPTLDVVVVRENTEGFYSDRNMYDGPGEFM
PTADVAMAVAVFTREACERIAHQAFRLARTRRRSVTVAHKANVLSKTTGL
FRDSCVRVAEQYPDVTVRLEHIDALAALLVARPAEFDVIVAENMFGDILS
DLTGQLAGSLGMAPSVNLSDTKAMAQAAHGSAPDIAGHNIANPVAMILST
AMLLEWLAERHHRGALAGAATRIRDAVCRSLDDGVHTPDLGGAATTTGFT
EHVLSVLASA
119868650YP_938602.1 TspO and MBR like proteins [Mycobacterium sp. KMS]MRASTLAKTAGTVFATGALGGLASRPGQSLWYVKLKKPSFQPPSQAFGIV
WPMLYADIAAVSAATIDHYNDTGQPEKARAYTTVLAANLILNGSWSWLFF
NRHKLAVSAMAAGALAASSADLTRRAVEAKGAQAAPLALYPLWCGFATAL
SSRIWWLNR
119868648YP_938600.1 hypothetical protein Mkms_2613 [Mycobacterium sp. KMS]MASVDVAVSSDLTPEKAWELASNLRRFDEWLTIFGGWRSEVPAEIEVGTC
VSSLIKVKGFRNTIHWRVTRYDEPKEIELIGTGFPAICIALSLHVEEEPD
KGSNFRVVADLSGGLLNTRVGSLVARVIESDVRKSVSNLASLR
119868646YP_938598.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MPRSSEFDPQLAARLAATRASRRRFLGGGAAAAAALALGPSVLAACGSDS
GGSEATTTDDGGPAGGTLRVSNWPLYMADGFVAAFQTASGITVDYKEDFN
DNEEWFAKVKEPLSRKQDIGADLVIPTEFMAARINGLGWLNEIRADRVPN
KKNLRPDLLNSAIDPGRNKTAPYMTGMVGLAYNKAATGREITRIEDLWDP
AFKGRVSLLSDTQDGLGMLMLSQGASPERPSTEAVQKAVDLVREQKDKGQ
IRRFTGNDYADDLAAGNVAIAQAYSGDVVQLKADNPDLEFIVPQSGGTWF
IDTMVIPYTTQNQAAAEAWIDYVYDRANYAKLIAFTQFVPVLSEMTDELN
KIDPGVAANPLINPPESTVNNLKSWAALTDEQTQEYNTMYAAVTGG
119868644YP_938596.1 binding-protein-dependent transport system inner membrane protein [MycMTTQAGAAVAAAAEQPPRPKTVRGTPKWGDWSLRIVAGLVLLYLFIPIFV
IVLFSFNDPKGKFNYSWQGFTLDNWLDPFKYPALTNAMKLSLNVAGVSTL
IALVLGTLVAIALVRQRWRGQRAVDTFLVLPLTAPEVVMGASLLVLFLDL
GWATGYVTIVLAHIAFEVSFIAMTVRARVRGFDWTLEDASMDLGASPTRT
FFKVTLPLIVPGIVAAAMLSFALSLDDFIITYFVSGSTVTYPLYVNAAVK
AAVPPQINVIATAILVVSLILLAAGTLYRRKRIDV
119868642YP_938594.1 hypothetical protein Mkms_2607 [Mycobacterium sp. KMS]MNIGKASVVVAVTMLSVSGCGYRLAAYPTDDAAAQPVEPRTMAASAAPEV
QHNASVSAANHGVPPNADGDPACPPSQAWGRQPEGRGVLVTVLTQEATAV
TVLVRTSTGVDVAKRAILDRDDLHLFEFPKIDADAVDEVLIMTSTQRCFA
VADPLTFN
119868640YP_938592.1 dihydroxyacetone kinase [Mycobacterium sp. KMS]MTKLFNDPARFTEDMLVGFLDANSRYVAGVPGGVVRAHETRPGKVAVVIG
GGSGHYPAFCGTVGPGFADGAVVGNIFTSPSTEEAASVARAAHGDAGVLL
ITGNYAGDVMNFGLAVTALRGEGVDAHYFAVTDDIASAPKGEEAKRRGIA
GDFTVFKCASAAAEEGLDLAGVVRVAEASNAATRTLGVAFDGCTLPGADH
PLFTVPEGQMGVGLGIHGEPGVAEKAMPTAAGLAGTLVDGVLGDAPADAA
SKRIAVILNGLGRTKYEELFVVWGEVARLLRDRGYEIVEPEVGELVTSLD
MAGCSLTVMWLDDELERYWRAPADTPAYRKGGAAVDNSGERRSDADIRTA
TAAPAVGERSDDAGRDGGRTVARIFEALAAMLADAEDELGRIDAIAGDGD
HGRGMVKGSAAARAAAAEAVEQGAGQGSVLAAAGKEWAAKAGGTSGVLWG
ALLSALGTRLGDTGRPDAATVAAGMRDGYDALVQLGGAAPGDKTMLDALW
PFVEELERRVSDGERWQQAWAVAAQTAEDAARATADLRPRVGRARPLAER
SIGTPDAGATSLAMCARTVAESLSVKGDSRQ
119868638YP_938590.1 ABC transporter-like protein [Mycobacterium sp. KMS]MATVSVADLHKSFGKTRAVDGVTVDIANGEFFVILGPSGAGKTTTLKSIA
GLVDIDGGTVHIGGRDVTHVEPYHRNVAMAFESYALYPQKTVSENLASPL
KSGRTGRYSEAERTERIDQVTTTLGINHLLKRYPRELSNGQRQRVALGRV
LVRPADIYLLDEPLSHLDAKLRAAMRAELKQLGAMSNTTTLYVTHDYQEA
LALGDRIAVMREGRLVQIGTPEDIWRRPADTFVARALGQPEINLLDGVVD
DDRIRLGDGSLDVAIPAGAVADRGDRVRVGLRPSDIHVTDGEGTLRGRVL
LAERLGRNIELTVDCGGTQLIVLTSGRHGVGEGDNVTMRVADSDVHVFAV
GDGDTPRLGPADHTSTLEAAQ
119868636YP_938588.1 binding-protein-dependent transport system inner membrane protein [MycMTTQTPKAPEASPEQRAQDPGRPLPEVPTWRRKLRPYLLSIPALIIVIGI
LYPFFVGAYYAFLNYAAVNPDPHFVWFENFASVLGDQIFWESVKVTGIFA
VVATTIETVLGVGLALLLNRSSIIGKIFEKVLILPLMIAPVIAGVIWKLM
FNPQFGILNHVLGLGNTFDWLSAGNALWSVILVDLWIFTPFVAILVLAGI
RSLPKEPFEASEVDGANWFYMFRKLMLPMLWPYILVAVIFRFMDNLKVFD
HIYVLTAGGPGVATRTLQIGAFEDSIINLDYSRGSTYMLLLWIIVFITAR
YLVSVLGKAQRRAAGAES
119868634YP_938586.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MSDQIPEKMQAVVCHGPRDYRLEEIAVPQRGPGEALIRVEAVGICASDLK
CYHGAAKFWGDENRPAWAETMVIPGHEFVGTVVELDDDAAQRWGIAVGDR
VVSEQIVPCWECRFCKRGQYHMCQPHDLYGFKRRTPGAMASYMVYPAEAL
VHKVSKDIKPHHAAFAEPLSCSLHAVERAQITFEDTVVVAGCGPIGLGMI
AGARAKNPMHVIALDLAPDKLELAEKCGADITINIAEQDAVAIVKELTDG
YGADVYLEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDK
ELDVLGAHLGPYCWPAAIKMIESGILPMDEICTHQLPLTDFQKGLDLVAS
GKESVKVSLIPA
119868632YP_938584.1 cytochrome P450 [Mycobacterium sp. KMS]MTGDPAVELYYDPFDFVIDDDPYPVWKRMRAEAPLYRNSRYGFYALSRYD
DVVRALPDWQTYRSGRGTTADILFSGIEVPPGILLWEDPPLHDLHRRLLS
RVFTPRRMLAVEDLVRGFCSRALDPLRDAEGFDFVTDLGAIMPMRTIGYL
LGIPEEGQQQIRDLNDKSITVGSQGSGTGEVSQTIFEESLGVFAEYIEWR
STHPSDDLMTELHNAEVEEPDGTRRQLERTEVLAYTAMIAGAGNETTARL
IGFMGQLLGEHPDQRRELVADPSLIPSAVEETLRYEPPSPVQARYVARDV
ELYGRTVGEGSYMLLLNGSANRDETRFTDPDRYDIHRKAGHLSFGQGLHF
CLGSALARLEARVAFEEVLARWTDWDVDYANATRARTSSVRGWAKLPVRT
R
119868630YP_938582.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPQRDSSDQPTSVAARAGRRPRGEARRLLLDAARDLFARKDYRATTTREI
AEAADVSEYLLFRHFGSKAGLFREALVVPFTTFLDDFAQTWQAVVPEETD
EEQLARQFVGRLYDVLVEHQGLLLTLVASDGLDDEEIEAAGIADIRRALS
MLGRISAEGMRLRGKRSRQPDLPAHSTVAMIVGMVALRSTFFGSSPPSRE
AIVDELVQAILHGFLHRP
119868628YP_938580.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTGDRCFTRQEAVSGLSYLIPFTKDWVSGTSPRREPLAVGGVVECRTVTN
KRNAAKRTSDNGSVAGSSYDDGTRRTEILQTAARMIATSGLRTSLQEIAD
AAGILPGSLYHHFESKESILVELLRRYHADLDRIAEHAQATLDDPSSHSA
FDRVLELSVAIAQCAVTHRAALQMSFYEGRSSNPELATLAQRRPTAVLQA
MLQTLRAARWSGYIRSDVDLPVLADRMVQTMLQAGLDVIRQNTPVEKVAT
LLTRIELEGLAAEPPTDQMLDQSAAFSAADAVVQSWIDDSETEADDKAAH
VRAVARTEFGRRGYEVTTIRDIASAAGMGTGTVYRLIGSKDELLVSIMRS
FGEKVAMGWTEVLSADATTIEKLDALSWINTNALDRFGDEFRIQLAWMRQ
SPPGTPNPGWLFSKRVRQMRSLLAEGIRSGEVRVDSPPNDLLARGVIGIG
WIPENILRDLGTRRALIHVRDTTLRGVVERNA
119868626YP_938578.1 integrase catalytic subunit [Mycobacterium sp. KMS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGLIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALGGLPPISRLTPTS
119868624YP_938576.1 cytochrome P450 [Mycobacterium sp. KMS]MSDFESVDYFTDMSLVPDPYPYFDYLRAKCPVQRATPYGVMAVTGHQEAL
AAYKDPAMSSCVAVAGPFPPLPFTPEGDDITAQIEEHRTAIPMAEHVVTM
DAEQHARTRGLLSKLITPKRLAENQDFMWRLVDRQIDKFLERGSCEFMTD
FAKPLSMLVIADLLGVPLEDHDEFRRALGDEVVGDIGAEDTVAHNPLMWL
DEKFASYVIDRRREPREDVLTELAAATYPDGSVPDVDEVVKLATFLFAAG
METTTKLLSTAMRVMGERPDIQQVLRDERTRIPTFLEECLRTESPVKSHF
RLARTTTTLGDADIPAGTIVMLLPGASNRDPRKFENPHEFRPDRSNVREH
VAFGRGPHSCPGAPLARAEARISMNRLLDRMANIRISEEMHGPAGERKYE
YDPTFIMRGLSALHIEFEPLPDP
119868622YP_938574.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MPDVNVTSESRMLIDGKLVDGEAGTFINVNPANEEVLGEVADASRADMQR
AIDAARRAFDETDWSTNGELRKRCVLQLHEAIEGELAELREELILEAGAP
RAVTHGPQLDAPLEDGLKYPARLIDEFTWETDLGDKVVSVTGVNTRRKVW
HEPVGVVGAIVPWNFPFEVTVNKLGPALAAGNTVVLKPAPNTPFNATRLG
RLIAEKTDFPAGVVNVVTASDHFVGEELTISPKVDMISFTGSTVVGKRIM
EKGAATMKRLFLELGGKSATIVLEDADFNTACLIGIGPLMHAGQGCAAPT
RMLLPRSRYDEGVALLKALYENMRAADPQDPGTICGPVISGRQQARILGY
IQRGVDEGATLLVGSTEAPEEFDKGFWVSPTLFTDVDNSMTIAQEEIFGP
VLVVIPYEDEDDAIRIANDSVYGLAGNVMSSSLDRSLAVARRLRAGFIGL
NGTAGYGADTPFGGYKDSGVGRQNGIVGFSQYTEVKSVAYPADERLREEQ
119868620YP_938572.1 hypothetical protein Mkms_2585 [Mycobacterium sp. KMS]MTTKDPLVSDGQTREKPTEKRNWGGWIGFLALVAFLSFFALSSRRNLDPR
VANPDVEGRPRPVEFIFGWDDWIYLHEVGTVLALIALVVVFIVGWKRNPG
SPVMLMFLCTTLIVWQDPIMNWAPFAVYNPELLHWPESWPLVSLSPTVEP
FLVFGYVMFYFAPYFPSVWILRKLQAKKGPQSFFSRHPLISLGSLALVIG
FIFDACLEIFLVRTGMYIYSQVIPFGSVFAGTTFQFPLIWESFAVCFVMV
PAAILCYRDDTGKSVAEKLSARAKLFRSKPALGTFLVMFVIINVSYFAYG
AWFAVIKASGAATSVACPWPYPEAKVYDPQGYYEKAGAEGPFSVGIWSTW
MSGQPDGRPDVEPPPPGEGACAVENQNG
119868618YP_938570.1 ATPase [Mycobacterium sp. KMS]MAAEIGLAYQNHAMPQTESPRPYYQAVGNEETVFKAAYRQGLSLVLKGPT
GCGKTRFVEAMAHDLGRELITVACHDDLTTADLVGRFLLKGDETVWVDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLGDHRRQLPIERLGITLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGFPAPEVEEGIVAREAGV
DHATAAELVRFGQAIRRLETGGLREVASTRVLIAAGRLVREGLTMQEAAR
AAIAGPLTDDMQVARGLHEMIDIYLGQQAGSDD
119868616YP_938568.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. KMS]MESVDFSYPQEAEQFRKDLRTWLSAHLTRNVIDSDSRRGADDDAFQTLRA
WNATMADAGWAAVSWPSDYGGRDATPVEQLIYAEETTRARVPLPLNIIGM
NNIAPAIMQYGTEPQKATLLSATRSAPTSSPSRPRCRPSRSRRFRESMRA
ARCFGCVSTMRPGRSWESPTGRRSGRSSTIFSHRTRV
119868614YP_938566.1 amidohydrolase 2 [Mycobacterium sp. KMS]MDMNDFVLVSVDDHMVEPPDMFDGHIPAKYKDDVPKLIQRADGTDAWVFE
GQEATNVGLNAVAGRPPDEYGAEPTKLSEIREGCYNIHERIRDMNANGVA
AALCFPSYPQFCGQYFARARDKDLVLAVLRAYNDWNIDEWCGTYPGRMIP
QALPPIWDPNLMAEEVRRVAKKGCHAVSFSENPTKIDYPSLHDPHWDPFW
QACSETNTVVNLHIGSSSSVVITSIDAPVDTMITLQPMSIVQAAADLIWS
PMLRRFPDLKFALSEGGIGWVPYFLERIDRTYKMHRAWTHQDFGDKMPSE
VFLDRVALCFIDDEFGVENRHKLNLDMVTWECDYPHSDSTWPLSPETLAI
YFNGVPDDEIDKITHLNAMRLYSFDMFSHIPKEQLTVGALRAQATDVDLG
FRSSERLKKTGTDTVTVLDLASKLST
119868612YP_938564.1 cytochrome P450 [Mycobacterium sp. KMS]MTGASTDLYYDPFDFDIDDDPYPIWKRMRDEAPLYHNDKYDFYALSRYED
VADGLHDWDTYRSGRGTTIDVIMSGVEVPPGVILFEDPPLHDLHRRVLSK
VFTPRRMGAIEPLTRRFCVRALDSIADASRFDFITDFGALIPMRTIGYLL
GIPEQGQQQIRDNTDSAIGLRDGSFQSVSAATFENAYQLFADYIEWRADH
PSDDLMTQLLNAEIEENGRLRPLTRVEVLTYTSMIAGAGNETTTRLIGFI
GQLLAEHPDQRRELVDDFSLIPRAIEEVLRYQAPSPVQARHVARDTRCHG
QLIAEGSIMLLLNGSANRDERQYPDGETFDIHRTGAHLSFGQGLHFCLGS
SLARMQARVALEEVLLRWTDWEVDYDNAAMAHTSSVRGWGRLPVMVG
119868610YP_938562.1 luciferase family protein [Mycobacterium sp. KMS]MFTLRFDMRAPTGGAPVTDLYAAAIEMCAWSETRGAVVAVLSEHHGAHDN
HLPAPLLLASAIAARTTQLAILLAAVPITFWDPVRLAEEISVLDIISKGR
VSYAFGIGHRAEEYRHFGVDMKTRGALAEESLALLRLLLRGDPIDLGGRL
VHVTPPPITPGGPHMVVAGGSRAAARRAARHGLGFLSQVASPGLREFYEA
ECRAHGFEPGAVVFPIEGAPTTVFVADDVDAAWGELGPYLLHDAVTAASY
RHGDSVASISSARSVSELREAGGPYRIFTVEEAATYVRDGRPLPLLPLCG
GVPTDVAWPYLERAALASERA
119868608YP_938560.1 hypothetical protein Mkms_2573 [Mycobacterium sp. KMS]MSESPAHFESADDGAYLPTRFAQSHWGEDHLNGPAVVGLAARVLESEYGR
DGFLPTRLTVDLFKAARGVPTTTKTNLVRDGRRVRNSECELVQDGVTVAR
ATLVQYRRAEAPRGTEWIAPGDFEVPPAVDPSRMIHLGSDGPGWTNAIVD
HQNTARKRTWSRSIQVVAGSENSPFVRAVVAAEGTSLVTNLGTAGVGYIN
GDLTVALARLPVGEWIGVQADSHWVADGISVGTATLYDGVGAFGSGMVTA
VSNPAAQIDFGNDPFPSRTH
119868606YP_938558.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTAVEYRGTQISYRTRTGRRLAVDRADLTVASGEFLALVGPSGCGKSTLL
KAAAGLVEPTAGQVLVGGAPVGESPARVGMVFQNDALLPWRSVIENVRLP
LQIDGGRRGEQDERIAELLDLVGLSEFGGYLPRQLSGGMRKRVALARTLA
SDPTVFLMDEPFGPLDALTRREISADFLQLWERLRTTVIFVTHDVDEALL
LADRVAVMSPSPGRIVEEFEVPLQRPRDIRELRFTADYHRLYDAISDALG
VA
119868604YP_938556.1 binding-protein-dependent transport system inner membrane protein [MycMTETRGRARTRLSRGTAKTDDALTRSDRRDAQRLRRIVTLGRIAIAVLFV
GGWQLSSERLIPAFYVSSPAAVLERLGSLIRTGELWPHLTQTLLEVALGL
LIGVPLGAVLGVALGFSTILGGWLLPYMMALYSLPRVVLAPLFIIWFGVG
LISKVTMVVTMVVFVVFYNVYQGVQEIDRDLLDVAKSLRANRLQTLRWIV
VPSLVPWLITGLRLSIGIALIGAVIAELIAASQGLGYYIKYSSNLLDVTG
VFAGLAVITVVAIALEQLLKRIERRVAPR
119868602YP_938554.1 xenobiotic compound monooxygenase A subunit [Mycobacterium sp. KMS]MTDSRRMHLGLTIWPTGFHPAAWRVPGAFSNGNSNPALLADAARTAERGV
FDFFFIGDRLVGLPSSQFANPNEVLRPEALTLASFIAASTTRIGLITTVN
TTYSDPYNVARATATIDHLSGGRVGLNIVTGKNVEAARNFGRDQHWDNER
RYDWASEYIQVLQLLWDSWEDDARVADAGTGQFVDPGRVHRIDFRGEFFS
VDGPLNVERPVQGQLPIVNAGASERSRELGAQFSDLRFTNSSTLGLEGAR
AYYADLKSRLPRYGRRPQDQLIIPGVAVYVEETKAAAHQAYSDLQRRLNT
GPGGRAQLSEALGVDLSAVPADAALADVVDMAALDAAARAVVDSAAELYG
HDRASVAEVTASLLRGGMFKEAVGSPAEVADVLEEWFTTGAADGFMIFPP
RVPYGIGAFVDLVVPELQRRGLHRREYTGTTLRDHLGLARPSNRFAAEES
HAVGVAR
119868600YP_938552.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMEPTFSLELPDDVVSVRDWVHEFARDVVRPAAAEWDEREETPWPIIEEAA
KVGLYTPELFAQMAGESSGIGLITVFEELFWGDAGIALSILATGLAAAAL
ASNGTPQQIGDWLPAMFGTPGDTKVAAFCSSEPGAGSDVGAVRTRAVYDE
AADEWVLNGTKTWATNGGIANVHVVVASVYPDLGTRGQASFIVPPGTRGL
SQGQKFKKHGIRASHTAEVVLDNVRIPGELVLGGREKFEQRMARAKEGQR
TASQAAMATFERTRPFVGAMALGVARAAYEYALDYACQREQFGRKIGEFQ
AVAFKLADMKARIDATRMLVWRAGWMHRNNKAFTSAEGSMAKLYASETAV
YVTDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVIGRALT
GLPIR
119868598YP_938550.1 hypothetical protein Mkms_2563 [Mycobacterium sp. KMS]MTGESTGRQRWDPGRHETETERLDRNWFSLLQELRVAQTGVQVLTGFLLI
LPFQDRFGALDDGARLVYLLTVACSIGSTVLLVAPVSMHRVLFRRHRLDA
LVASSHMLAMVGLLLLAMALTGVAAIIFDAVLGAAAAWTAAGVTLLALAS
SWFWLPVRQRRDK
119868596YP_938548.1 RDD domain-containing protein [Mycobacterium sp. KMS]MTTGDYPPQPGQPQYGQQPQYGQPQYGQQPQYGQPGGYPPPFGGQVPGTL
GMRFLARLIDGIIVGLVGGLVLALVDAMSNVWITGLFTGALSFLYYVVFE
VTQGWTPGKKLLGMSVRGPGGAAKPTASQSAIRNLFTLLPIIPFIGGLLG
VIAIVVIAVTINNSPTKQGKHDEMAGGTQVVKG
119868594YP_938546.1 hypothetical protein Mkms_2559 [Mycobacterium sp. KMS]MSDQEFKKGDKVTWQSHGSTAEGEVVEKITSETEAAGRKVKASKDEPQYR
VVSDKSGNDAVHKPGALDKK
119868592YP_938544.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MAHTADLVIERPADLTADWLTTVLGAGTVTQFGFDRIGTGQMSECYRVSL
TYADAATAGPESVVLKVAATDVNSRQTGLALGLYEREVRFYTDIAPGLPG
PVAPCYHAAYNAETGAFDLLLGDAAPAVVGDEIRGATVEQATLALAELGR
VHGPLLGNATLADADWLNRESPMNQVLLGQLWAGFADRYGDAIAPEHRAV
CERLVAVFDAYLDAESAADRPHGLIHGDYRLDNMLFGQAGADRPLTVVDW
QTVTWGPAFTDVAYFLGCALPVEDRRAHYDALLRAYHEALGAQAPVDLDT
VRDGVRRQSFFGVMMAIVSSMLVARTERGDEMFMTMLRRHCEHVLDTDAL
AALPEPGDDEPLQPAAADEGSHQPGDEELWNESWYFDFADGAQDVGGWVR
LGLYPNRNAAWINALVCGPGMPTIGIVDFDAPLPADYTETTTDTAHLGLE
PVEPLRTYRVTVRGRGEAHDDPAALLRGEAGRPVDLTMDLTWTTVGTPYR
YRITTRYEIACTVSGTVTADGREYRFDAAPGQRDHSWGVRDWWAMDWVWN
ALHLDDGTHLHGVDLRIPEIGPMSIGYVQPPDAALTETTQMTAAATFADT
GLPVTTSLTVQPGDLTVDVDIRGFAPVMLTAADGRVSHFPRAWAAVTTGD
GRTGIGWVEWNRNIARS
119868590YP_938542.1 protein LppI [Mycobacterium sp. KMS]MLAASVLVAGCSQAVDGQARQTVPTLSAPSGTTRTSPSSTAKPPPTSAPA
ARAPIGEVIRWIEAAPPAAPEDFHTVSREGAGTDLGDGVAFTTPTGTSKC
MTDRRAEGALTCLVDLREPPARPADVYGEWKGGWVDFPGGTLDVGSAHAD
PGPFSDGFGAELPYGQALNFGDYRCRTDPSGLFCVNYAHQSAVRFSDAGI
EPFGCLRQVSPPPEIGARFSC
119868588YP_938540.1 hypothetical protein Mkms_2553 [Mycobacterium sp. KMS]MTQHTRTLLLGVSAIFALGTLSACSGGESSTETTTSAPAPTSAQAFPPSA
KYIADMEKDGRPMTIGIAVDGDRVAAYACNGTDDEAWFFGDQTDGTIDLT
SKFRDTLDASFEGGDVEGDLTMDGVTYTFTAAEVPAPAGMYTAALGGVRE
SWVLRPNGSAVGVQFGGLGGDFGQDDDLNIFEKQQQLKDAQFRAEVRNRR
LLRQAGQLEQRPDGKWGATINGQPVEAVIVDGNFRIPPS
119868586YP_938538.1 ATP-dependent DNA helicase RecQ [Mycobacterium sp. KMS]MVAVGERAAELCRMARRVFGWDELHPEQLEAMMAVLAGRDVVAVLPTGSG
KSAIYQVPAVLLDGATVVVSPLIALQEDQIAGLADTRAPEAVAINSRQRA
SQTDDNWAAVHSHEAEYIFVSPEQLANDAVVGRLAEAAVSLIVVDEAHCV
SAWGHDFRPDYLRLADAFAQFGNGAPVVALTATASVVVRREIVERLGLRD
PLMVVGNFDRPNLTLEVEQFVRDADKRAAVVDTVAGLEVPGLVYTATRKD
AARYADALGERGVRAAVYHAGLVAAERERVHESFREDAVDVVVATSAFGM
GIDKPNVRFVVHASVPDSLDSYYQQIGRAGRDGGDARVLLFYRAEDLGLA
RFFTTHRPDADLIEAVYRALDTDKPMRTKALRERLDAQGRRLTNAINLLE
SADAIRSTRKGFYSNGIPPRVAVEAAIEVVEARERVDRSRVEMMRGYAES
RHCRRQFLLTYFGQPLPGPCGNCDRCRDGEGATDADAGGQPAIPVDTAVS
HREWGDGVVIGGDTDRVTVLFDDYGYRTLAMAAVTGKNLLTTR
119868584YP_938536.1 hypothetical protein Mkms_2549 [Mycobacterium sp. KMS]MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEI
PGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDMLLERRSVEELEELLKE
RLDLIKTKRRGS
119868582YP_938534.1 apolipoprotein N-acyltransferase [Mycobacterium sp. KMS]MADAPSGRLAAVVPRLRGVPRAVVDRMWQLVAAIGGGMLLCVSFPPFGWW
YCAFISAALLAWVLRQDSTTRAGGFGYGFLYGLAFYVPLLPWISGLVGAV
PWLALAAVEALFPALFALAAVTVRRLPGWPLWFAALWVAQEWLKSSVPFG
GFPWGVVAFGQTDGPMLSLVRLGGAPLLSFAVMLTGFALAALTEEIVRWT
RRHDISVAAPPAVVLPGAVIAVVLLGTAVVWPQVRHSATGAVDDQPVTVA
AVQGNVPRLGLEFNAQRRAVLDNHVEETLRLAQDVRAGRAPQPMFVVWPE
NSSDIDPLANPDAGAQISTAAAAINAPILVGAVVRTPEHTPDNPVSTNTV
LVWNPGTGPADRHDKRIVQPFGEYLPWRGFFSKLSPYAERAGYFVPGDGT
GVVNAAGVPVGITTCWEVIFDRAARESVRNGAQVLAVPTNNATFDEAMSR
QQLAFGRLRAVEHDRYVVVAGTTGISAVIAPDGRDLARTAFFEPAYLDTQ
IRLKTDITPATRWGPLVQALLVIAGVGAVIAAILHNGNFVPTRIAARSRR
RRPAARDRDDRSGARSSSNEGAS
119868580YP_938532.1 FxsA protein [Mycobacterium sp. KMS]MRLFLLYVVIEVAVIVALVSTVGLGWALLISLATFVLGLALAGSQLKKQL
RRLRSGLTATAAQGAVTDGALVALGTVLVVLPGLASSVVGALLLLPPTRT
AARPIVTALAARRLGRGVPIVVLGSAAASRRRDYIDGEVVDVVTVDPPAV
ERRVD
119868578YP_938530.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MAPTFKDVYGEKYLLLTTFTKDGRPKPTPVWGVPDGDKLLIITDDGSWKT
KRINNTPRVTIQKCGVLGKPKGAPVEAVARNLPSSETRRVWNMVTKRYWW
HAWWWVPHAIIRGGVDKLHSAIEVTSPA
119868576YP_938528.1 cobaltochelatase subunit CobN [Mycobacterium sp. KMS]MTPPHPAPTVLLLSTSDTDLITARSSGARYRWANPSRLVSGELDDLLDGA
DIVVIRILGGYRAWQDGIDTVSARGLPTVVVSGEQAPDAELMRHSTVPQG
AALQAHVYLAQGGVENLRQLHAFLCDTLLMTGFGFAPPAATPTWGVLDRA
VRATDGPTIAVLYYRAQQLAGNTAYIEALCDAIEAQGGRPLPVYCASLRN
AEPELLAQLESADALITTVLAAGAATPAAVGAGGDDDSWNVAHLAALDVP
ILQGLCLTSSWSDWSSNDDGLSPLDVATQVAVPEFDGRIITVPFSFKEID
SEGLISYVADPERCARVAGIALRHARLRRIPVQDKRIAVVFSAYPTKHAR
IGNAVGLDTPASAVALLRAMREAGYDIGDVPGVEAQDGDALIHALIERGG
QDPDWLTDGQFTGNPIRMSADDYRKWFATLPAELTDAVVEHWGPPPGELF
VDRSRNPDGEIVIAALQSGNVVLMVQPPRGFGENPVAIYHDPDLPPSHHY
LAAYRWIDSGYPTGFGAHAVVHLGKHGNLEWLPGKTLGMSAACGTDAALG
DLPLIYPFLVNDPGEGTQAKRRAHATLVDHLIPPMARAETYGDIARLEQL
LDEHANVSALDPNKLPAVRQQIWTLMRAAKMDHDLGLDERPDEDSFDDML
LHVDGWLCEIKDVQIRDGLHILGAPPAGEAELDLVLAILRARQLFGGEQT
LPGLRQALGLAEDGHDERTSVDAVEARARHLVAALQAADWDVAAVDTITD
DPQVAAILRFAAAEVVPRLAGTAAEIRQVLRALDGRYIAAGPSGSPLRGL
VNVLPTGRNFYSVDPKAVPSRLAWETGVAMADSLLDRYRDDYGTWPRSVG
LSVWGTSAMRTSGDDIAEVLALLGVRPVWDDASRRVVDLEPIPLAELGRP
RIDVTVRISGFFRDAFPHVVAMLDDAVTLVAELDESDEDNFVRAHTRADL
AQHGDRRRATTRIFGSKPGTYGAGLLQLIDSRNWRDDADLAEVYTAWGGF
AYGRGLDGRPAADDMNRSYRRIAVAAKNTDTREHDIADSDDYFQYHGGMV
ATVRALTGKAPAAYIGDNTRPDAVRTRTLSEETNRVFRARVVNPRWITAM
RRHGYKGAFEMAATVDYLFGYDATAHVMADWMYDRLSQEYVLDAENRKFM
EESNPWALHGMAERLLEAAGRGMWAEPDPATLDGLRQVLLETEGELEK
119868574YP_938526.1 binding-protein-dependent transport system inner membrane protein [MycMTTVADRNAPKATAGERLRLLIQPGLVLVVGAAVVFWAFNRDLTATQQEN
INPGNVATLIWQHLLITAAVTAIVLAVGVPLGVLVTRPGAKALRPLFIGI
ANIGQAAPAIGLLVLLFLLTARTGFWIGVLPIALYSLLPVLASTILGLDQ
VDRSLIDAGLGQGMSRMGLLARVELPLAVPYILAGMRTSLVLAVGTATLS
FLVNAGGLGILIDTGYKLQDNVTLVLGSVLAVCLALLVDWLGGLAEFFLN
PKGLR
119868572YP_938524.1 binding-protein-dependent transport system inner membrane protein [MycMVVRELWDYLRTHQAQLIFDSYQHVSAVVQSVLIAAVVGVAIGVLTYRNA
TAANLATATSSVILTVPAFALLGLLIPLFGLGVVPSVAALVLYSLLPIIR
NTIVGLNAVDPALTDAARGIGMSRLATLGRVELRLVWPSILSAMRIGTQM
SMGVLAIAAYVKGPGLGNLIFAGLARVGSPTAVPMALTGTLLIVILALVL
DAVLVLIGRLTTSKGIR
119868570YP_938522.1 cyclic nucleotide-binding protein [Mycobacterium sp. KMS]MKARAKQDEEDVRRLREFAEFADFSDDDLRRLVRAAHRTSTSAPWPLIHE
QTPSDACFILLSGSASVYLGRDRVAELSPGEVIGESALRQGKLRSATVTT
TGPAEVLRIGREDFAQLLDEIPALRGTVDDTVARHTSGTPATE
119868568YP_938520.1 precorrin-8X methylmutase [Mycobacterium sp. KMS]MLDYIRDAAEIYRQSFATIRDEADLARFPDDVARVVVRLIHTCGQVDVAD
HVAFSDDVVSRAQAALAAGAPVLCDSSMVAAGITRSRLPADNEVVSLVAD
PRAPELAARLGFTRSAAAVDLWADRLGGAVLAIGNAPTALFRLLELIDQG
APVPAAVLGGPVGFVGSAQSKDELIARPRGMAYLVVTGRRGGSAMAAAAV
NAIASERE
119868566YP_938518.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MQALIPAKPADVTPEWLGAALTRDGSPVEVRAVDTVAIGTGQTGATYRVS
VTYADPQPDLPTSFAIKLPSQDDAVRDRVAIGYRSEHAFYTNLAEQVQIP
IPPCYHCEIAGEGVDFVLLLGDMAPAVQGDQIAGCSAEEARLAVEALADL
HGPTWCDPQWADFPGIAMPKPEPASAQGFGEVATMAAGITLDRLGDRMRP
EDRETLSTAMSVVTPWLLSEPDRFAVLHGDYRLDNMLFDPDRSRITVVDW
QTLGSGLPARDLSYFTATSLQPETRAAVERDLVDAYHRRLLSHGVTGYDS
ETCWRDYRLGMLQAPLITVLGCAFATSTERGDEMMLVMAARGCQAIRDLG
TLDLIAPAT
119868564YP_938516.1 precorrin-4 C(11)-methyltransferase [Mycobacterium sp. KMS]MTVYFIGAGPGAADLITVRGQRLLGRCPVCLYAGSIMPEDLLALCPPDAR
IVDTGPLTLDQIVDELAQAHADGKDVARLHSGDPSIYSALAEQCRRLDAL
GVDYEIVPGVPAFAAAAAALGHELTVPGVSQTVTLSRVATLSTAMPPGED
LRTLSASGGTLVLHLAAAHIDNIVPELLAGGYGPETPCAVVAFASWPEEI
VLRGTLADIAAQMHDAAVTRTAVIVIGDVLAAGGTESYLYSSGRVRRGRH
119868562YP_938514.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MKDTDSGLVVIFGGRSEIGVEVATRLAPGATVVLAARGADRLDEQVSAVQ
SAGAAAVHTVEFDADDLGSHAPLVAKLVAEHGPIATAVLAFGILGDQARA
ERDPAHAAAIVHTDFVAQVSLLTVLATTMREAGRGPLVGERPARRSSIVV
FSSVAGARVRRANYVYGSAKAGLDGFANGLADALHGSGVHLLLVRPGFVI
GRMTAGMDPAPLSSTPAQVAEATVKALAKGRREVWIPRSLGAAVVVMRLM
PRFVWRRMPR
119868560YP_938512.1 peptidase M24 [Mycobacterium sp. KMS]MTGSRFDTDVYARRLQSAAAAARDTGLAGLVITPGYDLRYLVGSRAQTFE
RLTALVLPADGDPTIVVPRLELAALKESAIPELGVAVRDWVDGDNPYDLV
AEALGGGTLRTAVTDSMPALHLLPLAGVLGEVPVLATDVLRRLRMRKDAA
EIDALRKAGAAIDRVHARVPEFLVAGRTEADVAADIAEAIVAEGHSEVAF
IIVGSGPHGADPHHECSDRELRAGDVVVVDIGGPYEPGYNSDSTRTYSLG
EPDPEVARRYAVLQRAQLAAVEAVRPGVTAEQIDAAARDVLAAEGLAEAF
VHRTGHGIGLSVHEEPYIVAGNDLPLEVGMAFSVEPGIYFPGQWGARIED
IVIVTEDGAESVNNRPHDLVVVPAGPAAAG
119868558YP_938510.1 5'-3' exonuclease [Mycobacterium sp. KMS]MSAPLLLLDGASMWFRSYFALPSSITAPDGRPVNAVRGFLDTVAMLIGRE
RPSRLVVCRDDDWRPQWRVDLVPSYKAHRVAEPQAAGTDVEVVPDELTPQ
VDMIMEMLDAFGIPHAGAPGYEADDVLGTLAVAEERDRVIVVSGDRDMLQ
VVRDDPVEVRVLYLGRGMSKATLFGPAEVADQYAVPKERAGAAYAELALM
RGDPSDGLPGVPGVGEKTAATLLAQFGSLEAIVAAANDPKSKMSKAYRKK
MLAAADYIEAAEPVVRVATDAPVTMSTKTDELPLAAAHPRKVAQLAGDLG
VTSSVGRLQKALDALD
119868556YP_938508.1 DEAD/DEAH box helicase [Mycobacterium sp. KMS]MTNPPDTQLAAFAAGMPFALDPFQIRACEALESGHGVLVCAPTGAGKTVV
GEFAVHLALAAGGKCFYTTPIKALSNQKHADLVRRYGPEKIGLLTGDQSI
NGDADIVVMTTEVLRNMLYADSPALHGLSHVVMDEVHFLADRMRGAVWEE
VILHLPDEVRLVSLSATVSNAEEFGGWIQTVRGDTTVVVDEHRPVPLWQH
VLVGKRLFDLFDYRAHSPARSGRELVVDPELLRHIAHRREADRLADWQPR
GRGRSAHRSRPTIYRPPARPDVIAALDREGLLPAITFVFSRAGCDAAVKQ
CLRSPLRLTTNEERQRIAEVIDRRCADLAEADLIVLDYHEWREGLLRGLA
AHHAGMLPVFRHTVEELFTAGLVKAVFATETLALGINMPARTVVLEKLVK
FNGEQHMPLTPGEYTQLTGRAGRRGIDVEGHAVVLWTPDVEPVEVAGLAS
TRTFPLRSSFAPSYNMTINLVHQMGPAQARQLLEQSFAQYQADRSVVGLR
RGVERGERMLDEIAAELGGRDAPILDYVRLRAKISERERAQSRSSRLQRR
AAANDALSALRRGDIISITNGRRGGLAVVLESARDTDDPRPLVLTEHRWA
GRISSADYTGATPRVGTMTLPKRIEHRNPRVRRDLASALLSAAAGLATPE
SRGRRRGAQQDDDTDPELVSLREQMRRHPAHHLPDREDKVRIAERYLRIE
RDNAQIQQKVAAATNSLARTFDRIVVLLGERGFIDTTGDDPKVTDDGRLL
ARIYSESDLLVAECLRAGTWEGLDAAELAAVLSAVLFESRGDTPGVPAGS
EAPTTKVRRALSQTRRLSAELRADERRHRLNPGREPDEGFVAAIYRWATT
GDLTTALAASDASGGGSPLSAGDFVRWCRQVLDLLDQVRNAAPTPALRTA
AKRAINDIRRGVVAVDAG
119868554YP_938506.1 twin arginine translocase protein A [Mycobacterium sp. KMS]MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQSEG
KSDNPPATPITSERVDTNPTAEQPDKRSA
119868552YP_938504.1 hypothetical protein Mkms_2517 [Mycobacterium sp. KMS]MATSKVERLMNLVIALLSTRTFITADRIRQVVAGYADSPSDEAFSRMFER
DKNELRDLGIPLETGRVSQFDPTEGYRINRDAYALPAVELTADEAAAVAV
ATQLWESPELITATQGALLKLRAAGVDVDAADGVAISTATLPGVRGNEET
LRAILQAIDDGRAVQFGHRRDRSEPYTTRTVEPWGVVTHRGRWYLVGHDR
DRDAPRTFRLSRIADDVTTIGPPGAVHKPDDIDLREVVRRAVAEWPTGTQ
ARVWVADGRATALRRQAVVEGPMTRGGRTGEVITVEIGMFDQLAREIASY
GADAVALEPQTLRDDIIARLKAQATA
119868550YP_938502.1 hypothetical protein Mkms_2515 [Mycobacterium sp. KMS]MTGAGAWPETDESLFTDRASSLGGVLSQAAKAREGWQTNQASIFNGVHVW
AGEGASKAGAVVEKHASEMISHEQRMRDAISWCEKAAESITTAKDVICDN
VAKGQEEIRQLEREAANQDIDATNAIQSVVNRKYFENFDTVNKLAVGLGG
KPGVPQAPFEEPDELDTDGSRVPDGQRPSFFVRPTSSEVPQAPVVGEPVA
PPIGTPSIQPGASKGVRAAGTPDMGGPVVGQPAANPVVKPDVVRPAGRPN
IDAPSASPSPGRSPAGPQSQPSPVMASGGSGMPPITSSSPGSPLGSGGSS
GGGAPSLGGGSGSGGGGASGVGSSGGSSGGGTSSSPISDGPSSIGDQSSV
DPSNGASGPSSGAGGQPPIQSPPIADRLSNIGPAMQPASAPMAAPAAPTE
VAPPAAPAPSNPTTSTAAHAPVAPVSPPATGGGVPMAGGPAMPPPPMPLG
PPPTPSPAAPVVPTSAVPPPVAAPTSSAGSVVGAPAPVPVSAARAERDAI
AGSMRRQSAGDPVQVARRVAAALNAVESMDFGFFWATGVTKDGTILVANS
YGIGYIPDGVKLPDGVRMVSADESIPIDERAKWATFPMLALHGWAQHHDV
PLRAVVATAEQFDGFDPGAARVILTPDDIPERGDMAGRSRLEVIAPGAAR
QLASVDDTRLGDLLPPAPADTTPPADNSLMLWFEVMKPLMSTSAERGAAH
LEAMVSYANHAQELALHRAQTATDAATQRAAIADWVYWQHVSVMSNDAIV
IRQ
119868548YP_938500.1 hypothetical protein Mkms_2513 [Mycobacterium sp. KMS]MAVTELRVNTGELANGGKGLVSGAQAIPEPLQPLVTSGTDALSLALQSKT
QEIELPLIEGMPKTKAEALATAENIIRAAALYEQSDQQIADQLRKALAEL
DGAGAGGGAGAVGAATGAAGGGAAGAAGAAGAGQEMGQMGQMMGMPMQLA
QQAAQIPMQLAGMAMQIPQGIMQGVQSGMQQVGQMTSQFGDMGGAEKDEK
AKLEDELREKKDEPSEEKEPEGAAPGEATGERAPEVGPRHAAPEAPQTGP
APEPQPPAPKPAPTRPADSSILL
119868546YP_938498.1 regulatory proteins IclR [Mycobacterium sp. KMS]MPRDDDRPAAAVQSVDRALVVLEILAKAGQAGVTEIAAALDVHKSTVSRL
IAVLESRGYVEQVSGRGKYRLGFAIARLARASSGHLDLGRLSQDVCDGLT
DDLGETTNVAILDENRIVNIVESIGPGEITLRTWVGQSCPAHATSSGKVL
LAGLDPAEVRTRLTDPLVSFTPATIATVGQLLAELAEVRDHGWASVTEEL
EVGLNAVAAPVRDANSQVIAALSVSGPSYRLAEGKFGEVAEQTIAAADAI
SRRLGWIGPDTV
119868544YP_938496.1 glucose-methanol-choline oxidoreductase [Mycobacterium sp. KMS]MGDTGTFDYVIAGGGTAGCVLAARLSEDPDVTVCLIEAGPTDVGDDKILV
LADWMHLLDSGYDWDYPVEPQERGNSFMRHARARVLGGCSSHNSCIAFWP
PAEALDEWVTMGADGWSAAEILPLTERLTKTVQLRDVPPHDPCGSAVLEA
AALVGMPTVAFNRGETVRNGAGWFQINAGEDGIRNSTSHAFLHPILDTRR
NLEVRTDCWIAEILFDESNAATGVRYQRPDLTGYDTVSARREVIVCAGAI
DTPKLLMLSGIGPTAHLREMGIPVRVDSPGVGANLDDHVEGLVFWEAAKP
MVTTSTQWWEIGLFTTLDEGVTQPDLMMHYGSVPFDMNTLRRGYPTTDNG
FCLTPNVTQGRSRGTVRLRSRDFRDRARVDPRYFTDPDGYDERIMLTGVK
LARSIAEQAPLAPWVQRELAPGPDATTDDELLDYIHQCHNTVYHPAATAR
MGALSDPMAVLDPQLRVKGVSRLRVVDASAMPKLPAVNPNITVMTMAEKC
ADLIRES
119868542YP_938494.1 betaine-aldehyde dehydrogenase [Mycobacterium sp. KMS]MDGGPDLYIGGSWRRAGDGGTRQIINPADGSVAATVDEATPDDARAAVAA
ARQAFDDGAWPATAVTERAALLDLIADLLVRDKEDLALLETRDTGKTLPE
SRIDIDDVTSVFRYYARLIAVQSDRVVDVGDPSVISRVVHEPIGVCVLIA
PWNYPLLQMSWKVAPALAAGCTMVMKPSEVTPLSTIAFTRLLEEAGVPAG
VVNLVQGSGATLGSALTDTADVDFISFTGGVATGRTIAEAAAKHVTKVAL
ELGGKNPHIVFADIGTGDGWDSAVDHVLTGVFLHSGQVCSAGTRLIVEES
IADDFVADLAARAAEIRVGDGMDPASETGPLVSEQHRAKVESYVALGISE
GAQLVCGGSRPGDPALAKGSYYLPTIFDRCDRSMRIVTDETFGPILTVER
FTDESEAIRLGNDTQYGLAAGVRTSDTARGERVVRALRHGTVWLNDFGYY
TAAAEWGGYGKSGNGRELGPAGLAEYQETKHIWHNVAPQKAGWFKG
119868540YP_938492.1 N-methyltryptophan oxidase [Mycobacterium sp. KMS]MAHSSHADVIVIGLGGMGSAAAYHLASRGQRVLGLERFTPAHDKGSSHGG
SRIIRQSYFEDPAYVPLLLRAYDLWDRLATDSAREVYRMTGGLFIGPPNC
LTVAGSLRASRQWGLPHEVLDADEIRRRYPNFTPREGDVALYEANAGFAR
PEMTVQAHLDLAEHAGATLRFGEEVTGWTATADGVRVTTPAGTYRAGQLV
ICPGAWAPQLLAEFGIPITVERQVLYWLDPVGGTEPFVDHPIFIAENERA
EQIYGFPAIDGPHGGVKVAFFRKGVECTPDTIDRVVHEREIREMRDEAAR
LLPALDGPCVHSATCMYSNTPDQHFVIARHPDSVNVTVACGFSGHGFKFV
PVVGEILADLATTGATDHPIGLFDPRRLVHA
119868538YP_938490.1 ferrochelatase [Mycobacterium sp. KMS]MLFDALLVLSFGGPEGPDQVMPFLENVTRGRGIPRERLASVAEHYLHFGG
VSPINGINRALIAEIEAELGDRGETLPVYFGNRNWDPYVEDAVTAMRDDG
VRRAAVFATSAWGGYSSCTQYNEDIARGRAAAGDGAPQLVKLRHYFDHPL
LVEMFAESISVAAQSLPADVRDEARLVFTAHSIPVAADDRHGPNLYSRQV
AYATRLVAAAAGYSEFDQVWQSRSGPPRIPWLEPDIGDHVTALAERGTKA
VIICPIGFVADHIEVVWDLDSEVREQAADLGIAMARARTPNADRRYARLA
LDLVDELRGDRDPLRVAGVDPAPGCGYSVDGTTCADSPRCVARITG
119868536YP_938488.1 3-oxoacyl-ACP reductase [Mycobacterium sp. KMS]MTDSAVAETESQSTGGRPPFVSRSVLVTGGNRGIGLAIAQRLAADGHRVA
VTHRGSGAPEGLFGVVCDVTDNEAVDRAFKEVEEHQGPVEVLVSNAGISK
DAFLMRMTEERFEEVINANLTGAFRVVQRASRSMQRKRFGRIILIGSVSG
MWGIGNQANYAAAKAGLIGMARSISRELAKANVTANVVAPGYIDTEMTRA
LDERIQAGALDFIPAKRVGTAEEVAGAVSFLASEDANYIAGAVIPVDGGM
GMGH
119868534YP_938486.1 hypothetical protein Mkms_2499 [Mycobacterium sp. KMS]MTESDGRSVDLPSLQRGQIRDPALSAALRKLELTVRRKLDGVLHGDHLGL
IPGPGSEPGESRIYQPGDDVRRMDWSVTARTTVPHVREMIADRELETWLV
VDMSASLDFGTAGCEKRDLAVAAAAAIAFLNSGGGNRLGAVISNGQTMRR
VPALSGRMHEQEVLRTIATTPKAPPGVRGNLAEAIDALRRPERRRGMAVV
ISDFLGPIDWMRPLRAIAGRHEVLGIEVLDPRDVELPEVGDVVLQDAETG
VTREFTIDHQLREDFERAAAEHRAEVARTLRRCGAPLLSLRTDRDWIADV
VRFVASRRRGAMAGR
119868532YP_938484.1 NLP/P60 protein [Mycobacterium sp. KMS]MVRLLESLRRTLFHGVKSFVVAAAAVAMLVGVTGPASAAPDDGQWDPTLP
KLLSAGAPGDPLAIANASLAATAQATQVTMDLGRKFLSSMGIGGSSASAG
VAPGRVRGPQAIEYVIRRGASQMGTPYSWGGGKPNGPSRGVDSGANIVGY
DCSGFTQFSYAGVGVLIPKYSGDQYNTGRKVPTSQAKRGDLLFWGPGGSQ
HVAMYLGNGQMLESSGSAGKVTVSPVRQAGLQPYVARIIES
119868530YP_938482.1 hypothetical protein Mkms_2495 [Mycobacterium sp. KMS]MLPSGYPLARYGLPVTAAHVIPFLPGFIPPDVDMNMVIADVGDDGVSAPG
ADVAALRQVVSEARSDGIDLKIVVIDTNPHIDTPLRDIATEVGQAYPGST
VLALSPSYAGTYSSTFDRVTLEAGQDLAKTGDPVQSSKNFVGQLTTPDFP
WTALTIVLVIGVAAATAATRWLQIRGKRAAAAEAGPTPADQR
119868528YP_938480.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPRVTDDHLAARRRQILDGARRCFARYGYDKATVRRLEDTIGLSRGAIFH
HFRDKDTLFFELAREDAERMADVASREGLIQVMRDLLAAPDQFDWLATRL
EIARKLRNDPVFHKGWEERSAELSAATTARLHRQKEAGRLRDDVPSEVLQ
TYLDLVLDGLVARLASGDDPKKLGAVLDLVEASVRQQGSSVS
119868526YP_938478.1 ABC transporter-like protein [Mycobacterium sp. KMS]MITATDLEVRAGARTLLSIDGAALRVQPGDRIGLVGRNGAGKTTTMRILA
GEGEPYAGTVTRSGEVGYLPQDPREGDLDMLARDRVLSARGLDTLLSDLE
KQQALMAEVADDAARDKAVRRYGELEERFAALGGYAAESEAGRICASLGL
AERVLTQPLRTLSGGQRRRVELARILFAASDTGSGSDTTLLLDEPTNHLD
ADSIGWLRTFLQNHSGGLVVISHDVELLAAVVNRVWFLDAVRGEADVYNM
GWQKYLDARATDEQRRRRERANAEKKASALRTQAAKMGAKATKAVAAQNM
LRRAERMISELDEERVADKVAKIRFPTPAVCGRTPLVGKGLTKTYGSLEI
FTGVDLAIDKGSRVVVLGLNGAGKTTLLRILAGVEKADAGDIEPGHGLKL
GYFAQEHDTIDGNASVWENIRHAAPDTGEQDLRGLLGAFMFTGPQLDQPA
GTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRSYQG
AVVLVTHDPGAAEALEPQRVVLLPDGTEDYWSEEYRELIELA
119868524YP_938476.1 thioredoxin [Mycobacterium sp. KMS]MTTRDLTADQFNETITDNEIVLVDFWASWCGPCRAFAPTFAASSEKHPDV
VHAKVDTEAEQQLAAAADIRSIPTLMAFKKGKLVFNQAGALPPAALEDLV
QKVKEFDIDAAMAQQENAQSE
119868522YP_938474.1 hypothetical protein Mkms_2487 [Mycobacterium sp. KMS]MMTVPATGWRGGPVARGLWIGAAAGVFFGALALLDSGVPIVGAIVFVATG
LFLGVWTTRRMDRYWPGARELSPADRVTVVRAARRGYPIRDERLARGVVD
YDAGLRAAAERLYPYRWVVAVVLVVAIATAVVDAVTGSVRETVASCVYLA
LLAIELTWWPARRRELLLNSALAAALAQQSLDKRSP
119868520YP_938472.1 NifU family SUF system FeS assembly protein [Mycobacterium sp. KMS]MRLEQIYQEVILDHYKHPHHRGLREPFGAEVKHVNPTCGDEVTLRVALSD
DGDTVADVSYDGQGCSISQASTSVLTDLVIGESVGDALKTVAAFTEMVSS
RGTIEGDEDVIGDGIAFAGVSKYPARVKCALLGWMAFKDAVAQASHDSEE
ERR
119868518YP_938470.1 FeS assembly ATPase SufC [Mycobacterium sp. KMS]MTTLEIKDLHVTVAAGADASGADGGAKEILKGVNLTVNSGETHALMGPNG
SGKSTLSYAVAGHPKYTVTSGSITLDGQDVLEMTVDERARAGLFLAMQYP
VEVPGVSMSNFLRTAATAVRGEAPKLRHWIKEVKGAMTDLDIDPSFSERS
VNEGFSGGEKKRHEILQLSLLKPKIAILDETDSGLDVDALKVVSEGVNRY
AKENDGGVLVITHYTRILRYIQPQFVHVFVGGRIVESGGPELADELEAKG
YERFTAQAASTGV
119868516YP_938468.1 FeS assembly protein SufB [Mycobacterium sp. KMS]MTATPDTTSVTPEHTIGEPLSQEEAIASLGRYGYGWADSDVAGASAQRGL
SEAVVRDISAKKNEPEWMLDIRLRALRTFDKKPMPNWGSNLEGIDFDNIK
YFVRSSEKQAATWDDLPADIKNTYDKLGIPEAEKQRLVSGVAAQYESEVV
YHSIREDLEAQGVIFLDTDTALKEHPDLFKQYFGTVIPAGDNKFSALNTA
VWSGGSFIYVPPGVHVDIPLQAYFRINTENMGQFERTLIIVDEGAYVHYV
EGCTAPIYKSDSLHSAVVEIIVKPGGRCRYTTIQNWSNNVYNLVTKRARA
EAGATMEWVDGNIGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEGQHQDTG
AKMLHLAPQTSSNIVSKSVARGGGRASYRGLVQVNKGAHGSRSSVKCDAL
LVDTISRSDTYPYVDIREDDVTMGHEATVSKVSEDQLFYLMSRGMTEDEA
MAMVVRGFVEPIAKELPMEYALELNRLIELQMEGAVG
119868514YP_938466.1 hypothetical protein Mkms_2479 [Mycobacterium sp. KMS]MARMAGRLQSFSSSIARWHGDERTVGSPLTEADLVSLRRTRLFGATGTVL
MAIGALGAGARPVVQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWL
MLGRFALGSRRMSRSQTDRTLLLWAIPLLIAPPMYSKDVYSYLAQSEIAL
QGLDPYKVGPATGLGLDHVFTLSVPSLWRETPAPYGPLFLWIGQTISSIT
GENIVWAVLFHRLVVLAGVGLIVWATPRLARRCGVAEVSALWLGPCNPLL
FMHLVAGIHNEALMLGLMLAGTEFALRGVDAVRPLVPRPLHWPSGGAQWA
RWYPMAMLLAGTVLIAMSSQVKLPSLLALGFVAMALACRWGGTVKAFLIA
GGSLTAVAVTVMALIGWASGLGFGWLFTLGTANVVRSWMSPPTLIALGTG
QVGILLGLGDHTTAILGLTRAIGVSIIAVLVSGLLLAVLRGRLHPVGGLG
VALGATVLLFPVVQPWYLLWAIIPLATWATRPGFRGATIAVTLIVGIFGP
TANGDRFALFQIVMATLASTVVVAVLMALTWRRLPWQPLPDGDPPAMPGL
PPPSPESAESDPRPPQPRSAAPGAYADSP
119868512YP_938464.1 multidrug ABC transporter inner membrane protein [Mycobacterium sp. KMMTTNQFAPGTFTPDPRPAAVPKMLAAQFGLELRLLLRNGEQLLLTMFIPI
TLLVGLILLPLGDFGDDRAGTFVPAIMALAVISTAFTGQAIAVAFDRRYG
ALKRLGATALPVWGIIAGKSLAVVAVVFLQSVLLGAIGIALGWRPEVVGL
ALGGAIIALGTAGFAALGLLLGGTLRAEIVLAVANLLWFVFAGLGALTLE
GQAVPGALAWAARLTPSGALTEALTQAMALSVDWLGLAVLAAWGGVAALC
ALRWFRFT
119868510YP_938462.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MARRHGAELDAAIRAAVLKLLADHGPGAVTMESVAAAARTSKPVLYRRWP
DRASLLRDTLMQIATAAIPHDDTGSFRGDMLAVLRGWAVLFTGPDAAVMK
AAVAAAAHDPELTAALRNDVIGWRKQEMAALLRRGIDRGDVRRDVPVEIA
RELGQSVLWHRLLVTGDPITDDLVVALVDDVLVPFVAPR
119868508YP_938460.1 hypothetical protein Mkms_2473 [Mycobacterium sp. KMS]MTQVRLARPDLFHPRIVLAGCPALPEGDGDDDGLVDALRTRGLHARWLAW
DDPAVLDADLVILRATWDYIDRLDEFKVWTRQVRNLLNSPDVVAWNTDKR
YLVELAQRGVPTVPTRHFGSGDRVVVPDGEVVVKPAVGGGSVGAQRFTDP
VPAAAHAAHLQAQGRAVLVQPYDARVEYGETALVFLGGAQSHAFTKAAIL
PPEGPPVFDESGTYALETLAPAEPDFELWELGHAALGAAAAALGMEAAEF
LYARVDVIGDRAHARVLEVELVEPSLGWRQLDATTRTDRERDFALAVEVA
LERLGLGPLSHRRP
119868506YP_938458.1 peptidyl-tRNA hydrolase domain-containing protein [Mycobacterium sp. KMVSTTLVIAGSELSERFSRSSGPGGQGVNTADSRVELSLDLLRSRSIPQH
LRHRMLSHLRRRLTHGVLTVTASEHRAQLQNRAAARERMARLLRDAAAAP
PPTRRPTRPTRGSKERRITEKKRRGTIKEGRRGGWGPN
119868504YP_938456.1 inositol-phosphate phosphatase [Mycobacterium sp. KMS]MSTSSGELEDLAVAAAQTGADLCLRRLGEPLIVSTKSAAGDVVTPVDRAA
EEAVREILLAARPGDSVLGEELPAHTGVSGLEWVVDPLDGTTNYTRLIPY
FATSVAVRRTTDGVWLAGAVTAPALGATWSAARGGGAQLRSPAQRAVLPL
QLPATSARLIGTGLSYDPGRRRRQVRELGALVADYTDMRRFGAAAVDLCL
VAQGSLHAFVEDDLAVHDWAAGALIAEEAGATVCRPADGDETVSARWG
119868502YP_938454.1 carbohydrate kinase [Mycobacterium sp. KMS]MSQFTIGVDIGTTGTKTVLVDLAAGRIVAQASAESRLFADAPGHAEADPA
QWINNAHSTIRAVLAESGVTPGQVGALSTTGMVPAVVPVDAHGVPVRRAL
LQNDARATAQIERLREALDAADVLAATGSAITQQSVAPTAMWLRENDPDT
WHRTARLVGSYDWVLMALGAGPHVELNWAIESGLGTLDGQRYEPMFAAAD
LGADTMPEVLAPGAQAGTLSAAAAAATGLPEGLPLIVGGADHVLSAYAAG
VNAAGDWLVKLGGAGDVLAASDSPVIDGRLYLDAHPVPGRWLPNGCMATS
GSLIRWFQTLIGGVDLLQLDDEAAGRDAAEILCLPYFLGEKSPLHDPDLR
GAFVGLDLAHTRADMYRSVLEAIAFGFRHHTDVFTSIGVPLQRAMVTNGG
SKSVLWKQILADVLDTPLFPVIGHPGASLGAAVIAAIGVGALDDWDGAAR
FLTLGDAVEPDPRHVDRYAEAYSLWRTLGGVLTPVSHQLARKAK
119868500YP_938452.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MKIPKLGRRPARRKATRWMPALAMTAGLALAGCAGSGGSGDEQSSSGLGD
IPTDTNATVRVLMENVPDTDIVQGMVGQFNEKYPDIKVQIETMTFDQMRD
RLVSSFQSAEPAYDLIVVDNPWMDDFAAAGFLEPLNDRISSTPDYQPDDF
FPSLTDITDVDGTTYGVPFYNYALGYIYNKPDLQAANLQVPTDLDALVST
SQRLKAGDRAGIAMQPQRGYKIFEEWANWLFAAGGSIYDADGKPTLNTEQ
AARALDAYIETYRTAAPANSLNWGFDEAFRSVSGGNAASMIGYNWNLPAL
NDPAGASGARAGQFALAPIPGGKSALGLWSWAIPANSAAPDAAWAFTSWI
TSPAVDAQRVAEGGAVTRKGSLTDPKVLADGYGEEYYRVVGEILADAAPL
SQGRGGEEMIQAVGTELNDAAAGNKSVADALRDAQAAAERIQQ
119868498YP_938450.1 binding-protein-dependent transport systems inner membrane component [MTRPRPLEVLRIAVLTAALVFVLFPIAWVALASFKTPAQMSEPFLIAFGP
TLDNWRAVLDSGIFAAAGRSVVVGVVTVVVSLVVGSMGAYVIAKYRAGGS
LTRFGMLAAQVVPPAVMVFPFLTMAQALRMTDTLVPVIFAHLSFVLPLVT
WFLIGFFEAVPASLEEQARVDGFTRWQAFRLVVLPQVLPGIGAAGIFGFT
LSWNDMFYGLILAPGNAAILPVAISNFNTFRGVQIGTMSAAIMIAIVPVV
VASFFIQRRLVQGISGGAVKY
119868496YP_938448.1 protoheme IX farnesyltransferase [Mycobacterium sp. KMS]MTITKRKTINIAKTTANDEGVDCVSIRERHLSHGAPSRIRTTVLAYLALT
KPRVIELLLVTAIPAMLLADRGSVDPLLILNTLIGGMLAAAGANTLNCVA
DADIDKKMKRTARRPLARDTVPTRNALIFGLVLSVGSFFWLWGTSNLLSG
LLAVATIAFYVFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQW
PALVMFAIIFFWTPPHTWALAMRYKDDYKAAGVPMLPAVATERQVTRQIL
IYTWLTVLTTLALALATGWLYASVAVLAGTWFLVMAHQLYNGVKRGEPVK
PLRLFLQSNNYLAVVFAALAVDSVLALPTLLGS
119868494YP_938446.1 transaldolase [Mycobacterium sp. KMS]MTQNSNLAALSAAGVSVWLDDLSRERLQTGNLQELIDTRSVVGVTTNPSI
FQAALSKGDAYDAQVKELAERGADVDATIRTVTTDDVRNACDVLAKQYEL
SGGVDGRVSIEVDPRLAHDTDKTILQAIELWKIVDRPNLLIKIPATEAGL
PAITAVIAEGISVNVTLIFSVERHRAVMDAYLAGLEKAKEAGHDLSTIHS
VASFFVSRVDTEIDNRLEKVGSEEALALRGQAGVANARLAYAAYEEVFVG
GSRFEELKAAGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEK
TLEAVADHGVITGDTVTGKAAEAQAVFDKLDAVGIDLRDVFLVLETEGVE
KFEKSWQELLEATQGQLDEKKS
119868492YP_938444.1 OpcA protein [Mycobacterium sp. KMS]MIVDLPDTTTNDLNKKITSLREEGGAITLGRVLTLVIAPDCEDLVEFSID
AAVSASREHPCRIIVVVPDDPIADAPRLDGQLRVGGDAGAGEVVVLRTSG
PLAAHASSVVLPFLLPDTPVVAWWPGVAPDVPAQDPLGRLAIRRITDATG
TADPLASIKGRLKGYTAGDTDLAWSRITYWRALLTSAVDQPPYEPITSVV
VSGLKDEPALDVLAGWLASRVDGEVRREVGPLRVELVRPSSTITLRRPQE
GITATLSRTGRPDALLPLARREARDCLAEDLRRLDADEIYHEALQGIDKV
VYA
119868490YP_938442.1 hypothetical protein Mkms_2455 [Mycobacterium sp. KMS]MAIMVDRSGRGTTRTGTERIRKLAQAALNADVTVEQVDTILDGLSDTLDD
LNRSTANLDVTLERFNETINQINALAPRLIAVVDQMEGIVGRVERLVGMG
EAVLGPLAATENAVRGALNAVRRSTGL
119868488YP_938440.1 preprotein translocase subunit SecG [Mycobacterium sp. KMS]MVLALQITLIVTSLLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVVGIWVVSIVGVALQIKYS
119868486YP_938438.1 phosphoglycerate kinase [Mycobacterium sp. KMS]MAVKTLEDLLNDGDREIAGRGVLVRSDLNVPLDDNGAITDPGRIIASVPT
LEALAEAGAKVIVTAHLGRPKGGPDPKYSLKPVAAALSEKLGRHVQLAGD
VVGTDALARAEGLTDGDVLLLENIRFDPRETSKDDGERRKLAEALVELVG
DDGAFVSDGFGVVHRKQASVYDIATLLPHYAGTLVAAEVKVLEQLTSSTD
RPYAVVLGGSKVSDKLAVIESLAKKADSLVIGGGMCFTFLASQGVSVGKS
LVQPEMIDTCRELLDTYGDVIHLPVDIVVAPEFSADAEPETVAADRIPED
KMGLDIGPESVKRFTNLLSNARTVFWNGPMGVFEFPAFAAGTKGVAEAII
GATAKGAFSVVGGGDSAAAVRQLGLAEDGFSHISTGGGASLEYLEGKELP
GIQVLES
119868484YP_938436.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MTTVAGVGTLRVGIVVPNPPFTGMPGGLDVDLANAIADALGDRAEFVDYR
TVDEVLEALGSGDVDCAAGGLTATDGPVAFAPPYLIAGQALAVDAENHPN
VHSVDELDGLTVAVQRGSAAERFAAQLKGPVKRCDRLDIDGCDAIVALAP
VLTEYAKGRSDVDVVQKGLSVEHIALAVAGHDQQMLSRITVAQAELEEAG
TLQQIRRRWLGNPYADQSLAVH
119868482YP_938434.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPVRKSSEDRLLDAVDDLVFSRGIESTPVDAVLARAGVSAATLYRGFRSK
EALIAAALERRHERWRVVWERAIAAATDDEERLLAVFDAVDAFARRPDGA
RWCAFLGTAAEYADPPAEIADAVARDTDYLRERLRELASQLPCGDPDGLA
EAILVVLTGELAMRLRDARRRRSTVGRQIGRTLITTALAG
119868480YP_938432.1 hypothetical protein Mkms_2444 [Mycobacterium sp. KMS]MSPRIVALGGGHGLYATLSAARRLSPHVTAVVTVADDGGSSGRLRSELDV
VPPGDLRMALAALASDSPHGRLWATIIQHRFGGSGALAGHPIGNLMLAGL
SEVLADPVAALDELGRILGVKGRVLPMCPIALQIEADVAGLESDPRMSRV
IRGQVAIATTVGKVRRVRLLPGDPPATRQAVDAIMSADLVVLGPGSWFTS
VIPHVLVPELAAALRATSARRALVLNLAAEPGETAGFSVERHIHVLSQHA
PNFTVHDIIVDASRVPSDRERDQLSRTAKILDARVEFADVCRPGTPLHDP
ARLAAALEGVRLRGTAGGRDEVPTASTPTSNRPRGDDSWR
119868478YP_938430.1 excinuclease ABC subunit C [Mycobacterium sp. KMS]MPDPSTYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADL
SGLAPRTRQMVMTAAKVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDD
KSYPVLAVTLNEEFPRLKVYRGPRKKGVRYFGPYSHAWAIRETVDLLTRV
FPARTCSAGVFKRHNQIDRPCLLGYIDKCSAPCVGRVSAEQHRQIVLDFC
DFLAGKTDRLVRDLERKMTAAAEDLDFERAARLRDDIGALRRALEKQTVV
FGDGTDADVVAFADDDLEAAVQVFHVRGGRVRGQRGWIVEKSGEPGESGE
GQLVEQFLTQFYGDQAELGSAGDNAGDSGQDEATNPVPRQVLVPCLPDNA
DELTEWLSQLRGSRVALRVPQRGDKKALFETVQRNAKEALAQHKLKRAGD
FTARTAALQSIQDTLGLADAPLRIECIDISHVQGTDVVASLVVFEDGLPR
KSDYRHYAIREAAGDGRSDDVASIAEVTRRRFYRHLHDTQHPTELSAEGK
SRKFAYPPNLFVVDGGAPQVNAAQAVLDELGISDVAVIGLAKRLEEVWVP
SGSDLGPEPIILPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRMTASAL
DSVRGLGEHRRKALVTHFGSVARLKEASVEEITAVPGIGVTTARAVLEAL
GVPQAAPADSDTAAAVIDDDQRRVTG
119868476YP_938428.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MTAPHVTQLTEADWQQFAVVRLRALTDSLGVDDPQYRHESSFTATQWRRR
LREHAQFAVLADGRPVGLISAQRESTQSVYLYSLWLDPDARGHGLARPLV
EAAVDWARSQRAHTVTLRVAADNAVARAVYESVGFRISAATVGPRHELAM
SLSV
119868474YP_938426.1 6-7-dimethyl-8-ribityllumazine synthase [Mycobacterium sp. KMS]MSGGAGVPDLPQIDASGMKVGIVASTWHSTICDALLDGALKVTESANVSE
PTVVRVLGAIEIPVVAQALAADHEAVIALGVVIRGQTPHFDYVCDAVTQG
LTRVSLDASTPVANGVLTTNTEEQALDRAGLPGSAEDKGAQAAAAALSTA
LTLQGLRGRS
119868472YP_938424.1 riboflavin synthase subunit alpha [Mycobacterium sp. KMS]MFTGIVEEVGEVVGKEDLTDAARLVIRGPVVTADAGHGDSIAVNGVCLTV
VEIQPGGVFSADVMGETLDRSSLGDVGVGSRVNLERAAAVNSRLGGHIVQ
GHVDGTGHVIARTPSEHWEVVRIALPTALARYVVEKGSITVDGVSLTVSA
LGRASENDWFEVSLIPTTRELTILGTAPIGTRVNLEVDVIAKYVERLMST
SRE
119868470YP_938422.1 major facilitator superfamily transporter [Mycobacterium sp. KMS]MQPTEVGPAIAPANSRSRRIAISAGSLAVLLGALDTYVVIAIIRDIMFDI
GIAINQIQRVTPIITGYLLGYIAAMPLLGRASDRFGRKLVLQLSLAGFAI
GSVVTALSNDLTPMVIGRFIQGVASGALLPVTLALAADLWATRNRASVLG
GIGAAQELGSVLGPLYGIAVVAALSTWRDVFWINVPLAAIAMVLIHFSLP
ARLKPERPEKVDVVGGVLLAIALGLSVIGLYNPAPDGKQILPDYGPPTLI
GAVAAFVAFFVWERFARTRLIEPAGVHFRPFLAALGASLCAGAALMVTLV
NVELFGQGVLGKDQTEAVLLLLRFLIALPIGALLGGWLASRIGDRLVAFA
GLMIAAGGYLLISKWPVDLLSARHDLGFVTLPVLDTDLVIAGIGLGLVIG
PLTSASLRVVPAAQHGIASAAVVVSRMIGMLIGLAALSAWGLYRLNQHLQ
TLPFPPGADTLAERLAAEADRYRAAYVLQYGDIFIVTTIICVVGALLGLL
ISGRNEHADESPVPVGADHGDDAPTQFINVAGASGDADQTTRLPRQTPGR
HRDEA
119868468YP_938420.1 ribulose-phosphate 3-epimerase [Mycobacterium sp. KMS]MAHPLIAPSILSADFARLADETAAVTGADWLHVDVMDNHFVPNLTLGLPV
VESLLKVTDIPMDCHLMIENPERWAPPYAEAGAHNVTFHAEATDNPIAVA
RDIRAAGAKAGLAVKPGTPIDPYLEILREFDTLLVMSVEPGFGGQKFIPE
VLPKVGIVRRLVDSGELTVLVEIDGGINEDTIAAAAEAGVDCFVAGSAVY
SAQDPAAAVRSLREQAAAASKHLS
119868466YP_938418.1 methionyl-tRNA formyltransferase [Mycobacterium sp. KMS]MRLVFAGTPEPALPSLQRLIASPRHEVVAVLTRPDAAAGRRGRPTPSPVA
RLALDHDIPVLRPPKPNSEEFVAELRELAPDCCAVVAYGALLSERLLAVP
PHGWINLHFSLLPAWRGAAPVQAAIAAGDAVTGATTFLIEPALDSGPVYG
VVTETIRANDTAGELLTRLAESGAHLLESTLDGIADGRLQAVPQPADGVT
VAPKITVDEARVRWDLPAHVVDRRIRAVTPNPGAWTVIGDARVKLGPVAP
ESAEPLAPGAIRVLKNAVHVGTATEPVRLGTVQPPGKKPMNAADWARGAR
LDASVSAQ
119868464YP_938416.1 hypothetical protein Mkms_2428 [Mycobacterium sp. KMS]MRRLLAWSITLLLIAAGLLWPLLFDGGGSGGGTVDDPMVIRDYRAEFVVA
DDGELTAVETITGEFPADRHGIFRYWDVVNPNSPRIRQRPVVESVTRDGA
PEPYEMLWESGERFRVAKIGSAEVTLSPGDHVFEMRYRIPGVLDPGDTGA
DRRFATTTGDPNAPSTFFWNVIAPSWNNRIDRAEISVTLPADVTGVQCSV
GYGVGRACDLTTTGRTVRIEARDLPPRTPVTVRTGVEADPPPRDELPWSH
RWDRILGGSVDGLTWMLGLSALAALGGYVWTRSAVERPPAFPLQYAPPPG
IGPVQAEYIRTEKVPRHGLTATLFHLAEQDLVTLVQVNSKQWEVRGTAGK
SRWADVDPVGVAVGSALKVIGTGTEFEAKHTARAGEKLSKARTDMAAAVK
DWALDDGVMVKRGREGWLQTANILAAVLAVCGFFGWGFATTMAGLPFAMF
FVVTIPAWFGGLGTRRTPEGRQLWSQVGGFHRMLCTDSAEARFDFAARKD
LYTAYLPFAVAAGVAALWAKKYEMVMGVPAPQPEWYHSSTPSGSSFTGGS
DGGGGFESFESALSSSINAYTASQAASSSSSSSSSSGSSFSGGGGGGGGG
GGGGSW
119868462YP_938414.1 acetamidase/formamidase [Mycobacterium sp. KMS]MAAACARDTSSATTADPPYASIPVLQPGQGDRSGDHYLSSLPDQVLWGYV
PTVHATPVLRMRSGQTVTIDALSHEGILEDQGRNPVEYFGGLGVSEADVL
DDAKAIAAEYNRTPRNFAKDGPHVVTGPIFVEGAEPGDVLKIETLETIPR
VPYGVVSSRHGKGALGMTADKAAPAGISLAEVMPPTDTDGRSDPDPTKWG
DVSVFTPVEEGRGVMPVGAGGSVRFPLNPFMGMMGVAFARDESLNAPNAN
SIPPTLGGGNIDIKLLGAGSTFYLPVFAPGALFYVGDPHMAMGDGEVALT
AMEGSLRGTFRLTVCKPGSGDAPSVAYRYPFAETEQAWIPIGLSDPDGAV
GGQGSDLDVAMRRAVVNALDYLERDRGMDRATAYAYLSAASDFTISQVVD
RTVGVHGQIYKEHFGS
119868460YP_938412.1 alpha/beta hydrolase domain-containing protein [Mycobacterium sp. KMS]MPFQFSVDEGAEVIRRKLRDLPRREVHPEVEAQDRTIPGPAGDIPIRVYR
PATAESSPPVVVFFHGGGFAAGDLDTHDGECRHHAVAADAVVVAVDYRLA
PEHPYPAAVEDAWAALTWVAGHGAELSVDTNRLAVAGDSAGGNLSAVMTH
RARTRGGPPIAFQLLWYPVTMWDMSLPSVTENAGAPILDRTAMDGLSRWY
AGELTDPGHELAPGLADDFTGLPPAYIAVAGHDPLRDDGIRYAELLSAAG
VPVEVHNAETLVHGYLGYAGVVPSATAATDRGLAALRAALHPEAGQRPEK
119868458YP_938410.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MVRWQPDARGRLEQAALELYAERGFDGTTVADIADRAGLTERTFFRYFAD
KREALFGGQTAMIDLMVKAVAAAPDSVAPIEAVASALNAVAATFDGRLDD
VRRRQAVIAATPALQERESSKLALLATALADALRARDVAETTARLAAETG
VAVFRIAFERWVAGGDQRDLAQHIRELLDELATMTARPATT
119868456YP_938408.1 S-adenosylmethionine synthetase [Mycobacterium sp. KMS]MSKGRLFTSESVTEGHPDKICDAISDSVLDSLLAQDPRSRVAVETLVTTG
QVHVVGEVTTSAKEAFADITNTVRHRILEVGYDSSDKGFDGTTCGVNIGI
GAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIKDTPELMP
LPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTVQYDGVTPVRLDTVVL
STQHAEGIDLEGTLTPDIREKVVNTVLSDLNHDSMDTSDFRLLVNPTGKF
VLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRW
VAKNVVAAGLADRVEVQVAYAIGKAAPVGLFVETFGTETVDPAKIEKAIT
EVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIDLPWERTDKADALKT
AV
119868454YP_938406.1 DNA-directed RNA polymerase subunit omega [Mycobacterium sp. KMS]MSTPHADAQLTAVDDLTIDAAAAGAYDTPLGITNPPIDELLDRASSKYAL
VIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEKPLSIALREIHEDL
LEHTEGE
119868452YP_938404.1 protein MihF [Mycobacterium sp. KMS]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLKDAETDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFDQS
119868450YP_938402.1 carbamoyl phosphate synthase large subunit [Mycobacterium sp. KMS]MPRRTDLRHVLVIGSGPILIGQAAEFDYSGTQACRVLRAEGLTVTLINSN
PATIMTDPEYADYTYVEPITPDFVERVIAQQAERGNKIDALLATLGGQTA
LNTAVALSENGVLERYDVELIGADFDAIQRGEDRQRFKDIVTKVGGESAK
SRVCFTMEEVRETVGELGLPVVVRPSFTMGGLGSGMAYSAEDVERMAGHG
LASSPSANVLIEESIFGWKEYELELMRDRHDNVVVVCSIENFDPMGVHTG
DSVTVAPAMTLTDREYQTMRDLGIAILREVGVATGGCNIQFAVNPKDGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEILNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADATLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETGRAGFWTAPDPIATVDEVLENLRTPTDGRLYDIEFALRLGAS
VEQVAEASGVDPWFVDQIAGLVALRTELLDAPVLDGTLLRRAKNSGLSDR
QIAALRPELAGEVGVRALRQRLGIHPVFKTVDTCAAEFEAKTPYHYSSYE
LDPAAESEVAPQAERPKVLILGSGPNRIGQGIEFDYSCVHAATTLSEAGF
ETVMINCNPETVSTDYDTADRLYFEPLTFEDVLEIYYAESASGAGGPGVA
GVIVQLGGQTPLGLAERLEQAGVPIVGTSPKAIDLAEDRGAFGEVLRTAG
LPAPRFGLATTFDQARRIAADIGYPVLVRPSYVLGGRGMEIVYDEQTLEG
YITRATQLSPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGIMEHIEEAG
IHSGDSACALPPVTLGRSDIESVRRATEAIAHGVGVVGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAVPLAKACARIMLGASIAQLREEGVLAAT
GDGATTARNAPVAVKEAVLPFHRFRKADGAQIDSLLGPEMKSTGEVMGID
HDFGSAFAKSQTAAYGSLPSEGTVFVSVANRDKRSLVFPVKRLADLGFKV
LATEGTAEMLRRNGIPCDEVRKHFEEPGAGRPARSAVEAIRAGDVAMVIN
TPYGNSGPRIDGYEIRSAAVSMNIPCITTVQGASAAVQGIEASLRGDIGV
MSLQELHSELGN
119868448YP_938400.1 hypothetical protein Mkms_2412 [Mycobacterium sp. KMS]MNTGTLVTSLVLAAVIVVAIGLLIRAMMRGWHSRAQRQVELIGKLPPLPD
TVSQAVIPPMKGLYVGCTLAPNWHDRIVVGDLGYRTKAVLTRFPEGIMVQ
RSGAHSIWIPAESVTAIRTERGMVGKALTHDGILAIRWRLPSGTEIDTGF
RGDDRTKYDRWLEEVA
119868446YP_938398.1 aspartate carbamoyltransferase catalytic subunit [Mycobacterium sp. KMMTRHLLTAADLSRDEATAILDDADRFSQALIGREVKKLPTLRGRTVITMF
YENSTRTRVSFEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGA
DALIIRHPASGAAQQLAEWTAAEAGAPSVINAGDGTHEHPTQALLDALTL
RQRLGGIEGRRVVIVGDVLHSRVARSNVLLLHTLGAEVVLVAPPTLLPVG
VRQWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFPSAREYSVRYGLS
DKRQALLPDSAVVLHPGPMLRGMEISSSVADSSQSAVLQQVSNGVHVRMA
VLFHLLVGAEQEAISA
119868444YP_938396.1 beta-lactamase [Mycobacterium sp. KMS]MNLDGNQASIREAVDAGLLSGAVTLVWQAGRVVQVNELGHRDIGARLPMQ
RDTIFRIASMTKPLTVAAAMSLVDEGRFRLSDPVTAWLPELADMQVLDTP
GGPLDRTHPARRAITVDDLMTHRSGLAYFFSVSGPLARAYGRISAKQNPD
AWLAEIAALPLEHQPGERMTYSNSTDVLGVLLERIEGKSLQEVLTERVLG
PLGMADTAFYVAPRNRGRVATMYKLTSDDTLSHDAMGPPATTPPPFCMGG
ANLFSTADDYLRFARMLLAGGEVDGVRVLSEQSVQSMRTDRLTADQKRHP
FLGMPFWLGRGFGLNLSVVTDPAKSRQLFGPGGLGTFSWPGAYGTWWQAD
PTNDLILIYLIQNLPNFGADAAAAVAGNTSLMKLQSVQPKFVRRTYSALG
I
119868442YP_938394.1 transcription antitermination protein NusB [Mycobacterium sp. KMS]MSDRRPDRGRHQARKRAVDLLFEAEARGLTAAEVATSRNKLAGTQPDVTA
LNPYTVTVARGVTDHRDHIDDLISAHLQGWTLDRLPAVDRAILRVAVWEL
LHAEDVPEPVAVDEAVELAKQLSTDDSPGFVNGVLGQVMLVTPQIRAASQ
AVRESAQGPSEG
119868440YP_938392.1 peptidase M24 [Mycobacterium sp. KMS]MTLSQRRDRLRERLAAAELDAMLVTDLVNVRYLSGFTGSNAALLIRVSHT
TPILATDGRYRTQAARQSPDSEVVIERACAPYLAGRAAGEGLRRLGFESH
VVTVDGHRGLLKAVGDTELVRAPGMVEALREVKDAGEIAMLRLACEAADA
ALHDLIAGGGLRPGRTEKQVRRDLEALMLDHGADGPSFETIVATGPNSAI
PHHRPTDAVLATGDFVKIDFGALVSGYHSDMTRTFVLGRAGKIEDWQRDL
YDLVATAQRAGTDALTAGVTLSDVDAASRQVIADAGYAERFGHGLGHGVG
LQIHEAPGINAAAAGTLLAGSVVTVEPGVYLPDRGGVRIEDTLVVGLEAD
PRTGTGSDAPDLLTRFPKELAIL
119868438YP_938390.1 3-dehydroquinate dehydratase [Mycobacterium sp. KMS]MSATSTVNVINGPNLGRLGRREPAVYGSTTHADLVAMIEREAADLGLKVS
VRQSDSEAELIGWIHAAADAGEPVVLNAGALTHTSIALRDACAELSAPLI
EVHISNVHRREEFRHHSYLSGVATGVIVGLGVQGYVLALRYLAAG
119868436YP_938388.1 shikimate kinase [Mycobacterium sp. KMS]MAPRAVLVGLPGSGKSTIGRRLAKALGLTLLDTDAAIEETTGRTIADIFA
TDGEQEFRRIEEEVIRSALQTHDGVLSLGGGAVTTPGVRDALAGHTVIYL
EISAAEGVRRTGGSTVRPLLAGPDRAEKYKALMDARVPLYRRVATMRVNT
NRRNPGAVVRHIVARLEKSAPRAEAATPAPPTPNRPRRRRRPPWRRDAAK
DQQESDGPPTPAIMAARAAERASDPHRDTTLEKNT
119868434YP_938386.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MKAITYSRTGDSSVLQLQDRPLPEPGAGEVRVRVVVSGVNPTDWKHRRGA
APGQELEYPEVVPHHDGAGVVDAVGAGVSELSVGDRVWVFMAQHQRPDGT
AQEYLVLPVASVVPLPDGVGFEVGASLGVPAITAHRALTVAEGWPSRLRP
GALEGATVLVAGGAGAVGHAAIQLARWAGARVITTVSTSEKEALAAAAGA
HHIVNYRAGDTAAAIREVAPDGVDIVVEVAPAPNAALDAAVVSNRATIAI
YANDGGSSVELDIIPNMWVNARYQFLVLYTVGDDALANAREDVAAAVGDG
AMGVGEENGLPLHYFALEETAGAHDAVESGVTGKVLVRVSD
119868432YP_938384.1 shikimate 5-dehydrogenase [Mycobacterium sp. KMS]MPDRRPAAVPDSARKAAVLGSPIAHSRSPQLHLAAYRALGLTDWTYERIE
CTAEQLPGLVGGFGPEWVGVSVTMPGKFAALRFADERTERAELVGSANTL
VRTPNGWRADNTDVDGVAGALGNVDGPGIVVGSGGTAPAAVVALAGLGAT
RLTIAARNADKAASLVDLAHRLGVTARWCDLDDPDLTALAAAAGAVVSTV
PADVAQRYAATFAGTPVLLDAIYDPWPTPLAAAVQAAGGRVIGGLQMLLH
QAFAQVEQFTGLPAPKEAMRAALQTA
119868430YP_938382.1 Holliday junction resolvase-like protein [Mycobacterium sp. KMS]MTDSDHRLPDRPGEGDPGRGRRIGIDVGSVRVGVATSDPDGVLATPVETV
RREKSSDRHVRRLAQLVTELEAVEVVVGLPRTLADRTGPAAHDAIDVAEA
LARRIAPVPVRMADERLTTVSAQRSLREAGVRAKGQRAMIDQVAAVGILQ
SWLDQRRAALAAPGEGGHG
119868428YP_938380.1 hypothetical protein Mkms_2392 [Mycobacterium sp. KMS]MDTDLLDVDTSRRRIVDLTDAVRSFCGQRRDGLCNVFVPHATAGVALIET
GSGSDDDLLDTLERLLPRDDRYRHAHGSPGHGADHVLPALISPSVTVPVQ
DGQPLLGTWQSVVLVDLNRDNPRRSVRLSFLGR
119868426YP_938378.1 putative transglycosylase associated protein [Mycobacterium sp. KMS]MTVTGVISAILIGIVVGVLARLLLPGKQSIGMIVTILVGIVSALIGTAVA
RAIGLPTATSGVDWLELLVQVVVAMIGVALVATLMGRRRGGVMGGRRRPM
MR
119868424YP_938376.1 gas vesicle K [Mycobacterium sp. KMS]MTGPTPRQRINSDPESVERGLVSLVLTLVELLRQLMERQAIRRVDSGDLT
DEQIERIGTTLMLLEEKMEELREHFGLEPEDLNIDLGPLGPLLPRE
119868422YP_938374.1 gas vesicle synthesis GvpLGvpF [Mycobacterium sp. KMS]MSTDGTGVWAYAIFPDDSGDERVAGLVGVAGEPVRVISGAGLAAAVGTVG
LDEFGEEALRRNLENLDWLGVKARAHDAVVSTLARSGPVIPVRMTTVYLT
DERVRRMLENGRTVFRAALDRVTGRVELGVKAYADPKALVAEDDPVQEPG
GRGSGAAYLLRRKRQLHSQERAHGIAAAAAERFHRALLAGATDGKRKPVA
DNSLSGRSGWTVLNGTYLVDVDRVDEFRSIVTSLQSDSDGIELEITGPWP
PYSFTGDVVSADE
119868420YP_938372.1 gas vesicle synthesis family protein [Mycobacterium sp. KMS]MAERTRARPTDDGGADPPPLTAREAIDLAREQITDLLGREEVQMTSVAPT
QEGGWVIEVEVVEDHRIPSSSDILALYEVELDADGELLTYRRTRRYGRGR
TGNGNGGGLE
119868418YP_938370.1 gas vesicle synthesis GvpLGvpF [Mycobacterium sp. KMS]MTAADQVERAEGRDAGRAVYVYGIVPADVAVEEDAVGVGDPPSEVEIVKE
GDIAALVSRIATDHPLGTPDDLQAHAHLLDGAAAVAPVLPLRFGAVMTDA
ESVAEELLREHHDEFRETLEKLEGHAQYVVKGRYDQQTFLRDLLEESEQA
RALRDDIQSKPEDASRDSRMALGELIANTIEAKRQADTNTAVDALNTVAQ
AVNVREPTHEWDAVNVAALVEVKAQADVEAVVDELAENAAGRVDLRLLGP
MAAYDFVVTSNPEG
119868416YP_938368.1 cyclase/dehydrase [Mycobacterium sp. KMS]MTQNTTSATSAKNAPSGQLRTSLQQLAGTFTDRAVNKVTDRVGGTTQRLT
DYAQSGGGNGGLLAAATGSEKLLSGELPVKAALAGGLAGAKEKAKDALKG
VTGALTGKGGGGDKIKVTNIVEQIDVGVPVDLAYRQWTQFADFPKYMKKV
EQVEQVSDEKLVWKAQIFLSHRSWESTITEQVPNERIVWRSKGDKGYVDG
AITFHELAPNLTRVIVVLEYHPKGLFERTGNLWRAQGRRVRLELKHFQRE
VMAHAMLNPDDVQGWPGEIRDGEVVEDGEPDPGADEPADSDSDTGPDSDE
AAPPKQRRRATARTRGGDRAASPVRRAAKTRKTRA
119868414YP_938366.1 hypothetical protein Mkms_2378 [Mycobacterium sp. KMS]MNSVTDRREYDFLCSYATINIKTRSKNELPFKIMEFTANRIISISRTMRG
MNSLANYEFGGCINGPVPVRVGGDTAHDRGRPAVRASRAAMGAGKPLRGI
LNSVNAGERTPVGSVWSGSGGVAPGRCAGGRSRGGPSS
119868412YP_938364.1 isoprenylcysteine carboxyl methyltransferase [Mycobacterium sp. KMS]MYPVIYYLFIVAVGVERVLELVVARRHTRWSIANGGREFGRGHYPLMVTM
HTLLLVSCVVEVSVAHRPFIPWLGWTMVAVVVASTVVRWWCVSVLGNHWN
PRLIVIPGAPLVRRGPYRWVHHPNYIAVAAEVAALPLIHSAWVTAIVFTI
ANALVLTVRIRAENVALGYQNVVTKPPVGHHSPT
119868410YP_938362.1 activator of Hsp90 ATPase 1 family protein [Mycobacterium sp. KMS]MNNGLDLVAPVDTLAMDYTRDFDAPVAALFRAHAEPDLVRQWLGPHGVEI
SLERWDFRTGGGYRYVHSDENSSYAFNGVFHRVREDLVIQTFEFEGAPDM
VNIEFLWFEDLGDGRSRLRGRSICPNTDARDALLSSGMEGGMTEGYERLD
ALLPSLHSSRSPNSH
119868408YP_938360.1 recombination factor protein RarA [Mycobacterium sp. KMS]MSDSLFDLPADGPVAAAGAPVSAPLAVRMRPASLDEVVGQQHLLKPNSPL
RRLVEGSGAASVILYGPPGTGKTTLASLISHATGRRFEALSALSAGVKEV
RAVIETARQGILRGQQTVLFIDEVHRFSKTQQDALLAAVENRIVLLVAAT
TENPSFSVVAPLLSRSLILQLQPLAPDSITEVVRRAVADPRGLADSVDVS
DDAVDLIVQLSAGDARRALTALEVAAESAAAADGRVTVDIVEQSLDKAAV
RYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLM
ILASEDIGMADPTALPLAVAAAQTVQLIGMPEAQLTLAHATVHLATAAKS
NAVTTALGAAMSDVRNGKAGQVPAHLRDGHYSGAAKLGNAVGYVYAHDHP
DGVVPQQYPPDELVGVDYYRPTGRGAEREIGGRLDRLRAIIRKRR
119868406YP_938358.1 hypothetical protein Mkms_2370 [Mycobacterium sp. KMS]MRDFNCPNCGQRLAFENSLCLNCGSALGFSLDDMALLVIAPPKESDHAGA
VSARHYQLCANMHLAECNWLVETGPVALLCEACALTRTRPNDADAKALAA
FAVAERAKRRLIAELHELKLPIVGRDEDPDYGLAFDLLSSENEKVFTGHA
NGVITLDLAEGDDVHREQLRISMDEPYRTLLGHFRHEIGHYYFYRLIGPS
PTYLEGFNELFGDPDLDYQEALDRHYSEGAPAGWEENYVSSYATMHPAED
WAETFAHYLHIRDTLDTAAAFGFAPAGATFERRVLGPSGFDTIIEMWLPL
SWALNMVNRSMGKDDLYPFVLPPPVLDKMRFIHHVIDEVTADPTKLASST
ASQQQQQG
119868404YP_938356.1 hypothetical protein Mkms_2368 [Mycobacterium sp. KMS]MILSAEGPTGPADVDGVLAEYRAARAQQALFDVRGGAGSGYDEFVDAAGE
IRPAWRELAQCVVERGRDGLDRLRAVVRSLVDNDGITYIHVDQHGEAVTT
DDDAVPGPWRLDGLPLVISADDWDRLESGLVQRSRLLDAVLTDLYGPQRS
ITSGVLPPQLLFAHPGYLRAARGIEIPGRRQLFLHGCDVSRTADGSFNVN
ADWTQAPSGAGYALADRRVVAHAIPELYEQLGPRPASPWAQALRLALIDA
APESAEDPFVVVLSPGIHSETAFDQAYLASVLGFPLVESADLVVRDGKLW
MRSLGTLKRVDVVLRRVDADYADPLDLRADSRLGVVGLVETLRRGAVTVV
NTLGSGILESPGVLRFLPELAEELLGETPLLATAPVYWGGIDLERSHLLS
HTASLLITPVTGGDTIVGPALSRSQRDELVARIEAAPWQWVGRELPQFSS
APTVHRTGGLSAASVGMRLFTVAQRGGYAPMIGGLGYLLAPGNPAYALNS
VAAKDIWIRTPARVTAERTVPVEPEVVAPPAPVTPSRTHEVSSPRVLSDL
FWLGRYAERAEYTARLLNVTRERYHEYRYRQEMDGSACVPVLLTAIGKLT
GTDTGAGGDYAEMIAIAPTTLWAVTADRHRAGSLAQSIERLGLAARSVRD
QMSNDTWMVLAAVERAVLRASSAPPESKTEGDAYLASAHSATLAGMLALS
GVAAESMIRDAGWTMMDIGKRIERGLGLTGLLRATLVEARTPDAEQTITE
STLVACESSVIYRRRMLGTVRVAAVADLLLLDAENPRSLVYQFDRLRDGL
RALPGSSGSSRPERLVDDLVTRLRRVDPADLEEVTADGRRADLADLLDGV
HRDLRALSGVITAAHLSLPGGMQPLWGPAERRMVP
119868402YP_938354.1 hypothetical protein Mkms_2366 [Mycobacterium sp. KMS]MLHLRVIAPPDLSDPVLELLTDNPGVAHLVIHRDAALDPRGDEITADIAR
ESANEVVDGLKALGVKDRGAITLDVVDTVLSVRAYRAEDEAEGDPADAVV
WDELAARTREESTLNVTFVAFLTLACLIAAVGVVTDSPVTVVGAMVVGPE
FGPLAALAVSLVRRRTHLTRRALAALLIGFPIAMAVTAFGVMAGEGLGWI
ELASTRDLEEVDFIFQVGPLSLVVALLAGAAGMLSLVSAKSAALVGVFIS
VTTVPAAGFAVVAATVGDWDIAGESAAQLAINLTGIVAAGVAVLWIRKLA
DRHHRPA
119868400YP_938352.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MSGFTGRDAVIVGAVRTPIGKGKPGGGLHEVLPADLLAHSLRELVTRTGV
DPAQVDDVIAGAVTQVGDQAVNIARNALLGAGFPESVPGTTVDRQCGSSQ
QAISFAAQGVASGAYDIVIAAGVESMSRVPMGSSVLPGSNPFGDDFARRY
PDGLVPQGISAELIAAKWGLSRTALDEFSAGSHEKAAAATKAGLFEGELA
PIAGLATDEIIRPGTTVETLAGLKPAFYHPTYEERFPQIGWEITAGNSSP
LSDGSAAVLITTTEAAKRLGLRPLARIHTAVAVGSDPLYMLTGVIPATEK
VLAKAGLTLADIDLFEVNEAFAPVVLAWAQDTGADLDKTNVNGGAIAIGH
PLGASGVRIMTTLVNALEQRGGRYGLQTMCEAGGMANATIIERL
119868398YP_938350.1 hypothetical protein Mkms_2362 [Mycobacterium sp. KMS]MTRPDPASLNDFNQAIIEEFRNNDGVVGGPFEGATLLLLHTVGAKTGKAR
LSPLAYLTVDGRMLIVGSYAGAPKDPAWVHNLRALPKAHVEVGTEAYDVE
VRELPREERDELYAKIVEMAPTFAEYQANTDRVIPLFELTRV
119868396YP_938348.1 hypothetical protein Mkms_2360 [Mycobacterium sp. KMS]MYLSAERVAVANNAIQRTFEQTCIAWQAIPQWDIGDPGAVEVRNDVVDNP
GYLTLGHAEEPFELTLAQIGAPTPDAVLTEVIAATAKVAAKVDKAVIDEL
KAANVAANVELTATTATVLQSALIDARVKLEDNGFRAPSCLLTNTVGLKA
ISALNNGYSLLELLLESANINSLHRVSQLDAGDKIKMVLLGRRQRIAHGG
AVDASPGEEPVDIAVSMPPCLEIVGEVDDAKVRVGVRVRFATRVKDKNGI
AGIVDEAP
119868394YP_938346.1 hypothetical protein Mkms_2358 [Mycobacterium sp. KMS]MPAPARGRGCVTRSSAPKGSRICAASGRRSASTCSTVRPHPAPLRTRGPI
CSPTRSSGAASTTRSWPDCARRGSHDAHRSSRGTGRPEQLHRLPPRSHRC
GAPRPRVGRRSSASRDRCSGRRFRSSAPRFREYRTDHRAPRCAVGPTGGP
HAVRRDADPVVAMTAVLTNSDFLRAPVLATARPEGFKEWHHFVVHGPDQR
LLVNFSLTDETRSTGRSRLVPRVIVIAHDRQWSGAVERFDTSELDVSPDL
GGLSIGGNRLTVRPDGYDVSLDLPDHGIHGALHLRSVSRPFVVNNQPVGD
GTMCWLFVPRLRADGWVQIGGREHRIRDALAYHDHNWGRFRWGGDFGWTW
GTLLPRDPDDPWSFVFLQMTDRARLRCLSQALYVWHRDEPAAIFRHAAVS
THSHGVLGRAPDCTLPPPMRLLLDGRMPGVPERVEVNAHRAGDTVCAEFR
PHSYARLALPSEVRLDGATVLCEASGTARVTGSVRGVDFDVVGAGVFEFL
HG
119868392YP_938344.1 hypothetical protein Mkms_2356 [Mycobacterium sp. KMS]MTEPIPTPASCRRRRTVAVLGGGIAGLTAAHELADRGFDVTVYEPRHDER
IGLGPEPPSCYPPVKLGGLAASQYSTVGTHDGSNAELRPFPGRRGAPRKP
GRAVAGEHGFRFFPAYYLHIWDLFQRIPVYERIELPGSDIRFLPTSRTVL
DNVRRVVTQGTTVEGKPSLVFPREAPRSLAEFLGTVNQLRELGFTQADVS
TFVSRLLRYLVTSPHRRARELQNLSAYDFFVGRDSATGVPRFSYTPQFDT
VLREMPKVLAAFDSNWGDARTNLTTYLQLQLQMDRRDNKADGVLNGPTTE
SWFDHWYRHLTALGVRFVRAVANRIDALPVDPSLPPHRRARVQITLADGT
RLTPDYAVVAVDAPEAERVTAPLRTAACGGTVSELEGFTTSVPPATGPLE
PAATRTAARRNPYALAEMGRVPWDRFQTLGGIQYFFDTEFQLLRGHMYYS
GTEWALSSINQHGMWERRPMLAQDGHVSVLSVDIGDFNAPSRRLVDADGH
GKAARDCTADEIAAEVWRQIVTALTNNVDRPPESLLPTPAWYALDRGLIM
ADGPGQGTGPPVLNETPYLVPIIGDWPNRPGGDPWNPHGTSYVGVPTEEA
WREDLELRNVWQARHGGYQVHNNSVVFAGTWAKTFTRMTSMEAACESGRH
AVNAILDHYIWVESGGRDRREKTTLKWRFPYGFLDQGQSTPIRMPTPAGD
YCYVFDIENREPSDTRALRVLDSRFSERSLPHPLDTLVPPTGGIPMTMPP
FGPFDANQQLLAFLQAWRQLLEQWTALLSGAGTPFPMPAPPGTANAPAPA
PADYSQQLFGQLQAWRRYLEHAAGATPQTASQAPAQQSGGGQESAASGSS
SGPTEPPEYFPQLDDYWGSADPATQWGKRQQKVIRPPDDDWGTVGIPFRD
LAGGLDVGRPPQGPTPPPDRWSGQTGPLESPAARTVRSAFRDVTTGADPA
AARQVAPKSLYRDVMGEIRGGD
119868390YP_938342.1 2-dehydropantoate 2-reductase [Mycobacterium sp. KMS]MTTRIALVGPGAIGATMAALLHEAGRPVLLCGRTARSSLEVRPDDREPIV
IPGPVHTDPADVDGPVDVVLLAVKDTQNEAAAPWLSRLCGSRTVVCALQN
GVEQVERVGRFCPDATVVPAAVWMSAETSGPGQVRLRTDARVVLPATEAA
AMLADTLATPHLSVACDPDFASAAWRKLLVNAVVGLMVLTGRRSGMFRRD
DIAALGRRYLAECLAVARADGAALGDEVVDEVIGMLAAGPPDITTSMLTD
REAGRALEWDIRNGVIARKGAAYGIATPISDIVVPLLAAAGEGPG
119868388YP_938340.1 type B carboxylesterase [Mycobacterium sp. KMS]MSAVAEVQTVAHTALGRLRGTNEGGVHVWRGVPYARQPLGELRFAAPVAP
EPWSGVRDALEHGPIPPQGRSFVGGGRDDPKHRDEACLTLTVWSPDTTAA
LPVMVWIPGGAFVYGAGQLQLYNGSRLAANGGVVVVNVTYRLGVFGGLDL
SALGDGFDDNLALRDQIAALRWVRENIAAFGGDPDRVTVFGESAGATSVL
ALLASPAADGLFARAIAQSPALPLIADRETRADRATRFLELLNLDPEQVK
SAPQRSLRRAAGLLQLDSVAETPTLAYGLTHGVDLLPAHPIAAARAGAAR
PVPLIVGTNSHEASMFAWGRPPMLPTTPAGVDSWFARCAPDARERILAAY
PDYPRRQALVAIGSDVMFGGPTWAFTDAYSAAAATYVYRFDHTTWTLRAL
RLGATHGSEIVHVQHSYASYLGRKLHPLGRRVLPSVGRRMQRTWLDFATR
GWASGEQWREDWPRYDAVRRRTRVIRSMRDDSVDDPDVVRRSAWSGVY
119868386YP_938338.1 hypothetical protein Mkms_2350 [Mycobacterium sp. KMS]MVRPHTAVDAVAERYLDTLAALDPCTATELGIAGGDRNYDEDITDYSPDA
VAARAEAARSALKELRAVVAVDETDAVTAAAMRERLGVLIDIHEAGLDIG
ELNVIASPLQTMRDVFDLMPTDTADDWTVIDRRLAKLPERVPGYAEALRT
AVAEGRPPAIRQVQRGVEQAAQIEQLFLDMVSGATVAPALRADLDRHAAA
AAEAYRGLGRVLREDIAPYARERDAFGRDAYRLMSRSFLGTEVDLDETYA
WGLEHLNAIVAEQETVAERLYPGAGVAETIRRLDEEPRYQVHGTDALQAW
MQDLSDRVVDALADTHFDIDPALRNLECRIAPTHTGGIYYTGPSEDLTRP
GRMWWSVPPGKQTFHTWQETTTVFHEGVPGHHLQIGRAVVLADRLNRWRR
LGCWVSGHGEGWALYAERLMAELGWLDDDGARMGMLDAQGFRAARVAIDI
GVHCELTAPDGGTWDADRAWDLLAAHCAQSEKTRRFELDRYLGWPGQAPS
YAVGQRIWEQLRETMLARSMTLKDFHSRALDLGGLPLDVLRSALVGELA
119868384YP_938336.1 hypothetical protein Mkms_2348 [Mycobacterium sp. KMS]MTTESTQDTTAAQWTVEMLLDLFDAQPAGDDRFTAQTGVAAADERQVVEG
TQVLAQAIVAVAKRFPDKSVRSAYAVFSRVVLVGPPVEFEIDVVSEGRST
ATAVVSASQNGKRCISVTVFTDVPSGDVIRHHLPRPAVVPPAEANDGGMP
MVGRQVRLVDVVDVNSPDEVGPPELYAWLHYDPIPQRDDLAKALIAYFTG
HLGISTTMRAHEGIGTAQAHLTVSTAPMTISVSFHEPVRWDGWLLYSHES
TQVGAGMSYVRGAVHTEEGELIASFSQDALIRPLRTTDNSIATQNRL
119868382YP_938334.1 amidohydrolase 2 [Mycobacterium sp. KMS]MPSRELSYPVFDGDNHFYEPKEALTQFLPEHRKGVIDYIDVRGRTKIVVR
NTISDYIPNPTFEVVARPGAQEEYFRHGSGGKSFREVMGKPMKAIPAFRN
PEARLEVLDGLGLDYSIMFPTLASLVEERMKDDPDLILDIIHALNQWMYE
TWQFDYEGRIFSTPVINLSVVDRALEELEWCLERGAKTVLVRPAPVPGYR
GTRSPGLPEFDPFWDACVKAGIPVSMHASDSGYAQYLNDWEPADEYLPFK
PTAFRMVSMGKRPIEDTMAALVCHGALTRNPDLRILSIENGASWVPYLFY
QFKDVYSKMPQEFPEDPIEAFKRCVYVAPFWEDNFKQMSELLGVDRVIFG
SDWPHPEGLADPINLVGDLEEQGLDEASIRKIMGGNLVDLFKVPNEVVHR
PDVPALVIA
119868380YP_938332.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTETSTRSQSAPAEAAESVEEFQARARAWLADNMPRIDPDNPPDADRGEE
GPWLRARELQKKLYAGGFAGICFPKEYGGLGLPIAYQRAFDQESKAYELP
IILNTPTFTICAATILDTGDEAQKQQHIGGAIRGDEILVQLLSEPSGGSD
LAGVITRADRRGDKWVINGAKTWSTSAFAADYGLLLARTDWDVPKHEGLT
MFLMPLDAPGITMRRIKQVDGGNEFCEEFFDDLELGDDAVVGEVNNGWEV
ASRQLYHERRAVGGGSEFASGIGPEGVSDQPVDYVALLAATGQSDNERVR
EMAGRALVRRKVQEQLIDHVYHGVLDGSLPPAAGSIIRITHAESIQFELD
AALSISGSSGVVDGGDGLAQFGDRYLSRQAASLGGGTTEIARNIIGERVL
GFPREPAADRGVPFKDVKRNKA
119868378YP_938330.1 cold-shock DNA-binding family protein [Mycobacterium sp. KMS]MTQGTVKWFNSEKGFGFIAPDGGSDDVFVHYSEIQGGGFRSLEENQRVEF
EIGQGAKGPQATSVTAI
119868376YP_938328.1 thiamine pyrophosphate binding domain-containing protein [MycobacteriuMTVSGGDLLARALADAGVTEVFTLHGGHLDAFLVACGKHDVRLTDTRHES
SAGHAADAYARVTGSLGVCVVTSGPGFTNAYTAIANGYLDRTPTLFIVGG
PPLRESATNPLQGGFDQVAAAAPVTKWAYRLTEAARIPEIVSLAVRKATT
GAPGPVLLEVPIDVMFGEADEAEVRYPARYALDARSVPSDSVVHQALDVL
QGAQHPVIVIGGGVTFSRAADALVAFAETVGVPVFYPGKSDGAIPASHRL
AAGGLLGLGALSALGAPTPDVVLLVGARAGMFTGGRASMFPGARIVQVDL
DAAEIGRMQDVAVAIVADCRETLRALQAAAADRDWPDWSEWVHTAVQAQR
FHRALYPDAATPSGRMHPYFAARAVVEACPPGTTFVLDGAEAPAWAEFFA
TTETVGGVLRLGYLGTLGVGPGFAIGAARARPAAPVVLITGDGAAGFHLG
EFDTMARHGMPVLTVVFNNAVWGMSVHGQQAVYGDGGVVVSELADSSYEK
VAEAFGGYGERVGEVDEIAAAVQRAFAAQVPACLNLEIDPHTVHPLTTMM
LGDVTATDAIVVPYYENLPR
119868374YP_938326.1 extracellular ligand-binding receptor [Mycobacterium sp. KMS]MRRPGRSSFHRSALAAGSLVAVTSMLLAGCGSKASDTDAASAESCVDTSG
PNIKVGSLNSLSGTMAISEVTVRDAIKLAVDEINGAGGVLGKQIQLVGED
GASEPTVFAEKAEKLISSDCVAAVFGGWTSSSRKAMLPVFESANSLLYYP
VQYEGLESSPNIFYTGATTNQQIVPALDYLKEKGVKSLYLVGSDYVFPQT
ANRIIKAYAEANGIEIKGEDYTPLGSTDFSTIINKVRSADADAVFNTLNG
DSNVAFFREYRNVGLTPQDMPVVSVSIAEEEVGGIGVQNIDGQLTAWDYY
QTIDTPVNNEFVKAYKAKFGADKPTSDPMEAAYVSVYLWKNTVEKAQSFD
VKAIQDNAGGVTFDAPEGKVTIDGENHHITKTARIGEIRPDGLIYTIWES
PGPIEPDPYLKSYPWAAGLSS
119868372YP_938324.1 inner-membrane translocator [Mycobacterium sp. KMS]MRTFVGRWQTWAGFGVAALLLFAVAPAVLSDFRLGLLGKFLCFAIVAVGI
GLAWGRGGMLVLGQGVFFGLGGYMMGMHLKISDAQLRGDDVPDFMQIAGV
RELPGYWAPFASPAFTLLAIVVIPTGIAAVLGFGVFKRRVKGAYFAILSQ
ALAAALAILLVGQTGLGGSNGLTNFRTFFGFALNDPVNKQMLYFIAAAVL
LVVVAVVRQLMQSRYGELLVAVRDGEERVRFLGYDPANIKVVAYTVAALC
ASIAGALFAPIVGFMAPSQVGILPSIAFLIGVAIGGRTTLLGPVLGAIGV
AWAQTLFSERFPSEWIYAQGLLFIVVVGFFPAGLAGLGVLLKRRRRKKSE
PVPAQPDPQPEKVGAPT
119868370YP_938322.1 ABC transporter-like protein [Mycobacterium sp. KMS]MLQLVDVRTGYGRSQVIHGASVEVPADGVAAVMGHNGAGKTTLLRAAVGL
LKCTGGRVMFEGEDITRLRPSARVARGLAYVPQGQQSFGQLTTAENLQVV
ADGRKNGKQLIDEQLDLFPALKELLTRRAGLLSGGQRQQLAIARALITSP
KCLILDEPTEGIQPSVVAEIEGAITALTARGDLGVLLVEQHIGFALESSQ
RYYILEAGRITSSGTGGSASEADVRAAMAI
119868368YP_938320.1 histidyl-tRNA synthetase [Mycobacterium sp. KMS]MTETAFQAPKGVPDYLPPESAQFVAVRDGLLSAARRAGYGDVELPIFEDT
ALFARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVIRAVIQHRLDR
GALPVKLCYAGPFFRYERPQAGRYRQLQQVGIEAIGVDDPALDAEVIAVA
DAGFRSLGLDGFRLELTSLGDDTCRPQYRELLQDFLFKLDLDEETRRRAE
INPLRVLDDKRPHVREMTADAPVMLDHLSDSAKAHFEAVQTHLQALGVPY
VINPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMRRLGGQDVS
GIGFGLGVDRTLLALRAEGKTAGQVARIDVYCIPSGPDAKVDIAVLAADL
RRAGVRADVAYGDRSLKAALKAADRTGASIALIADPGVATVKVKDLGTGD
QIEMAREAVVAEVVSRLG
119868366YP_938318.1 cyclophilin type peptidyl-prolyl cis-trans isomerase [Mycobacterium spMPVSHARRGAVFQRVVHLTLSNFWHTRCRPDAGMTAQTRRTAAVPTNEQR
REAAKRKLERQLERRAEKARKRRIATIAGSAVAAVVVIGAIVATIVLTKS
DSSDTTASAQTPTPTSGAPAQPAADGGLPAFAPPAGLGADCQYPASGAAS
KPVEPPRTGQVPTDPAEVSVSMSTNQGNLGLLLDNAKAPCTVNSFASLAQ
QGYFNDTPCHRLTTTPSLSVLQCGDPTGEGTGGPGYKFANEYPTNQYQPD
DPALGEAVLYPRGTIAMANAGPNTNGSQFFLVYKDSQLPPGYTVFGRIDD
TGLATLDKIAAAGVQGGGPDGAPAEEVQVKTILLD
119868364YP_938316.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium sp. KMS]MVTPSSDRREVRAMSDILGDRRRATWLLALLMATASLSASAGAGCRECAR
PQADSPVASAAAVRPPAPATLTVNPPAAAQDVSPAVPVFVRASAGTLTEV
QMTNEGGRVIAGTMTPDHRMWRPAEELGYGRTYTLTVRSRGVGGMSAAQT
STFSTVSPAGQTSVELTATSGQALADGATYGVGTVVVARFDEQIGDRAAA
ERRLVVTTDPPVTGSWYWVDDQTAHWRPERYFAPGTKVTVAANVYGARLG
DGLYGQDDRQVSFRIGDAHVSIADDTTKQVSVYDNGVLVRTMPTSMGMGG
TETIGGTTLSFWTPPGVYTVLDKDNPVIMDSSTFGLPTNSRLGYRETISY
ATRISIDGIYLHQLDSTVWAQGNTNLSHGCLNLNGENARWFYDFSVPGDV
VEVRNTGGPRLTLAQNGDWSIPWPEWRKGSALP
119868362YP_938314.1 adenine phosphoribosyltransferase [Mycobacterium sp. KMS]MTDISKVIASLMREVPDFPEPGIQFKDLTPLLADAEGLMAVTDALAATAE
GADLVAGIDARGFLLGAAVALRLGTGVLAVRKGGKLPPPVHSQTYNLEYG
SATLEIPADGLDIAGRSVVIIDDVLATGGTVAATHRLLTSGGATVLHAAV
VLELTALGGREVVQPLSVSSLYTV
119868360YP_938312.1 preprotein translocase subunit SecF [Mycobacterium sp. KMS]MAAEDKTAEDTVKTAGTETAPQHGFFVRLYTGTGAFEVVGRRKMWYAISG
VIVLIALASILIRGFTFGIDFEGGTKVGMPVAGANGNAEVTQVETVFNET
LGKPPESVVIVGSGSSATVQIRSETLSNDEASELRTALFDRFQPIGEDGQ
PSEQAISDSAVSETWGGQITKKALIALAVFLVLASLYIGIRYERWMAIAA
MATLLFDLVVTAGVYSLVGFEVSPATVIGLLTILGFSLYDTVIVFDKVEE
NTHGFEHTTRRTFAEQANLAVNQTFMRSINTSLISVLPIIALMVIAVWLL
GVGTLMDLALVQLVGVIVGTYSSIFFATPLLVSLRERTQLVRDHTRRVLN
RRKPGRRSAAVTAPVDDDTVADEPEKVTAASAPVTSAPADKPAPGAKPSR
PTSRPSRPTGKRTSRGR
119868358YP_938310.1 preprotein translocase subunit YajC [Mycobacterium sp. KMS]MDLVVFLPLLIIMGAFMFFASRRQKKAMQATIDLHESLQIGDRIHTTSGL
QGTITGITDDDVHLEIAPGVVTTWMKLAVRDRIDPDDELDTDDSAATEVF
DSPVADAASDPDRSKRD
119868356YP_938308.1 gamma-aminobutyraldehyde dehydrogenase [Mycobacterium sp. KMS]MTTVKNFIGGELVDSVSGATMPLVDPSTGEEYGTAPVSNEADIDNAYAAA
SKAFKDWKRTTPAQRQKALLDFADEVEKAADDLVTAEGRNTGKPNHVTMA
EEIPPMVDQIRFFAGAARVLEGKSAGEYMENHTSWIRREPVGVIGQVAPW
NYPMMMAIWKICPAIAAGNTVVIKPSDTTPVTTVMLAELAAKHLPPGVLN
VVTGDRVTGANLVAHPTPEMVAITGSVAAGRAVAVSAGGHLKRTHLELGG
KAPVIVFDDADIAAAAEGIATAGYFNAGQDCTAATRVLAPARIASDLTDA
LAEQAKAATTTFGRPADDEDAWVPPVNNVNQLDRVLGFFDDVPSHATVAV
GGNRQGHKGFYIEPTVVGGLRQDDRMIQQEIFGPVITVQSFSDEDEAVAW
ANGVEYGLASSVWTKDVSRALRVSAALDFGCVWINTHIPLVAEMPHGGFK
SSGHGKDLSMYGLEDYTRIKHVMAYIG
119868354YP_938306.1 thioester reductase domain-containing protein [Mycobacterium sp. KMS]MSTETREARLQQRIAHLFTTDPQFAAARPDPRISDAVDRDDTRLTAIVSA
VMSGYADRPALGQRAAEFVTDPQTGRTTMELLPRFDTITYRELLDRVRAL
TNAWHADGVRPGDRVAILGFTGIDYTVVDLALIQLGAVAVPLQTSAAVEA
LRPIVAETEPMLIATGVDHVDAAAELALTGHRPSRVVVFDHREQVDDERD
AVRAATARLGDAVPVETLAEVLRRGAHLPAVAPHVFDEADPLRLLIYTSG
SAGAPKGAMYPESKVAGMWRASAKAAWNNDQTAIPSITLNFLPMSHVMGR
GLLCGTLSTGGTAYFAARSDLSTLLEDLRLVRPTQLSFVPRIWDMLFQEF
VGEVDRRVNDGADRPTAEADVLAVQRHELLGGRFVTAMTGSAPISLEMKT
WVETLLDMHLVEGYGSTEAGAVFVDGHIQRPPVLDYKLVDVPDLGYFSTD
RPHPRGELLVRSTQLFPGYYKRPDVTAEVFDDDGFYRTGDIVAEVGPDQV
QYLDRRNNVLKLAQGEFVTISKLEAVFAGSALVRQIYVYGNSARSYLLAV
VVPTDDAVARHDPASLKTAISASLQQAAKTAGLQSYELPRDFLVETQPFT
LENGLLTGIRKLARPKLKARYGDRLEALYVELVEGQAGELRTLRRDGAKR
PVAETVGRAAAALLGAAAADVRPDAHFTDLGGDSLSALTFGNLLQEIFGV
DVPVGVIVSPAADLASIAAYIEAEQASTGKRPTYASVHGRDAEQVHARDL
TLDKFIDAETLSAATELPGPSGEVRTVLLTGATGFLGRYLALDWLERMAL
VDGKVICLVRAKDDAAARKRLDDTFDSGDPKLLAHYRKLAADHLEVLAGD
KGEADLGLPHPVWQRLADTVDLIVDPAALVNHVLPYSQLFGPNALGTAEL
IRLALTTRIKPFTYVSTIGVGAGIEPGRFTEDDDIRVISPTRAVDTGYAN
GYGNSKWAGEVLLREAHDLCGLPVAVFRCDMILADTTYAGQLNLPDMFTR
MMLSLVTTGIAPKSFHPLDAKGHRQSAHYDGLPVEFVAESISALGAQAVD
EAGTGFATYHVMNPHDDGIGLDEFVDWLVEAGYRIDRIDYYAAWLQRFET
ALRALPERTRQYSLLPLLHNYQRPAHPINGAMAPTDRFRAAVQEAKLGPD
KDIPHVTPAVIVKYATDLELLGLI
119868352YP_938304.1 ferredoxin [Mycobacterium sp. KMS]MPNPVPRGRRLLLRAVRHLFNPLRPDDYLEMVNPLWTTKELRGKVERVEP
QGSEAASVLIRPGYEWPGHKPGQYVRLGLVIDGRYHWRAYSLTSDPHPDD
GLISVTPKKVDNGVVSPYLVQKIQPGELVRLGEIEGVFTLPEPLPAKMLF
ISAGSGITPIISMLRSLDHRGEMGDVVVIHSARTREQVMFLSALEDLDRR
HENLRLDLRLTSERGRMSAGDLDEVCPDWREREAFCSGPSELLDDMIEHW
EDNGDRDRLHFERFQPKIGGDAGDGEGGQITFLDSDTTTESDGGTPILES
GEQAGLKLAYGCRIGICHTCVGTLKSGRVRDLRSGEVTEPTGQDVRICIH
AAEGDVEFEL
119868350YP_938302.1 Holliday junction DNA helicase RuvB [Mycobacterium sp. KMS]MGRFDDAGAQDAEPDDRDVSPALTVGEGDIDASLRPRSLGEFIGQPRVRE
QLQLVLEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELSSSLRVTSGP
ALERAGDLAAMLSNLVEGDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVV
GKGPGATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAEL
ERVLARSAGILGIHLGTEAGAEIARRSRGTPRIANRLLRRVRDYAEVRAD
GVITRDIAKAALEVYDVDELGLDRLDRAVLSALIRSFGGGPVGVSTLAVA
VGEEPTTVEEVCEPFLVRAGMIARTPRGRVATASAWTHLGLTPPSGITGL
GQTGLFD
119868348YP_938300.1 Holliday junction resolvase [Mycobacterium sp. KMS]MFSRRGVVVRVMGVDPGLTRCGLSVIESGQGRKVIALDVDVVRTPADEQL
HRRLLIISDTVEHWMDTHRPDVIAIERVFANHNANTAMGTAQAGGVIALA
AAKRDIDVHFHTPSEVKAAVTGNGRADKAQVTEMVTRILALQAKPTPADA
ADALALAICHCWRAPMIARMAAAEAMAAEARRKYQAKLKAARA
119868346YP_938298.1 mechanosensitive ion channel MscS [Mycobacterium sp. KMS]MPEETELQSATDLAVTLSWVAGAVVAAYLVGIVLTWVLSRVARRSHVVKD
IEVCTRLPIRAILMVVAATVAVQRTADPATTWRGWVDHTLVIALIATLTW
LVTGLVKVAERQAISRFGGGDAGLTDADRHRRRVRTQVTVLRRLAVAIVV
VLGSAAILMTFPSFSDIGTTLFASAGVLSVVAGLAAQTSLGSVFAGLQIA
FSDAIRVGDVVVLEDEWGRIEEITLTYVVVRVWDERRLVLPCTYFTNTPF
QNWTRNATEIMGTVEFDVDFSVPFDDMRAELDRLLAESDQWDGRSGVLQV
TGAVGGFVRVRVLVSAPDASALWDLQCAVREGLVDWIRRTHGTAPRFRLE
SSQPAPRRHVTTGGETPRVGSAVFSGSPEAEARARDFDHSNGSNGHGRD
119868344YP_938296.1 hypothetical protein Mkms_2308 [Mycobacterium sp. KMS]MALTGRRRVPGDEGGVSTTAGRSAVARVASCSAMAALPVLPRCGAEIIRR
ADPPQSGQQTTSGRLSIGCICCVVPHPVSQRKT
119868342YP_938294.1 ferredoxin [Mycobacterium sp. KMS]MKLRVTQLKWEAAGIVSVVLRSPTGDRLPAWAPGAHVAVTLPSGLVRQYS
LCGPADDPYSYTIAVLLVGDGRGGSREIHQRLRIGEVLEVGEPRNNFALS
DAPRYLFLAGGVGITPILSMIESLRGRTDPPPWRLVYGGRDRAAMAFLDR
VQASDGVDVIPQDEAGLPDIAGALADSPPGTAVYCCGPPAMIAAVSDACA
RHPGLDLHVERFAAAAGDVPPTVDGDGAFDVELARSGVTVTVPAGTSVLD
AVLEVNPDTAFSCAAGFCGTCETKVLAGEVDHRDELLSEDERRSNATMMI
CVSRSRGGSRLTLDL
119868340YP_938292.1 polysaccharide deacetylase [Mycobacterium sp. KMS]MTALIPAGPVPWPDGKRCAVAFTFDVDAESPLLTTDLAFADRMGAMSHQA
YGPLVGVPRLLNILDEFSVPATFFVPGYTAHRHPEAIRSIAAAGHEIAHH
GYLHESLVGVDEDTERAILERGLEALDEVAGVRPSGYRAPMWEMNWHTPK
LLAEYGFTYDSTLMDSDHPYELAVGDSSLVELPVSWALDDWQQYCFVPDF
SGTGLIETPAKAIELWRCELDAMRDIGGAWILTNHPFLSGRPGRAAALRD
FIAEVRAMDDVWVAGMSEIATHVRAQHLTPRTLTRPEPTPVTARP
119868338YP_938290.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MGDESMRVLITGADTTLGAAVADYFTSRGAVTEGADADPTDSVDVRRAVA
QAADVMGGIDALVVAHALPRVAAFAEQSMDMFWDHVDATLTGSFLYAQAA
AEHMRHNDTGGRIVLTTSRWHVGGPELSAVATAAGGIVALTKTLTRDLGG
FGIGVNAVAVGAVDSEWSVCDAAAGLPGGVPPTGRFGTVEQVARVIGLLC
RRRLGAAVGQIVNVDGGTSRNRV
119868336YP_938288.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MTSNAQTGSAPTELRREFSLWSAFAFAFAFISPIVAMYGIYGLSLATAGP
GFWWTFVIVGVGQFIVALAFAELVSRWPYEGSIYQWTRRLAGEVAGWLAG
WVYMWALVIIMATVAYGGAGFLAQLIGIERPTAVQQSIVALLILLAGTGA
NILGRGFLKALMLGSIVAEIVASVGLGTYLLLFHRHHGFDAILHGIDLSS
GWSWAYISGPFLAALAFTGWSILGFESAGAIAEEVKEPRRNVPKAMLFSI
AFIALVIAYASLAVTLAVPDFEMVRSGEEPDPVSYVLRSALGESFVKPIL
LAFVIGFLASFLALQASGSRVIWSFARDRVLPGSRVLSKLSKTEAQPIPA
ILVTTVIGAFVYLISATDVYSVLVTFTAGGYYLAFLFPLVTGLVARLRGT
WEPGPWNLGRFGTPVAVLAVVWVGFEFTNIVWPRTVSESWYMNWAFFVAM
GAILALGAVIIKARNVAGRRIDDPVETDQTTETELV
119868334YP_938286.1 hypothetical protein Mkms_2298 [Mycobacterium sp. KMS]MSGHSKWATTKHKKAIIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLY
DAIQKAKKSSVPNDNIERARKRGAGEEAGGADWQTITYEGYGPNGVAVLI
ECLTDNRNRAAGEVRVAMTRNGGNMADPGSVSYLFSRKGVITLEKNGLSE
DDVLMAVLEAGAEEVTDLGDSFEIISEPTDLVAVRTALQDAGIDYDSADA
SFQPSVTVPLDAEGARKVMKLVDALEDSDDVQDVYTNADIPDEILAQLEE
119868332YP_938284.1 acyl-CoA thioesterase II [Mycobacterium sp. KMS]MAIEQILDLEQLEINIYRGAVFSPESGFLQRTFGGHVAGQSLVSAVRTVD
PKFQVHSLHGYFLRPGDARAPSVYIVERIRDGGSFCTRRVSAIQHGETIF
SMSASFQTDQSGIEHQDAMPAAPPPDDLPGFRSGKAFDDAGFAQFAEWDV
RIVPRDQVQRLPGKASQQQVWFRHHDPLPDDPVLHICALAYLSDLTLLGS
AQVNHPDERKYLNIASLDHAMWFMRPFRADEWLLYDQSSPSACGGRALTQ
GQLFNQYGEMVAAVMQEGLTRYPRDFTPGRA
119868330YP_938282.1 NUDIX hydrolase [Mycobacterium sp. KMS]MTWIVIVALAVLLVIVLLVGAWAYQTAHRLDRLHVRYDLSWQALDGALAR
RAVVARAVAVDAYAGGPEGKRLATLAAAAERAPRSGREAAENELSAALAL
VDTGSLPVALVAELADAEARVLLARRFHNDAVRDTLALRERAPVRLLRLG
GTAALPSYFEIAEVSSRDAEPLGRRVSARVVLLDETGAVLLFCGSDPALT
DAPRWWFTVGGGVEPGEAIAEAAARELAEETGLEVDAAALVGPVWRRDAV
FEFSGAVLRSQEMFFVHRTARFEPSLDAHTPLEQRTIHGHRWCDATMIDE
LVAAGETVYPQQLGALLARAGELADGLLAPGPVETIR
119868328YP_938280.1 lipid A biosynthesis lauroyl acyltransferase [Mycobacterium sp. KMS]MTALGGWLPGTDHLTDWGYAAGWRVVRAVPEVLARNAFDAGAWYSARNGG
PEQLRKNLARVIGVAPADVPDELMRASLASYARYWREAFRLPTMDHRKLG
EELTVDDIGHVWDALDSGRGAVLALPHSGNWDMAGVWLVQNHGTFTTVAE
RLRPESLFNRFVAYRESLGFEVIPLSGGERPPYELLRDRLRANRVVCLMA
ERDLTRQGVAVDFFGEPTRMPAGPAKLACETGAALLPVHCWFDGDGWGMR
VFAPLDTSGGDVGLVTQALADRFAANIAEHPEDWHMMQPQWIADLSDARR
ARLAGAG
119868326YP_938278.1 histidine triad (HIT) protein [Mycobacterium sp. KMS]MTEPDDRTTGDERLREGRTIGDERLREGRTIGDERLREERTIGDERTIID
HGVGDPDNLQRLWTPHRMSYIAESPMKKGSNSSQSSQPFTDIPNMADEDG
LVVARGDQVYAVLNLYPYNPGHLMVVPYRRVSELEDLTDAESAELMSYTQ
KAIRVIKAVSRPHGFNVGLNLGQSAGGSLAEHLHMHVVPRWGGDANFITI
IGGSKVIPQLLRETRELLATEWAKQGERSDGGSKQERSDGGLSR
119868324YP_938276.1 hypothetical protein Mkms_2288 [Mycobacterium sp. KMS]MTENDTDQPSRWTRVKDRWKRWRDGLRARPRMEFFYRIAVGVIGLLVLVL
GILAIPYPGPGWAIVFIGLGILATEFDWAKRLLAYARERYDRVMDWFHGQ
HAVVQILGGLLTALVVFTTLWLLGAVDWVAKIFGIEHEWLNSPFGLGP
119868322YP_938274.1 hypothetical protein Mkms_2286 [Mycobacterium sp. KMS]MKLADLADLADLPLTYREVGATAGPMPPGYHHVRESALIGSGRARFDEAA
EAVMRWGMLRGAGLRVTPTTEVARVGSEVIVGLGPVKVPCRVVYVVDEPD
RRGFAYGTLPGHAETGEELFAVRYDPMSDGVYAEVAAFSRHRTWWSRLAG
PVTSRLQRVVTRRYLRAL
119868320YP_938272.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMERVALSNLSEEHDRKVLVNEPAGVEGVHRRIAELVQQLHGRTDADADTV
LAELVEHAAVEIPGADYAGVTITRTSKKIETPAATHKWPIVLDEIQERYR
EGPCLTAAWEERTVHVPDLERDDRFPNYRRDALEQTPIRSIMAFQLFIAD
ETIGAINVYAEKPNAFGTESREIGLIFAAHSSVAWNSARRDEQFKQALAS
RDIIGQAKGMIMERYSVDAVQAFALLRKLSQDSNVPLIAIATDLTRKATS
SGI
119868318YP_938270.1 hypothetical protein Mkms_2282 [Mycobacterium sp. KMS]MTAPDRPEPGPDAGMEDIEADIEATRRELGETVEALSAKLDVKQQAKDKV
DETKHRVVEKAHTAQHVVADNPQKSIPVAAFVVAVVVAVGVVVWRRRH
119868316YP_938268.1 hypothetical protein Mkms_2280 [Mycobacterium sp. KMS]MTSTQPTTSAAGGVASRSESLTSSQGKTTIADTVVSKIAGIAAHEVNGVY
ALGGGASRAVGALRERFPGGSVNHAQGVSVEVGETQAAVDIDVVTEYGVS
ITDLAAGLRRNVMAAIERMTGLEVTEVNITVHDVHFAEDDRSDDQPAPAR
VQ
119868314YP_938266.1 hypothetical protein Mkms_2278 [Mycobacterium sp. KMS]MTTSSLGLIAGLLLGVAAAAGGFTGFVIALLLGVIGYLVGGQADGQFDLG
AMLRGRGRG
119868312YP_938264.1 hypothetical protein Mkms_2276 [Mycobacterium sp. KMS]MTTTPDTAPETPTDDTIAEEARPATPPPPAAAPVAGYVGSLIALLTLALG
VVALRDSAVFAGWLDGRPWTLNAVEWLDGLTFQWWMYPVGVMAILVGLWS
LYSALRPRRRTGLQLAADSSVWINKTDLARIATSAAERVPGVLDARSAAT
LRKVTVTAVTTAAERGRGGDQVKTAVTAAVEKTLDTVVADRPKVAVRVRT
GGR
119868310YP_938262.1 hypothetical protein Mkms_2274 [Mycobacterium sp. KMS]MVGRVDVLTGKGRKLAVIGAGALALTGAVLAFGAGTANADVVDIGGKPNP
VFDANPAAEGGVRTTGKGVANAGPSDVRRSRKGAPLPPAGGEVKDSIRAV
PPITGGIGTYIRTGPARNGPGIAGW
119868308YP_938260.1 hypothetical protein Mkms_2272 [Mycobacterium sp. KMS]MTERIEVQRVIPAPPEAIFEVLCDPQGHVAIDSSGMLQGADGQPVSAVGD
TFVVHMDREALNDFPMGKYEVTVEIREFEPNRRIAWTILGQIRPQIGHVY
GYTLEPTEDGTVVTSFYDWSQIDDKWREAGIFPVISEGALRATLGILERA
VRRGYVRS
119868306YP_938258.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. KMS]MRPFEDVVAEHGPVVLRVCRAVVGPVDAEDAWSETFLSALRAYPDLPADA
NVEAWLVTIAHRRALDVGRANSRRAVPTGTVPDSPAVGGDPADRHPDLWA
ALESLPTKQRQAVAYHHIAGLPFAEIAGLLGNSPDAARRACADGLSRLRS
IYREEPLP
119868304YP_938256.1 hypothetical protein Mkms_2268 [Mycobacterium sp. KMS]MRRLLMLLTAMIVAAGLTAAPAGAVDSPIGRIGQPLRVQFKGLIADVTVV
SVEPSPIPPGFGYPPRPPRNQVWRANVVVQPVKVPVPYAMAITFQFRGVT
PTGDAYEPRNTDAPDALQAALTKAPPGSTVSGGVWWDCYRDLVSNVVLVD
KITGEHLAQWNL
119868302YP_938254.1 AFG1 family ATPase [Mycobacterium sp. KMS]MPGSSGAPNRPDHLVDRNPSVTPERLVAQLVPPPTFTHVSFDNYRPDPAE
PSQAAAVDACRAFCADAVTRRAGKKKLFGKREVLPGVGVYLDGGFGVGKT
HLLASSYYDLPETPAHPKAFATFGELTQLAGVFGFVESVELLSHYVVVCI
DEFELDDPGNTTLISRLLSQLVERGVSIAATSNTLPEQLGEGRFAAQDFL
REIHTLASIFTTVRIEGPDYRHRDLPPAPEPLTDAEVAERAEQTEGATLD
DFDALCAHLATMHPSRYLSLIEGVTQVFITGVHPLDDQSVALRLVSLTDR
LYDAGIPVVASGSKLDTIFSEEMLAGGFRKKYLRATSRLLALTAAGQRA
119868300YP_938252.1 TAP domain-containing protein [Mycobacterium sp. KMS]MRRHPQLLRVVSLSTVALVLAGCAPGLAANPRFATDNGARPQGQPETTQQ
QAGPPAVEAPKNELSWRECTDQVFGDAAVDPVPGVTLDCATYDADLDPID
GATGTVSIGVVRATSPRTPQDAGPVVMTTGSDLPSSVQLPVWLARSQALV
DKHPIVAVDRRGIGMSGALECRDLYDRQEMIEQAQFAYGDDPVANLGAIT
MTATTSCTDTIAPGDSAYDNAHAAEDLERLRSTWDVPTLALLGIGNGAQV
ALAYAGSHPNKVARLALDSPLPLAIGAEAAAEQRVRGEQAALDAWAAQCV
AIGCPAAPDPKGVVDGLLSAARSGDGPGGASVAAVAAAISTALAYPKGDG
VTATNDLGAALAGARSGDTARLTALIADAEGLRQTDGQFVNSCSDALNRP
TPDRVRELVVAWGKQYPQFGVVGALDLVKCLNWPSGSAPPEPKDLPVPVL
LLGVQNDPIVGNEGVAAVAATVLNAGASNKRVMWQGIGHGASVYSPCALT
PLVGYVDTGAPPATDTYCPA
119868298YP_938250.1 methionine-R-sulfoxide reductase [Mycobacterium sp. KMS]MSAPKVQLTDDEWRQKLSPEEFAVLRRAGTERPFTGEYTDTETKGVYQCR
ACGAELFRSSEKFESHCGWPSFFDPADSDAVILRPDDSLGMRRVEVVCAN
CHSHLGHVFEGEGYPTPTDQRYCINSISLRLVPAGG
119868296YP_938248.1 chlorite dismutase [Mycobacterium sp. KMS]MAKLDFDALNSTIRYLMFSVFSVRPGELGYDEQARAAVVDETATFLKQQE
ERGVVVRGLYDIAGMRADADFMIWTHADTVEALQATYSDFRRATALGRAS
SPVWSNVALHRPAEFNKSHIPAFLAGEDPGNYICVYPFVRSLEWYLLPDD
ERRRMLSEHGMAARGYKDVRANTVPAFALGDYEWILAFEAPELHRIVDLM
RDLRATDARRHVREETPFFTGPRVGVEELVTRLP
119868294YP_938246.1 uroporphyrinogen decarboxylase [Mycobacterium sp. KMS]MNTRRELPDSPYLAAARGRKPARVPVWFMRQAGRSLPEYRALRARNTMMQ
ACFDADLITEITLQPVRRHGVDAAILFSDIVVPLRASGIALDIVPDVGPV
IDHPVRTAADVAAIRPLERQTVEPVEQAVRMLTAALGDVPLIGFAGAPFT
LASYLVEGGPSKHHEHTKAMMLGAPDTWHALMSALTDVTIAFLQAQVDAG
VDAIQVFDSWAGTLSLADYRAYVLPHSARVFQALAPAGVPMTHFGVGTAE
LLGAMSEAIATSGAPGVVGVDWRTSLTDAAGRVERGSALQGNLDPVVLLA
GWPVVERAVRAVVEDGRRAVDAGAAGHVFNLGHGVLPATDPEIVTATVEL
VHSL
119868292YP_938244.1 3'-5' exonuclease [Mycobacterium sp. KMS]MSETPDTDPEGPDTDIDAEAGTDTGAVPLLTPADGVPDLAVTTDEILAAA
ELLAGGHGPFAIDAERASGFRYSNRAYLVQIRREGAGTVLIDPVNHGEDP
TMVMAPVADVLDTDEWVLHAADQDLPCLAELGMRPPKLYDTELAGRLAGL
ARVNLATMVSELLGLQLMKGHGAADWSKRPLPDDWLNYAALDVEVLLELR
DAVAAVLDDQGKTDWAIQEFEHLRTYEAAPTRRDRWRRTSGIHKVRNPRA
LAAVRELWTTRDHIARRRDIAPGRILPDAAIINAATADPDSVEKLTALPV
FGGTRQRRSAQVWLDALDRARHNTDPPDSAEPPNGPPPPSRWARRKPEAA
ARLEAARAGLSALSERVAVPSENLVTPEVVRRLCWDWQPVTDIAAAVEEF
LVAAGVRPWQRDLVVPVLTAALAPSTAE
119868290YP_938242.1 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium sp. KMS]MLEQIRGPADLQHLSQSALSELAGEIRQFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPLIFDTGHQAYVHKMLTGRSHEFDSLRKKDGLSGYPS
RSESEHDWVESSHASAALSYADGLAKAFELTGHRNRHVVAVVGDGALTGG
MCWEALNNIAAARRPVVIVVNDNGRSYAPTIGGFADHLAALRLQPGYERV
LEEGRKAVRGLPVIGEFCYQCMHSVKAGIKDALSPQVMFTDLGLKYVGPI
DGHDEHAVESALRHARGFNAPVIVHVVTRKGMGYAPAENDEAEQMHACGV
IDVATGRATKVAAPGWTSSFSEALIDYGAKRRDIVAITAAMPGPTGLSAF
RDRFPDRFFDVGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQLMM
DVALHKLPVTLVLDRSGVTGPDGASHNGMWDLSVLGIVPGMRVAAPRDGA
RLREELGEALDVNDAPTAIRFPKGDVGEDIPAVRRHRGVDVLAEPADGLS
DDVLLVAVGPFASMALTVAERLRKQGIGVTVVDPRWVLPVPEVLTEFAAA
HKLVVTVEDNGLHGGIGSSVSAALRHAEVDVPCRDVGLPQQFFDHASRGE
VLADVGVTDRNISRQITGWVAALGATPADADEVSERLD
119868288YP_938240.1 ABC transporter-like protein [Mycobacterium sp. KMS]MHAIPPASARAESPLAIHTGGLGKRFGPVLAVEGLDLSVTPGEVFGFLGP
NGAGKSTTIRMLLGFLRPSEGSAHVFGIDAGDVRRVHRLLAYVPADVALW
PALTGAETLELLGNIGPGVDTDYRAELIRRFDLDLDRPGKAYSTGNRQKV
ALVAAFATRAPLLVLDEPTSGLDPLMEREFRRCIREARDRGQTVFLSSHQ
LAEVEAVCDRVAILRSGRLVEIDNIADLRRLRRTVVEVGYRDAAPQLTGV
AGVSDIERLEGRRLRFTLSGPPTLVLRALSSVDVTALRMHEPTLEEIFLD
YYGETSR
119868286YP_938238.1 putative antibiotic-transport integral membrane leucine [MycobacteriumMATPVVRAWRAFGRNDIRGAYRDPLLVMIVFAPVIWTSAVALLTPRVTEM
LAEKQGFDLVPYYPVILTGFLLLTSIIIAGALAAFLVLDEVDAGTLTALR
VTPVKLSVFFAYRAVTVVVVTTVYVVTTLSLSGILQPGMTGALIPIGLLS
GLSAVVTLLLIVAMAGNKIQGLAAVRGLGMLIAGLPCLPWFIDSAWNLAF
GVLPPYWAAKAFWVAGDHGTWWPYLLAGVVYNGAVAWPLFRRFLAKNG
119868284YP_938236.1 ABC transporter-like protein [Mycobacterium sp. KMS]MVSRCRKAPIVTQSARLHQPPSAGTDEVIRVRGLTYAYLKAAEPAVRGMD
FEVGRGEIFGFLGPSGAGKSTTQKLLIGLLRGHGGDIAVWGREPLDWGPD
YYQRIGVSFELPNHYQKLTGLENLRFFASLYDGPTLDPAELLSAVGLGEH
AGTRVAKYSKGMQMRLTFARSLLNDPDLLFLDEPTSGLDPVNARNVKDMI
LELRARGRTVFLTTHDMATANELCDRVAFVVEGRIVALDTPAELRIARGR
RVVRVEYRSPRGELAEAEFAMDGLADDPAFHDVLRAHHVETIHSREASLD
DVFVDVTGRRLT
119868282YP_938234.1 hypothetical protein Mkms_2246 [Mycobacterium sp. KMS]MNALRAAWLEFVGEETTPAGTASILGLAALGGYLAPRLAGRRLGAARATL
LVVAAVDLWGGVLANNTVACARWYERPGQTDADHLRFAVAHVHPLALAWL
DGGGRTRWRWAVANYGYLLAATALIRYARRHRRAAGVVTTLGGICVDRAL
GPSNTAPWFGPVFYSKLLLGHAGAALWSDATLAARR
119868280YP_938232.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MSKLSTAARRLVLGRPFRSDRLSHTLLPKRIALPVFASDAMSSVAYAPEE
IFLVLSVAGLTSYTMAPWIGLAVAGVMLIVIASYRQNVHAYPSGGGDYEV
VTTNLGPTAGLTVASALLVDYVLTVAVSMASAMSNIGSAIPFVAQHKVLF
AVIAILLLASANLRGIRESGTAFAIPTYLFMAGMFVMLGWGLFQIYMLGE
PLQAESAGFELHAEHDDIMGFALVFLVARAFSSGCAALTGVEAISNGVPA
FRKPKSRNAATTLALLGVIAITLFMGIIMLAKATGAKVAERPAEQLGGAP
EGYQQKTLITQLADAVFHGSSIGLLLIAGVTALILVLAANTAFNGFPVLG
SILAQDRFLPRQLHTRGDRLAFSNGILMLAFAAVAFIVAFRAEVTALIQL
YIVGVFVSFTLSQIGMVRHWTRLLRTETDPAVRHRMMRSRVINGIGLTCT
GSVLVIVVATKFVAGAWIAILAMGSLFIIMKSIRRHYDTVARELAQQEDE
SDDIVLPSRNHAIVLVSKLHLPTLRALAYARATRPDVLEAITVSVDDAET
RALVHQWEDSDVTVPLKVIASPYREITRPVLDYVKRVTKESPRTVVTVFI
PEYVVGHWWEQVLHNQSALRLKGRLLFMPNVMVTSVPWQLNSSERLKLLE
PQSAPGDARRGFLE
119868278YP_938230.1 TrkA domain-containing protein [Mycobacterium sp. KMS]MKVAIAGAGAVGRSIARELLESNHEVTLLERNPDHIDVDAIPAAHWRLGD
ACEISVLESVHLEDFDVVIGATGDDKVNVVVSLLAKTEFGVSRVVARVND
PRNEWLFDENWGVDVAVSTPRMLASLVEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKAVKRLELPRDSALVTILRGPRVIVPEGDEPLEGGDEL
LFVASAEVEDELSRLLLNPKQR
119868276YP_938228.1 tRNA/helicase-type nucleic acid binding protein [Mycobacterium sp. KMSMATAEGYLRRLTRRLTEDPEQLDVEELSDEAAQTGAQKAIDCQRGQEVTM
VGTLRSVETNSKNCAGGVRAELFDGTDTVMLVWLGQRRIAGIESGRTLRV
HGRVGKLENGTKAIYNPHYEIQK
119868274YP_938226.1 hypothetical protein Mkms_2238 [Mycobacterium sp. KMS]MAFGKRKSSGKIGEPATQPTPEPVVEPAGEEDLEGPFDIEDFDDPEVAAQ
GRLDLGSVLVPMPAAGQVQVELNEAGVPSAVWVVTPNGRFTIAAYAAPKS
AGLWREVAGELADSLRKDGAAVSIQDGPWGREVVGTATGMVRFIGVDGYR
WMIRCVVNGVAESIEALTREAREALRDTVVRRGDTPLPVRTPLAVQLPEP
MAAQLRAAAAAQQGQQPDQQQAPPPPPPPEPAARRSAQGSAMQQLRTITG
G
119868272YP_938224.1 hypothetical protein Mkms_2236 [Mycobacterium sp. KMS]MSDTRATTQTVRYRERLSVPWWWWLPGLGLAGLIAYEVNLGVEALPDWVP
FAVLLPVAAVVLAWFGRAEIRVVGGPAGETELWVGDAHLPVSVVAKSAEV
PRTAKSAALGRQLDPAAYVVHRAWVGPMILLVLDDPEDPTPYWLVSTRHP
DRVLSALGR
119868270YP_938222.1 hypothetical protein Mkms_2234 [Mycobacterium sp. KMS]MVSSITEGTAFDRHGRPFRRRNYVPGLLTIGALAVVALVVWVIALNQPTD
VREAAVCNPPPPAPAAEPPPPTLGKQVSRVDMTDVTPAKLADTRIRVLNA
SGQGGQAGEIASELRDLGFAQPEAANDPIYVTARLQCQGQIRFGPSGRAA
AAAVWLVAPCTELFEDERPDPTVDLAIGTEFAELTASDDIDAVLASLRPD
ATAPADPELLKRIHTGTC
119868268YP_938220.1 polyphosphate glucokinase [Mycobacterium sp. KMS]MTATDSPVADPDAAGGDARRGFGIDVGGSGVKGGVVDLDTGQLIGERFKL
PTPQPATPDAVAKTIAAVVKEFGWTGKLGVTYPGVVTHGVVHTAANVDKS
WLGVNAQEIYSAALDGQPVTVLNDADAAGLAEERFGAGRDNTGVIVLLTF
GTGIGSAVIHNGILLPNTEFGHLEVGGKEAEHRAASSVKERKDWSYERWT
QEVTKVLVAIENAIWPDLFIAGGGISRKADKWVPLLKNRTPVVAAALQNS
AGIVGAAMAAEVDVTATNR
119868266YP_938218.1 hydroxyneurosporene-O-methyltransferase [Mycobacterium sp. KMS]MPKPPRVPPQRVVRAVDRVRAGLQRLHRTTAPGNIALLELATGAWTTAAL
YTAAKLGIADQLAAGPKHSNDVADRVGADHDGVHRLMRALASCGVLTQHA
DGSFTLTRVGDALRSDAEGSLRDMVLFIGHPIRWADWGNLEHSVRTGKTA
FAELHGRPFFEYLETDPEFAAVFNNAMTASSGVTDEVALGAYDFSGFKLV
VDVGGGHGSVLSTILRSAPQARGVLYDLPEVVADAGPTFEAAGVADRASA
TGGSFMDSVPDGGDLYVMKNIIHDWSDDDAATILRNIRTAMAPGGKLLLI
EMVLPERANAFIGLLLDLEMLVAAGGRERTRGEYANLLSRTGFRLTHVTG
TVTPLSILEAEPV
119868264YP_938216.1 hypothetical protein Mkms_2228 [Mycobacterium sp. KMS]MCRVSRQAGLPDRQARRMYPHSTPKPPVLLHLCSAAEWQAISAEGEHRPD
SLGSVGFVHLSTPEQVHLPANRLFAGRTDLVLLHIDPARLTDPVRWEPGL
PTDPEAMVFPHLYGPLPAEAVRDVTPYRPGPDGRFAPFDQPT
119868262YP_938214.1 ribonuclease BN [Mycobacterium sp. KMS]MTDQPPPVNTTRHHVRRTLVRTLSKSWDDSIFSESAQAAFWCALSLPPLL
LGMLGSLAYIAPLFGPDVLPTIENQLIRTANSFFSSNVVNEIIAPTVSDI
VKGARGEVVSLGFVISLWAGSSAISAFVDSIVEAHDQTPLRHPVRQRFYA
LGLYVVMLVFAVGTAPLLALGPRKVAALIPDEWDAVLRFGYWPALFLSLL
VAVNILYRVSLPKPLPSHRLILGSILATVVFLVTTLGLRVYLTWITSTGY
TYGALATPIAFLLFAFFLGFAIMIGAELNAAVEEQWPAPSTHARRAKVWL
EERTSPERSAPPVAPDEPATS
119868260YP_938212.1 hypothetical protein Mkms_2224 [Mycobacterium sp. KMS]MWNSGGMKHGSELSFDDEGRPVLITRAAPAYEEQHRARVRKYLTLMSFRI
PALILAAVAYSIWENGLISLGIVVLSIPLPWMAVLIANDRPPRRAEEPRR
FDNRRIPLFPTAERPALEYPTRPAPQPDITGEEPDAAR
119868258YP_938210.1 iron dependent repressor [Mycobacterium sp. KMS]MNDLVDTTEMYLRTIYDLEEEGVVPLRARIAERLDQSGPTVSQTVSRMER
DGLLQVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVQVLDNPTTSPFGNPIPGLSELGLDSLSRAEVVN
LVRLTELPAGMPVAVVVRQLTEHVQGDADLIARLKDAGVVPNARVTVESA
DHGGVNIVIPGHEQVELPHHMAHAVKVEKV
119868256YP_938208.1 hypothetical protein Mkms_2220 [Mycobacterium sp. KMS]MTAMDGVLVRGASGAVVALAGALLCGCVRVTDGTASLAADAKPVVLADAL
LEPSRFPPAYRAAVLDPQATGEAVAAVEGVPVGATVEPPGCAPPRVGPGP
EHAVAAQGVDSATGAALTVILTRTDTALSARRDQIARCAALTATAGEVVS
TVDTVLLAPPPVDADESLASEATILRSTEPAVRVLTLSAQIDEARLTVAW
LNNDPAVEPDTSALDVLFTDALLTLRRAAR
119868254YP_938206.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MTDRTPNLRPVRDVTPTLHYRTIHGYRRAFRIAGEGPAILLIHGIGDNST
TWNTVQTKLAQRFTVIAPDLLGHGKSDKPRADYSVAAYANGMRDLLSVLD
IDRVTVVGHSLGGGVAMQFAYQFPQFVDRLILVGAGGVTKDVNIALRVAS
LPMGSEALALLRLPLVLPTLQVAGRLAGTVLGTTKMGRDLAEMMRILADL
PEPTASSAFARTLRAVVDWRGQVVTMLDRCYLTESVPVQLVWGTHDSVIP
VSHARLAHAAMPGSRLEVFEGAGHFPFHDDPDRFVEIVERFIDSTEPANH
DQDILRQLLRTGLSESAISGSVDTRVAVLDAMGSDERSAT
119868252YP_938204.1 transcriptional regulator NrdR [Mycobacterium sp. KMS]MHCPFCRHPDSRVVDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSREKVIKGVRRACQGRQVDDDALNLLAQQVEDAVRATGSPEV
PSHEVGLAILGPLRDLDEVAYLRFASVYRSFESAADFEREIEALRAHQDV
TRSG
119868250YP_938202.1 LexA repressor [Mycobacterium sp. KMS]MSDDSSETRTGGRRGADAGLTERQRTILEVIRASVTSRGYPPSIREIGDA
VGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVDVRLSDEPATPVVTTDVA
GSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGSLFLLKV
VGDSMVDAAICDGDWVVVRQQAVADNGDIVAAMIDGEATVKTFKRSRGQV
WLMPHNPAFEPIPGNDAAVLGKVVTVIRKI
119868248YP_938200.1 molybdopterin guanine dinucleotide-containing S/N-oxide reductase [MycMPARPTSLTHWGGFSAEVSSGDIAAVTPLPGDDDPSPLLGNLPGSVRHRS
RIAGPAIRRGWLDDGPGPSRRRGADEFVAVSWDELTDLLAAELRRVVDTH
GNEAIYGGSYGWASAGRFHHAQSQVHRFLKLLGGYTYSRHSYSLGATGVI
MPRVVGTHDDLFKRSTDWDVIAARTDLLVCFGGLAMKNTGTNHGGTTAHP
ARAALRRFRGRGGRIVSFSPLRDDVDGECDWYAPVPGTDVAIMLGLAYVL
ATERLADRGFLETHCVGYDRFERYLLGADDGVAKSPQWAAAICGLPADEI
TALARRMAAQRTIVTVSWSLQRVRHGEQAPWMGLTLAAMLGQIGLPGGGF
GHGYGSMNEPGLPPLRCGLPRLPQGINPVSTFIPVAAVSDMLLHPGETFD
YNGMRLTYPDIRCVYWAGGNPFHHHQNIPRLRRALARVDTVVVHDPYWTA
MAKHADIVVPSTTAFEREDYSGSKNDPVLMAMPKLVEPYADSRDDYTTFA
ALADRLGFGEQFTEGRTARQWLAHLYEKWSAELDFAVPTFEQFWRDGSLR
LPTEPGLTLLGDFRADPVAHRLGTPSGRIEIFSEDIAGFGYADCAGHPTW
FEPTEWLGGERAATYPLHLVANQPATRLHGQLDGGSTSQSAKVVGREAIR
MHPDDAAARGVADGDVVRVFNDRGACLAGAVIDDRLRRSVVQLPTGAWFD
PADPADYDAMCVHGNPNVLTDDVGTSSLARGSTGAHVLVQVEKFSGPIPP
VRAHEPPVIRQR
119868246YP_938198.1 HSR1-like GTP-binding protein [Mycobacterium sp. KMS]MKSDLRANLDSLMTFPEFPAHQTPSAGELALEDRSALRRVAGLSTELADI
SEVEYRQLRLERVVLVGVWTDGSAADAEASLAELAALAETAGSEVLEGVV
QRRDKPDASTYIGSGKAAELREIVLATGADTVICDGELSPAQLTALEKIV
KVKVIDRTALILDIFAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQ
AGGRAGGAGGGVGTRGPGETKIETDRRRIRERMSKLRREIKDMKKIRDTQ
RSGRRRTEVPSVAIVGYTNAGKSSLLNALTGAGVLVENALFATLEPTTRR
GEFDDGRPFVLTDTVGFVRHLPTQLIEAFRSTLEEVADADLLVHVVDGSD
ANPLAQISAVREVINEVIAEQNAKPAPELLVVNKIDAADGLSLAHLRRAL
PEAVFVSARTGQGLDRLSARMSELVESTDVTVDVTIPYDRGDLVARVHSE
GRIDATEHTTDGTRVKARVPVALAAGLRDFATF
119868244YP_938196.1 tRNA delta(2)-isopentenylpyrophosphate transferase [Mycobacterium sp. MRPLAIIGPTGTGKSALALDVAERLGGEIGVEIVNADAMQLYRGMDIGTA
KLPAAQRRGVPHHQLDVLDVTETASVARYQSEAARDIEAIAARGAVPIIV
GGSMMYVQALLDDWAFPATDPAVRARWEQRLAEVGVAALHGELGKVDPDA
AASILPTDGRRIVRALEVVELTGQPFAASAPTIGAPRWDTAIIGLDWETT
VLDERLAARTDSMFAEGLVAEVAGLLRHGLREGVTASRALGYAQVLADLD
AGGDGSAAREPTFVGTRRYVRRQRSWFRRDHRVCWLDGGSPDNVDRTLRA
WRAVS
119868242YP_938194.1 hypothetical protein Mkms_2206 [Mycobacterium sp. KMS]MDRSAWPSEPLKAIETGRPGVCAHLRRAGLRDHPPSGHAHARYDDEEIAM
ARADIAALLALGAAFFIAIGDVIHQRSAHEVTDEAVGHLQLFLQLLRDRQ
WWLGSTVAALGFGLQAAALGLGSVLLVQALLVTSLLFALPINARLTGRRV
TRWEWLWAALLAGAVAVIVTVGNPTAGQARASWETWMVVLAVLVPALVVC
VVGARIWSGPPSAVLLALVSGALWGVFAVLTKGVVDRLDDGLWAVLQMPE
LYALAAVAVAGTAWQQASFRSGALTASLPTMTVTEPVVASVLGVAVLGET
MRPGESGWFTLVVAAAAMVLATAALARGEAAGAEAQASVAH
119868240YP_938192.1 hypothetical protein Mkms_2204 [Mycobacterium sp. KMS]MCAVSTPDGPNGFDSYKGDIEDVERRVAGEFDPGARALVVAVLVFVVLLS
FVLPHAGGARGFDVLTGTDAAAEAGISLPSRVFAILAIVFSVGFSIVALL
TRRWAIAWVALAGSAVASAMGMLAVWSRQTAAEPYPGPGIGLIIGWLAVI
VLTFHWARVVWTRTAVQLAAEEERRRRAAENQGKGLLDFGDEPRDDQDGP
ARPGV
119868238YP_938190.1 ABC transporter-like protein [Mycobacterium sp. KMS]MISMQEVNKHFGDLHVLKDINLRVERGQVVVVLGPSGSGKSTLCRTINRL
ETIDSGTIAIDGEVLPDEGRKLAQLRSDVGMVFQSFNLFAHKTILDNVTL
APMKVRGLGKDAAREAAMALLERVGVANQADKYPAQLSGGQQQRVAIARS
LAMNPKVMLFDEPTSALDPEMINEVLSVMTALASEGMTMLVVTHEMGFAR
RASDRVVFMSDGAIVEDAEPAQFFDNPQTDRAKDFLGKILHH
119868236YP_938188.1 polar amino acid ABC transporter inner membrane subunit [MycobacteriumMEIFTEYRAQIFEAFWTTIQLTVYSAVGALILGTVLAGMRLSPVPMLSWL
GTAYVNVIRNTPLTLIILFCSFGVSQTLGITLVDPQSSTSIEDSNFRLAV
LGLTVYTASFVCETVRSGVNTVPLGQAEAARSLGLTFSQNLRMILLPQAF
RSVVIPLGSVLIALTKNTTIASAIGVAEAALLMKEMIENTAALLVVGSIF
ALGFIILTLPLGLVFGWLGKRLAVAR
119868234YP_938186.1 hypothetical protein Mkms_2198 [Mycobacterium sp. KMS]MIETVTALDILPESTLRSAVDVMVRLVEACGAVVIVVGAVIAIVKFAVTL
ARRDIGEFSSVRLTLGRFLALGLEFQLASDVLRTAISPSFEEIGKLAAIA
AIRTALNYFLAREIAEEQRAVEEARAARSAPDASPR
119868232YP_938184.1 hypothetical protein Mkms_2196 [Mycobacterium sp. KMS]MHMLTNIDVRPHHRTAVETSVRIVSTVTPADLGRPTPCAGWDLGDLLVHM
TVQHRGFAAAARGRGADHGVWDPATVADAVRSRPADSYRAAAEDVVAAFA
VDGVLDAPFALPEFGSDATFPGAMAIQFHFVDYVVHGWDVARASGLSFDI
PADVVSVAAPIAFAVPDGEIRSADNSPFAPALPASQDGNELDRMLRHLGR
SPDWRP
119868230YP_938182.1 recombination regulator RecX [Mycobacterium sp. KMS]MTSFPHPSTSESGPDPDSEPNREEQAHAYCLRLLTARARTRAELAGKLTQ
RGYDEPVVARVLDRLVDVGLVDDEDFAEQWVRSRHLYAGKGKRALAAELR
RKGVDDEVISSSLADIDAGAERDRAERLVRDRLRREKLDDEPGSDLKVKR
RLAGMLARRGYSQSMALDVVTVELAGERERRRV
119868228YP_938180.1 hydrogenase nickel incorporation protein HypA [Mycobacterium sp. KMS]MATTAIGDSTRRARTPAYREGTAPVEDGTPMHEMAITQSVVDAVCDHAAG
RRVHSVRLEVGALCAVVPDAMRFCFELATEGTAADGARLDLDVRPGLARC
RTCDTDFELTDLILLCPCGSADVEVRAGRDLRILSMEVS
119868226YP_938178.1 NADH ubiquinone oxidoreductase- 20 kDa subunit [Mycobacterium sp. KMS]MPTEAAVKAEEALIHVLWINAGLSCDGDSVALTAATQPSIEEIALGALPG
LPKIAVHWPLIDFECGPNGGADDFLEWFFRADRGELEPFVLVVEGSIPNE
AIKDEGYWCGFGNNPATGQPMTTSEWLDRLTPKATAVVAVGTCATYGGIH
AMAGNPTGAMGVPDYLGWDWKSKAGIPIVCVPGCPIHPDNLAETLTYLLY
MATDQAPMIPLDDALRPQWLFGQSVHEGCDRAGYYEQGDFATEYGSPKCI
VKLGCWGPVVKCNVPKRGWINGVGGCPNVGGICIGCTMPGFPDKFMPFMD
EPPGGKVSTTASTLYGSVIRSLRHVTGRTVDKEPKWRHPGTKLETGATRT
W
119868224YP_938176.1 NifU domain-containing protein [Mycobacterium sp. KMS]MCPAAPSEHDADADTRWRTAGERIQTLLDASSAGGAAARERAEQLVGEVT
DLYGAALGRMLDLAVSVDPDLVDAVAADPLVASLLLVHGMHPHSVERRIT
DALDTVRPYLGSHGGDVHLLGVDGDTARLRFAGSCKSCPSSAVTLELAVE
DAIRAAAPEIETIEVVAEERDSADTVIPAESLFTRVHGSASWLPVPGLAE
ILPGEVGGFAVAGTPVLVCRLDDTLYAYRDRCGRCDASMAGARLTGEVLR
CPRCDAGFDVVHAGAGLGGLERLEPVPVLRRQGVWAVAIAESVA
119868222YP_938174.1 hypothetical protein Mkms_2186 [Mycobacterium sp. KMS]MTADVRFTVQDVTPERYAVTPVLTARIEVTATGDDPVHAIALRCQVRIDP
LRRGYTDDEAEGLADLFGPRERWGTTQHTFLWQHSATMVPGFSGGTHVDL
PLECTYDVEVAAAKYMHALRDGVIPLQFLFSGTLFTRGERGFAVTQISWD
REDTYRLPVTVWRDLIALHYPNTGWLRLSHDTIAALTAYRSAHGLLSCDD
AVTALLSQARQEVP
119868220YP_938172.1 peptidase M52- hydrogen uptake protein [Mycobacterium sp. KMS]MLRRAAPLITDPRVRAVDYGIRGMHLAYDLLEPWELLVLVDALPDRGAPG
TLHVFEADHDALCATGGLDAHAMDPAAVFASLTALGGAPPRTVVIGCEAA
DVAEGIGLSTPVAAAVPEAVRAVGAVVSGQTTQPGRV
119868218YP_938170.1 (NiFe) hydrogenase maturation protein HypF [Mycobacterium sp. KMS]MRLCVRGVVQGVGFRPFVYTTATALGLTGSVRNDSAGAVVEIEGDPDALT
RFVERLHTRPPPLAVIESVDIEDLPPVGGTGFFIADTSRGRGRTLASPDV
AMCAQCAAEQRDPGDRRYRHPFVNCTDCGPRFTIIASLPYDRAATSMAGF
AMCADCAREYADPTDRRFHAQPVCCPHCGPTLTFRDADGRHTAGEDGLRR
ARRLLRDGGVVAVKGIGGYHLACDAENNTAVAELRRRKQRGDKPFAVMVP
DAAAAGRIAVLDEVAQHLLGGPQRPIVLAPRRTPTTVAAAVAPGNPDLGV
LLAYSPLHTLLFGLPGDEPGPQVLVMTSGNLAGEPLCYDDDDAVTRLRAL
ADGWLMHDREILVPCDDSVVRVVDGVELPIRRSRGYAPLPVALPLAVPPT
LAVGADLKNTMAVADGRYAWLSQHIGDMDDIATLSAFTAAERHLRELTGV
APQILATDAHPRYRSTGWAQRHAGDRPVRAVQHHHAHIAAVMAEHGLDGS
APVLGFAFDGTGYGPDGAVWGGEVLLADYKGFRRIAALEYVPLAGGDVSV
LRPYRMALAHLWAAGLPWAGDLPPVQACPEDERRVLRHQLETGLNCVPTS
SMGRLFDCVAALAGVRQTVAYEAQAAIELEALARTVDDDPAPYAFTVTES
SGTAMIGAAAVVEAIVADRRRGTAAAVIGWRFHHAVADLVVRLAEGARDP
VALSGGVFQNALLLRMTLRALTERGVEVLTHRRVPPNDGGIALGQLMVAN
AG
119868216YP_938168.1 hydrogenase expression/formation protein HypD [Mycobacterium sp. KMS]MKYLDEFSDPQLARKLIEQIKSVTTRRWSIMEVCGGQTHSIIRHGIDQLL
PDQIEMIHGPGCPVCVTPLEIIDKALEIASRPEVIFCSFGDMLRVPGSES
DLFQIKSRGGDVRVVYSPLDALTVAKDNPDRQVVFFGIGFETTAPANAMT
VYQAKRQGIPNFSLLVSHVLVPPAISAIMESPTCRVQAFLAAGHVCSVMG
TAEYPPLCEKYGIPIVVTGFEPLDILEGIRRTVVQLEAGRHELENAYPRA
VRAEGNPAAKTMLADVFEVTDRSWRGIGMIPQSGWRLSPAYRDFDAEYRF
AVTGIHTDESTLCRSGEVLQGLIKPHECAAFGTVCTPRNPLGATMVSSEG
ACAAYYLYRRLEVSHA
119868214YP_938166.1 hypothetical protein Mkms_2178 [Mycobacterium sp. KMS]MLPTRRRGDTLFARYAFPPNELGYCGPPGSATVGGVSELAGQAREFDGAW
PYLRALAAAAGDTDVLDEDVVRSYWIGGGLLHDVDAEGLLVALRRAFTGQ
VTGLLDAVPAGTALAHHSFHVFVVYPWARFLDRDPTTPIRIMQQCRIRSG
TVESVDGDHVVVSTRPLTVDGGTLALGAAVSERVRWRRDGSSLIPAPRPG
DPVAAHWDWVCDALTEDDVAALTAATQATLDLVNEIRTAVNQGAPTQ
119868212YP_938164.1 hypothetical protein Mkms_2176 [Mycobacterium sp. KMS]MRLTEFRELVDGQFGSMRGRSLLVDHVLSGLGGRTAAQAIEDGVEPRDVW
RALCADFDVPRDQW
119868210YP_938162.1 limonene-1-2-epoxide hydrolase [Mycobacterium sp. KMS]MTESSNGSTSALQSTTNARTVETFLFALQDEDFDAADSLMADHIAWQNVG
FPTIRGRERITKLFRRGQGKLGFEVKIHRIAAEGDAVLTERTDVLVLGPV
RLQFWVCGVFEVHAGRITLWRDYFDTVDFLKATVRGLLAVPFPALRPTL
119868208YP_938160.1 phage shock protein A- PspA [Mycobacterium sp. KMS]MANPFVKAWKYLMALFSSKVDEYADPKVQIQQAIEEAQRQHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQAVANGDAAKATEYNN
AAEAFAAQLVTAEQSVEDLKALHDQALQAAGQAKKAVEQNAMMLQQKIAE
RTKLLSQLEQAKMQEQVSSSLRSMSELAAPGTTPSLDEVRQKIERRYANA
MGEAELAQNSVQGRMLEVQQASVQMAGHSRLEQIRASMRGEALPSGGATP
AASPATPAANPAQQAPENPLSQ
119868206YP_938158.1 CinA domain-containing protein [Mycobacterium sp. KMS]MNDPLVTDDARALVADLTVRHQSVATAESLTAGLLSATLAGVPGSSAVLR
GGLVTYVEDTKIALAGVAPQVLDAVGPVAAPTARALAVGTRQRCGATWGV
GLTGVAGPEPHGGHPVGTVFLGLAGPVDTKVVELHLSGTRWDIRKAAVDE
AIAHLRALVEAQ
119868204YP_938156.1 N-acetylglutamate synthase [Mycobacterium sp. KMS]MRRARTSDVPAIKGLVDIYAGKILLEKNLVNIYEAVQEFWVAELDDELIG
CGALHVLWADLGEVRTVAVHPKVRGRGVGHLIVERLLDVARELRLQRIFV
LTFEVEFFARHGFAEIDGTPVTAEVYEEMCRSYDTGVAEFLDLSYVKPNI
LGNTRMLLTL
119868202YP_938154.1 antibiotic biosynthesis monooxygenase [Mycobacterium sp. KMS]MPVVVVATMTAKPESVDTVREACKKAIESVHSEPGCDLYSLHEANGTFVF
VEQWADADALKTHSTAPGVTTLFAEVGEHLDGAPDIKMLEPVPAGDPAKG
RLRP
119868200YP_938152.1 hypothetical protein Mkms_2164 [Mycobacterium sp. KMS]MVVSLAVASIRGDHDAESLSPVDPEAVLRRCAESPRIPAIRPFDLGNTMH
ANQLMHPRQFVTTWIVHRPPKHQTVITVQEVELATAAAAAPAAAALARAE
SRHRVLKWPAPHVLPESRSHYYPRRCAYFETSTMSRLMDHL
119868198YP_938150.1 dihydrodipicolinate synthase [Mycobacterium sp. KMS]MSPVSISGFDVTARLGTVLTAMVTPFKPDGTLDTDAAARLANHLVDSGCD
GLVLSGTTGESPTTTDDEKLTLLRTVLEAVGDRARVVAGAGTYDTAHSVH
LAKSCAAEGAHGLLVVTPYYSRPPQAGLLAHFTAVADATDLPVVLYDIPP
RSVVPIAWDTIRTLAEHPNIVAIKDAKGDLHGGGQIIAETGLAYYSGDDA
LNLPWLAMGAVGFISVWGHFAASQLREMLSAFNSGDIATARKISVALGPL
SDAQARLGGVTMSKAGLGLLGFDVGLPRLPQIPPTPDELTALAEDMRAAA
VLR
119868196YP_938148.1 hypothetical protein Mkms_2160 [Mycobacterium sp. KMS]MRLTGAQARRIAVAAQGFAEPKPRGPVTRGHLRRLVDRIQVLQLDSVSVA
VRAHYAPVFSRLGPYDRGVLDGAAWSHSTRAPRLLVEYWAHEAALMAVDD
WPLLRWRMREYTHGRWGTHIVKANPQLADDIVTAVTELGPATAGQIEEYL
GAEQRGRKGPWWDRSDTKWVTEALFASGVLTTATRVGFARHYDLTERVLP
ADVVARQIDDADAVRELCLRAAGALGVATEADIRDYFRLAAKQVKPALAE
LVAAGELVPVEVDGWAAPAYLRAGQTVPRTDRGTALLCPFDPLIFFRPRV
ERLFGFHYRIEIYVPQHKRQYGYYVWPFLLDGRLVGRVDLKAERTRDALH
VVGAFVEPGEDPARVAVALAGELKTMAQWLGLADVTVGDRGDLVATLRES
AALG
119868194YP_938146.1 thymidylate synthase [Mycobacterium sp. KMS]MPIPTPYEDLLRLVFERGTPKSDRTGTGTRSLFGHQMRYDLAAGFPLITT
KKVHLKSVVYELLWFLRGESNVRWLQEHGVTIWDEWASETGELGPVYGVQ
WRSWPTPSGGHVDQISAAVDLLRTDPDSRRNIVSAWNVGEIPQMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLGVG
EFVWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAQRDSIFDYTYEDVV
VKNYDPHPAIKAPVAV
119868192YP_938144.1 hypothetical protein Mkms_2156 [Mycobacterium sp. KMS]MPGIADIALGAAPIAGGALLGIAAGGLRGPDVRGMIAKDMELLERLPEEQ
VELRARLRRSIDQRIEDLVTTAERSRELRIAAMSYEGNWRDVLVFICTVL
FTVVWWHVSHSRSNWLVMFIVLIVLTVVAGAYAARGIRRALGRKRRNRRG
AL
119868190YP_938142.1 TPR repeat-containing protein [Mycobacterium sp. KMS]MTDDRRALRTQVLIGLMCVALVVYFLLLGRIAFAFIKTGELAAVGLGVAL
LALPLIGVWVMVSTLQAGFAHQRLVRLAREQDMDLDVSDLPRRPSGRIER
DAADALFELVRAELHEDPDNWIRWYRLARAYDYAGDRGRARAAMRRAVEL
EESA
119868188YP_938140.1 hypothetical protein Mkms_2152 [Mycobacterium sp. KMS]MSTPDAPQVSQQFAHLRGLLETSFVTVVSTVTLLAVLSVVRTSVRSMDGL
PGAVDRLLAAVAELQTASIDELSYEQIVAELDRIKAAVWAVPSVEHRLTA
RLMDADPHELGATSIKEVLANHLRISRKAAGERLTDARQLGPRYTLTGER
VQTELAHTAAAVARGDIGTAHVRIIQDFVRKLPAWVSWERRDHYERDLVG
HASALRPEDLRKVADTLLGFIDQDGTEPDHHTQQRRREFTVGRQQADGMS
RVSGWLTPEARAHWDVIAAKYAAPGTNLPHDDAHTGRDDRTTGQRHHDAL
TRAMRDHVQSGALGQVAGVPASIVATMTLSELERAAGWAHTGGGNKIPIR
DLIRMAAHSRHYLAVFDDHTEEILYFGRARRTASTAQRLALFARDRGCTH
PGCTVPFYWTEAHHTHDYSRGGRTDIDDLTLACQPANLLIEKTGWTTHRP
GNGRTQWTPPADHDTGQPRINNHFHPHRYLTDNDDGQDDEPE
119868186YP_938138.1 L-alanine dehydrogenase [Mycobacterium sp. KMS]MRVGIPTEIKNNEYRVAITPAGVAELTSRGHDVLIQSGAGEGSAISDADF
KAAGAQLIAGADEVWAEADLLLKVKEPIEPEYSRMREGQTLFTYLHLAAS
QPCTDALLASRTTSIAYETVQTADGALPLLAPMSEVAGRLSAQVGAYHLM
RTQGGRGVLMGGVPGVAPAKVVVIGGGMAGDNAAAVAWGMGAHVTVFDVN
INILRKIDAEYGGAIETRYSSRLELEEAVTQADLVIGAVLIPGAKAPKLV
TNSTVAQMKSGAVLVDIAIDQGGCFEDSRPTTHDDPTFKVHDAVFYCVAN
MPGAVPRTSTFALTNATMPYVLKLADKGWRAACQADPALAKGLSTHAGAL
LSEQVAADLDLPFTDPATVLA
119868184YP_938136.1 beta-lactamase [Mycobacterium sp. KMS]MTYSLTRRRLLSATAVLGGAAAFATYAGRPAYAQPVAGLDALERANTAVV
GVFAVNLDTGRTVAHRAQESFAMCSTFKAYLAAHVLQLVGRGERSLEQGL
YVDAADILPNSPRTEPRVGGEMTLAELCQAILQVSDNAAANILLRDVGGP
PAVTAFARWIGDPRSRLDRYEIELNSAVPGDPRDTSTPEALGGGFRTLLT
GDVLAPPQRRLLEDWMRANETSSMRAGLPPGWTTADKTGSGDYGTTNDVG
IAYGPQGQRLLLAVMTRSATDDPDAENMRPLIGEVTAAVLPELLRG
119868182YP_938134.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium sp. KMS]MSVVEIEDGVYESTAVIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDET
MLLSATSASKSPKDHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPTFVSGLRNEIQVVVTVMSLDPKDLYDVVAINAASAST
QIAGLPFSGPVGGVRVALIDGTWVAFPTVEQLERAVFDMVVAGRKTADDV
AIMMVEAEATDKVVELVAGGAQAPTEAVVAEGLEAAKPFIKVLCEAQQEL
AGRAAKPTADYPLFPEYGEDVYYAVASVATDALSEALTIAGKEERNNRTD
EIKVEVLGRLADQFAGREKEIGGAFRSLTKKLVRQRILTDHFRIDGRGVT
DIRALSAEVAIVPRAHGSALFERGETQILGVTTLDMVKMAQQIDSLGPET
SKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALMPVLPSVEEFP
YAIRQVSEALSSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSDD
VEVDGKTERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDTKLDGI
PSQVLAGALAQAKDARITILEVMAEAIDAPDEMSPYAPRITTIKVPVDKI
GEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAIDKINAI
ANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGKRIAKV
EDVAKVGDKLRVEIADIDNRGKISLVLVAEEEAAEASDNGSATPSDKAPA
TADATTAGN
119868180YP_938132.1 bifunctional riboflavin kinase/FMN adenylyltransferase [Mycobacterium MARRRLAVVQRWRGQDDIPTDWGRCVVTIGVFDGVHRGHAELIDNAVKSG
RSRGVPTVLMTFDPHPMEVVFPGSHPAQLTTLTRRAELVEELGIDVFLVM
PFTADFMKLTPERYIHELLVERLHVVEVVVGENFTFGKKAAGNVELLRKA
GERFGFAVDSLSLVAEHHRDETVTFSSTYIRSCVDAGDVVAAAEALGRPH
RVEGVVVRGDGRGRGLGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPVM
GTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTAADLYGQHVAVDFVA
RIRGQEKFDSVDDLIATMGTDTERARTILRNSV
119868178YP_938130.1 signal-transduction protein [Mycobacterium sp. KMS]MTDLPSAGSIQVSTLTGDAVVRVPADATVADVATAIIDKEVGAVLIGDDD
RPTALVSERDVVRVVASGRDPATVRADEVATTNLVWCEGDATVDFVATRM
MDRYIRHVLVEQDDRLVGIVSARDLLGVYAADADLPR
119868176YP_938128.1 4'-phosphopantetheinyl transferase [Mycobacterium sp. KMS]MSPQVTLLPEVLGDKAVSAERYDDPPDIAPLPEEEPLIARSVAKRRNEFV
TVRFCAREALGELGLPPVPILKGDKGEPCWPDGVVGSLTHCEGFRGAAVA
RRGDARSIGIDAEPHGVLPKGVLDAISLPAERSALAALPGGLHWDRILFC
AKEATYKAWFPLTHRWLGFEDAHITFDVDGSGQTGRFVSKVLVDPAAESG
PPLSTLEGRWSVRDGLALTAIVL
119868174YP_938126.1 hypothetical protein Mkms_2138 [Mycobacterium sp. KMS]MAAKLRVLSALCALFAAVMVVIATNPTGESATGRVDLRSTFLPLTGSTTI
KYPVVETVDPSPFDPCRDIPFDVVQRAGLAYTPPAPEDALRCKYDAGNYQ
MTIEAFVWRTYEETLPPDAVQLDIAGHRAAQYWIMKPTDWNNRWWTTCAV
AFDTSYGVIQQVLFYSPIYSQPDVDCMQTNLQKAHELAPHYIY
119868172YP_938124.1 hypothetical protein Mkms_2136 [Mycobacterium sp. KMS]MSTPALKEWSAAVHAMLDGRQTVLLRKGGIGEKRFRVDADRFVLFPTVAH
SHAERVRAEHRDLLDRAAADSTEEALTLRAGARVVAAVEVNRPEAVGELE
PMHIWTAESVQADRLDFRPKHRLTVLVVQVSPLAEPVRIERTPQFGGCTS
WVDLPVHPAWEPPVHDDATLAAIAESVRRSVG
119868170YP_938122.1 enoyl-CoA hydratase [Mycobacterium sp. KMS]MSNADTPDVLAIETTDRVRTLTLNRPQARNALSKALREAFFTALRNAEYD
DDVDVVIVTGADPVFCAGLDLKELGDQTQLPDISPKWPSMTKPVIGAING
AAVTGGLELALYCDILIASEQARFADTHARVGLLPTWGLSVRLPQKVGVG
MARRMSLTGDYLSATDALRAGLVTEVVPHAELLPTARAIAASIVGNNQRA
VRSLLESYHRIDESQTAGALWLEADAARRWMASATGDDIAANRAAVLERG
RAQVR
119868168YP_938120.1 type 11 methyltransferase [Mycobacterium sp. KMS]MTEHPTVVNHHAGQPGFGGPVGVLFAVVFLLTGRGNARLAADVAAVSADD
RVVDVGCGPGTAARLAARRGARVTGVDPSDAMLRVARAVTRRRPSVTWVR
GGAEALPVPDASATVVWALATVHHWPDVGAALTEIRRVLSPGGRLLVVER
QVQPGATGFASHGWTAQQAETFAALCRSAGLTDVGVTGRGRGRRAVWSVR
GVRPAGL
119868166YP_938118.1 phosphoesterase domain-containing protein [Mycobacterium sp. KMS]MTAIDKTTDVPAGARVDAYRAADLLAAAATVSVVCHVYPDADTIGAGLAL
ALVLDHSGKSVQVSFAAPAELPESLQSLPGGHLLVAPEEMRRDADLVVTV
DIPSVNRLGALGDLAVPGRRVLVIDHHASNQLFGTANYVDPSADSTTMLV
AELLDAWHKPIDLGVAHCLYAGLTTDTGSFRWASARAHRLAARLVEIGVD
NAAISRTLLDTHPFAWLPMLSRVLASARLLPDAVDGRGLVYAVVSHEELA
GARPEEVESIVDIVRTTQQAEVAAVFKELEPQQWSVSMRAKSIDLSSVAS
AFGGGGHRLAAGYSASGPADDVVAALRAALG
119868164YP_938116.1 translation initiation factor IF-2 [Mycobacterium sp. KMS]MAGKARVHELAKELGVTSKELLATLKEQGEFVKSASSTVEAPVARRLREK
FGSKSAPAPAKSAGNGATAAPATSATPATAAAAAAPAPAPAPQAPAKPAA
PKPAAPQPVAPPQPAAAAPTPPPAASAPAPAPAPSAPAPSRPGPTPGPRP
GPAPKPAPRTPRVGNNPFSTQQPVDRPIPRPQPRPGAPRPGTPRPGMSPN
NMPPRPAGPRPGAPAGRPGGPRPGPGGRGPGGGGGRPGGPGGGGGGNYRG
GGAGGGGGAGGAAAGGFRGRPGGGGRPGQRGGAAGAFGRPGGAPKRGRKS
KRAKRAEYENMQAPVVGGVRLPHGNGETIRLARGASLSDFAEKINANPAS
LVQALFNLGEMVTATQSVNDETLELLGSEMNYVVQVVSPEDEDRELLESF
DLSYGEDAGDEGDLEIRPPVVTVMGHVDHGKTRLLDTIRQANVREGEAGG
ITQHIGAYQVLTELDGNERLITFIDTPGHEAFTAMRARGAKATDIAILVV
AADDGVMPQTVEAINHAQAADVPVVVAVNKIDKEGADPQKIRGQLTEYGL
IPEEYGGDTMFVDISAKQGTNIDALLEAVLLTADASLDLRANPDMEAQGV
AIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVE
AAMPSRPVQVIGFTSVPGAGDNLLVVDEDRIARQIADRRSARKRNALAAR
SRKRISLEDLDSALKETSQLNLILKGDNAGTVEALEEALLGIQVDDEVEL
RVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYY
SVIYQAIDEIESALKGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVQ
SGIMRRNAKARLLRDNVVVAENLTVSSLRREKEDVTEVRDGYECGLTLTY
SDIKEGDVIETYELVEKART
119868162YP_938114.1 transcription elongation factor NusA [Mycobacterium sp. KMS]MNIDMAALHAIEADKGISVDVVVDTIKSALLTAYRHTEGHQADARIDIDR
KSGAVKVMARETDADGNLIQEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVAGVIQRDARANARGLVVVRMGSETKGNEGVIPAAE
QVPGERYEHGDRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
NDGSVDIVAVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDEQTRAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDAAPPDQHRPDSDAPQSAVRDR
119868160YP_938112.1 hypothetical protein Mkms_2124 [Mycobacterium sp. KMS]MPSAPVPAVISRRGLLMSAATLAVVGVSVAACGSAPPPPEVDELTAQLDR
ARADSRLATDAAATARQPMKQTLTTIAAERDAHAQALADELVRLVGTEAP
TATAPTSTAAPATPATVREVIGALRQSAESATGLAAQMSGYRAGLLGSIA
ASCTAAWRVALAPPAKDTP
119868158YP_938110.1 prolyl-tRNA synthetase [Mycobacterium sp. KMS]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYVRPVGPGLYTWLPLGLR
VFRKIEQIVRDEMTAIGGQEILFPALLPRAPYETTNRWTEYGDTLFRLKD
RRDNDYLLGPTHEELFTLTVKGEYSSYKDFPLILFQIQTKYRDEARPRAG
ILRGREFVMKDSYSFDVDDDGLKTAYHLHREAYQRIFARLGVHYVIVSAV
SGAMGGSASEEFLAESEVGEDTFVRCLQSGYAANVEAVLTRVPEPLPIEG
QPEAVVYDTPDAPTIATLVDWANGADLPNFAGRAVTAADTLKNVLVKVRE
PGGEWELLAVGVPGDREVDDKRLGAALEPAEYALLDEADFARHPFLVKGY
VGPKALLDNGVRYLVDPRVVDGTAWITGADAPNKHVVGLVAGRDFVADGT
IEAAEVRDGDPSPDGAGPLVSARGIEIGHIFQLGRKYTEAFSADVLGEDG
KPVRLTMGSYGIGVSRLVAVIAEQQHDELGLRWPAAVAPFDVHVVIANKD
DGARTGATELAGELDRLGLEVLLDDRKSSPGVKFKDAELLGVPWIVVVGR
GWGDGVVELRDRFSGEKREIGVDDAATEILATVR
119868156YP_938108.1 uroporphyrinogen-III C-methyltransferase [Mycobacterium sp. KMS]MTDNAYLVGLRLAGRKVVIVGGGTVAQRRLPLLIANGADVHVIARAATPA
VEAMTGITLTLRDFRVGDLDGAWYVIAATDDPDVNAAVVAEAERRHVFCV
RADVAREGTAVTPASFEYEGLSVGVLAGGEHRRSAAIRSAIHEALASGLI
SGDDPDTVTTGVALVGGGPGDPELITVRGRRLLAQADVVVADRLAPQELL
AELPPHVEVIDAAKIPYGRAMAQDAINQVLIDRASAGKFVVRLKGGDPFV
FARGYEEVLACVDAGIPVTVVPGVTSAIGVPALAGVPVTHRHVTHEFVVV
SGHVAPDHPESLVNWDALAALTGTIVLLMAVERIELFTKVLIEGGRPAET
PVLVVQHGTTTAQRTLRATLADAPERMSAEGIRPPAIIVIGPVAAFGG
119868154YP_938106.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium sp. KMPQGRPATVPDDGLTTRARRNAPLLAVHTGPGKGKSTAAFGMALRAWNQG
FDIAVFQFVKSAKWKVGEESVFRELGRLHDEHGTGGAVEWHKMGSGWSWS
RKPGSDDDHAAAAADGWAEIARRLAEERHDFYVLDEFTYPLKWGWVDVDE
VVEVLRSRPGRQHVVITGRDAPQALIDAADLVTEMTKVKHPMDAGRKGQK
GIEW
119868152YP_938104.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MTVALRRSWAKDLDAATLYELLKLRVEVFVVEQACPYPELDGRDLLAETR
HFWLEGSDGEVISTLRLMEEHPGGQKGFRIGRVCTRRDARGHGHTARLMQ
AALADVGDHPCRINAQTYLQEMYARHGFVRAGDEFVEDGIPHVPMLRPGS
GTAHQ
119868150YP_938102.1 hypothetical protein Mkms_2114 [Mycobacterium sp. KMS]MGARGLSWEADVLPDYQRHTLGLGPDPDGEGDLVATLVRRGGPQPGARHA
VLLVHGFTDYFFHTELADHLAARGFAFYALDLHKCGRSHRDGQTPHFTTD
LARYDRELEQGLRIIGEETDGAAVLVIGHSAGGLIVSLWLDRLRRRGMTA
RLGVSGLVLNSPWFDLQGSAVLRSAATSAALGAVSRFGKRRIVRAPNPGG
GYGATLHRDFAGEFDYNLEWKPVGGFPVTAGWIHAVRRGHARLHRGLDVG
VPNLILRSDHSVREAPDPDAMQRGDAVLDVAHIARWAGCVGNRSTIAPIP
DAKHDVFLSLAEPRRAAYGELDRWLDWYLGEGSNTMRRGL
119868148YP_938100.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTAPAVRIERLRHVYPDGHVALAGVDLTIGVGERVAVLGPNGAGKTTLML
HLNGVLEATAGSVRIGGTTVGRRTLADIRRRVGLVFQDPDDQLFMPTVAQ
DVAFGPANFGVRGDELAARVRRALATVSLTAEADRSPTHLSAGQRRRAAL
ATVLACEPEILVLDEPSANLDPVARRELAETLRAIRATMVIVTHDLPYAA
QLCERAVIVDAGVVVADGPIGELLADAALLAAHRLELPWGFAMPRPS
119868146YP_938098.1 hypothetical protein Mkms_2110 [Mycobacterium sp. KMS]MTRLFWIACAAVTLVVAGALSYAASASPDGLDATTLRGCEVVETAEGESL
TGDCIARHADEHALADSPLADYTVGGRSGTNGVAGVVGVVVTAAAGSALF
WFIARGRRSRR
119868144YP_938096.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MSAVEQPGDHSQVERATSALADVDTSGWTQRFDLLSDPHRLEILLSLHRA
PGICVSDLAAALGRSENAVSQALRVLRQQGWVSSTRVGRAVSYRLDDEVV
HDLLHWIGARHG
119868142YP_938094.1 short chain dehydrogenase [Mycobacterium sp. KMS]MDLTQRLKGKVAVITGGASGIGLATAKRMRAEGATIVIGDIDPATGKTVA
DDLNGTFVQVDVSDQVAVDALFDTAAEEHGSVDIAFNNAGISPPEDDLIE
VTGIDAWDRVQDINLKSVFFCCKAALRHMVPAQKGSIINTASFVAVNGSA
TSQISYTASKGGVLAMSRELGIQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPMGRFAEPAELAAAVAFLASDDASFITGSTFLVDGGIT
GHYVTPL
119868140YP_938092.1 peptidase C26 [Mycobacterium sp. KMS]MTTYLQQAQTGVWDVHASFLPAIYFQGVNLAGGVAVLLPPQPVDSGAAAR
VLDGLDGLILTGGKDVDPARYGQTPRPTTDEPDRIRDAWEFALLDEALRR
GVPVLGICRGAQILNVALGGTLHQHLPDVIGHTHHQKGNAVFGTSAVWTE
PGTRLADLIGATSDAQCYHHQAIDRVGDGLIVSARDDDGVIEAVELDRER
HPDRWVVAVQWHPEERLDDLRLFAAVVAAANRYAMERVRT
119868138YP_938090.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MADDRLKSSGATYSQAGEGYFEKRQLKRTAGFWGLWGIGVAAVISGDFSG
WNFGIGEAGWGGLAVASVLIVITYFGMLFSIGEMSAAMPHTGGAYSFARA
SMGPWGGFITGFAETIEYVFTTAVVVFFSASYADAVTSELFGLSMPGWVW
WLILYAIFVGLNSWGAALSFKFALVVAIISIGILVLFGVLAIANGAVDFS
RLFDIAPDPAAAGSSDFLPFGWVAVLYALPFAMWFFLGIEELPLAAEEAH
DPARDIPKAGIWGLISLVGCGAIVFFLNPAVTGSEALGASDEPLLDGFRA
FLPGSLAAVLSAFALIGLLASLQGIMYAYGRNLYSLSRAGYYPKVLSLTG
SRQTPYIALILGAVIGFVALVVVSLNEGAGDVVLNIAVWGAVLAYMLQMI
SFVLLRRNFPNARRPWVSPTGNAGAIVALVIAAITFVGVLVNPTYRPAVI
AIVVFYVIGLLVFGFYGRHRLVLSPEEEYAVTGGLHGYDPEAEGLGGTIE
DEILKGHTD
119868136YP_938088.1 N-acetyltransferase GCN5 [Mycobacterium sp. KMS]MTDLGSHLDPDSDHTEAITLGLHDASPQHLVDRMADDVVLELGWGRLIFG
QTFADPEKLAKVLQHEGPGRRDICIYARESHVLVARSPSELFIDPSHTYR
LRFTEGEETPDPTPTGFTVRSLREPSDADAMNRVYVQCGMVPAPTDVIWE
NHNQVDAVDYLVAVRDDDGSVVGTVTGVDHKLLFDDPEDGSSLWTLAVDP
TSSLPGVGAALTRALARLFRGRGRSYMDLSVAHNNTAAIALYEKLGFQRV
PVLAVKRKNAINEPLFTHSPETVDDLNPYARIIADEAIRRGIWVEVLDAG
AGEMRLSHGGRSVITRESLSEFTSAVAMARCDDKRQTRRIVSEAGITVPK
GRLATFDEKDHEFLAEVGDVVVKPTRGEQGKGITVGVEGPEELDAALARA
REQHPEVLIEQRAPGDDLRLVVIDGKVVAGALRMPAEIVGTGKHTIRELI
ETQSRRRAAATGGESQIPMDKVTEGTVKEAGWSLDDVLPEGERLRVRRTA
NLHQGGTIHDVTAEVNPELCRVAVAAAEAIGIPVTGIDLLVPDVTGVDYV
FIEANERPGLANHEPQPTAAAFVDFLFPMQPGLPQAWTPEETPA
119868134YP_938086.1 hypothetical protein Mkms_2098 [Mycobacterium sp. KMS]MTGWRAVPWALLLLGALTGCATTVTGNPTWPGARLETVILTEADFPPGVQ
YDRIVDEPGPGGTAGGPPPMLSRPQGCSDGLTRVIERGAQRGPGSAAKYV
AAYDGARVVMTVLTWRLDMDALAATAERCAEFETFFDPTDAGIPMTTTRI
DSVRPDALVYRQTMTLAGVDSSVYFGFENIGTMAVFGIAFPTPNPEIPAK
GTLPQTFLDVATRQADRIAAG
119868132YP_938084.1 methionine aminopeptidase [Mycobacterium sp. KMS]MSVRTALRPGELSPTLPVPKSIARPEYAWRPTVAEGSEPWVQTPEVIEKM
RVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYMVDHGAYPSTLGYKGF
PKSCCTSLNEVICHGIPDSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAG
DVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIEAYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPSVETVIEPGMTFTIEPMINLGGLDYEI
WDDGWTVATKDRKWTAQFEHTLVVTDTGAEILTQL
119868130YP_938082.1 hypothetical protein Mkms_2094 [Mycobacterium sp. KMS]MTTPAHNPAHDGEARPEPMPMRISDADRNGTLRRLHNAVALGLIDIEEFE
ERSALVSQARLRSDLDALVTDLPGPGAIVTSATDRVELRGVFGSLKRHGE
WIVPTRLALHRRMGSIDLDLTRARFAGPIVVIELDLKFGGLDLRLPDGAS
ASIDDVEVIVGSATDHRRDVPAEGRPHVVLTGKVVWGSVDIRGPQTGWLR
RPRFLGERG
119868128YP_938080.1 hypothetical protein Mkms_2092 [Mycobacterium sp. KMS]MTYADHDRRIDRREIADALMRALERRHEVLDVIVASEDYDAAIEEVAALL
GTSAAGGEAVLRLSFDRLTKVSRRRIAAELEDLNNQLSFTMGEQSSRPVE
RVVLRPFSAAEDRDVFAARTADVRAAGDGSGAPAGALDDEISAAVGRVNA
EEAVWLVATVGADKIGMVFGELSGGEVNVRIWIHPEHRKRGYGTATLRAS
RSEMAAYFPAVPLVVRAPAAGA
119868126YP_938078.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Mycobacterium spMTSGPAIGLGMPPAPPPVLAPRRKTRQLMVRDVGVGSDHPISVQSMCTTK
THDINSTLQQIAELTASGCDIVRVACPRQEDADALPIIAKKSKIPVIADI
HFQPKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGDAGIPIRIGV
NAGSLDKRFLQKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPV
VMVAAYELLAARSDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTI
RVSLSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANE
VTAGLEGMDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVI
KTVPEAQIVETLIEEAMRIAEEIGAAGDSPEGSPSGSPVVTVS
119868124YP_938076.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. KMSMGTRLRVLILGSTGSIGTQALDVIAANPDRFEVVGLAAGGANPELLARQR
AATGVHAIAVTDPAAAEKIGDVTYSGPDAVTRLVENTQADVVLNALVGAL
GLEPTLAALATGARLALANKESLVAGGPLVLRAAAPGQIVPVDSEHSAMA
QCLRGGSADEVATLVLTASGGPFLGWSAEDLQSVTPEQAGKHPTWSMGPM
NTLNSATLVNKGLELIETHLLFGIDYDRIEVVVHPQSIVHSMATFTDGST
LAQASPPDMKLPIALALGWPDRIPGAALACDFTTASTWEFLPLDDDVFPA
VRLAREAGRRGGSLTAVYNAANEEAAAAFLDGRIRFPQIVESVAEVLRAA
DQWAAEPATVEEVLDAQRWARDRAGRAVEHAATPPSKGLVTR
119868122YP_938074.1 beta-Ig-H3/fasciclin [Mycobacterium sp. KMS]MNININRVLGAGFAAVAAAGLSLGVAATAQAQPATGLVGPGCTAYAQQVP
QGPGSVAGMAMDPVATAASNNPLLTTLTKAVSGQLNPQVNLVETLNGGEF
TVFAPTDEAFAKIDPATIERLKTDAPLLTSILTYHVVPGQAGPDAVVGTH
KTVQGADVNVTHGAELKVNDASVVCGGVKTANATVYLIDTVLMPPAN
119868120YP_938072.1 deoxyribodipyrimidine photo-lyase type I [Mycobacterium sp. KMS]MPTLLWFRRDLRLHDLPALVDAAQGDGQVLACYVLDPRLHRSAGPRRLQY
LHDALRDLRDQLDGRLLVTRGRPEQRIPALAKSIDASAVYVSGDFTPFGR
RRDDAVRKALGEVPLQPSGSPYLVSPGRVTKGDGTPYKVFSPFFDAWRRH
GWRAPAQSGPDSATWIDPADLTGRDLRTEIPDDGATLDIPAGERAAAQHW
RAFVADELDGYADNRNRPDLDVTSRMSAHLKFGTIHPRTMVDDLGRGKGA
QAYLRELAFRDFYAAVLHEWPRSVWWNWNTGFDGIRVDEGAVAEQRFDAW
KRGRTGFPIVDAGMRQLAGIGWMHNRVRMIVASFLVKDLHLPWQWGARWF
LEQLVDGDMANNQHGWQWTAGCGTDAAPFFRVFNPSTQGAKFDPDGTYVR
RWVPELKGVADVHKMGDDRPADYPAPIVDHAAERAEALRRYAEIS
119868118YP_938070.1 hypothetical protein Mkms_2082 [Mycobacterium sp. KMS]MVTQSLPLDDPNGAARTASAPGPHLEYRLDVLGTDAADLVRYAGGWMFDR
ALAGWRVNAWLLDADDLRPLQVLGVQGHRLEPGARRTDDEHTAGLAVSAN
LAESDADVRAAVRGVLTSGHTEVVLWGGRRPELLGGRAEPVRYRLSAAAR
TFKRHALLAADCREIPVEACESLVCGGYRPVDSDLVRR
119868116YP_938068.1 hypothetical protein Mkms_2080 [Mycobacterium sp. KMS]MLYSETPEIHMHTLKVGILDVSGVSGGYSRELVRSVAAPRLQALRPLRQQ
LVEIPGRLHHPMWVENQTIDLDYHLRHLEIAAPGGRRELDELIGRIASTP
LDRSKPLWEMYVVEGLVGDRVAIVHKVHHVLADGVASANQMSQAISPRGP
QVDDGDPGPHPGHTSRRLLRAAGEDHLRQIGRLPALVRDTAAGVSQVYRK
GRERDTNPDLARNFAPPRSFLNHVVTPARRFATAPLALADAKHLARTLGV
TLNDIVLATASGALRELLLRYDGHADAPLIAGVPIAFNTSPDRLSGNEFS
YMTPSLPVHVDDPLERVRLTSVSTRIAKENHHLLGPTLIASWLNYLPPRL
VPPVFRHQARRRDSSMIMNLTISNVPGPRELGLVAGASVDEIYSVGPLVV
GSGMNITVWSYVDQLSISVLTDDQTLDDPHEATDAMVRSFAEIRTAAGIT
APLTDVPAALPLAAAARS
119868114YP_938066.1 luciferase family protein [Mycobacterium sp. KMS]MSMHFTITHPMHTHPYNPELVTGDGVAAVAVAAEAAGFTGFGFTDHPAPT
QRWLDAGGHDALDPFVAMGYAAARTSTLRLIPNIVVLPYRNPFVVAKSGA
TLDLLSGGRFTLAVGVGYLKREFAALGVDFDERADLFTEALSVIRAVWTS
DEFSFEGRHFTAKGITAHPRPVSTPHPPIWIGGNTAAARARAVAFGDGWC
PFPAPAVLAQTARTAALDSVERLGEAIDDLRRRCDAAGRDPATVDVTFTN
LGGGDPGGADFDPDRYLEGVAALERLGVTWIQVTVPGDSLAHACETIEEF
GRRVIAQR
119868112YP_938064.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDFSVVELSGEDRAFQRELREFLSTVVTDEVLARDRETGENFDEGVHLAL
GEAGYLAADYRSEADGGFSAVRRRIWELEIGRAHTPWFHWGTTAMVAHTV
ERFASSELADEVLPGVLSGRLRLCLGYTEPEGGSDVATCKTRAVREADGS
TWIINGSKMFTSNAHNAHYVFLITNTDPAAPKHKSLTMFLDPLDSPGVEI
QPLRTVDGDRTNITYYSDVRISDRYRVGDVNAGWSVLRGALDVEHGTVER
DAEGLQKIAVMTEHITLMADAVDAIAAALATPDAAGRRPLDDTSVAYRLG
RGIARMEAAMSTPEMFGRVAIAQTMRDVSPDLMDILGAAGALPVDAAGAA
AGGGAEYVFRLAGPTGIYGGTLEVFRNMIAQHALGLGRPHYSAPR
119868110YP_938062.1 alpha/beta hydrolase domain-containing protein [Mycobacterium sp. KMS]MTVSDVAARLDPALLRFAAARTDLSADTLPAVRQSLDGRRAEAAATVDTT
GVEIDDRTARFGHASIGVRIYRGGPSPAPAVVYCHSGAFVLGNLDTDHRQ
CVEFARRAECTVVSVDYRLAPEHRYPAAVDDALTGLRWVVANAVELQVDP
SRVAVAGSSAGGALAALLAQASAAGTAPPVVFQLLHQPVLDDRPTPSQRE
FATTAGFDGPAVEQMWRHYLPPGTEPAGIAPARRADLTGLPPAFVSCSEL
DPLRDEALDYARRLVGAGVATELHLYPGTCHGFDSLLPDWEISRQLFDLQ
GTALRRALHQ
119868108YP_938060.1 hypothetical protein Mkms_2071 [Mycobacterium sp. KMS]MIRIPSPPTSRRIQGVMGALMLIVGAAGTVAPQRLSNTRNSGAGAAERNH
LTQMYAMREAAIGAILLSGGGARSALGAVIGLTAVEVATGVRSPALDRQS
RITTAVTASVFGAAAAYALSGAGPHRGRPQKGH
119868106YP_938058.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MNRVALVTGAARGQGAAIVARLHADGYRVTACDVLIDELRTAVADLGDDV
LAIELDVTSAQQWAAAVADTVERFGALTALVNNAGVLHRAPIADETPAAF
ENSWRVNCLGPFLGIQAVLEHLKAADGAAIVNTCSTGAIRPFPHHAAYGS
AKWALRGLTQVTAAELAVDGIRVNAVFPGPVETPMLDPDTQTRLAARAVL
GRIGKPVEIADAVAFLLSDQASFITGSELVVDGGQTLQIG
119868104YP_938056.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MWAYRLVAPYTFEKLDLPAPSVEGLRDGQVLLRFLSAGICGSDLPGFRGA
KGRLPSDTGVSAAEMNGFPIHEVVGEVAGSRHPAHRRGDLVVGWASGFDG
LMEFVVADGDGLAAYDPALPPHHAVALQPLACVLYAVEQLPDLRGHHVAV
IGQGSIGLLFSYLAKAAGAQHVTGVDPVDRTAVGPAFGVDTVVRATSDRW
VSHLGTDRPDVVIEAVGHQVATLNHAIEAVAFGGTVFYFGVADDDAYPIS
MRLMLRNNLTLKSGVTLERRRMLAAADEFARAHPDLLPAYVTHTFDVDDV
QAAFELACRPTPGRVKIAITR
119868102YP_938054.1 hypothetical protein Mkms_2065 [Mycobacterium sp. KMS]MSRSLGATVNHLRRWRAMKKYYSHTLLYLHETISLGSGRSETFLPAFSAV
YHPMMADLGARLFAIWESTPYNGHWPAVTVIWEIDAFADYARIGKAQRAG
GTHAEAAAEWSRFLAEMGASGEGRIMYAGRSNRTLAELQDAGFGAGLVIQ
EIMQTKPGRQDDYIRELERLYVPWSERTGKRWLGSFITTFRFNEVIHYWA
LDGEWDCFAEHYPSWKDTPPAEIVTWMSVAPALRDGWEDSILQALPPSPL
Q
119868100YP_938052.1 hypothetical protein Mkms_2063 [Mycobacterium sp. KMS]MSDSYYELVGEDSRGERFVATDLVRSTWSAAIQHAAPVSALLVRALERCE
HRDDTRLSRVMVDLLGPVPAEGDLWVSAQRERAGKQIELVSAQMAAPGPD
GSPRPVARASGWRLQTLDTTGVAHAGAPALPPLAEARGRDMAKDWDRNYV
HSLDWRWLTRPLNDGPGESWITPTVDLVKGETMTPLERLFAVADDANGIG
TKLDPRQWTFLNTDLVVHVHRIPDGRWIGIRAETSYGPDGIGTTTGTLFD
QTGPVGAIQQSVLVRPRPPR
119868098YP_938050.1 putative ferredoxin [Mycobacterium sp. KMS]MRVEVDLAKCTGHGICESIAEDVFEVQDDGTVTIHGPERPAADRDRMRQA
VTQCPAAALRLTD
119868096YP_938048.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MTSVTGDGNRTRERILAATAEVLGRNGMTKLSLSQVAAQARVSRPTLYRW
FPSKQDLLSAFVVWERSLYERAVAEAAANLPADQRLDAALRIIVEYQQSY
PGLRMVDIEPAQVIAGLAHILPRMRDRLERGMSGPDAAVAASTAVRVAIS
HYLVRSDDGEDFLAQLRHAAGLT
119868094YP_938046.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MTKTFSMSPAVGLAAHLGRGVQRVATDAVLRGLRPFPRSVGDLDARTLSG
LMERTVTSVSILGGDAGTSSRARLALTGRDVPDTVFVKLPAETAATRLMG
ELGRLGDTEVRFYRQLRPELDGAPAAYASAFDRLTGRYVLVLEDLPADDC
LFPDTLHPLDRDQAALVVELLARLHARFWGRLSAPGQPGPFDWVYTPSAD
HTSMLTGTLLKTSARRIAQNSDIPVQYGSFIDENYRAAARLIDEPPHTIM
HGDAHPGNLYFRNGAAGLLDWQAVRRGHPSRELAYTLVTSLTPADRQDAQ
RDLLDVYRRALAAAGGPDLDREELWHRYRQAALYAYVAALITAGMGGMQN
EDIAYEGLRRGVAALQDLDTVAVLKKSL
119868092YP_938044.1 formate dehydrogenase [Mycobacterium sp. KMS]MSAPTAEHRVTYCRICEPMCGLIATVDDGRLVSLRPDPDHPLSQGRACPK
GIAFTDIQNDPDRVLEPLRRRADGTFEAVSWDEALDDIAARLTTILDRDG
GDAVGQYFGNPAAFGYASSLWAGVFMARIGARHLYSAGSQDINSRFVASK
LLYGAASQLPFPDLLRTEFLLMVGANPLVSHGSAVRAPRIKNDLADIVRR
GGRVVVVDPRRTETAREYEHLAIRPDGDAWLLLSMLQVIFAEGLEDTTAM
AEQSTGGETLRRLCREHTPERTAERTGIPGDIVRMLARDFATAPSATAYG
RTGACLGRHGTLVSFLLDALTLVTGNLDRPGGSLMSRAVIPVEEMGERLG
SFSYDTMRSRIGNHPDVLGTFPAAVMADEITTPGPGQLRALFVVAGNPVL
SVPNGKALESALPQLDLFVSLDLYVNETNRLADYILPGTTMLERDDLPIM
FAACSPTLFVQSTEAVLEPYGQARQEWQVYAELARRMGISLFATGPLERF
NRVLAQLDRFRATRMTPRRMMALLLRFGPYGDRFGLRRGGLNLDRLRARP
HGIVLDEHAPSGILDTVVRHRDGKVRLDPPEIVAEVGRLGARSHDDPRFP
LLAIGIREMRSQNSWMHNSPTLMKGDRRHRTRIHPDDARAAGLVDGGPVR
IVAADGAVESEVLVTDEMRPGTIAIPQGWGHRGGGWTLANSVPGANVNEL
TSNRSADLEALAGMSVLNGVPVRIEAVGTAAAG
119868090YP_938042.1 hypothetical protein Mkms_2053 [Mycobacterium sp. KMS]MTGAADELEIARLLYRYARAVDSKDWELYRSVFTDDAHIDYSSAGAVVGH
RDEVVDWFAANFGVLPWSMHYITNIESDVDGDSATVRAMFYNPMQLPGMD
EVSACGGYYHHELVRTADGWRSRSLREENVWFTNAPARTG
119868088YP_938040.1 phosphatidate cytidylyltransferase [Mycobacterium sp. KMS]MSETPVDEPQKKPSRAGRNLPAAIAVGVALGGGLIAILLFAPYLWLALVA
AAVAVSTYEVSSRLTEAGYRMPMIPLLVGGQATLWLTWPFGPAGALGGFA
ATVVVCMIWRLVGQGLKHTPQNYSRDIAAAVFLATWVPLFASFGALLIYP
EDGANRVFCLMLGVVFSDIGGYVAGVLFGKHTMAPAISPKKSWEGLVGSL
LFGGTAAVLAVVYLLDKPWYAGVALGVMLVITGTLGDLVESQFKRDLGIK
DMSNLLPGHGGMMDRMDGMLPSAVATWIVLTLLA
119868086YP_938038.1 uridylate kinase [Mycobacterium sp. KMS]MNSTAPATPGAPHEAGWVCHLGERPVRRSEEAEGPMSEPNSDHGAGAAVG
ETRPLYSRVLLKLGGEMFGGGAVGLDPDVVHLVARQIAEVVRSGVQVAVV
IGGGNFFRGAQLQQRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIDTRV
QTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRAL
EIGAEVVLMAKAVDGVYTADPRKDPDAQLLTAITHREVIDRGLAVADATA
FSLCMDNGMPILVFNLLVDGNIARAVAGEKIGTLVTT
119868084YP_938036.1 glycerate kinase [Mycobacterium sp. KMS]MKIVLAPDSFKESMSAAQAIAAMRDGVRAALPDAECVGVPMADGGEGTVD
AVVDALDGERVTVEVADALGRPVPATYGYVPGRRLAVIEMAAAAGLELIP
ADERDVLRASTFGVGQLMAYALDRGAAEFLIGLGGSATNDGGAGLLTALG
VELLDGSDAPLPPGGGALADLHRIDTAGLDPRLAGVHIQLACDVTAPLLG
PAGASAVFGPQKGATPADVARLEAALARFAAVADAAHAETPGAGAAGGLG
FALLEFLGATSRPGVEVVAETVGLEQALRGAAWVFTGEGGVDAQTLMGKT
PFGVAQVAARTGTRVVIFAGRVGADASVLLEHGVDEIVGITAPGTPLAEA
LRTGPHSLARAVENFLRRL
119868082YP_938034.1 amino acid permease-associated protein [Mycobacterium sp. KMS]MTAELEASPPPGRDALMTTELVPEQILPKVMSTFGLTAAYVFIICWVTGS
SVMAAGGWTAIPMWVLGILTFLIPAGMAVVELGNLWPGQGGVYIWAYRTM
GETWGFIGGYLSWVPVILNAASSPAVVLQFLLLAFHAELGLTISIILQLV
ILWTVIGLALAKLAANQRIMNIVFVVYGVLTLTIFICGLLYAGKNGSATP
FSWEEATIPNFAVAGFLYGTVLLYLLGVETPYNMGAEFLSVRRSGPRMIL
WGSTALVAIYLLTTLGTMMALPGDEIDPVTGIIGMLDVAGFPGLMEVCAV
VLAFIIIVALMTYQVAYSRLIFVSGLERHLPRIFTHLNPRTRNPVTAILI
QGVISSLILVGLYSQSSMANVTIYLQGGLSTVWLLSGFFFLFPVIIARRK
YADRYVNEQFWRIPGGMVGVWITVVVGTLGTIGGIYYSFVTPWIDVPAAT
WMTWVGGISLGMFALGLVVYIFGRRSAHKMTQDDALAHLAVLDLNKSDTS
PEGV
119868080YP_938032.1 hypothetical protein Mkms_2043 [Mycobacterium sp. KMS]MREEERTIVLRRGLSYGWLSTRRRIRELVLPIVTTATGAFLVVIVFGMSE
GIRAQSASLGHADEINRAVVLIAVSVLLVGVVEVAVATTRTVAHRTRELG
VLGANGIPRLPVVAALLVEPLVAAVIGALAGAALAAVAGIVLGGTGLAAG
GVAASGLLTGAATAVGVSVVAALATSIPPTWAAASRPPIRSLTAGG
119868078YP_938030.1 amidase [Mycobacterium sp. KMS]MTRISAFTDDALGDLDAVGIVEALQQGRVSRAELVEAAIARTEAVDPALN
GVAYEAFDRARARAGGPGSYGGFFDGVPTYVKDNVAVGDMPTMQGTDAWD
PRPAGAHGDFARAYLATGLLALGKTRLSEFGFSASAEHPRLGAVRNPWDT
DHTAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASCNGLVGLKPSRGR
LPLDRDMRQMPLRIVANGVVTRSVRDTAAFYREMERVYRNPKLPPIGDVT
APGRQRLRIAVCTHSIAREAGREVREETMRTAALLEDLGHRVTPIDNPIP
GHFMDDFLLYWAFLSFALVRGGRRTFGASFDRTRLDNLTLGLESHAARNL
HRLPVAIARLARTRRISARLAREYDVVLTPTLAESPPRIGHLDPTADYRQ
IIDRLVDWVAFTPLQNATGDPAISLPLGVSDRGLPIGMMFASTVGREARL
LELAYELEQARPWRRIQDAS
119868076YP_938028.1 30S ribosomal protein S2 [Mycobacterium sp. KMS]MAVVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DKAYEFVKETVAHGGSIMFVGTKKQAQESIAEEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMQKVPSAIWVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDVVDYPI
PGNDDAIRSAALLTKVVASAVAEGLQARAGGGNGNKPEAEAAEPLAEWEQ
ELLAGATASPTAAGAAPGTPEADIQTEPTAPQNP
119868074YP_938026.1 hypothetical protein Mkms_2037 [Mycobacterium sp. KMS]MKSVALVVVGVLVALAGGLFALQGFGFVGGSPMSGTTTWSIAGPVIALVG
IGLVYLGWRAGKSRPQ
119868072YP_938024.1 FMN-dependent alpha-hydroxy acid dehydrogenase [Mycobacterium sp. KMS]MAFGDYQLEIYLQGLSGIMPKLPMTFADWEAKAQSAMPPSVYSYVAGGAG
DERTQRVNRTAFDNWGLVPRMFRATRERDLSVDLFGLSLPAPVFMAPIGV
IGICAQDGHGDLATARAAARTGVPMVVSTLTEDPLEDVAAEFGETPGFFQ
LYTPTDRELAASLVQRAEAAGYKGIIVTLDTWVPGWRPRDLSTSNFPQLR
GRCLANYTSDPVFRAGLAQPPEENPQGAVLKWVSLFGNPLTWDDLPWLRS
LTKLPVILKGICHADDARRAKDEGVDGIYCSNHGGRQANGGLPAIDCLPG
VVEAADGLPVLFDSGIRSGSDIVKALALGATAVGIGRPYAYGLALGGVDG
VVHVLRSLLAEADLTMAVDGYPTLADLTPDTLRRVG
119868070YP_938022.1 DNA protecting protein DprA [Mycobacterium sp. KMS]MNTIETRAWAYLSRVAEPPCPELAALVTDVGPVEAAEKIRRAEVGERLRR
KTEARREHGCAQADLDVLARMGGRLVTAFDDEWPLLNFLKFTGVDTQKRP
QGHPPLVLWAVGPVGMDEVAERAAAIVGTRAATAYGEHVAADLAAGLAMR
DVAVVSGGAFGIDGAAHRATLAGEGVTVAVVAGGIDVPYPAGHSALLARI
RANGLVLSEYPPGSRPTRSRFLTRNRLVAALSGATVVVEAGARSGAANTA
AWAGALGRNVCAVPGPVTSGASVGCHRLLRDGGAILVTRAEEIIELVGRM
GELPPVEAGPATPLDGLTDAERRIYDALPKRGARSADEVAVAAGIPAYQV
VGPLAMLEVAGLVVHEGGRWRMARGR
119868068YP_938020.1 hypothetical protein Mkms_2031 [Mycobacterium sp. KMS]MPSVSVWVRSLAPMTTWTRAAIGALGEDLAVKHLDSLGMRVLERNWRCRY
GELDVIAEDPAARAVVFVEVKTRTTDHFGGVAEAVTPQKVRRLRRLAGLW
LAGRDERWAAVRIDVIGVRIGRQATPEITHLTGVA
119868066YP_938018.1 hypothetical protein Mkms_2029 [Mycobacterium sp. KMS]MSTRPGYGGGTGGGSAGVNGAVNKATNSDAFEYTARAGFAASGVLHLLVG
YIILQIALGSGGNADQSGALATLAGQTGGKIVLWIATIGLIALGLWRLAE
AFIGAKPGEQYGQAQGDNPAWKRAKSVGLAIANFAIAFSALQFATGGGQS
SGQQNSGISAQLMQHGWGKALLILVGLGVIAVGGYHVYKGATKKFLKDLR
VTGGTGINAVGVAGYVAKGLVLAGAGILVIVATLQADPAKASGLDAAVKT
LGQAPFGKFLLIVAAVGIAAFGAYSFVRSRYGRL
119868064YP_938016.1 binding-protein-dependent transport system inner membrane protein [MycMVAAAPPVPPPATPVARSDKNARPGPLVSGTVAILVAATLVPLGYVVWGA
VSIGWDRAYELVVRPRVGELLLNTVALVAVTVPLCVVIGVGVAWLVERTD
LPGRAFWRPLFVAPLAVPAFVNSYAWVGVIPSLHGLWAGVLVTTLSYFPF
MYLPAAATLRRLDPAVEESARALGSHSTGVFFRVVLPQLRLAILGGALLI
AVHLLAEFGAFAMVRFDTFTVAIFQQFQVTFDGAAGSMLAGVLVLLCLTL
LVAEAAARGNARYARIGSGAQRAATPVHLGANIIPAQLTLAALAVLALGV
PVWTILRWLHIGGAEVWAFDDIGEALGQTVALAGIAAVLTTVLAFPVAWV
AVRSSGFLARAVEGANYVTSSLPGIVTALALVTVTIHVVRPLYQSVALIV
FAYVLLFMPRALVNVRAGLAQVPTGLEEASRSLGRSPTVTFLRVTLRLTA
PAAAAGASMVFVAVATELTATLLLAPTGTRTLSMLFWSYASELDYAAAAP
YALVLVLLAVPVTMILLKQSTKGAAQ
119868062YP_938014.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MSRLVDCLRAHGDRIAVLTDSERLSYRDLADLVSGSAARLGDTRRLVMLE
TRNDLPTLVHYLGALAGGHVVLPVPAGRDHRELTATYDPDVVVDGCGPQI
RREGSAHRLHDDLALLLSTSGSTGSPKLVRLSRRNLLSNAHAIADYLDIR
ETDRAATTLPMSYCYGLSVVHSHLLRGAALVLTEHSVVDDEFWTLFRRHG
GTTFAGVPYTFDLLDRAGFDTMDLPHLRYVTQAGGRLAPERVKRYAELGA
ARGWQLIVMYGATEATARMAYLPPDLAAEHPGCIGVPIPGGSFTIEPLDG
WPADDAAGELVYRGDNVMMGYAHTAADLSRGDEVEALHTGDIARRRPDGL
YEVIGRSSRFVKMYGLRIDLQRLETALRARGVPALCTDLDDRLVVAATAP
QRPAEVARLAAEAAGVPSSAVHAVVVADLPVLPTGKPDYPAVRALAAPVD
DAPPTTDLTTVFAEVLHLDRDGIDPDASFVDLGGNSLTYVAMSVRLERAL
GRLPADWQRVPLRDLQTRAVPPRRRWTATLETSVALRAVAIVLIVGSHAA
LFELWGGAHVLLGIAGYNFGRFCLTPAPRAQRVRHLRTTIAWIAVPSVVW
VVIALLVTDDYHLSNLLLANKFLGPHDSMTAGRLWFVEVLVWTLVALAVL
MAVPAADRAERRWPFLFAVVFLAAGLALRYDILGLDLGRDAWFTMLTFWF
FAAGWAAAKATAPWQRVAVTTALVVGLYGYFGNTNREILVLAGFLLLIWL
PALRCPPGLTVIAGVVAEASLYTYLTHFQVYALFEGRPALGVAASIAVGV
LLTQALTLLRRRLRDRRPSVSAATAVPARR
119868060YP_938012.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMPATDPVRPLAGVRIVEISSFVAVPLAGMTLTQLGAEVIRVDPVGGAADY
RRWPVTDAGDSIYWAGLNKGKRSVAVDMRTAEGQELVTRLIVDAGILITN
VAGRQWHSYDTLAAQRPDLIHVEVSGRADGGTAVDYTVNAATGFPLVTGP
PELATPVNHVLPAWDVSCGLYAALAVTTALRHRDASGDGARISIPLENVA
LATAGNLAFLTEAMVTGESRPRVGNSLYGTYGQNFVSCDGAAFMVVALTN
RHFRDLTELTGTAKAVAALGDALGADFTDEGERYRHRDALTGLFTVWFSA
HTADEVASALSGTSVLWERYRSFAEVAGDDRVTTNPLFTELDQPRVGRYL
APGLPIAIDGTYPPAVAAPALGDDTAAVLAEWLGMPSDEIAHLAESGSVA
TGSGGA
119868058YP_938010.1 HAD family hydrolase [Mycobacterium sp. KMS]MRSNTRCWLTDMDGVLVREEHALPGAAEFLARLVERERPFLVLTNNSIFT
PRDLAARLARSGLIVPEEAIWTSALATATFLSDQLPGGSAYVIGEAGLTT
ALHEAGYTLTDVGPDFVVLGETRTYSFEAITKAVRLILGGARFIATNPDV
TGPSAEGPLPATGSVAAMITKATGREPYFVGKPNPMMFRSALNRIEAHSE
GTVMVGDRMDTDVVAGIEAGLETILVLTGSTTIEDVERYPFRPSRVLPSI
AEAIDLV
119868056YP_938008.1 hypothetical protein Mkms_2019 [Mycobacterium sp. KMS]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMVPRN
ANGEVYFELRLADAWVWDMYRPARFVKQVRVITFKDVNIEEVEKPELRLP
E
119868054YP_938006.1 signal peptidase I [Mycobacterium sp. KMS]MTDRPESSSEDAVGSVDPGLEQDAEPHADDQDETPGRKHSALRELAILVT
IAIVLYYVMLTFVARPYLIPSESMEPTLHGCPGCVGDRIMVDKVTYRFSE
PEPGDVIVFKGPPNWNIGYKSIRSDNPAIRLLQNTLSVVGFVPPDENDLV
KRVIAVGGQTVECRAATGLTVDGKRLEEPYLDPKTMMADPAVYPCLGNEF
GPVTVPEDKLWVMGDNRTHSADSRAHCTNLPGDAQRGLLCTGDPEAGTIP
VENVIGKARFIAWPPGRWGGVGSVNPQTAADPNQ
119868052YP_938004.1 hypothetical protein Mkms_2015 [Mycobacterium sp. KMS]MRRPSVLLTATAASVVAAVVVSGCEARVYGTPPAPDGPHLTVVAPQGALA
PLPEAPPDQPPAAFTGLDDRARMATEEAAEAGADITLVVEDRNTGQIVSN
GNNRGIAIASVVKLFIADDLLLSGKPLSPEDVKNFQSMLRSSDDSAAEVF
WNRGGGSDIVTRVAQRYGLSGTRPPGDGRWWNTISTAADLVRYYDMLLSG
AGGLPRDKAGMIIANLAASTPDGIDGTQPGGVYPQRFGIPEGLYAVPVAV
KQGWMCCVGSDWMHLSTGVIGADRRYIVVIGSDQPAGAAEARATITQAVK
TLFPGGRI
119868050YP_938002.1 16S rRNA-processing protein RimM [Mycobacterium sp. KMS]MDLVIGRVAKAHGVTGELVVEVRTDDPDARFVPGARLRGRAPRGGAERAF
VVESVRPHGGRLLLRLDGVADRTAADALRGTVFLVDSADLPPIEEPDEYY
DHQLEGLLVRTVDGVDVGTVAEVLHTAAGELLSVKTPEGAEILVPFVTAI
VPRVSLADGLVEIDPPEGLLDLE
119868048YP_938000.1 30S ribosomal protein S16 [Mycobacterium sp. KMS]MAVKIKLTRLGKIRNPQYRIVVADARTRRDGRSIEVIGRYHPKEEPSLIE
LNSERAQYWLGVGAQPTEPVLQLLKITGDWQKFKGLPGAEGTLKVKEPKP
SKLDLFNAALAEAEGGPSNEATQPKKKKAPAKKAASDIEATADPAGNADK
SEPAAEGEDATVAGATEG
119868046YP_937998.1 hypothetical protein Mkms_2009 [Mycobacterium sp. KMS]MFNRAMLSLAEISDRLEIQQLMVDYSSAIDQRRFDDLDRVFTPDAYIDYR
ATGGVDGSYPEVKKWLAEVLPNFPAYSHLVGNFDVRVSGDTATSRAICFN
PMVMGEQVYFVGIWYVDEFVRTAEGWRMTRRVEEKCFDKLV
119868044YP_937996.1 peptidase S11- D-alanyl-D-alanine carboxypeptidase 1 [Mycobacterium spMTMSSVGVVTRTPAALAQPQPAGAVALPEGPAQAWLLADLDSGRVLASRN
PYEPHAPASTIKVLLAMVVLDHLSPDNFARANRSHTEVECSCVGLTPGQP
YTTRQLLSALLMVSGNDAANMLADMLGGQRAAVAAMNRKAALVGAKSTRA
SSPSGLDGPGWESITTPHDLAVMLRAALKYPLIAQIMRSPTAPFPGKTLT
NQNELLSRYPGDIAGKTGFTNLARKTYVGAAQRGNRRLAVVQMYGTGDLY
GQAIGLFDYGFSQP
119868042YP_937994.1 signal recognition particle subunit FFH/SRP54 (srp54) [Mycobacterium sMFESLSDRLTGALQGLRNKGRLTDADIDATAREIRLALLEADVSLPVVRA
FVARIKERAKGAEVSAALNPAQQVVKIVNEELIGILGGETRPLVFAKTPP
TVIMLAGLQGSGKTTLAGKLAKWLRGQGHTPLLVACDLQRPGAVNQLQIV
GERAGVSVFAPHPGTAPGAPEVKGTADPVAVAAAGLAEAKAKHFDVVVVD
TAGRLGIDEELMNQAAAIRDAVDPDEVLFVLDAMIGQDAVTTAEAFREGV
GFTGVVLTKLDGDARGGAALSVREVTGVPILFASSGEKLEDFDVFHPDRM
ASRILGMGDVLSLIEAAEQHFDAEQAEATAAKIGSGELTLEDFLEQMLAI
RKMGPIGNLLGMLPGAGQMKDALAAVDDSQLDRVQAIIRGMTPAERADPK
IINASRRLRIANGSGVSVSEVNQLVDRFFEARKMMSQMAGQMGMPFGRGK
NTRKNAKGKGKKGKKAGRGPTPPKNRNPLGAGMPGMPAGFPDLSNMPKGL
DELPPGLADFDLSKLKFPKN
119868040YP_937992.1 nitrogen regulatory protein P-II [Mycobacterium sp. KMS]MKLITAIVKPFTLEDVKTGLEQTGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVIVDDSAVDKVVDVIVQAARTGKIGDGKVWVSPVDTVV
RVRTGERGADAL
119868038YP_937990.1 signal recognition particle-docking protein FtsY [Mycobacterium sp. KMMTLDLSLAVWIAIAVIAVLLVVALVVGLVRYRRRRIRLSKTDTATPVDRS
GGYTASSGITFTQSSATATPPAAPPVRPKDRIDTSGLPAVGDDATIPRDA
PKRPIADVRLPEPPTETAPPRAPERPVAEPEPAPEPEPTPEPIPEPEPAP
EPEPEPAEVIAPTHGRLDRLRGRLAKSQNALGRSMLGLLGGGDLDEESWE
EIEDTLLIADLGPVVTESVVAALRTRMASDAVRTEADARAVLRDVLISEL
HPEMDRSIRALPHADKPSVLLVVGVNGTGKTTTVGKLARVLVADGRRVVL
GAADTFRAAAADQLQTWASRVGAEVVRGPEGADPASVAFDAVSKGIENGA
DVVAIDTAGRLHTKTGLMDELGKVKRVVEKRAAVDEVLLVLDATIGQNSL
PQARVFAEVVKITGVVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPD
DLAPFEPGAFVDALLG
119868036YP_937988.1 condensin subunit Smc [Mycobacterium sp. KMS]MHLKSLTLKGFKSFAAPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
HSAKTLRGGKMEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYSEVSI
TRRMFRDGGSEYEINGSHCRLMDVQELLSDSGIGREMHVIVGQGKLSEIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMQANLARLTDLTTELRR
QLKPLGRQAEMARRAQTIQADLRDARLRLAADDLVTRRSEFDSTHQTETM
LRREHDEITTRLEAATAELDGHEVAVAELSEHAEAAQRTWFRLSALAERV
NATVRIADERTQLLDTEPEPSTGRDPDELEAEADHTAAHEAELLAELAES
RAVLEATRDELAERERVAAEAERAHMAAARAEADRREGLARLAGQVDTMR
TRVESIDETVARLTVGIEEAAAKAEAAQAEFETVQSRVGELDEGEVGLDE
HHDRTVAALRQADERVAELQTAERAAERQVASLRARIDALAVGLDRRDGA
AWLQQNRGGAGLFGSIAELVKVRPGHEVAVAAVLGAAADALAAEDSGAAR
AAVAALKESDGGRAALVLGDWPETPAGDLPALPAGAVWAVDVVDIPPRLR
GAVTAMLSDVAIVGDLAAALDVVTGRPGLRAATADGDLVGAGWISGGSDR
KPSTLEIASEIDKARTDLEAAEKQVGELAAALSGAQAEQRARQDAAEHAL
AALNESDAAISSIYEQLGRLGQDARAAAEEYQRLIRQRDELEAGRTRTVE
ELTELETRLHNAQQAPMFEAEPVDRQASMAAAEAARAAEVEARLSVRTAE
ERANAVRGRADSLRRAAAAEREARVRAQRAKQAREHAAAVAGAVAESGRQ
VAVRLSAVVAAASRNRDTLAAERRQRAEALSKAREEVNELGTRLTALTDS
LHRDEVAKAQAALRIEQLEATVLEQFGMAPADLIAEYGPHIALPPTDLEM
AEYEQAKERGEQVVAPAPMPYDRGTQERRAKLAEKELKELGRVNPLALEE
FAALEERYNFLSTQLEDVKAARKDLLDVIADVDDRILQVFTEAYADVERE
FTQVFATLFPGGEGRLLLTDPDDMLTTGIEVEARPPGKKIKRLSLLSGGE
KSLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLISLFEQLRERSQ
LIVITHQKATMEVADALYGVTMQGDGITQVISQRLRGQELVGTQS
119868034YP_937986.1 OsmC family protein [Mycobacterium sp. KMS]MGAMTDLWVERTGVRRYTGRSSRGAEVLVGSEDVEGVFTPGELMKIALAA
CSGMSSDQPLRRRLGDDYPATIRVAGPADREQERYPLLEESLEIDLTGLS
DAEVARLLTVVERAIDQVCTVGRTLKSGTKVTFEVKNVGRA
119868032YP_937984.1 ribonuclease III [Mycobacterium sp. KMS]MTLDRSPLLAALGVTLPDDLLTIALTHRSYSYEHGGLPTNERLEFLGDSV
LGLTITEELFHRHPDRSEGDLAKLRASIVNTGALADVGRKLSDDGLGSYL
LLGKGEESSGGADKSSILADGVESLLGAIYVQHGLTVTREVILRLFAGLL
DTAPTLGAGLDWKSSLQELTAARGLGAPHYVVTSTGPDHDKEFTATVLVT
DIEYGRGVGRTKKEAELKAAAAAWTALSATDVDA
119868030YP_937982.1 hypothetical protein Mkms_1993 [Mycobacterium sp. KMS]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDSMLRDAKEHSESMVTNARAEAESMVNHARAEADRLLADAK
AQADRMVGEARQHSERMVGEAREEASRVMATAKREYDASTGRAKSEADRL
IESGNLAYEKAVQEGIKEQQRLVSQTEIVSTATAEATRLIDTAHAEADRL
RGECDIYVDSKLAEFEDFLNGTLRSVGRGRHQLRTAAGTHDYAAR
119868028YP_937980.1 phosphopantetheine adenylyltransferase [Mycobacterium sp. KMS]MSGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAVLVNPNKKGMFTLDER
MEMIAESCAHLPNLRVESGQGLVVDFVRARGYSAIVKGLRSSTDFEYELQ
MAQMNKHVAGVDTFFIASAPSYSFVSSSLAKEVATLGGDVSALLPDAVNV
RLQAKLRG
119868026YP_937978.1 pyruvate carboxylase [Mycobacterium sp. KMS]MISKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQ
IGEMGHPVRAYLSVDEIIRVAKHAGADAVYPGYGFLSENPELAAACAEAG
ITFIGPRAELLELTGNKSRAIEAARAAGLPVLRSSAPSSSVDELVAAAAD
MEFPVFVKAVSGGGGRGMRRVTDPDALAEAIEAASREAESAFGDPMVYLE
QAVVNPRHIEVQILADRQGDIMHLFERDCSVQRRHQKVIELAPAPNLDPE
LRRRICADAVAFAREIGYSYAGTVEFLLDERGRHVFIEMNPRIQVEHTVT
EEITDVDLVASQMRIADGETLADLGLSQEKLAAPRGFAMQCRITTEDPAN
GFRPDTGRITGYRSPGGAGIRLDGGTVLGAEISAHFDSMLVKLTCRGRDF
STAVSRARRALAEFRVRGVSTNIPFLQAVVNDPDFRAGRVTTSFIDERPY
LLTSRTPADRGTKILNYLADVTVNQPHGPRPSTVYPQDKLPQIDHTTPPP
AGSKQKLVELGPEGFARWMRDSPAVGLTDTTFRDAHQSLLATRIRTTGLL
MVAPHIARMTPELLSLECWGGATYDVALRFLKEDPWERLAALREAVPNIC
LQMLLRGRNTVGYTPYPETVTTAFVEEATATGIDIYRIFDALNNVESMRP
AIDAVRQTGTAVAEVAMSYTGDLSNPAENLYTLDYYLRLAEQIVEAGAHV
LAIKDMAGLLRPQAAAKLVGALRSRFDLPVHVHTHDTPGGQLATYLAAWQ
AGASAVDGAAAPLAGTTSQPALSSIVAAAAHTEYDTGVSLEAVCELEPYW
EALRKVYAPFDVAASGPPTPTGRVYRHEIPGGQLSNLRQQAIALGLGDRF
EEIEEAYAAADRILGRLVKVTPSSKVVGDLALALVGAGITADEFAEDPAR
FDIPDSVIGFLRGELGDPPGGWPEPLRSKALAGRAPAKPVEELSAEDEAV
LAQPGVKRQAALNRLLFPGPTKEFEAHRETYGDTSRLSANQFFYGLRHGD
EHRVVLERGVELLIGLEAVSDPDERGMRTVMCILNGQLRPVLVRDHSVAS
DVPTAEKADRANPDHIAAPFAGVVTVGVEVGDTVSAGETIATIEAMKMEA
AITAPKAGTVERVAVSATAQVEGGDLLVVVS
119868024YP_937976.1 hypothetical protein Mkms_1987 [Mycobacterium sp. KMS]MATKPKKTPRYDLKAADRKRNLFVQIGLTAVVVVFAVALVLYIVMSAEDK
PGSGEATAVRVAAENVVTQEGTSEPKAVLSLYEDFLCPACGNFERQFGPT
INKLIDTGAVAADYYMVSILDAQGDGYSSRAGSAAYCVADENKDAFRRFH
AALYTEGIQPAEGGGTYPGDEQLTELARQAGAGGTVPECIKKGRYVDMVK
GMASATEIRATPTVRINGEDYDPSTPDALVAKIKEIVGDVPGLDGAAPAP
TS
119868022YP_937974.1 2-5-didehydrogluconate reductase [Mycobacterium sp. KMS]MGAPLVALNDGNSIPQVGLGVWQTPPEDTERAVAAALAAGYRHVDTAAAY
GNEEQTGRAIAQSGLDRSQVYLVTKLWNSEQGYDATLAAFEASVDRLGVD
YLDLYLIHWPVPEKNLFVDTFKAFARLREDGRIRSIGVSNFEPEHLRVLI
DSTGIVPAVNQIELHPLLPQRELRELHAQLGIATEAWSPLGQGSLLAHPT
VTGVAESHGKTAAQALIRWHMQLGNIVIPKSVNPQRIESNFDVFDFELSE
QDMASISSLEDGSRLGPDPKTFNFTG
119868020YP_937972.1 hypothetical protein Mkms_1983 [Mycobacterium sp. KMS]MNRSRSVWVVLAAVLALLVAYQTVSSTAERSAQFIADADVPTVAPGVDVL
AGVATVPARIRGHDYRRAAFGDAWTDDNSAPGGHNGCDTRNDILDRDLVD
KTYVSISRCPTAVATGVLHDPYTNIVISFTRGNQTGAAVQIEHIVPLAYA
WDQGARAWTDEMRVRFANDPANLLAVQGEANQDKGDQEPALWMPPNTAFH
CQYAMQFIAVLRGYGLPVDAPSVPALRRAADSCPRG
119868018YP_937970.1 Dak phosphatase [Mycobacterium sp. KMS]MAAGRLDATVLRDWAHAAVEDLISHTDEINGLNVFPVPDADTGTNMLFTM
RSAWSRAQDCVGDVAEVSAALAAGALHGARGNSGVILSQILRGFAEVTAG
AAARGGGTLPEVDGALFAAALRHAVDLVEAALDTQPGTIVSVLGAAAHAA
DAQASGTAASGLPEVVVAAADAAAIALDETPGQLDVLADAGVVDAGGRGL
LVLLDALTRTLGGHAPRRPSYRPAAPPARRAAGAAPQFEVMYLLGGCDAD
GVEVLRRRLEGLGDSIVIAAAGGSGIPGQYSVHVHSDDAGGAVEAGLAVG
VPTRIQITALAATATTRPQGSWSRERAVLAVVDGPGAAELFAGEGAHVLL
AEPDAPVTAKQLLRGLVDTGAGQVMVLPNGYVAAEELVAGCTAATGWGID
VVPVPAGSMVQGLAALAVHDPARHAVDDGYTMARAAAAARHGAVRVATEE
ALTWAGACRPGDGLGISGDEVLIVGPDVTAAASGLIDLLLLSGGELVTVL
TGHGADGAVGTDIGAALREHVHHRHLGTELVTYHTGHRGDVLLIGVE
119868016YP_937968.1 uracil-DNA glycosylase [Mycobacterium sp. KMS]MTARALSELVDQGWAQALEPVREQVAQMGEFLRAELAAGHRYLPAGANVL
RAFSFPFDQVRVLIVGQDPYPTPGHAVGLSFSVDPEVRPLPRSLANIFTE
YTADLGYPQPSNGDLSPWAQRGVLLLNRVLTVRPGTPASHRGKGWEAVTE
CAIRALVARDTPMVAVLWGRDAATLKPMLTGSACVAIESPHPSPLSASRG
FFGSRPFSRANELLTQMGAEPIDWRLP
119868014YP_937966.1 AsnC family transcriptional regulator [Mycobacterium sp. KMS]MLIQTEVGRAEVVAARLAELPGVRTAEYVTGPYDVVVRVGADNLEELRSG
VVPSVQRVDGITRTLTCPIANGAHP
119868012YP_937964.1 D-alanyl-alanine synthetase A [Mycobacterium sp. KMS]MIARNQRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFDVVAVGITPD
GSWVLTDGRPETLAITDGRLPEVSAESGTALALPADPGRRGELVSLSPAA
AGEVLAAVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDK
EFTKKLLVAEGLPVGDHVVLRPGRANVTLDERERLGLPVFVKPARGGSSI
GVSRVSDWAELPAAIEAARRHDPKVIVEAGIAGRELECGVLEYPDGRVDA
STIGEIRVAGVRGREDGFYDFATKYLDDGAELDVPAKVEDDVADEIRRLA
IRAFRAIDCQGLARVDFFLTDDGPVVNEINTMPGFTTISMYPRMWAASGV
DYPTLLAAMVDTAVARGTGLR
119868010YP_937962.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Mycobacterium spMVKAAVMGSGAWGTALAKVLADAGNSVTLWARRPEVAAEINDTHRNSGYL
DEVDLPKTIHATADAAEALAGACTVVFAVPAQSLRSNLEQWKGLIADDAT
LVSLAKGIELDTLMRMSQVIVQVTGADPARVAVVTGPNLASEIADEQPAA
TVVACSDSGRAVALQRALATGYLRPYTNADVVGAEIGGACKNVIALACGM
AVGVGLGENTVAAIITRGLAEIMRLGIALGAKPATLAGLAGVGDLVATCT
SVQSRNRTFGERLGRGGTMESALRAAGGHVAEGVTSCRSVLALAASYDVE
MPLTDAVNRVCHKGLSVDEAVVLLLGRSTKPE
119868008YP_937960.1 polyphosphate kinase [Mycobacterium sp. KMS]MNISHTRWQDDAAMGEDRAMTEAEAAIRAEGTAESTERTPGDSTPEAPPA
ATSPAIDNALPEDRYLNRELSWLDFNARVLALAADPSLPLLERAKFLAIF
ASNLDEFYMVRVAGLKRRDEMGLSVRSADGLSPREQLRRISERTQQIASR
HARVFLDAVRPALADEGIVIVTWSELDEAERAQLSTYFHEQVFPVLTPLA
VDPAHPFPFVSGLSLNLAITVRHPDDGGQHFARIKVPDNVDRFVRLGVRG
QTGEVVRFLPMEELIAAFLPVLFPGLEIVEHHAFRITRNADFEVEEDRDE
DLLQALERELARRRFGSPVRLEVSDDMTESMLELLLRELDVDPGDVVEVP
GLLDLSALWQIYAVDRPALKDRPFVPATPPAFGERETPKSIFSTLRDGDV
LVHHPYDSFSTTVQRFIEQAAADPNVLAIKQTLYRTSGDSPIVNALIDAA
EAGKQVVALVEIKARFDEQANIKWARALEQAGVHVVYGLIGLKTHCKTAL
VVRREGSMIRRYCHIGTGNYNPKTARLYEDVGLLTAAPDIGADLTDLFNS
LTGYSRKVAYRNLLVAPYGVRRGIIERIEREVAAARDGAEGRIRLKANAL
VDEQVIDALYRASQAGVRVEVVVRGICALRPGAPGFSDNIVVRSILGRFL
EHSRVIHFRAIDEYWIGSADMMHRNLDRRVEVMAQVKDPRLTTQLNDVFE
SAMDPATRCWELGPDGHWSASPREGETVRDHQVSMMHRHRQP
119868006YP_937958.1 nucleoid protein Hbs [Mycobacterium sp. KMS]MNKAELIDALTTKMGTDRRQATEAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAIVSGAQKLASEGP
AVKRGVAAGPAKRAAKKAPAKKTAAKKTTAAAKKTAPAKKSTAAAKKTAP
AKKTAAKKTTAAAKKTAPAKKSTAAAKKTAPAKKAATKAPAKKAAAKAPA
KKATAAKKTASKAPARKAPAKKGRK
119868004YP_937956.1 isopropylmalate isomerase large subunit [Mycobacterium sp. KMS]MAQPATPRTMAEKVWADHVVAHGIGEGAAREPDLIYIDLHLVHEVTSPQA
FDGLRLANRPVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
AEFGIRLHPMGDAEQGIVHIIGPQLGLTQPGMTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFRTMAVNVDGELPPGVSAKDIILAVIAK
IGTGGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMVAPDDTTF
EFLRGRPHAPTGADWDAAVEAWRQLRTDPGAEFDTEVHLDAAELSPFVTW
GTNPGQGVPLSGAVPDPELIVDEGERQAAEKALTYMGLQAGTAMRDVAVD
TVFVGSCTNGRIEDLRVVADVLRGRRVADGIRMLVVPGSMRVRAQAESEG
LDRIFIDAGAEWRQAGCSMCLGMNPDQLSPGQRCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSSPADLSAVPAR
119868002YP_937954.1 glutamyl-tRNA synthetase [Mycobacterium sp. KMS]MNDMAVRVRFCPSPTGTPHVGLIRTALFNWAYARHTGGTFVFRIEDTDSA
RDSEESYQAILDALNWLGLDYDEGPEIGGPYAPYRQSQRRDLYRDVIDRL
IAAGEAYEAYSTAEEVEARHLAAGRNPKLGYDNFDRDLTDEQRAAHRAEG
RNPVIRLRMPERDITWRDLVRGETTFGAGTMPDFALTRGNGEPLYTLVNP
VDDALMKITHVLRGEDLLPSTPRQIALYEALIRIGVADGVPEFAHLPSVL
GDGNKKLSKRDPQSNLFLHRDRGFIPEGLLNYLALLGWGIADDRDVFSLD
EMVAAFDVVDVNSNPARFDQKKADALNAEHIRLLSEDEFTARLKAYFAAH
GHDTGLDDAQFAEAARLVQTRIVVLGDAWGLLKFLDEGAFVLDEKAAAKE
LKADAVPVLDAALAGLEGVGQWTTGAIEEALKKALLEDLELKPRKAFGPI
RVAATGASVSPPLFESLELLGRDRSLARLRAGRDHAAAAA
119868000YP_937952.1 secretory lipase [Mycobacterium sp. KMS]MTLRTVGAVALLVGALTMPAPMAQASSPVPDWSGLDARIYTEDIPAPGTL
IRDVALAPQLSVRGAGAAYRILYATRDQHDAPAVSTAAVFLPHGEPPHGG
WPTVAWAHGTVGLGDDCTPSALPRSDRDNEYLTHWLDQGYAVVATDYAGL
GTPGLMSYLNSVSTARAVVDSVVAAHGFGLPLSPAWAIVGQSQGGAAAVS
SARWATEFSSGTGLDYRGVVATGTPAGIEQVVKRAAPDMALPPELGPAAN
SYAAYILAAFREARPDLDVDSVLSPQGLEAATLAETLCKPALDEALAGQT
PSEFLRAPLVSLPGAAQALEAYMGTPVSGYDRPIFLGVGLLDRDVPPSST
LSLYDQLGANGQDVTLRVYPDQDHSGTVLASLPDSTPFLRTALAGGADG
119867998YP_937950.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MTAAVEDGVGYLVKRVQQSLRRRCDAALRETGLSMSQYAVLRALADHPQA
SAAELARLCFVTRQSLQDVSTALRSAGLIDHAQVAARGRARALTLTTTGR
RRLAAAHGAVTAVEAQMLTGLSSAESRRLSGLLAACAANLEGE
119867996YP_937948.1 amidohydrolase [Mycobacterium sp. KMS]MKPLLLHHATLIDGTGAAPLPDAAVLVENDRIRWAGAASDAPTDDATPVD
LGGNTICPGFFDCHVHFSLPGAGATPIDRALNPPSYHYFQLIDRLRVTLH
NGVTTARDLMGIDAGVRDAVAHGLVDGPRLLVAINMMSQTCGHADFHLPS
GIDLTPMVGGSLVDTVDEARRRTRELIAAGADVIKVASSGGVSSPSDQPE
WLGMRRELIAAVVEEAAAYGHKRVAAHAIGRAGIEAAVEAGVSSVEHGYQ
LDEGLRHKMVEAGIFLVPTLLETMADVTSSPAGQAKSAHWHAVAQESIGA
SAAAGVKIAVGTDAGLSPAHGTNLKELGLLVRFGGLTPMQAIVAATSTSA
ELCGLAEQLGTVEAGKLADLVIVRGDPLADIDSVGEPDNILLVLKEGRAA
IDRAGFLTA
119867994YP_937946.1 3-isopropylmalate dehydrogenase [Mycobacterium sp. KMS]MNLAIIAGDGIGPEVIGEAVKVLDAVLPEVEKTTYDLGARRYHATGEILP
DSVLEELKVHDAILLGAIGDPSVPSGVLERGLLLRIRFALDHHINLRPAK
LYSGVTGPLAGNPEIDFVVVREGTEGPYTGTGGAIRVGTPHEVATEVSLN
TAFGVRRVVEDAFRRAQQRRKHLTLVHKNNVLTFAGALWWRTVQEVGAEY
PDVEIAYQHVDSAMIHIVTDPGRFDVIVTDNLFGDIVTDLAAAVCGGIGL
AASGNIDATRTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLAHVGE
TDAAARVDKAVEAHLSSRGDQELGTAAVGDRIVGLL
119867992YP_937944.1 hypothetical protein Mkms_1955 [Mycobacterium sp. KMS]MIGAGRSAATGEVIGVDVTVVGSGPNGLAAAVICARAGLSVRVIEGQPTP
GGGARSAADPEFPDVLHDVCSAVHPLSVASPFFAEFDLAARGVDLISPEV
SYANPLPGRPAAVAYRSLDRTCAELDHGESWRRLFGPLVEHVDGVLGFFL
GDKRSLPPDLPTTVRTGLRVLAQGSPLWGSLRGEDARALFTGVGVHAIKA
IPSPVNSGAGLMLGTVAHTAGWPVPVGGTQRISDALIADLQAHGGELVLG
EPVTAPPAGVTLYDTAPTALLAIYGDAVPPRYARALRHYRYGPGVCKVDF
VLSGEIPWRDPRVRDAVTVHMGGSRAQMALAERDVAAGRHAEWPMVLASL
PHLADPSRIDAQGRRPLWTYAHVPSGSDADLTETVTAMFERAAPGFRDLV
VGARCVPAAQMSLHNANYVGGDIIVGGATLFAAMAGPTLRLDPWTTPIPG
AYLCSSATPPGTGVHGMAGYYAARTMLRREFGIEKLPSLAP
119867990YP_937942.1 acetolactate synthase 3 regulatory subunit [Mycobacterium sp. KMS]MATTGNVRTHTLSVLVEDKPGVLARVASLFSRRGFNIQSLAVGATEQKNM
SRMTIVVSVEEAPLEQITKQLNKLINVIKIVEQDEDNSVARELALIKVRA
DATTRGQVIEAVNLFRAKVVDVSTESLTVEATGTQEKLDALLRVLEPYGV
RELVQSGVVSLSRGPRGIGTVK
119867988YP_937940.1 low molecular weight protein antigen 6 (CFP-6) [Mycobacterium sp. KMS]MSSSDPSATTAPVVIRIPRTAHLAVGFFTLGLLSIVLANPRWFAVLLVIP
VVASVFIMRLRTVADRDTVTARNLLGSQTVSWDEIEGLRFSKANWARATR
KDGSEMRLPAVTFSNLPQLTAASGGRVPNPYR
119867986YP_937938.1 protein LppZ [Mycobacterium sp. KMS]MPGDRRGALRRRIRNLASMRTRRPLLGVAALLCATALFGSGCARFDGAQS
QPFTTEPELRPGPTSSEPPPPPLPAKPFPKACPAPGVMQGCLESTSGLIM
LPDSQSALVAERTTGAVKEVSVRAEPKVKTTIPVDPSGDGGLMDIVLSPT
YSQDRLMYAYVSTPTDNRVVRIADGDVPKPILTGIPKGATGNTGSLIFTS
PTTLLVQTGDAGNPGAAADPASQAGKVLRIEQPTTVNQAPTTTAMSGMGS
GGAMCIDPSDGALYVTDRTPTGDRLQKMTKDSKISTVWTWPDRPGVAGCA
ALDGTVLVNLVNTKQTVAVRQAPDTGAVTGQPEVIRQDTRGHAWALALSA
DGNVWGATVNKTAGDAERLDDVVFPLFPQGGGFPRSNADNT
119867984YP_937936.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MSELDLESLRTRLAAAGVCDVRPLTGGASSLTFRATRGDRPVVVKVAPPG
HAPVGHRDVLRQARIIEALAATDVPVPEVLCTDPGAPPEIPPLFVMSLVE
GESFEPLFDTDAAREDTDGARKDTVPERFRSAARVLAALHRTPPAGLGLT
GEPVGDAVAEVDRWSATLRTVDPALVPGWTAVREALVATAPAPVRPGVVH
GDYRLGNLVASGTAITAVIDWEIWSVGDPRIDLGWFLVNADPDTYRRPTP
YVDAVPPVAELASRYTDAVGAPMPELPWFMALACFKSAATWSLIVKHNRR
KSTPRAELEAMAPILPHLLERSTTLLG
119867982YP_937934.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MTDTVTATTPSPGVVLLHLNRPDRLNAINSAMVADLAATLAAVRADTATR
AVVLTGTGRGFCSGLDVRDFGDGMLEADAPALDRMRFQEAMAALPQALRA
LPQPVVAAVNGPCVGAGMALCLAADIRICSSAATFGNAAILLGLSGAEMG
MSYHLPRIVGTSVAADWMLTGRTVSAGEADRRGLVSELVDPEVLVDRAVE
LAALVAGLSPFGVQLTKRALQVNTDAPALAAALELENRNQVLAHATDEAA
ARRQPWTAK
119867980YP_937932.1 hypothetical protein Mkms_1943 [Mycobacterium sp. KMS]MSERLHAQDLLARAEAATGLYDYGDPTLPARFGIAVDHLNGQGMDAEGVQ
RAAQVCHWLLTSRLEFFADRDRYPIGDEVIERPMFVTGEPRSGTTLMHAL
MSVDPDARALRFWEVMYPSPPPGLAGPDDTRRTRADADWREINAKMPKWL
HSHPYNDMLGDGLPEDERTWAFDFRVMTPTAWWRVPMQTVVGGLPTDPAA
QYRIHQAMLQQCQYRRPPKRWVLKGFHGFRLTEFFAGYPDASLIWLHRDP
VQVAASRTMMMADILDGIVGPIDLKAAAKMHLDLTRASIANTMSHPLVDD
PRIQHVRYTDFVADPVGTVRAYYAFCGHALTEAAESAMRGYLAHNRGDRY
GKFRYSTSLLTDIGEDIDALNEEFRPFRERFGVAIEKRD
119867978YP_937930.1 hypothetical protein Mkms_1941 [Mycobacterium sp. KMS]MAFGDGPDDTALDAAWAAFCDRLKAAGAQAFKDHNATSGAQRVDALRFLT
QNLGQAFDLALETADTRYPIVHAFCTPLRKLGGDSADFTYHQAWIDGTHT
YRLTGNRGGAPFFNITVQGPRGSGPGVLHEPFGDVPEVNLSGSQLATAAG
GDFELYIGGPERGPNWLPTTPGSRKLFIRQGFDRWDDRPAELRIERVDMA
APRPLPTPAEMVAAIDWAGDFVEGVMRDWPDYPFTYGGVDAAHPNRFPAV
DSDTGDDKRGRAAANMFWELGADEALIIEFDAHEGLWMLTNMGVFFNSMD
YLYRPVSYTPSRTVTDGDGRIRIVLAHDDPGCHNWLDTQGFSRGNVTYRH
MLAGKPAVLHTRLVARSDLADALPSDTATVTGEQRVAQMWARFNGIRRRH
RM
119867976YP_937928.1 cutinase [Mycobacterium sp. KMS]MKISRVWNIAIAAAAVGSGVAAGGVLSAPSAAAEPCPDVEVIFARGTTEA
PGVGWAGQEFVDALQSQMGGRSVQVHPVAYPASPDWPRAADGVIDTSNRV
REVVATCPDTKMVLGGYSQGAAVMGYVTADQIPPGYIPPAGITGPMAPEI
ADHVAAVVLFGKPSTRFLDAISAPPITIGSLYADKTLSQCIPDDPVCTAD
GANLFAHSQYGANGMIDQAATFAVDRLGDVEAQPKNSAASS
119867974YP_937926.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium sp. KMSSTELIREDAATLAGRIAAKEISSTELTQACLDQIAATDDRYHAFLHVA
GNRALAAAARVDAAVAEGERLPSPLAGVPVALKDVFTTTDMPTTCGSKIL
EGWRSPYDATVTFRLRAAGLPILGKTNMDEFAMGSSTENSAYGPTRNPWD
VDRVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYG
TVSRYGLIACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVPAEVP
DVVAAARAGASGDLNGVRVGVVKQLRGEGYQPGVLASFTAAVEQLTALGA
DVVEVDCPNFDHSLAAYYLILPSEVSSNLARFDAMRFGMRVGDDGTHSAE
EVMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIAGDLD
AAYEKVDVLVTPATPSTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMS
VPSGLSPDDNLPVGLQIMAPALADDRLYRVGAAYEAARGPLPTAL
119867972YP_937924.1 amino acid-binding ACT domain-containing protein [Mycobacterium sp. KMMVAVPSYLLRVQVEDRPGRLGALAVALGSVGADILSLDVVERVAGYAIDD
LVVDLPAGTMPDRLITAAESLTGVYVDTIRPHTGLLEAHRELELIDHIAA
AKGKAAKLQTLVDEAPRVLRVGWCTVVQDDGSGLQRVVGSHGAPETQAQS
APWLPLAHAEALDASADWVPQLWRDMDTTLAAAPLGDAGTAVVLGRPGGP
AFRPSEVARLGYLAGIVNTILR
119867970YP_937922.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMRRFPRVAQKPITTGQDVVDYLEAQHEAIRQLFVETLDAADAETKREKFT
RLRTMLAVHETAEEMMVHPRVRRKIEGAGAVVDARLAEEHDSKIALSELE
KLDIDTADFTKGLIHLQAAVLEHAEKEEAEEFPLLTEHLEAEELERLAVA
VQVAERIAPTHPHAGVESATANFALGPFASLIDRARDALRGAA
119867968YP_937920.1 hypothetical protein Mkms_1931 [Mycobacterium sp. KMS]MPFHQLAVAPADVDGAALGLALNAPAPVPLAGIRLSHRRGGALVLGVLGA
SHVVTIEHPAGGFSEEVSCSAHAYGRTLPGRFEGPGYRFESETTVCAATE
FETLAQRLHERCLTDRNSLGGRFPGDDAALTVLQARPDGPGWWWQTWHLY
PGGPRVPGGTAVHTTSRWHP
119867966YP_937918.1 hypothetical protein Mkms_1929 [Mycobacterium sp. KMS]MYLAVEFGTISGESLAQNVVAAILYFVIGALVLAAGFGLMDLLTPGSLRH
LVFVEYRPNAVAVACGMYSALAIVVVSAIIASSAELGQGLLDAAVYGIVG
VLLQGVALVVLEVAVPGRFRDLIEADRLHPSAIATSVVLLAVGGVNAAAL
S
119867964YP_937916.1 NAD-dependent DNA ligase LigA [Mycobacterium sp. KMS]MSAKSTPDAGPQEQATEAEAELRHRWQALADEVRDHQFRYYVRDAPVISD
ADFDKLFQQLEALEAEHPELRAPDSPTQLVGGAGFATDFTPAEHLERMLS
LDDVFNVDELTAWSSRVRAEVGDDAAYLCELKVDGLALALVYRDGRLERA
ATRGDGRVGEDVTLNARTLDDVPERLTPSDEFPHPAVLEVRGEVFFRVAD
FEALNAGLVAEGKPPFANPRNSAAGSLRQKNPAVTARRPLRMVCHGIGYT
EGFSPTSLHEAYGALRAWGLPVSDHTTRVQGMDAVRERIAYWGEHRHDIE
HEIDGVVVKLDQIALQRRLGATSRAPRWAVAYKYPPEEAQTKLLDIRVNV
GRTGRVTPFAYMEPVKVAGSTVGLATLHNASEVKRKGVLIGDTVVIRKAG
DVIPEVLGPVVDLRDGTEREFVMPTHCPECGTELAPAKEGDADIRCPNSR
TCPAQLRERVFHVAGRGAFDIEGLGYEAAIALLQAGVITDEGDLFTLTED
DLLRTELFTTKGGAVSANGRRLLANLGKAKAQPLWRVLVALSIRHVGPTA
ARALATEFGSLDAIIEASEDQLAAVEGVGPTIAAAVKEWFTVDWHCAIVE
KWRAAGVRMADERDASIARTLEGLSIVVTGSLAGFSRDEAKEAIIARGGK
AAGSVSKKTAYVVAGDSPGSKYDKAIDLGVPVLDEDGFRNLLENGPQAPE
G
119867962YP_937914.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MSFASPYPAVQIPTTSVYDYLFSDLSDTDAQRVALIDTPSGNRMTYGEML
ARIDAFAGALADRGIGVGDVVGLLAPNSSAFAIAFHGILRAGATATTVNA
LFTAKDIANQLADSRATMLVTVTPLLAHAAEGAAAVGLADDRVIVLDGPG
AAADGHPNAADLLGPGFAPPEVSFDPATHLAVLPYSSGTTGNPKGVMLTH
RNLTANVAQIRPVQGMTADDRILAVLPFFHIYGMTVLLNAALHARAALVI
MPRFDLTEFLANIADHKCTYAFIAPPVAVALAKHPLIDEYDLSSLQGIMS
GAAPLDADLGHAVAERLGCAVVQGYGMSELSPVSHVTPFDGGVGLVGSAA
PLASSGWTVPNSESRITDPETGAEIDIPPSGMSATGELWFRGPNVMAGYL
NNDEATRETIDDEGWLHTGDLAQVDAQGCVYIVDRLKELIKYKGYQVPPA
ELEAVLLSHDAIADVAVVGVVDTESGEEVPKAFVVRRPDASLTEAEVMEF
VAGQVAPYKKVRKVEFIDAIPKSASGKILRKDLRH
119867960YP_937912.1 protein LpqA [Mycobacterium sp. KMS]MTAQATALMVSVAAVLTAGCVSVVGGTAVRSTPGLDDDSRSPVDVDTVLL
ETAQMQAITGAGEDLTIIPTMDGKIPVDIEPLMEQMPTPCQWLFAESQTF
GDEVEEFHKTTFQNPPDGGLISQGAAGYRDPETARRAFDGVVALVDGCGT
TNYGPAYIGEWTATADAVQTRPGDCGRDYRLKSTVLVEVTFCAFTEAVPD
IVMTNILAKVPG
119867958YP_937910.1 class V aminotransferase [Mycobacterium sp. KMS]MTSPKSVYLDHAATTPMHPAAIEAMTAVLTTVGNASSLHGAGRLARRRME
EARETLAGLLGARPSEIIFCAGGTESDNLAVKGIFWARRDAERRRNRIVT
TPIEHHAVLDAVQWLVEHEGAEVTWLPVQADGSVTAAALREVLQSCDDVA
LVSVMWANNEVGTVQPIAELAAVAAEFGVPMHSDAVQAVGQLPVDFAASG
LSAMSVTAHKFGGPTGIGALLLRRDTACVPLLHGGGQERDVRSGTADVAG
AVAMAAAARVAIDGLDAHRARVSALRDRLIEGVLATIDDVSFNGSRVDRL
PGNAHFTFRGCEGDSLLMLLDAKGIECSTGSACTAGVAQPSHVLIAMGAD
PASARGSLRLSLGHTSTDADVDAALEVLPAAVDRARQAALAASGVTD
119867956YP_937908.1 ornithine-acyl[acyl carrier protein] N-acyltransferase [Mycobacterium MSAASVLIAADIAADHPKAADTPRYSLLLSTDSDLIAAAQRLRHDVFTSE
PGFALTGALDGRDADRFDEYCDHLLVREETSGELVGCYRMLPPPGAIAAG
GLYTATEFDVRALDPLRPSLVEMGRAVVRHDHRNGGVVLLMWAGILAYLD
RCGYDYVTGCVSVPIAGADGEPAGTQVRGVRDFVRRRHAAPEHYTVYPYR
PVVVDGRGLDDIPPPVRAGVPPLMRGYLRLGAQVCGEPAHDPDFGVGDFP
ALLDKRHADTRYLRRLRSVSAATGSAS
119867954YP_937906.1 electron transfer flavoprotein subunit alpha [Mycobacterium sp. KMS]MAEVLVLVEHAEGALKKVTSELITAARALGEPSAVVVGKPGTAEPLVDGL
KAAGAAKIYVAESEDAENYLVTPQVDVLAALAEENSPAGVLLAASADGKE
IAGRLAARIGSGVLTDVIAVAEGGKATHSIFGGAYTVEAEVTGDTPVITV
RAGAIDAEPADGAGEVVNVEVPAQAETATKITKREPAVAGDRPELTEATV
VVSGGRGVGSAENFGIVEELADALGGAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIIAVNKDEEAPIFEISDLGIVG
DLFKVTPQLTEKVKARKG
119867952YP_937904.1 type 11 methyltransferase [Mycobacterium sp. KMS]MSAFVTGPRGGGDETLPLTGERTIPGLAEENYWFRRHEVVYARLADQCAG
RDVLEAGCGEGYGADLIAGVARRVIALDYDEATVAHVRARYPRVEIHHGN
LAALPLVDSSVDVVVNFQVIEHLWDQPQFVGECLRVLRPGGLLLMSTPNR
ITFSPGRDTPVNPFHTRELNAAELTELLTTAGFEMEAMLGVYHGPRLREL
DARHGGSIIDAQIARAVADAPWPQDLLDDVAAVRIDDFDLTSGEDIDDSL
DLVAIAVRP
119867950YP_937902.1 group 1 glycosyl transferase [Mycobacterium sp. KMS]MRILLVSWEYPPVVIGGLGRHVHHLATALAAAGHEVVVLSRRPADTDPST
HPTTDEVSEGVRVVAAAHDPHEFAFGPDMMAWTLAMGHAMIRAGLAIKDH
GRPWRPEVVHAHDWLVAHPAITLAEFFDVPLVSTMHATEAGRHSGWVAGP
ISRQVHAVESWLARESDSLITCSSSMREEITELFGPGLPEIRVIRNGIEA
QRWPFAQRRPRSGPAQLLYLGRLEYEKGVHDLIAALPRIRRTHPGTTLTI
AGDGTQLDWLIEQARRHKVRKAVSFAGRLDHDGLVDMLHTADAAVLPSHY
EPFGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGVSFPPRDVTGLAAAV
RTVLDDPAAAQRRAVAARDRLTSEFEWHTIAEETSQVYIAAKRREREPLP
RLPIVERALPDR
119867948YP_937900.1 Pyrrolo-quinoline quinone [Mycobacterium sp. KMS]MFRRFLVLAVSALLVGASAGCGDASSWVEAKSAPGWPAQYGDAANSSFVA
ADGADSLTLEWSRSVKGDLGAAVALGTGGYLAANAQSPAGCSLMVWEAEN
DARQRWCSRLVQGGGGASPLLDGFDNLYVGQPGAILAFPRTQWIRWRKPV
IGAPTTPRIMAPGQLLVITHLGQVLVFDAHRGTVEGTPIDLVSGVDPRNS
ERGLADCRLSRPECPVAAAPAFSAAGAIVVLSLWEPGADKPVLVGLRYRP
GQTPLLAREWTSDAVEKGPLASPVISADGSTVYVNGRDERLWALDTADGA
AKWSVPLDYLPQTPPSVSPDGSIIAGGGPGAKLTAIRDSGDRGEVVWTRE
DVVPLTTSSRAGRLGYAVVEAPDGAQDLTVFDTADGRTVNSYPLPEATGW
PVGVSLGHDGSVVAATSDGQVYGFAPE
119867946YP_937898.1 immunogenic protein MPB64/MPT64 [Mycobacterium sp. KMS]MTRALSIAALLTATVLTGWTGTPVASAQTACADLGGALNSEQSCQVHAAA
AEYTVEFSFPAGYPDEQAVSAYLTQTRDGFVNVSEMPGARGLPYVLDAKG
TAYHSGLAPRGTQSLVLEVYQNVGGAHPQTWFKAFNYDLGARAPITFDTL
FRPGTRPLDVVYPAVQRDLQAKTGIDQPVLPADGLDPQNYQNFAVTDEAV
IFFFGQGELLPEAAGAIQASVPRAALAPILAV
119867944YP_937896.1 type 11 methyltransferase [Mycobacterium sp. KMS]MTSIDHTSTDLPASNPHATAEQVEAAMTDSKLAQVLYHDWEAETYDEKWS
ISYDQRCVDYARGRFDAAVPEEVQRELPYDRALELGCGTGFFLLNLIQAG
VARRGSVTDLSPGMVKVATRNGQSLGLDIDGRVADAEGIPYDDDTFDLVV
GHAVLHHIPDVELSLREVIRVLKPGGRFVFAGEPTTVGNRYARELSTLTW
RIATNVTKLPMLSDWRRPQTELDESSRAAALEAVVDLHTFDPADLERMAR
SAGAVDIRTASEEFTAAMLGWPVRTFEAAVPPGRLGWNWAKFAFGSWTTL
SWVDANVWRRIVPKGWFYNVMVTGVKPS
119867942YP_937894.1 NUDIX hydrolase [Mycobacterium sp. KMS]MTEPAQKSTPDPLVPRPAATVMLIRSARGVPETNEVFLMRRHAGMDFVAG
VMVFPGGGVDDRDRNADIAWAGPGPQWWAERLGVDEHLAEALVCAAARET
FEECGVLFAGAADDPDVLVDDASVYRESRLALANRSLSFADFLRTEKLVL
RADLLRPWANWVTPEEERTRRYDTYFFVGALPDGQLADGENTETDQAGWV
TPEEALRDFADGRSFLLPPTWTQLDALAGRTVAEVLAVERRIEPVQPTLA
AHNGNWEIEFFDSDRYNAARNHRAP
119867940YP_937892.1 hypothetical protein Mkms_1902 [Mycobacterium sp. KMS]MAVRLTRASARAAVLLVGLLLYGFSMALMVRAGLGLDPWDVFHQGLARRT
GMTIGTATAVVGVAVLLAWIPLRNRPGVGTVANVVVIAVSVDASLAVLPG
ASTLPVQVAWMLTAVVLNALATVLYIGAGLGPGPRDGLMTGLVARTGRSV
RLVRTAIEATVLTAGWLLGGTVGVGTVVYAFGIGPLVQLFMRVGDFAARR
RGAPQVADDLEYGTMVGCPEKTRPRV
119867938YP_937890.1 phosphoserine phosphatase SerB [Mycobacterium sp. KMS]MTSPVGSSRKRSSLLITVTGVDQPGVTSALFEVLSRHRVELLNVEQVVIR
GRLTLGVLVAAAPEVADGDGLRTDVEEAIHDVGLDVTIERSADTPVMREP
STHTIVVLGRPITAEAFGVVAREVAALGVNIDTIRGVSDYPVTGLELRVS
VPAGAAYGQLQKAMARVAVAEGVDIALEDYSLSRRAKRLIVFDVDSTLIQ
GEVIEMLAARAGAEAAVAEVTEAAMRGELDFAESLHRRVATLAGLPASVL
DDVADQIELTAGARTTLRTLRRLGFHCGIVSGGFRQVIEPLAHELMMDFV
AANELEIVDGKLTGRVVGEVIDRPGKAKALRDFAQQAGVPMEQTVAVGDG
ANDIDMLSAAGLGVAFNAKPALREVADASLSHPYLDTVLFILGVTRGEIE
AADAVDGLLRRVEIPED
119867936YP_937888.1 periplasmic binding protein [Mycobacterium sp. KMS]MGTTVSATLVAALVAALAGCGSTDADPAASALMSSVITSTTSVAGAGVLG
NQRRPDESCAAGPAPVDPGPPEREVRHAAGETRVTADPRRIVVLSGDQLD
ALCALGLQSRIVAAALPDGRDEQPSYLGSVIHDVAPAGTRSAPDVDAIRA
AAPDLILGSQALTPELFDALGQIAPTVFTGPPGADWQANLRTVGAATGRF
DATGGLLDGFADAARRTGLDNDAAHYQVSVVQLTEDTVRVYGARNFAGSV
LAEVGLDRPAAQRFTDEPFVEIGTGDSPDYGIADADIVYVSFASAAAREN
AATILDSDAWRALSAAQDDRVYVVNNEVWQTGQGVVAARGVLSDLRWVNA
PIN
119867934YP_937886.1 hypothetical protein Mkms_1896 [Mycobacterium sp. KMS]MTDVAVVMRECAGLWRRTLLIEADGSRDTGTDVLWLQGATAYVDSRGFAG
VLTQRPAQGGDVFEWRRDIDLQPPGEFPDAGLMRWDGDTLVEEGVYADYV
EHWVRDAGPAAPCWALSLTSGAGRAMLLRVGDRFGWAGGDLVLIGTVGDD
RWDALGIAMAGTRLRAGGVGWDVQRTEGEVEL
119867932YP_937884.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MIRRLKTVAALAAAAALTLSACGGSDSGGGAPSAAPTDKVLHLSFLQDPG
QPPDPDVFYAGQGLLLTTNVYEGLMQYKGGTEKAEIEPLLATEWTESPDH
RVFTFKLREGVTFHDGTPFTAEAVKASFDRRLAVDQGPAYMVADVESITT
QGDHAVTITLKAPNAAFLDYLACPYGPRMLSPKGLADNAGDDHAQNYLTT
HDLGTGPYTLTAAEVGSRYALAAYPGYWGEKPYFEQVEIPVITDVSAQQL
QFNNGQIAAILHDLPSSAVESYLNNDKYAHFSLPTMMSNYLYLNPRRGML
TDPKNRAAVLAAIDVDALVKQTYFGRGKKAEQLYPPNMIAPELAKQNVTH
DPSLLTEIAAGLPADQKAVTIGYDSSNPDNQLINNLIQTQLAAAGLNAKV
QSYPTSEIYGWIGNDAPNAPDILTGTAWPDAPSPYTWGHISWDADGGLNY
LGCSAPPVTSALARGLETGDPQVFSEAAKAAADTGCWLNIADVDDFVVAQ
PWLAGVEEAHVVTNPNSLRLFELSVA
119867930YP_937882.1 binding-protein-dependent transport systems inner membrane component [MRTFVTTRIAAMFAILVALTGVMFVLAHISPLDPVKAQLGAQASQAAVAA
RREALGLNEPMLVQFWNYLTGAVTGDLGTSYRTRHPVASDLGDFLPATLE
LAVFGMVIALVLAALLAFSTTLKWRGSAVLRAVLFTGSSAPMFLLGILGL
IVFYQQLGWVPANGRIGIANPPTGPTGLLTVDGLLHARFDVVGDALQHLI
LPAVVIAIGPAVAIGRVLRSSLLGDTDSDYARTARAKGLSEGRIMVGHVL
RNSIGAALSMTGLQIGLMFSGVLVVEQVFGWPGIGQYIAQSIPVADFPAI
AGVTLMLGALYVFINTMVDLLQAAADPRITVRGG
119867928YP_937880.1 oligopeptide/dipeptide ABC transporter ATPase [Mycobacterium sp. KMS]MGTAVSEADAPAAAPPTPDPVATVGDLAVKFRRNGRAIHALRGVSLAVAP
GEILGLVGESGSGKSVLGFSLLGLLPDNATVSGTVRVAGSDMVRGDPKAL
RKVRRLDLGAVFQDPMTSLNPTMRIGRQVAEAAGSDEEALRLLTAVGIPE
PARRMRAYPHELSGGLRQRVMIAIAIAGDPDLIVADEPTTALDVTVQAQV
LRLLRRLRDEIGCSIVLITHDLGVAAQISDRIAVLYAGRIAEIGPSAEVL
AAPAHPYTHGLLRSRLTLDTARDRPLAALAGSVPSPVTPLPGCAFVPRCA
LATDECTTAPPEPLAVAPGRVSACIRPQGEVAEHLGAAETNTDDAFPATT
ADRAEMPPSVVLRDVTKSFSVARRWFDRSADGDGKLHALRGVSLRVGHGE
SVALVGESGSGKSTLLRVIAGLEPPTSGFVDLAGGQRPQMVFQDAGASLT
PWLSVGELIAERLRGTGLSRARRRERVAEVLERVGLPAEVAKSRAGQLSG
GQRQRVSLARATVVPPSVLLCDEPTSALDVSLAASVLNLIGDLRRSLDMS
VVFVTHDLSVARVVADRIAVMYLGRIVEIGPADQVIAEPAHPYTQALVDS
IPDLGREPRSLAGEPASPLSPPTGCAFHPRCPLAIDACDDTGLDVRLEGF
PGNPHQVACIERKAG
119867926YP_937878.1 allophanate hydrolase [Mycobacterium sp. KMS]MTAVERVRAAYATIEAVARPEVWIFLRPFADALTDAEAVDSAVAAGADLP
LAGLTVAVKNNVDVAGLPTTAGCPGYATDPAEVDAPVVARLRASGAVVLG
ATNLDQFATGLVGTRSPHGAVRDARRPGHISGGSSSGSAVAVALGIADLA
IGTDTAGSGRVPAALQGIVGIKPTYGVVPTDGVVPACRSYDCVTVFARDL
DTADAAMGVMAGADPSAGVRARPFPPDAPLAAPAVPLVGVPRDLPGLSPA
WRQAFGEARSRLEGQGAAVREIDMRAFLEAARLLYDGGLVAERHEAVGDF
VDTHRDEVDPTVGAIIAAAGTVPATRLLRDRVRLAELTAAAMAELGDCDA
LLIPTTTDHPTIAEVEAEPIAVNSRLGTYTNFCNLLDMCAVAVPSGAADG
AQFGVSIVARAGADAVALDLARRVTSGSSDPVVSQAPWPVRAGLSATPLL
VVGAHLRDQPLAWQLEERGARWLGPAVTAPLYRLARLHTTPAKPGLVRVG
AESGTAIGGELWLVGTAMLGDFLAALPSPMMLGRVTLSDGTEVVGFGCAL
DAWQSGEDISSYGDWRNYLGSGQLSERV
119867924YP_937876.1 hypothetical protein Mkms_1886 [Mycobacterium sp. KMS]MTTTSDTAEALVPGHTILDETVAARAPWSAVVAAGDVLTIVDLDGNQAVD
CLLYSAADTAIRYSAPETIARQGRIALTTGSVLRADTGAALMTVVADEVG
VHDTLGGACSKESNTLRYGQHTRAQHGCMENFLIEGARHGLDARDLASNI
NWFMNVPVDPDGALGIVDGLSGPGKRVALRADIDTLVLVSNCPQINNPCN
AFDPTPVRMIVTRP
119867922YP_937874.1 hypothetical protein Mkms_1884 [Mycobacterium sp. KMS]MCLSCDRFSGPWTRSTTLRPVFHVLTLTYLQPLDVIDETRPDHLDWLARE
VESGRILLAGRVEAQTGAVLVTGDLSAEEADALAAADPYSKAGVVSYART
SFNGAFRAPGL
119867920YP_937872.1 putative esterase [Mycobacterium sp. KMS]MSFIQSFRRRLLAGALAALLLPGLIAVAGGTATAGAYSRPGLPVETLMVP
SAAMGRDIPVKFQGGGTKAVYLLDGLRARDDNSGWDIETAAFENYFESGL
SVVMPVGGMSSFYTNWQGPAVGNGQTYTYQWETFLTSELPAYLAANKGIS
PSGNAVVGLSMSGSSALILAAYHPGQFSYAGSLSGYLNLSDGLWPTLVGF
AMRDSGGFDATAMWGPGGGPAWKRNDPTVNVGKLVANGTRIWVYCGTGRP
GDLGGGGDIPGQLLEAITLDSNRQFQSEYRAAGGSNATFNFPANGTHGWG
YWGSQLNAMKGDIQRTLGV
119867918YP_937870.1 hypothetical protein Mkms_1880 [Mycobacterium sp. KMS]MRRALLALTLAGILATAFELASERHWNGFEQLIPWIALAVLAVALGLACL
RSGTAQLLARAAAVLVMCASIYGVIDHATANHHAGPLDQRYADTWATMPA
TEQWWAAVTKSVGPAPTLAPGILAQTALLLVLAGLLQTRRPEDVAA
119867916YP_937868.1 hypothetical protein Mkms_1878 [Mycobacterium sp. KMS]MIRQLIAASGALIAVVASPLAPTALADDGQVVMLQSGKVRCAVSADNMDR
GGGPMVVCELSNGQPWGMSPWETSKYNARLNLAIVRATGEHYWDRGRITG
SDASAAGGLSVNDGQTYNLYGWTIHSDGFRTRITNDATRHGLLVTEGYVR
QF
119867914YP_937866.1 hypothetical protein Mkms_1876 [Mycobacterium sp. KMS]MRCMPLRYVDPHKRHSRRYRAIEAFSRSGPGQFLAHHLWSRVDPWLYRAT
GGRYPSVFGGPSTAPLMTTGAKSGQPREHQITYFHEGSDPIVTASNYGGP
RHPQWYYNLKAHPECELGDEKFVATEITDPQEYARVYGLAEQVYAGWSDY
RLKTEPIGRHIPVFRLKPR
119867912YP_937864.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MRRGSRARTGAEPGGKVDARSERWREHRKKVRSEIVDAAFRAIDGQGPDV
SLREIAEEAGTAKPKIYRHFTDKSDLFQAIGQRLRDMLWSAIFPSIDLSV
DSGREVIRRSVEQYVRLVDEHPNVIRFLIQGRFAEQSESTMRALNESREI
TLAMAELFDNELREIELDAAALELAAYAAFGSIASATDWWLGAEPDSPRR
MPSEEFVAHLTTIMIGSINGTCELLGIKLDPDLPLHEGVRRNEHVA
119867910YP_937862.1 agmatinase [Mycobacterium sp. KMS]MASSAFGPDITFLGVPRCDLSDASTYTDADIVILGAPLDGGTTYRSGARF
GPSALRQACYLPQDGSRPSLALRVDGLKDLRVYDAGDVALYSGNVEQAVQ
LIEEEVFTISAAGAIPIILGGDHTIAWPDHTGVARQHGFGKVSMIHFDAH
ADTGDIHAGSLVGHGTPMRRLIESGALRGDRFLQLGLRGYWPDEPVLQWM
AAQGLRSYEMTEIVARGLETCLTEAFEIATDDCGGVFLSVDIDVCDPGHA
PGTGTPEPGGFSARQLLDAVRRICYELPVLGVDVVEVAPPYDHADITALL
GNRVVLEVISAIARRRKDAAAGTTWDPSQPLLAGREVDEQMRLIAEGEDA
RRRGEGGGRPHHHHH
119867908YP_937860.1 extracellular solute-binding protein [Mycobacterium sp. KMS]MRCTPAVVTLAVTTLVLAATGCSGSSNSPTDTAALMSSVRTPLMSDPPPL
DPDVFYQPEGLLIMTSAYQGLLRYAPESTEVEGLLATEWTVSEDGLTYTF
TLRDGVKFSDGTPFDSAAAKASFQRRIDMAAGPSYMLADVRDMQTPDPQT
FVVTLTKPVAPFLDYLASPYGPLMTSPAAIAEHAVGDDRGAGWLAAHTAG
TGPYELTAAIPANRYTLTANEHYWGEAPQITTVELPVVAATAVQRMQLEN
GQLDMILHGLSKGDYEALGAGPDTEVRQETALVKALVMVDPDSEVFGPPA
ARAALSAALDQTTLTTTVFGDQGSPSTQFYPSGMLPDGAVPDTHDFDPAK
LAETGRSGGDVEIGYPTGDSSLQNLANQMQVILQQAGLTATVRDFPLAQF
FALGENPGQRPDLLLASFNPDAAHPDTWSRIYQYTDAPVNLQGCSVPAAD
ALLDAGSAEPDPAKSRALYVEAAKEYRDSLCWINLADLHNTIAARKGYSG
WSSQPAWMWDTDFSTLAYRD
119867906YP_937858.1 LysR family transcriptional regulator [Mycobacterium sp. KMS]MNPPSLTLGYVPGGTPAKWARNWAERHPDVPLQLCTVAAADAADAVRAGT
VDVALLRLPADTSALAVIPLYEETTVVVVPVDNVLTAGDTITAADLDGEP
VLMPLDHVVAWAEAPGTLVDHRPETTEDAMELVAAGVGALVVPQSLARLY
HRKDLTYRPITDAPTCPVALAFPDGPQSPLLEEFIGIVRGRKPGSSRGQA
QPAPKRTAREKTLAKQAARAAAGKGARKPGRAGRGRR
119867904YP_937856.1 hypothetical protein Mkms_1865 [Mycobacterium sp. KMS]MDWQHFEPFLVALAIGLLLGLERERSHNLTLPAGSRSFALLSVAGAVAAS
IGTSAVAAGSIGVAVLMALAYFRTSTDDAGTTTEIAALVAFLLGALAYNR
PAEAVALAVVVVVLLVSKSRIHRFAREVVSEVELEDAIKFFVVAFVILPL
LPDRPMGPYGVLNPSKIWLLVVLLTGIGWVGYIGVRALGPQRGLLVTGMA
GGFVSASATTASMGRLSRTETGLRAPLASALVASLATFLQLLLVIGVVDI
DVLRRLWPPVVIGALVLVGVAAFVYRGANRTDHITADDDEAPAEPTSRPF
ALRPALVLATVLTLALLVSRWAADVLGPNGLVLAAFAAGLADAHAGGVAA
ASLAAKGDVTVDAALIAIAAALGSNLVVKVLLAFTAGGRRFGLAFLAGMA
APTVAFGGAITLAVTLG
119867902YP_937854.1 ribonucleotide reductase stimulatory protein [Mycobacterium sp. KMS]MGNIVYFSSVSENTHRFVEKLELPATRIPILGRIQDPDFVREPYVLVLPT
YGGGHANGPDPDAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNTNFGAEFG
YAGDVVSRKCGVPYLYRFELMGTTDDVLAVRAGLENFWKEQTCHPPSQLQ
SL
119867900YP_937852.1 NADPH-dependent FMN reductase [Mycobacterium sp. KMS]MSDVNVLVLLGSLRKASVNRQLAEVAVDSAPEGVTLRLFDRLGELPFYNE
DLDNNIDENLVPEPVRALRAAAGAADAALVITPEYNGSIPAVLKNAIDWL
SRPWGDGALKDKPLAVVGAALGRYGGKWAHDESRKSFGIAGARVIDDLEL
SVPSASLEGAHPRENAELVVALGDVIGKLVASVGATVG
119867898YP_937850.1 DNA polymerase IV [Mycobacterium sp. KMS]MPRWILHVDLDQFLASVELRRHPELAGLPVIVGGSGDPTEPRKVVTCASY
RAREFGVHAGMPLRVAARRCPDATFLPSDTAAYDEASEQVMGLLRDLGHP
VEVWGWDEAYLGADVEDPFALAERIREVVAGTGLSCSVGISDNKQRAKVA
TGFGKPAGVFMLTDANWMAVMGDRPVDALWGVGPKTAKKLTALGITTVAD
LAATDAAVLTSTFGPTTGLWILLLAKGGGDDTVSAAPWVPRSRSHVVTFP
HDLTDRAEMTAAVTRLAEQTLTEVVEAGRVVTRVAVTVRTSTFYTRTKIR
KLSAPTTEAGVVTATALDVLALFDLDRPIRLLGVRLELAMPEAPKPPEPL
VAADQ
119867896YP_937848.1 short chain dehydrogenase [Mycobacterium sp. KMS]MTQGSGFTGKRCLLTGAASGIGRATALRLARDGAELFLTDRDADGLETTV
ADARALGGKVAMYRAFDISDYDAVVQFAADIHRAHPAMDVVMNIAGISAW
GTVDRLTHQHWKSMVDVNLMGPIHVIETFVPPMIAARRGGHLVNVSSAAG
VVALPWHAAYSASKYGLRGLSEVLRFDLARHRIGVSVVVPGAVKTSLVHT
VQIAGVDREDPNVQKWTDRFAGHAVPPEKVAERILTGVRRNRYLVYTSPD
IRALYLFKRTMWWPYSVAMRQVNVLFSRALRPARR
119867894YP_937846.1 cytochrome P450 [Mycobacterium sp. KMS]MATISTPEYLLDQAKRRFTPTLNTIPGMGIVEKRLRDKLQNQEWKQFVLA
EPPAGSGLKPVMGDSGLPVLGHMIETFRGGPDYLLQVYKTYGPLHYAYSP
ALPAVVALGPDATQAVFSNKNKDFSQRGWHPVIGPFFNRGLMMLDFDEHM
YHRRIMQEAFTRTRLAGYVEHIDRVASQVIANDWVENDARFLFYPAVKEL
TLDIASVVFMGHEPGTDKELVTKVNDAFTMTTRAGGAIIRTGLPPFKWWR
GLQARKVLDNYFEQRVKEKRGSEGTDMLTVLCHTADEDGNTFSDQDIVNH
MIFLMMAAHDTSTSTLTTMAYHLSRNPEWQERCREESERLGDGPLDIEAL
EKLETLDLVINESLRLVTPLPFNVRQTVRDTELLGHYIPANTDVVLWPSV
NHHLPELWTDPEKFDPARFTEPRNEHKQHRYAFAPFGGGAHKCIGMVFGQ
LEIKTVMHRLLRRYRLEPPRPGYVSKLDYAGMPVPMDGMPIVLRPLR
119867892YP_937844.1 hypothetical protein Mkms_1853 [Mycobacterium sp. KMS]MLDLRAAAVQTLSLADRPRRGGTKVVAMGWPEFGLLLAAGVLGGLTGSIA
GLASVATYPALLLAGLPPVAANVTNTVSLVFNGIGSVLGSQPELRGQGGW
LRRIVPAAALGGVAGAALLLSTPAEGFEKVVPILLGGSAVLILLPRRSAP
AHPGHRPHAGLWASAAILAICIYGGYFGAAAGVLLLALLLTTGTDTLAHA
NAGKNVVLGVANATAALVFAVFAPVHWVAVIPLGAGCLMGSRLGPVVVRR
APAGPMRILIGLAGVGLAVKLGVDAYR
119867890YP_937842.1 type 11 methyltransferase [Mycobacterium sp. KMS]MSSDTATVDDGQLAARHRSMWASGDYPRLAAELVAPLGPVLVEAAGIGTG
DRVLDVASGTGNAAIPAAQKGAAVTASDLTPELLEAGRALAAQTGVQLDW
READAHALPFADNDFDVVMSCIGVMFAPYHQRAADELLRVCRPGGTIGLL
NWTPEGHIGRLFATMKPYMPPPPPGASPPPLWGREEHVRELFGDRVTDVV
AERRTLPVTHFADGAQFRDYFKAVYGPTIAAYRNLGDDADRAAQLDNDIA
QLGDELMDGSSHMEWEYLLLTARKA
119867888YP_937840.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MEIEGKKAVVVGGASGFGRATAEALTKRGASVAVLDRPQSKGQEVADELG
ATFYPVDVMDFAGTEQVLAQAVEALGGLHIAVTTAGGGSAMRTLSKNGPH
DLDVFRQVQDLNTVGTFNISRLAAEHMSKNEPEDDERGVIINTSSIAAFE
GQIGQVAYTASKAAIAGMCLTMARDLGSLGIRVLAIAPSLFATGLTEGIP
DEFAAQLTKDAAFPKRLGRPEEYAKLAVAIVENAMLNGQCIRLDAGQRFA
PK
119867886YP_937838.1 GatB/YqeY [Mycobacterium sp. KMS]MTTPADHWRHLLRGELLTARKQRDTVRIAALRSALAAVDNAETPESTVVS
AQPGQPGTPAGTVAGSVQGLGAAEVARRVLSDEQIRSLLTAEVDERVGAA
ATADARGFPDRAATLRGEAEVLEALLGNV
119867884YP_937836.1 carbon starvation protein CstA [Mycobacterium sp. KMS]MATPTAAPSERFEETDGDVTYIRTDKDLPPVAIIDRSPITTRHRIVFGLI
ALAGAIAWAVIAFFRGETVNAVWFVIAAICTYVVAFRFYARLIEMNIVKP
RDDNATPAELFENATDYVPTDRRVLFGHHFAAIAGAGPLVGPVLAMQMGF
LPGTIWIIIGAVFAGCVQDYLVLSISTRRRGRSLGQMARDELGAVGGAAA
IVGVLVIMVILLAVLALVVVQALAQSPWGVFSISMTIPIALFMGVYLRFL
RPGRVSEVSVIGVALLLLAVASGRWVAETSWGASWFDLSPVALSWAIILY
GLAASVLPVWLLLAPRDYLSTFMKVGTIALLAVGILIARPVMEAPAISNF
AASGTGPVFAGSLFPFLFITIACGALSGFHSLISSGTTPKLLEKESQMRL
IGYGGMLTESFVAIMALITAAILNQHLYFTLNAPAAQTGGTAETAAEYVN
NLGLSGAPITPEQIDEAARSVGESSIVSRTGGAPTLAFGMSEVLSSVFGG
DALKAFWYHFAIMFEALFILTTVDAGTRVARFMLSDGLSNLGGPLRKLKD
PSWRVGAWACSVIVVAAWGSILLMGVTDPLGGINTLFPLFGIANQLLAAI
ALTVVTVVVLKKGLGKWALVPGIPLLWDLVITLTASWQKIFSGDPKVGYW
TQHFQYKTALAQGKESFGAAKNPDQMNDVIRNTFIQGTLSIVFAVLVVIV
FAAGVVMAVRALRGTAPPTTEDEEVPSRIFGPSGLHTTAREKEVQKQWDA
LPSSHARSVGTSPR
119867882YP_937834.1 cytochrome P450 [Mycobacterium sp. KMS]MSAPIIDAAARVFATPRAYTDEPALHAALTHLRAHAPVSWVDVDGYRPFW
AVTKHADIMAIERANTVFTNSPRSVLMTATADELQAGVGIRTLIHLDDPE
HRDLRAIGADWFRPKAMRALKVRVDELARIYVDKMLATGPECDFVQEVAV
NYPLYVIMSLLGVPEADFPLMLKLTQELFGSDDEEFQRGDSSEEQMAALL
EMFQYFTALTASRREHPTDDLASAIANARLGGEPLSDIDTVSYYAIVAAA
GHDTTSATISGGMLALIEHPDQLRRLQADPGLMGLAAEEMIRWVTPVKAF
MRTAAQDTEVRGVPIKAGESLLLSYVSGNRDDDVFDAPFRFDVGRDPNRH
VSFGYGVHFCLGAALARMEVNSFFAELLPRLRSVELAGRPEHVATTFVGG
LKHLPIRYALRPA
119867880YP_937832.1 propionyl-CoA carboxylase [Mycobacterium sp. KMS]MTDAQDWKETLEDLERRRAHTYGMGGPERVAKHHGKGKLDARARITRLLD
PDTFCEFGTLVGGDIAADGLVAGSGRVGGVPVMVGAEDFTTLAGSIGPGG
NAKRYRLAELALRNKIPLVMLLEGAGFRPSGEHYGRTPTDLIIQAQCSGK
VPTVAAVLGPSAGHGALVAPVCDFTIMSAGGAIFTAGPPVVKESTGEDIS
KEDLGGPEVALASGVIHNYGEDDETVIDDIRRYLSYFPSSAWSYPPTRLA
DDTADPRPTPELLDIVSRDNRHIYDMRTVLDVIFDRPDWLEVQPRFGRAV
ICALAHLGGFPVAVVANQPEVMAGSIDADAADKAAHFITVADSFHLPIVF
LADNPGMLPGSRSERSGVLRSGARMFAAQTAATTLKLHVTLRKAFGFGSM
VMSLLGFDDQVATFAYPGATMGAMSAAAMSRATHAGEDYTEVLKRMELEA
SYRSAGHLGFDELISPVETRDRLLTALQHGIFSRQAVAEPVARTVIMP
119867878YP_937830.1 hypothetical protein Mkms_1839 [Mycobacterium sp. KMS]MTRTAREVVELYNLQVWNERDFALAEELMGDTVVRHDVGQSVTLTHEQAV
QRIVDHWAMFDTVRFGLNLVVAGDDGEHVAIVYQSPMTLKDGTTTTISSM
EVFRVVDGRITEVWNCGYKQGIWC
119867876YP_937828.1 hypothetical protein Mkms_1837 [Mycobacterium sp. KMS]MTHPTRYEVLVVGAGFSGLYALHRLRELGVNARVVEKADDVGGTWLFNRY
PGARCDIESIEYSYSFSEEIQQEWVWTETMPAQPEIEAYLNFVADHLDLR
RDIDFDTEIVAMTFDEDAAEWVLETAAGARYVAPFVVAATGILSVPLEPD
IPGIDSFTGTSLFTSRWPREGADLTGERVGVIGTGSTGVQLIPVVAREAE
QLTVFQRSPAYTLPWRVRPFAPGELDDLKARYGEIRAAQREHPVGAARLS
AFSVLLDMLVRPPLKTAGPEDRRRAVEEHGIMGALNWGDIFFDIEANRIA
AELYGQAVARIVRDPQTAAALVPTHPFACKRPIIDQGYYETFNRDNVTLV
DLRRGGIRSVTPTGIDAEQGSFDLDVIVYATGFDAMTGALSRIDVRGRDG
VLLRDVWAADGPVSYLGLQVAGFPNLFTVQGPGSPSAATNFVAALEQHVD
WIADCLQYLRSRGHRTIEALPGAQTEWIEHTTALVAPTVLMDPSCNSWYN
GGNVPGKKRMYMGYTGGLPEYRRRCDEIAAAGYLGFKVG
119867874YP_937826.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]MKVPFTWKVTGWFMVGWSAEFVSGETRALHYFGDDLVAYRDESDTLHVLE
AHCKHLGAHLGHGGKVVGDCVECPFHGWRWGPQGDNTYIPYQPDRPNRAL
KLRVYPVVEQYGCVFVWHHPDGAPPQWPLPDLFEKFPQFPTDPDAYYRPY
PEFSSRAENEPVHPQIVAENGPDSSHFRYVHGASVTPVCLNWEVVGEEWR
FLTGWPDPRSDDPDKMALFIHSHFSGLGFAVSVFEGSSNHRLIFACTPVD
DGLSDMFYSIWWPKVDGETSDVPPDDVRARVERQFLRTVWEDLDIWRYQR
YVERPPLAKIDAKPYMAMREWAKQFYDVSASV
119867872YP_937824.1 acyl-CoA synthetase [Mycobacterium sp. KMS]MQFTMPQVADAVAEVLPDRELVVQGGQRHTYADIVARSNRLASYLHGAGL
GCHTERSELGGHETGQDLLGIYAHNSTAYVEGLLGAFRARVAPFNVNYRY
VRDELRYLLDDSGATALLYHACFAPRVAEVLPDLPRLRTLIQVADGSGNE
LLPGAVDYESTVASGPSTPPPVQPSPDDLYVLYTGGTTGMPKGVLWRQHD
IFMTAFGGRSLYGGDTVTSLEEVAQRAAANPGTKLLILPPLMHGAAQWAV
MTALTTGQTVVFTSVVDRLDAQDALDTIAREQASVVTVVGDAMARPLADA
VEKARRSGEPDISSLAVVANGGAFLTPTTKQRLIDLLPNAMVVDGVGSSE
TGAQMTHLSMNGAVATGRFNAGPDTCVIAEDLGSVLPPGHDGLGWLAQRG
YVPLGYKGDAAKTARTFPVVDGVRYAVPGDRARHLAGGEIELLGRDSVTI
NSGGEKIFAEEVEAALASHPAVEDVLVAGRPSDRWGQEVVAVVALAEGAT
ADADELITHAANSIARYKLPKAVVFRAAIQRSPAGKADYRWAREQAIGS
119867870YP_937822.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MGALPVIEHTRSHVAKWMRRTTLLRPARLAGLRAEVEPVPVGVVGIVGPW
NFPVNLVVLPAAAAFAAGNRVMIKMSEITAHTAELLEARAPEYFDAAELT
VVTGGPDTAAAFTALPFDHLFFTGSPAVGVHVQRAAAANLVPVTLELGGK
NPAVVGPRADLRRAAVRIAQGRMVNGGQVCVCPDYVLVPEYLVDEFSATV
LATWRRMFPSITGSEDYCSSVNDANFDRVVGLIDDARAGGARVNSVVPPG
ETLPDRRSRKIAPTLIRDVTPTMRIASEEVFGPVLSVLGYSTTDEVIDHI
NSRPAPLVAYWFGPDDQDFRTFVRRTRSGGVARNDFAAQMIPSDAPFGGV
GRSGMGAYHGKAGFDTFSHHRSVVGSDLPFSITGSAAPPFGAAMRRSTEF
RLRMARRRNHRRLRRSHG
119867868YP_937820.1 cytochrome P450 [Mycobacterium sp. KMS]MHHYCNGYSKVGVVGPSIRDDAVTAPKPAGYLRDPYPHFTEKRNACGVFH
GSVIDYSKTPESLRPTDGYAAMSFDAVNRVFRDGKVFSSTLYDTTIGLFT
GPTILAMEGHPHRDHRNLVSAAFKSKSLARWEPTIVRPVVTALIDEFVDA
GHADLVREFTLEFPTRVIARLLGLPEEDLPMFRRRAVELISYTVNYQRAF
DASAALETYFVEQMELRRSHPTDDIIGDLVTAEIDGEKLTDEAIYSFLRL
LLPAGLETTYRSSGNLLYLLLTHPDQFAAVQADRGLIPQAIEEGLRYETP
LTTVQRFTTVDTELEGVAIPKNTVVDACIGSANRDEMRWARADEFDVFRD
RVPHISFAAGAHTCLGLHLARMETRVALECLLDRVRDIRLVTDDDPHIFG
QPFRSPTAIPVTFEPVAR
119867866YP_937818.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMEGVRVLEVAQFTFVPAAGAILADWGADVIKVEHPVRGDTQRGFINMGGF
QLDPNRHPLIEHPNRGKRSVGIDVSTPDGQEVLYEIAKTADVFLTNYLPA
QRQKNKFDVEHIRAANPNIIYARGSAYGDKGPERDVGGFDGTAFWTRSGV
GHALTPEEIGGALSQGIPAFGDSIGGMNIAGGISAALFHRERTGEAVELD
VSLLSTAWWAAGASVTQGMETGETMRSLMPDSASPSVNPFLGNYLTSDGG
TINLCIVSPTGYIRDAFEHLGLPELADDPRFNDVMPLIENAPAAVQLIAD
AIRSKPFDYWRLHLKTMKGQWAPFQSLVDLGTDEQAIANDMIVEVEANDG
GEPFKVVRGPVQFNHEPLVTTRAPQASEHTEIVLMELGLDWDRIEALKDS
GAIA
119867864YP_937816.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDFSRVELSDEDAQFRDAVRAFLREHVTEEVKRRDRETGDNFDEGVHLAL
GAAGYLEREWKSEADGGFSRVRRRIWELEKRRHHVPWVTWGTTSMVARSV
DKFATPEVRDEVLPRVFSGHVRLCLGYTEPEGGSDIATCKTRAVRDGGQW
VINGSKMFTTGAHNCQYVFLITNTDPAAPKHQSLTMFLVPLDSAGIEIQG
IRTVDGDRTNIVYYSDVRVDDRYRLGEVNGGWTVLREPLNAEHGAVAAAE
DGLADVSIMMHQAGFMADALDRIAGKVCQPDPGGRRLIDDQSVAYRLGRS
AARVEAALSAPSIFGRVAIAQTMRDVSPDLMDILGAASTLPIGTDGAADD
GGAEYVYRFAPLVGIYGGTLEVFRNMIAQYALGLGKPNYSPPVKKAG
119867862YP_937814.1 amidohydrolase 2 [Mycobacterium sp. KMS]MSPRVLDCLVNVHFGETAKQPDFMVKVRDDYFKGPRSLYDQVELPALLDE
MAEHGVEKAILMDNLAKPSVTARKFVEERPDRFALAVGGVNLLRPMPSLR
ELQAVVADLPVAYAVVGPSFWGDGMYPPSDAVYYPLYTKCAELGLPLCIN
TGLPGPPIPGEVQNPIHLDRVCVRFPELKLCMIHGADPWWDVAIRLMIKY
RNLRLMTSAWSPKRLPDSLLHYMRTRGKDKVIFASDWPVLRQSRVVPEAL
ALDLPTDVLENYLYHNAQEFFFSEQEL
119867860YP_937812.1 amidohydrolase 2 [Mycobacterium sp. KMS]MTLDYMAIDVDNHYYEPLDAFTRYLPKEFKRRGVQMLTEGKRTFAVMGGV
VNHFIPNPTFDPIIEPGCLDLLFRGEIPEGVDPASLMKVDRLADHPEYQN
RDARAKVLDKQNLETVFMLPTFACGVEEALKHDIEATMVSVHAFNQWLDE
DWGFDRPDHRFLSAPIISLADPEKAVEEVEFVLGRGAKIVCVRPAPVPGL
VKPRSLGDPVHDPVWARLAEAGVPVIFHLSDSGYLAIAALWGGKATFEGF
GKKDPLDQVLLDDRAIHDSMASMIVHQVFTRHPKLKVASIENGSYFVYRL
IKRLKKSANAAPYHYKEDPVEQLRNNVWIAPYYEDDVKLLADTIGVDKIL
FGSDWPHGEGLADPMTFTADIPQFPEFSAEDTRKVMRDNALDLIGVNVAA
R
119867858YP_937810.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MDLGLTDATAVVVGGGRGMGLATARCLAEDGAKIALIGRTKDVLDRAAAE
LAECGSPDAIGIPADIAEPEQVERAFAEVARRWGGALNILVNTVGPDVRG
DFESLSDDQWRAAVESGVLGMVRCVRAALPLLRSASWARIVNFSAQSTQR
QSVTLPAYTAAKAMLTSVSKNLSLTLARDEILVNVVSPGSIASEALTGWA
ESVGVDAHDPYRLMDAITEHFGHPAHLPRAGLPSEIGPVAAFLASRRNSY
MTGANVNVDGGSDFT
119867856YP_937808.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MARQATAEKRQRRERGSINPEDIIKGAFELAEEVSVDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMADRALRQIAFEAPYVDAANWRESLHNHAHNM
RKTFLASPILCDLVLIRGALSTKALRLGLEQIEAAVSGLVGAGLSPEDAF
DTYSAVSVHVRGSVVLARLYEKTRSLESSEFRLDDSATIDPESTPLMAEL
SAKGHHVGVPNDMNFEYGLNCILDHAARLIEQQDTTAKPAAARRKNASSR
119867854YP_937806.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MHGCEHGKAPTMTDSDDRVLFEADHDTRIATITLNNAGRRNSYDAAMRDA
LARHLDRVAEDDDLTVVLLRGADGVFSTGADMNNAYGWYGGEDNGKDQGG
KAQTKSRPSQRRRLTVDRKSFGFYHNFMGFPKVTVGEISGYALGGGFEMA
LMCDIAVIGRGTEIGMPATRFLGPALGSLHMFFHRLGPVLARRLLLTGDI
VDAGSLEHLGIFTETCDDAMVSARARYWAQKAAKMPADGVVIAKEAFRLV
EQSQVYQGEEVASYLFHAYGTNLQFAPGEFNFVKTRAQYGTKEAFRRRDE
HFHVPEPDVE
119867852YP_937804.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MGQQGGTAAPDGSVSVHREDAALVLTLDRPQRRNSLSHMMIDELVTALTA
AATDDSLRVVHIRGAGGDFCTGADWVATNTAGQRPRTGDLVRRIPHGANR
VVELVHTLHLPVVCSVQGWAVGLGCNLALAADFTVAGTDAVFWEPFVERG
FAPDSGASWLLPRLVGLARTKRMLLLGEKVSGAEAAEWGLIHDSVPGDEV
AAAADRLVARLAAGPTVAIGLAKQAVHQALHTPLAQAMTQELFNVELSCR
TADFKEGLAAFRDKRDPDFQGR
119867850YP_937802.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. KMS]MTFETITLDVDAAVHVATITLNRPERLNAFNRTMCAEMAEAWRVVKADDT
VHAVVLRAAGDRAFSAGLDVKSTYGQPDNVWNHEDPGELLSPKWQKMWKP
VVCAVQGMCTAGAFYFLNEADVVICSEEATFFDSHVSAGLVCALEPIGLM
RRVGLGDTLRIALMGNDERVGAETALRIGLVTEVVARERLWERAHEIAAT
IAAKPPSATQGTVKAIWESLDRPYRAAMEQGLIYTRLGNPIGQAELAAHP
PAARPDPRVR
119867848YP_937800.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MAEPHTVAAVLGRWAVDRPAHPLLICDADRLDYGQAERRSARLARGLLAL
GAGKGTHVGLLYPNGAEFLVGMLAAARIGAVVVPFSTFATARELAEQLRH
SDTEILLSAGSFRSHDYASRLREVLGGDIPAGERLYCAAVPHLRHVFVDR
HPDGGVDPALLTAVEDDVDGSDPLTIVYTSGSTSAPKGVVHTHAALIEHQ
RNLNAIRGLGADDRLFCNSPFCWIGGIAFSVLATLVAGATLVCSNAEDPA
ATLDLLEATRPTITNGYVAGIAALAAHPSLPHRDLSSMRRGNLYPIMAPD
ARPADPDLRHHMLGMTETGSVVLLHPDVSDQPEHRRGSFGLPAPGFDTRI
VDPDTGAPVAAGEVGELCVRGPYVMQRYYKRSREECFDPDGWFHTGDLVR
TDDDGLYYFLGRRGAMIKTAGANVTPAEVERAITRATGAQAYVVGLPDRD
RGQVVAAAVIVDDPGDFDAAALREALREELSAYKIPRRITALTRDDLPVM
ASGKVDLPRLTKVFDVQR
119867846YP_937798.1 GntR family transcriptional regulator [Mycobacterium sp. KMS]MSAPDFAARPQLSEDVARFVRRRIFDGTYPAGGYIRLEQLASELGVSVTP
VREALFGLRAEGLLAQQPRRGFVVLPVTGRDIADVSNVQAYVGGELAARA
AHNITDDQLRELTAIQDALEDAYRRDDGEGAVRLNHEFHRAINVAADSPK
LAQMMSLITRYAPESVFPTIERWPAESVRHHRQLLTALAQRDDALARSAM
SEHLAAGAEPLIEHLKTRGVVQ
119867844YP_937796.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MRDTVICEPVRTPIGRYGGMFKDLTAVELGVTALQGLLTRTGIAPDAVED
VIVGHCYPSMEAPAIGRVIALDAGLPVTVPGMQIDRRCGSGLQAVLQGAM
QVASGNNDLVVAGGAESMSNVVFHSTDMRWGGARGGIAVHDALSRGRTTA
GGKNHPVPGGMLETAENLRREYGITRAEQDELAVTSHQRAVAAQKNGVFA
EEIIPVTVRTRRGEDVVDTDEHPRADTSMETLSRLKPILAKQDPEATVTA
GNASGQNDAASMCVVTTPEKAAELGLEPLVRLVSWGLAGVPPKVMGIGPV
PATEAALARAGLDLADIDLIELNEAFAAQALAVMREWKFTAADMERTNVH
GSGISLGHPVGATGGRMLATLARELTRRQGRYGLMTMCIGGGQGLAAVFE
RVTP
119867842YP_937794.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMSEVSDEDFREILAQTRHFVRSAVVPRESEILAEDKVPDDLREAAKSMGL
FGYAIPQEWGGLGLDLTQDVELAMEFGYTSLALRSMFGTNNGIAGQVLVG
FGTDEQKKQWLEGIASGDVVASFALTEPGAGSNPAGLRTKAVRDDAGDWV
VNGQKRFITNAPTADLFVVFARTRPADDRGAGIAVFLVPADADGVEVGAK
DAKMGQEGAWTADVNFTDVRVPASALVGGSEDIGYRAALITLARGRVHIA
ALAVGAAQRALDESVAYAATATQGGTPIGDFQLVQAMLADQQTGVMAGRA
LVRDAARKWVTDEDRRIAPSAAKVFCTEMAGQVADLAVQIHGGTGYMREV
PVERIYRDVRLLRLYEGTSEIQRLIIGGALVKAAQRTAANS
119867840YP_937792.1 alpha/beta hydrolase fold protein [Mycobacterium sp. KMS]MTTTYDEVDFTSMDTRCAARHYRSESDRLSGPYGRPVVVMAHGFGGTMDS
GLEPFADRLCAAGADVLTFDYRGFGASDGRPRQSVSVTRQLQDFHAAVVA
AQRLPGVDPVRVALWGSSFSGSHVIRVAAGRADVAAVIAMTPLTSGLAAS
RAAVAHRDVGAALRWSLVGAKSRVAVACGRAPSLMPLAARPGQPGALALD
GAYDSYLSIAGPTWRNEVDAAIGMELVKVRTAKEAKRIRVPVLVQIADFD
RFVPAESVARTAVQARAQVHHYPCDHFDVWPGHDWHDRAATDQAAFLTRV
FAQRSPARTVRTG
119867838YP_937790.1 dimethylaniline monooxygenase [Mycobacterium sp. KMS]MGQTSPRTAIIGAGISGLTAAKMLKDYGVAHTTFESSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKHRLSFKDFPMAEHYPSFPHHTEIKAYLDDYAETFG
LLDDIEFDNGVVRAERKIAGGWDIEDQAGERRHFDLLVVANGHHWDPRWP
EFPGDFAGESIHSHHYVDPHTPLELTGKRILVVGLGNSAADITVELSSRS
LRNKVTLSTRSSAWIVPKYIAGRPGDQFFRTTPHLPLSWQRKAIQLVAPM
LGTDPTSYGLPPANHKLFEAHPTQSVELPLRLGSGDVTPKPNVTRLDGYT
VHFEDGTSDDFDAIVYSTGYNITFPFFDPALISAPDNQIRLYKRMFLPGV
DDVVFIGFAQSVPTLFPFVECQSRLLAAYAVGRYALPGRAEMERTIDADQ
RLHAGHCTDRPRHTQQVDYFVYEHDIRARELPAGYERARRQRPVFANAAG
119867836YP_937788.1 hypothetical protein Mkms_1797 [Mycobacterium sp. KMS]MPAAQLDTPTPGLLELDRNPTWFDTASQCTIVLAQPSTEPELWAEYVRGA
QLSYHKHGVERALDTGALERGDDTALFCAGINQAGQVVGGVRAKGPYTAV
DECHAVVEWDGQPGLTAVRKMVGDRLPFGVVEIKSAWVSDDPEQSRALTD
VLARVPLHSMLLLEAQFAVATAAAYVLNRWLSSGGVLAAKIPATPYPDAR
YQTKMMWWDRRTYANHADPKQVSTFFAETRQVTAQLDRIGRLTSAAATV
119867834YP_937786.1 diguanylate cyclase/phosphodiesterase [Mycobacterium sp. KMS]MPRNLEVLVTAVAIDLMAVTAATSAQVSERVLGDLVSYLDVDASFLRHHD
HRVHASELVAEWPPRTSPGGPDPLKVVYFSDADPVFAQTEHLGEPAILRP
APADATGPRGAATVAEIPLRSGDVTTGVLGFVKFGDRVWEQDELNALTAI
ASLFAQVQARIAAEERLRYLADHDDLTGLHNRRALLRHLDDRLAAGRPGP
VAVLFFDLDRLKAVNDYLGHIAGDWFIRVLAERLQQGDEKKFIARLGGDE
FVVVPAAPTTADDAETLAHRLQAVLRERVSIDGELLTRTISIGVAVGTPG
RDTTSDLLSRADQAVLSAKGEGGNSISVFSEQMSQEITLRNDIELHLQSV
IDSGALVLHYLPEVDIRTGEILATEALVRWQHPTRGLLSPDRFIGVAESI
NLAGELGRWVLRNACAEFARWRAAGVGDRIVLRVNVSPVQLVTEGFVESV
ADVMADFGLERGSVCLEITESVVVQDIDTTRVTLAGLKEAGVKVAIDDFG
TGYSVLSLLKSLPVDTLKIDKSFVRDLGVNAGDLAIVRAIIALAAAFGLE
LVAEGVETEIAAQTLLDHGCHRAQGFLLSRPVPGEQMERLLAEGRIPVHF
S
119867832YP_937784.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAEQADRRTDATRQQILRAAARQFAIKPYGLVNLDDILSDAAVTKGAMYH
HFRSKYALASALVDQWLESTLRTVDETVALRRSAMETLVDLAFGTAVDDI
GEHVTRAGLNLLESVGRTDGLRRRAFDTSRAALVPLARRAVEEGDAADHT
PPEDVARLLVFLYLGVRQASDLDDAAAFLGDLERAWALVLPGLAATERLG
YLRTFVRRRSALAIKKARPLSTDTL
119867830YP_937782.1 putative PAS/PAC sensor protein [Mycobacterium sp. KMS]MERRRDGQDDRSPMSLLRDMPALVLLERFPVPVLAIAEDGAILFANGAFA
DMVGHRTQDVTAAHFTEIFHRLPAEDSAVTAVRAHADLVVELVHRDGSIV
RARMSKSALVRGDDPVALATFTDLTERLWAEGM
119867828YP_937780.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMDFSLTKEQELLRDGLTKFLSTRYELEKSRAAARTGAGWQPDIWRGFAEE
LGILGATLPEDAGGIGGGAVEAMVIAEALGHALVVEPFVDSVVVAGGLLQ
RAGGETASAVLEKIVEGTALVALAATEATSGDNWRDVSTTAEKDGADWVL
RGEKVVVTSAPLTGHLLVTARTSGGRDDEEGISLFLVDLSAVQGGLTMHA
YRTIDDRRAADITFDGVRIPGEALLGEEGRAWPSIARARDEGAAAVCAEA
VGAMRRVLADTVEYCKQRHQFGTPIGSFQVLQHRMVDMHMEVEQSVAATY
LAVLNLESDEMVRARAVSAAKATIGRAARFVGQNAVQLHGGMGMTEELAI
GHYFKRLTALQYEFGSTDHHISRYAQLTRP
119867826YP_937778.1 TM helix repeat-containing protein [Mycobacterium sp. KMS]MEDALRDMWRSVANFAPKLVAFLVILIIGWILAKLIAKAIDKILEKVGFD
RAVERGGVKKALARSDYDASTIVSKIIYYALLLIVLQLAFGVFGPNPISE
LIAGVIAFLPRLLVAVIIIVVAAAIAAAVRDIVSNALSGLSYGRMLANIA
SIAILGLGAIAALNQVGIALTVTLPVLIAILGTIGGILVVGVGGGLIKPM
QQRWEDYLSRAESEGRNMREHLNSRDRETTVLPATAGSPQPGYSPGGGQQ
GAGQYGYTEGAPRYSNEPQYQSDPRYPSAPQYPNDPGGRTSPTGPPTGPY
PTGQPTGYDDPSGGRHTGMPGGQQYPYGGDRGGQQ
119867824YP_937776.1 ABC transporter-like protein [Mycobacterium sp. KMS]MAGKTGKHAADTHDVIRVVGARENNLKNIDVELPKRRLTVFTGVSGSGKS
SLVFGTIAAESQRLINETYSAFLQGFMPSMSRPDVDVLEGLTTAIIVDQE
RMGANPRSTVGTATDAHAMLRILFSRLGEPHIGSPQAFSFNVASVSGAGA
VTFDKGGRTVKERREFSITGGMCPRCEGRGSVSDIDLTALYDDSKSLNEG
ALSIPGYSMEGWYGRIFRGCGYFDPDKPIRKYTKKELNDLLYREATKIKV
DGVNLTYAGLIPTIQKSFLSKDVDAMQPHIRAFVERAVTFATCPECEGTR
LTDQARSSKIKGCSIADVCAMQISDLAEWIRGLDEASVRPLLDGLGHLLD
SFTEIGLGYLSLDRPAGTLSGGEAQRTKMIRHLGSSLTDVTYVFDEPTIG
LHPHDIERMNTLLLRLRDKGNTVLVVEHKPETIVIADRVVDLGPGAGTGG
GEVVFEGTVAQLRRSGTLTGRHLDDRAALKKSVRQAQGALEIRGATTNNL
RDVDVDIPLGVLTVLTGVAGSGKSSLIDGSVAGRDEVVSIDQGAIRGSRR
SNPATYTGLLDPIRKAFAKANGVKPALFSSNSEGACPACKGAGVIYTELG
VMATVESPCEECEGRRFQASVLEYTLGGRNIADVLEMSVADALGFFADGE
AATPAAHKVLDRLADVGLGYLSLGQPLTTLSGGERQRLKLATRLGDTGAD
KKDVYVLDEPTSGLHLADVEQLLALLDRLVDSGKTVIVIEHHQAVMAHAD
WIIDLGPGAGHDGGRIVFEGPPADLVASRATLTGEHLADYVGG
119867822YP_937774.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MAPDERRLDDLKRLRKVRDRMDRDYAEPLDVEALARGVNMSPGHLSRQFK
QAYGESPYSYLMTRRIERAMALLRRGDLTVTEVCFAVGCSSLGTFSTRFT
ELVGVPPSTYRQQLADATAEPPSCVTKVVTRPVRNQEAPPAAPHLR
119867820YP_937772.1 putative transcriptional regulator [Mycobacterium sp. KMS]MSRGEIAEYLGVSLATVKGYVDFPEPDVTVGRNQGWAKETVDRWVASRRR
AK
119867818YP_937770.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. KMS]MTSPKLTDDAKKMLSKPNPAVISTVRRDGQPVSAATWYLLRDDDRVLVNM
DVARKRLEHMRNEPRVSLTVIDGTDWYSHVTLIGRVTEMYDDEGLTDIDA
LSQHYQGQQYPDRKRPRISALIEVDRVHGWGAQKNNDQPDGRG
119867816YP_937768.1 hypothetical protein Mkms_1777 [Mycobacterium sp. KMS]MYVRGMSGHDLQAAVTALRAAFDEVASCDVALLDRSELVAALDELEILGC
RLPTMSHRLLARLQSEATPQQMGAKSWREVLTVRWRISGSEANRRLTEAG
LLAPRQALTGASLPPVLPATAAAQAHGLINSEHVQVIRRAVDKLPGFVDT
VTREQFEVTLVRTAVGVGPKELKDAADLTLFLLDQDGPEPDDTERARKRG
VSRSKQRPDGMVELSGHLTPEAWAVWEVIFAKYAAPGMCNPDDPEPCTSG
TPSQEQIDNDHRTLAQRQHDAMVVIGRIALMSGELGQLNGLPVSIIIRTT
LEDLESRAGVGTTGGGTVVPIADVIRMAGHANHYLAVFDGATGSALDLFR
AKRTASAAQRIMLIARDGGCTKPCCTVGAYGCQVHHVDADWSDGGNTNVD
ELGLACGADNRSVDKDGGWSTRMNDHCEVEWIPPPRLDTGQARLNHYHRP
ERLLRPPDDPEPQGHHNTAASADSDDGDEIGDIQACTPPPADVDRPGGPA
PPEGRAA
119867814YP_937766.1 phosphoglucomutase [Mycobacterium sp. KMS]MAANPRAGQPAQPEDLIDVAQVVTAYYAVQPDPEDVAQQVTFGTSGHRGS
SLDAAFNEAHILATTQAIVEYRAAQGTTGPLFIGRDTHALSEPAWTSALE
VLAANDVVAMVDSAGRYTPTPAVSHAILAFNRGRGAGSTSSSRAGDLADG
IVVTPSHNPPRDGGFKYNPPNGGPADTDATGAIAKRANEILRDGLRDVKR
VPLARALQTAQRHDYLDAYIADLPNVVNLHAIRAEGVRIGADPLGGASVD
YWGAIAERHDLDLTVVNPLVDATWRFMTLDGDGKIRMDCSSPNAMASLIG
KIGDYQIATGNDADSDRHGIVTPDGGLMNPNHYLAVAIDYLFTHRPDWPS
ATAVGKTAVSSSIIDRVVDGLGRTLREVPVGFKWFVDGLIGGTIGFGGEE
SAGASFLRTDGTVWTTDKDGIILALLASEILAVTGSTPSQRYAELADKYG
APTYARIDAPADREQKARLAKLSPEQVTATELAGEPITAKLTAAPGNNAP
LGGLKVTTENAWFAARPSGTEDVYKIYAESFKGPEHLAEVQEAAREVVAA
VIS
119867812YP_937764.1 camphor resistance protein CrcB [Mycobacterium sp. KMS]MIVWAGVMLLGGAGAVCRFLLDRTVTSAVGRPFPFGTLAVNVTGAFVLGF
LGGLALSPHLALLMGTAFIGSYTTFSTWMLETQRLAEERRGWPAAANVLG
SVVAGLAAAAAGLWLGSLL
119867810YP_937762.1 acyl carrier protein [Mycobacterium sp. KMS]MQTSNSESVSAALTEILRDDMNVDIRRVTRESRLIDDVGLDSVAFAVGMV
AIEDRLGVALTEEDLLSCDTVGDLEAAIQAKVPSSPSGQ
119867808YP_937760.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMTLAAHTTEDYEELLGRVFDDQVKAWTAEAEASERFPRQLIEHLGRTGVF
TQKWGDGQQPDVAKLIALALELGRLGSAGIGVGVSLHDSAIALLRRFAKN
DYLRTICEQAIRGEAVLCIGASEISGGSDLQIVGTEVRSVRDGYEVRGVK
KFVSLSPIADHIMVVARNVDHDPGSRHGNVVVIAVPTSQVEAQAPYRKVG
AGPLDTAAVHIDTWVPGDALIARPGTGLAAISWGLAHERLSIAGQVAGAS
QRVIGITLARMMKRRQFGHTLYEHQALRMRMADLQARVDMLRYALAGIAA
GGRLDLRAAAAIKVTAARLGEEVLSECMHIFGGSGYLTDETPLGRWWRDM
KLARVGGGTDEVLWELVAAAMRPDYDGYDELIDSPTGDD
119867806YP_937758.1 hypothetical protein Mkms_1767 [Mycobacterium sp. KMS]MDAASAVAVGAIFVWLGMVLAISFLEAPLKFRAPGVTLQLGLGIGRLVFR
ALNACEAVLAVAVVVAFVAHQPSAGAAVGAAVALVCLLVQVVLIRPRLQR
RSDAVLAGAEGPRSHAHYVYVGFEAVKVIALVTAGVLLLAAS
119867804YP_937756.1 YbaK/prolyl-tRNA synthetase associated domain-containing protein [MycoMRLGELDFTPIADALDLVAEPVRRDVRRGGAQGLWVSAIDPGLADTAEFC
AQYGIAPEHSANCVVVEAKRAERVWYAACLVLATTRADVNGVVRKWLDAR
KISFAPTETAVSLTGMEYGGITPLGLPDDWPILIDEQVLAQPHVVIGSGV
RASKILAEPDRLTSLPRAEVLSIVKTG
119867802YP_937754.1 cytochrome P450 [Mycobacterium sp. KMS]MRRSHSPGSRADGSARDDGWVVTDLDLDLQALPLAPKNPLPYRQLLPLVR
HFHTGQEVLRQAAGPVIRLKLGPKWMIPEIVVVTSPAGIRDVLGRNHASA
ERCRVHDEVRDLGGESLFVLPNDPWIPRRRALQPVFTKPSVRGFGGHMSR
AAEMVGERWGQTAQVNLDEECRRLTMRSLGRSILGLDLDAKADLIAGPLP
VAAGYAADRALKPVRAPRWLPTPQRRRANAAVATMKAVTNDILQACRADP
ARDAPLVHALINASDPETGRSLSDDDICNELLVFMLAGHDTTATLLTYAL
WALGHHPDIQDRVAAEACALGDRLPTPDDVGRLGYTVQVLNESLRLCPPA
AGVGRMALRDVEVDGYRVEAGSLVGIGIYAVHRDPELWDRPLEFDPERFS
PENVKDRDRWQFIPFAGGPRACIGQHFAMLEATLALATLIRSHEIRSIDD
DFPLETPYTTVAAGPIWARVHRRT
119867800YP_937752.1 beta-lactamase [Mycobacterium sp. KMS]MTNGTPVVRTAIVRAAVALALVAASSCGYASSSAVNEGTQTAATTKVPAP
PPRASATRPAPPPPPVAPLAADFATVAKLVNDAIAARRLPGAVVSIGHGG
RVVFQQAFGSRKVAGAPGLDGLPAPAEPMTEDTIFDLASLTKCLATATAV
MQLYEQGKVQFDDPVQKYLPEFNRADDPQRARVTVRMLLTHTSGEEPDVN
LDDPWGLRRAEKGEGLHRALTSPLHSEPGAVYRYSDINYILLGALIEKVT
GEAEDTYVERSIFSPLGMGDTRYLPPAEACGPRRMRGTAIGWAAARQSGV
PAVCPAGTWNTSLFSRIAPTAHDDEGRRDPRTNPDWDQLLRGAVHDTTAR
RMGGVAGHAGVFSTARDVGIYAQALLDRLAGRPSNFPLKRATLELMTAPE
QPGSSPRQLEAANGTARHAIAHTPNTAHPLLAPSYPAIEGQNLRGFGWDI
DTAHSQPRGRVFPIGSFGHTGFTGTSMWIDPSSDTYVVLLANAIHPRGNY
PISELRGEVATAAAQALGLDDGATSAPR
119867798YP_937750.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MDVRSVADPSPPPGGVVVEVHATGLCRSDWHGWAGHDRGITLPHVPGHEL
VGVVAEVGAGVEKWRVGDRVTTPFVCGCGRCQWCLEGQAQVCPDQTQPGF
THWGSYAEYVALHAADANLVAVPDAVGDAAAAGLGCRFATAYRALSARAR
IRPGEWVTVVGAGGVGLSSVQIAVAFGARVIAVDREPAALALASRLGAEH
TVHADGADVAGRVHDLTGGGSHVAVDAVGSAATCADAIHSLRRRGRHLQV
GLLPDVTGHPAVPMDRVIAWELDVLGSHGMASGDYPGMMRLIEAGTLRPQ
AIVERVVGLTEGATLLSSLSVATPAGVTLIDPRLG
119867796YP_937748.1 apolipoprotein N-acyltransferase [Mycobacterium sp. KMS]MWGVNASRLGLAAAFVVGALPALAFPAPSWWWLAWIGVVPLLLVVRAAPT
ARTAALRAWCGMAGYILATQYWLLPSAGPLLLVLAVGLGALWLPWGAATY
LLLREPNTVGRTGAAMAVLPSAWVVAEAVRSFPGLGGPWALLGASQWNQP
ATLASASLGGVWLTSFLIVAANTAVAGVILNRQLPVRLVAAAVALACAAL
GPAWFWLGPAPPAGSTVRVALVQPGNIEDSAARQAAGEALTDDLRGRRVD
LVVWGESSVGVDLAGDPDAVARLADLSRRVGADLLVNVDARDRTGEISKS
SVLIGPGGVRGTYSKMRLVPFGEYVPLRPLFGWATRHTKAAAEDRKRGSG
IAVLHTEDLALGPLISFETTFSDLPRELVERGAQLLVYQSSTSTYQGSWA
QPQLAGMVAVHAAEVGHPAVHTGLSGVSSAFDARGRQLGWYAATESGVLV
VDVPLGLHTTTFQRFGNWVLAMALSILACGIAWLVIQHAGRGERLGTGSG
A
119867794YP_937746.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MTREHGRLHGKSAVITGAAFGIGRATAVLFAREGARLVVTDIQSEPLLAL
ADELRHAGADVEPVVGDVSVEYDAGRMIGAAVDRFGRLDVLVANAGIIPL
GDALEMTAAGWDEVMAIDGRGMFLCCKFAIEAMLPTGGGAIVCLSSISGL
AGQKRQAAYGPAKFIATGLTKHLAVEWADRGIRVNAVAPGTIRTERVKRF
PEEPGGSEYLAAVERMHPMGRIGEPAEVASAIVFLASDDASFITGAVLPV
DGGYLAQ
119867792YP_937744.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MRLCRPACGQGRIDNDMATNKRRRHTPDQIIRKLAEGNKLLGAGQELAEV
CRHLEITESTWHRWIAQYGGMKANEAKRLKELEAENARLKKLVANQALDI
DMLKEISAGNF
119867790YP_937742.1 cupin [Mycobacterium sp. KMS]MTLSRDELDEFAKSMARAGGRDSQHVGEKHLVVSSAEAHWIQTASPSQIG
LLLRIPASSIEIFLQRIPAGEASDLHRHVHESIHFVQHGSGWSEIGDQRV
RWSAGNFVYTPPWIWHRHYADDGLDVAMIVIENSRLLAAVDASQRESMGN
TSFADAFGANTE
119867788YP_937740.1 NAD-dependent aldehyde dehydrogenase-like protein [Mycobacterium sp. KMQRILLHVYKFHDATASSRTKVSMIVVANPRKIGAQAGPLVSHAQPERVC
RNIASTEGTKFSGGEPSQPDELPGYFAASTIVATLERASAVVQDMQDDIV
GSVLTLKEFDDEVQAISLANATPYGLAVAVWTRLNDAAIGLSREATAGFT
WFNGSRKNSPEMSCSGVDNPGCTIAGAAKETRIFGSYDPYPARQSWRIHR
SAAVSSILAGPPAAADWIPSIFDQCDEAAGGILADYGIGDVSCV
119867786YP_937738.1 3-oxoacid CoA-transferase subunit A [Mycobacterium sp. KMS]MSRTVVCDRAEDAVAGIDHGATVLVGGFGMAGMPTTLIDALIRQGAADLT
IVSNNAGNGDTGLAALLAAGRVTKVICSFPRQADSYVFDALYRAGKVDLE
VVPQGNLAERIRAAGAGIGAFFCPTGVGTPLVEGKEIRTIDGRDYVLEYP
IFGDVALIGAHVADQVGNLLYRKTARNFGPVMATAALLTVVEVSRVVDTG
QIDPETVVTPGIYVDRVLDLSAIPETSTEAAS
119867784YP_937736.1 fumarate lyase [Mycobacterium sp. KMS]MIDLFWPGDDLAGDLMSDGAFLSAMVAVEQAWLDGLVDAGIAPRQARADL
TILLADGDAATIARRAGADGNPVSALVLMLRERSAEPTARWLHRGLTSQD
VVDTALMLCTRDVLIRIGDEFAIQVRALTELAETHRDTSALARTLTQAAL
PSTLGAKFARWLTGVLDAAEPIAGLMASLPAQVGGAVGSLAAATELAGSV
EGAIALSDGLAATLRLAPTPPWHTTRWQVTRIGDALVSCCDAWGHIATDV
TTGCRPEIGELAEGHGGGSSTLPHKNNPVRSVLIRRAALTAGPLGSILHT
AAGATVDERSDGAWHTEWATLRTLARHTVVAAAHTSDLLSGLRVDPPRAA
ANLAAAESLLSEQRSMTELTGRAALPGYTGAADRLIDSTLGRACRFVKDA
P
119867782YP_937734.1 protocatechuate 3-4-dioxygenase subunit beta [Mycobacterium sp. KMS]MAFPLSGILPFANLNVVGTVGAVTTSIDSNPDGAVASQSEISAEIGAIES
AYQRAGVEETQPRLSYPPYRSSLLRHPTKDLHHADPEGVELWTPCFSERD
VHPLEADLTVQHSGEPIGERLVVTGRVVDGAGRPVRRQLVEIWQANAGGR
YIHKGDQHPSPIDPNFTGAGRCLTDEDGIYRFTTIKPGPYPWKNHRNAWR
PAHIHFSLFGTEFTQRMVTQMYFPGDPLLCLDPIFQAIPDQKARSRLVAS
YDHELSTHEWATGYRWDVVLTGSARTPIENLGRGAHR
119867780YP_937732.1 dihydrodipicolinate synthetase [Mycobacterium sp. KMS]MTTTTPLGSDARAWAAENLRGFYMCPVTPLTDEFELDEEGLRQNIDAFVE
MGCTGLVVGGFFAEGWNMTLAEWQRYHEVVAGATAGRLPLFTIILDHSAY
QAIEKMRFVESLGFTGAEIMNPSVQLKTDDDVVDYFDFVAPATGLALVLY
RTPVSGFVYSHDAVARIAEHANVVGIKNGTLSWTDSIALRHRFGDHLVIS
EPNERYWAHDAALFGGRVLYGELSLILYGKRRQELHQYTDLAFAGELAGA
LPVSAKVDAIRQVYEEVLIGRIAATGSYVAAMPYLKAWFELLGLRAGPVR
PPVKARLSAPEREVLQEKLTAAEAI
119867778YP_937730.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MTQDPESEARPSALVFDGATDSVGELRLPQRESELLPMANGPKMAGSYFS
RRETVCTEQLSAAEHLASEIFTPHRLRYSRRGQRLNARLSAARIGAVTVG
YLRYGADVELVNSTALDDYHINVPLTSHADSWCGPATAQATPTQAAVFLP
GRPAGIKWAADCGQLCVKFSRTDLEYELEGLLGRPAVRPLNIAHSMDLTA
DSSRAWRALLSVLYREVSRPESIVQHPMTGRHFEQLLIHGFLLAQPHYQA
MALAADQHAAPPPKVLRTALDLIEEHPERSWTTTDLAREVGISVRALQES
FKRHVGLPPLTYLREVRLIRAHAELAASSESAVTVARVAMKWGFGHLGRF
SAEYRRKFGVTPQHTLRAT
119867776YP_937728.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MRLCRPACGQGRIDNDMATNKRRRHTPDQIIRKLAEGNKLLGAGQELAEV
CRHLEITESTWHRWIAQYGGMKANEAKRLKELEAENARLKKLVANQALDI
DMLKEISAGNF
119867774YP_937726.1 cupin [Mycobacterium sp. KMS]MTLSRDELDEFAKSMARAGGRDSQHVGEKHLVVSSAEAHWIQTASPSQIG
LLLRIPASSIEIFLQRIPAGEASDLHRHVHESIHFVQHGSGWSEIGDQRV
RWSAGNFVYTPPWIWHRHYADDGLDVAMIVIENSRLLAAVDASQRESMGN
TSFADAFGANTE
119867772YP_937724.1 NAD-dependent aldehyde dehydrogenase-like protein [Mycobacterium sp. KMQRILLHVYKFHDATASSRTKVSMIVVANPRKIGAQAGPLVSHAQPERVC
RNIASTEGTKFSGGEPSQPDELPGYFAASTIVATLERASAVVQDMQDDIV
GSVLTLKEFDDEVQAISLANATPYGLAVAVWTRLNDAAIGLSREATAGFT
WFNGSRKNSPEMSCSGVDNPGCTIAGAAKETRIFGSYDPYPARQSWRIHR
SAAVSSILAGPPAAADWIPSIFDQCDEAAGGILADYGIGDVSCV
119867770YP_937722.1 3-oxoacid CoA-transferase subunit A [Mycobacterium sp. KMS]MSRTVVCDRAEDAVAGIDHGATVLVGGFGMAGMPTTLIDALIRQGAADLT
IVSNNAGNGDTGLAALLAAGRVTKVICSFPRQADSYVFDALYRAGKVDLE
VVPQGNLAERIRAAGAGIGAFFCPTGVGTPLVEGKEIRTIDGRDYVLEYP
IFGDVALIGAHVADQVGNLLYRKTARNFGPVMATAALLTVVEVSRVVDTG
QIDPETVVTPGIYVDRVLDLSAIPETSTEAAS
119867768YP_937720.1 fumarate lyase [Mycobacterium sp. KMS]MIDLFWPGDDLAGDLMSDGAFLSAMVAVEQAWLDGLVDAGIAPRQARADL
TILLADGDAATIARRAGADGNPVSALVLMLRERSAEPTARWLHRGLTSQD
VVDTALMLCTRDVLIRIGDEFAIQVRALTELAETHRDTSALARTLTQAAL
PSTLGAKFARWLTGVLDAAEPIAGLMASLPAQVGGAVGSLAAATELAGSV
EGAIALSDGLAATLRLAPTPPWHTTRWQVTRIGDALVSCCDAWGHIATDV
TTGCRPEIGELAEGHGGGSSTLPHKNNPVRSVLIRRAALTAGPLGSILHT
AAGATVDERSDGAWHTEWATLRTLARHTVVAAAHTSDLLSGLRVDPPRAA
ANLAAAESLLSEQRSMTELTGRAALPGYTGAADRLIDSTLGRACRFVKDA
P
119867766YP_937718.1 protocatechuate 3-4-dioxygenase subunit beta [Mycobacterium sp. KMS]MAFPLSGILPFANLNVVGTVGAVTTSIDSNPDGAVASQSEISAEIGAIES
AYQRAGVEETQPRLSYPPYRSSLLRHPTKDLHHADPEGVELWTPCFSERD
VHPLEADLTVQHSGEPIGERLVVTGRVVDGAGRPVRRQLVEIWQANAGGR
YIHKGDQHPSPIDPNFTGAGRCLTDEDGIYRFTTIKPGPYPWKNHRNAWR
PAHIHFSLFGTEFTQRMVTQMYFPGDPLLCLDPIFQAIPDQKARSRLVAS
YDHELSTHEWATGYRWDVVLTGSARTPIENLGRGAHR
119867764YP_937716.1 dihydrodipicolinate synthetase [Mycobacterium sp. KMS]MTTTTPLGSDARAWAAENLRGFYMCPVTPLTDEFELDEEGLRQNIDAFVE
MGCTGLVVGGFFAEGWNMTLAEWQRYHEVVAGATAGRLPLFTIILDHSAY
QAIEKMRFVESLGFTGAEIMNPSVQLKTDDDVVDYFDFVAPATGLALVLY
RTPVSGFVYSHDAVARIAEHANVVGIKNGTLSWTDSIALRHRFGDHLVIS
EPNERYWAHDAALFGGRVLYGELSLILYGKRRQELHQYTDLAFAGELAGA
LPVSAKVDAIRQVYEEVLIGRIAATGSYVAAMPYLKAWFELLGLRAGPVR
PPVKARLSAPEREVLQEKLTAAEAI
119867762YP_937714.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MTQDPESEARPSALVFDGATDSVGELRLPQRESELLPMANGPKMAGSYFS
RRETVCTEQLSAAEHLASEIFTPHRLRYSRRGQRLNARLSAARIGAVTVG
YLRYGADVELVNSTALDDYHINVPLTSHADSWCGPATAQATPTQAAVFLP
GRPAGIKWAADCGQLCVKFSRTDLEYELEGLLGRPAVRPLNIAHSMDLTA
DSSRAWRALLSVLYREVSRPESIVQHPMTGRHFEQLLIHGFLLAQPHYQA
MALAADQHAAPPPKVLRTALDLIEEHPERSWTTTDLAREVGISVRALQES
FKRHVGLPPLTYLREVRLIRAHAELAASSESAVTVARVAMKWGFGHLGRF
SAEYRRKFGVTPQHTLRAT
119867760YP_937712.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MRLCRPACGQGRIDNDMATNKRRRHTPDQIIRKLAEGNKLLGAGQELAEV
CRHLEITESTWHRWIAQYGGMKANEAKRLKELEAENARLKKLVANQALDI
DMLKEISAGNF
119867758YP_937710.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMVATVEQQLLLRCEMENFLFEEAELLNDGRFHDWLELCAEDIHYVIPVRV
SRERANGDGNSTTMTHWDDDYAGLELRVLRLDTEYAWAEDPPSRIRHHVS
NVRVRPGAGTDEYDVRSNLLVFRNRGDSPQHDLISAERHDVIRRSEMGLR
LASRRVVLDHAVVGTHNLANFF
119867756YP_937708.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MLVKALGYVGVESPDAKEWLAFGPEVLGMEAVEASSGSVLLRIDDADHRL
AVHHGERNRMLYAGWDVGSEEALEAAGESLHRQGIGFEVGTEEDCAARGV
LGFVTLSDPSGLRHELFYGQKVVPGSFRPGRAISGFVTGAQGLGHVVLAT
PDLAQADRFLRGVLGFKKSDEIYTFMDLWFYHCNPRHHSIALTRMPGVRG
LHHVMVEVQSFDDVGMAYDLCMSRNIPLSMTLGRHVNDRMVSFYVRTPSG
FDIEYGWDAVTVDEETWTVAQYDRPSVWGHQMVAQTPPGALEAATT
119867754YP_937706.1 class II aldolase/adducin family protein [Mycobacterium sp. KMS]MSSTPSGAGLDTERHAIALACRVLAARDLAPGILGHISLRVDRDRLLIRC
RGPRERGLAFTSAEDIRMVTLDGTAGGKGELDDGYQPPNELPLHTEVLRT
RRDVNAVVHAHPEAVVAADLAGLAVRPIVGAFDIPGFRLAAAGVPVYRRG
VLVRNRQLAQEMVAAMADRPVVVLRAHGLTSAADTVERAVLQAISVDTIS
RLSLQIASAGGTLADLPDADAAELPDLGNAFNETIAWRHELARLETHGLS
CHPSEKRSS
119867752YP_937704.1 oxidoreductase domain-containing protein [Mycobacterium sp. KMS]MTDVASRELGLGFLGIGQAVARIFQQYPDMSTLPYRVVAAADTRSHSLAR
FATEFSGQTYTNAEQLCADPSVDVVYIATPPELHREHALMAARHGKHMIV
EKPLAMSIDDCTAMVEAAQAAGVQLMAGHTHSFDAPVRAMAELVASGELG
ELLMVNTWNFNDFNRRPWPTSELRSTSGPVLNQGPHQVDIVRQIVGGVAR
TVRASTIWDDVRECVGGYTCHLGFESGASATLVYDARAFFDVAELHSWVA
EDGGRRSPQANQRVANNFAALSQNPDQLEVALEAQKEQGRYGAATTTEES
QELWGYSAPGEIIHHPYFGLTVVSCERGAIRQSPDGLVVYGQNGLQEIPV
ARTMRGRAAELAELHRAITEDRPVQHDGRWGRATLEVCFAILQSAYEDRE
VVLSHQVSL
119867750YP_937702.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. KMS]METIGSKTGSALPIDSSAFYDEAVYQRELDSIFKRSWLFVGHESMIPKPG
DFRTTYMADDAVIVCRDKESRVRVLLNKCRHRGNKVCQFDKGNANIFHCS
YHGWSYDTAGRLRSVPLAESAYGPQFDKASMGLVSPRVATYKGLIFACWD
QSAPPLEEYLGEGLLWYLDNFLLDCDPNGLQVVPGLHRYLMPVNWKLLAE
NFGGDQYHFAATHGSVSALSKAGQTARINFSIDEGQHYSVVLDGCAPHGL
LQLAVGKNFYQDDLAQAETLGTEAVDWLTERQRLQDERLATSPVQPYSFH
VANIFPNFSMIGMGTAFYGRGFIMWQPRGPRLTEVWEWCLVESSAPRAVK
ERMVFVLSQRQSAAGLVTPDDHENFERLSDALDTGVARDVPFNYSLGEDV
EPMESLVAELPGNVRPQISEAYQREFYRHWHRTMTEPA
119867748YP_937700.1 transposase- mutator type [Mycobacterium sp. KMS]MGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITNDNP
EIGADDMPALTA
119867746YP_937698.1 phage integrase family protein [Mycobacterium sp. KMS]MTAPHVGETPGLLAKLMAGVRNEFRSDVLEFDAEDPVFGGGSCLVDGCER
SARGRGLCPGHHQRWSNAGRPALDEFAASTDHRWRKQRPNQCCRARACGY
GSARGGLCQLHAQRWERAGRPDLDQWCEDPPPIKKPVPDARCRIEHCSLW
PQAQLAFCHTHANTWKANGRPDIEEFASRFASTEIPPNETIVLGSLTPQL
KLEMQYVLQFRHDERRGKLTPTIVARVVRLLAQAGVASLLEHDEDAWREH
SASLRTDTRSRGLLIYAYRTVVDLAEAGGWEAEYRRDVWRMHRLGFEGRY
TLQFNRIPQPWLREPAKRWIRLRLSRGLGLEAGGGRPVLAIARFAQFLAA
AGIDRIELIDRALLERYLADLHRELRPQHQGSHTGLLNGFFAAIRQHRWS
PDLPATAMFFTEDYPQRGEHLPKALAEHVMTQLEHPDNLDRWDNPTYRLI
TIILMRCGLRITDALRLRGDCITTDADGAPYLRYFNHKMKRDALVPIDPD
LADLIGAQRDRTSQRWPDGTPLLFPRPTKNLNGQLPLAIPTYREALGRWL
HACDICDEHGHQVRVTPHQWRHTLGTRLINRDVPQEVVRRILDHDSPQMT
AHYARLHDTTVRRAWEAARKVDIHGHTVALDPDGPLAEAAWAKQRLGRAT
QALPNGYCGLPVQQSCPHANACLTCPMFLTTPEFLPHHRAQRHQTLELIT
TAEARGQNRLAEMNRQVLGNLDTIIASLDTEAPAHEG
119867744YP_937696.1 transposase- mutator type [Mycobacterium sp. KMS]MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWG
QPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAE
SALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQ
FRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVL
GMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGA
AWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAVIWSPAVGVV
DVRHEASGSLVLLSGRGYLQPSRKQSLRRKSACYTGGFANLVG
119867742YP_937694.1 6-phosphogluconate dehydrogenase [Mycobacterium sp. KMS]MRRVGVIGLGGMGSALAASLLATDHYVVCFDIRPDVLRPIVELGAEAAAD
ARELAGACDVVLTFLPGPSQVLEVALGSERGVLAGLADGAALLDMSTCNP
EVAAIIGQAYDAAGRRFVDCPVSRKAPNMTVLVGGPSGVLGPDADVLAAV
SRTLVYCGHRGAGYATKLLNQHIKYSWYLASAEALLIAEAMGLNAGEVAD
AIAECSGGDSGLTTAAAYFRHDTESVRNRAPASTITKDSALAERMATNAG
IRSRTLEPVVDFFQSVAASEFRDRAYPESTELLQRIRSMPPK
119867740YP_937692.1 3-phenylpropionate dioxygenase subunit beta [Mycobacterium sp. KMS]MSATGGEISTRQDAVEKLLLQAEIADFLYREADLLDERRYSEWLGLLTDD
YEYSVPLRANVAYDDLAQLEQTQEGHDICWFDEKKETVALRVEQLMTGLH
WAEEPVSRVSHLVTNVRIEGVDGAEVDVSCRFLVYRNRVADETDLLVGRR
KDRLRRVAGDWQLCRRRLLLDQTVLLAKNLSIIL
119867738YP_937690.1 hypothetical protein Mkms_1697 [Mycobacterium sp. KMS]MSVIKADVEVCQGYANCVVAAADVFDIGDAGTVVILDDTVAESDEARIVT
AIRSCPVSALRLATV
119867736YP_937688.1 hypothetical protein Mkms_1695 [Mycobacterium sp. KMS]MRRTGPDVAAPPLPSLEGLTAQFYEHCRREELSFQRCSRCDRWRHVPRLT
CAGCGSNSWSWQRSSGRGVVFSHTVIHRALHPGFDEAVPFVCAVVEMDEG
VRMVARIVDLVADGTAMLVDAAVEVVYVHAADDVVLPAFRLPAAEVRGNG
RR
119867734YP_937686.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMSANMESLFDGLTILELGHVIAAPFAASLIGDFGAQVIKIEDPGSGDMLR
RSGPRKDGVPLWWKSAARNKSSVAVDLRLAEGQALVRKMVERADVVIENF
RPGTLERWGLGWEELHAANPRLIMLRISGYGQIGPESAKPGYGRVGEAMS
GAVHITGHPDRPPTHFGFSLGDVTTGIMGAFAVAGALFKREAIGDRFDGE
CIDLALYESLFRGIDWQVILYDQLNFVAERQGNQFQVSPSPVSDTYLSGD
GVWYTVATGTVRSVQSLLELLGGTTLRNDPKYATQELQMLHREELGEMVR
QWFAENNSDIVEKACASSGVVAARIFTPAEMFSSPTFAARQSLVEVADQE
LGPVRVTGVVPRLTNFPGSVRSTGPGLGIHGQEVLTEWLGMADSEYEALV
SSGVVGAVDVDGEVPGH
119867732YP_937684.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMTTTVPQDPPQAARVSRDVREEIEDFLFDEADLLDRDEFEEWLELLAPNV
HYFARVRQTLRRAGGPGFSERSMHLSDNYTSLKMRIQRHRTSSDWAEDPP
SRIRHYITNVRVRSGEDGDEYRVTSNALLVRTRGDEAKAETVSAERRDII
RRDETGLKLVQREILLDHTTLPTHNLSFWI
119867730YP_937682.1 MarR family transcriptional regulator [Mycobacterium sp. KMS]MSRNPEADEVWRAMTALVTDNRDSWRRATVDQTGLPFSRIRILLRLSRGS
MTVKEVAHAVTIDPPAATVAVNDLEDRGLVMRQTIPTNRRYKVVSLTDAG
WSMVATINAVDDPAPEALAALEGNELRALRDAIARVSAARQTLNESRGRI
AQRTTLSPA
119867728YP_937680.1 aldehyde dehydrogenase [Mycobacterium sp. KMS]MRTWTLPLGDATLQGQSVYDVEDPCTGDVLTQVPDCSSEDVDRVVATAHA
AQRDWALRTPRQRGTALRALATLMRDHSEELALLDAIDGGFPLPAMRDDV
TWAADVLELMADDALDLGGRTIPLSANLHYTLQQPYGVVARIVPFNHPVL
FAGSKIAAPLMAGNAVVLKAPDQTPLSAIRLAELAREVLPEGLFGVVTGH
GATAGAALVAHPLVRRIGFIGSPGTGRHIQRLAAEHGVKYVTLELGGKNP
MIVMPDADLEAAAKSAVVGMNFTTTAGQSCGSTSRLLLHEAIADEVIDLV
VDQVAAIKVGDPLVDGTDMGPVIDQAQYSKSLRAIESGRAGGASVLTGGG
RAQGVGSKGWYVAPTVLAGVAPQADVARDEIFGPVLSVLTVRDEAEAVEV
ANSVEFGLTAAVWTNDVSQAHRMAAGLDAGYVWINGSARHYWGLPFGGWK
SSGVGSEESTEELLSYTQVKAVTVTLD
119867726YP_937678.1 hypothetical protein Mkms_1685 [Mycobacterium sp. KMS]MRNSPAKVEPDDGDAAHSAGADAQPPSPEKTSKSASGCEAAVAPECLDRD
DVASIADRRGTFVRMLGFWLLPSIALLLALGAAYFKYQEGTASDEDRARV
ETVQVATEATVAMLSYTPETAAEKLKAARDRLTGPFRGSYTSLTEDVVIP
GAQQQRISATARVSAAASVSVSKNRAIVMVFVDQTTTVGKDAPTETDSVV
QVSLDKVGSHWLISGFEPK
119867724YP_937676.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MYLSKRVRLQLAIFAMVTVVAGGSMAFAYLRLPSLLFGVGRYQVTMKLQD
AASLYRDANVTYRGTTVGRVSDVRLSDAGVDAMLSLQSDTKIPADLDAHV
GSQTAVGELFVDLVPRSGDGAPLKNGDVIPADRTSVPPDINALLRAVNTG
VQAIPRDNLTTVIDESYIAFGGLGPDLARLTRGATTLAIDTRNNLPALTT
LIDDAKPILDTQTETSDSIQTWASNLAQVTNQLQLQDESVQGLLVNGPPA
ADQVRQLFERVQPTLPILLANLVSLGQVALTYQPNLEQILALYPIEIAGL
QGAALANRNTKQDYKGLFLSFNLNLNVPPPCRTGYLPAQQQRAPSEVDYP
PKPPGDLYCRIPQESGLTNVRGARNLPCVTRPGKRAPTVKMCESDENYVP
LNEGTNWKGDPNATLSGQPVPQPPPDPPPPVPVTAPIAVAEYDPSTGSYI
GPDGKQYRQADLGQNAAGQHTWQDMLLPPKDGDP
119867722YP_937674.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MTNSRTKLGLAIILVSLVVGGAIAVTRAAHELDRVHVVAYFDNSNGVFVG
DDVRIKGVRVGRIEAIEPQPTQVRITFWFDAKYPVPADAKAVILSPTLVT
SRAIQLTPGYTGGPTLQNNATIPRARTAVPVEFDEFRQQLERLTALLQPT
EPGEVSTLGSLVNTAADNLRGQGPAIRDAIIRLSQSVSALADHSPDIFTS
VRNLSTLVSALQDSTVLIRQLNQNLASVTGLLANEPTEVGDAVKNLNDVV
GEVTAFVAANRDTIGATSDKLTSVSQALTDSTDDIEQLLHIAPTTLSNAA
NLYQSAQGTLTGALNVANFSDPITFLCGAVQAASRLNNEQSAKLCVQYLA
PIIKNRQYNFPPIGVNPFVGATVRPNEVTYSEDWMRPDYVPPQPTLPAAT
GADPDAPPPLTGPTLPAEAPVPMPDPSNRQTDPAAGLPGMMIPHGGGS
119867720YP_937672.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MTNKISAVLWRLGIFVVVCALGAFALIAVFAQLRFEREQRYTAVFANVSG
LTSGDFVRIAGVEVGKVRTLTVRDDSTVAVEFGADDSVVLTDGSRAVIKY
DNLIGDRYLAIEEGAGGTTKLRPGDAIPLDRTAPALDLDAVIGGFRPLLN
ALDPTQVNTLTSQLIAAFQGQGATIGSILAQTAALTNTLADRDELIGQTI
VNLNVVLGSLAGHSDQFGKAIDSLSQLVHGLQARKQDISNGVAYANEAAR
SIADLLAQARPPLQKAVHETDRTATAVLADRDYFDNLLNTLPDTYRVMLR
QGLYGNYFTFYLCDLLLKVNGKGGQPVYIKLVEQSSGRCTPQ
119867718YP_937670.1 hypothetical protein Mkms_1677 [Mycobacterium sp. KMS]MSAGVVFRQRFPGTARSLSQWRANWRDLGDQARFYGQSISSTVQAATTYR
AEVLRQIAAIGLGAGSLAVVGGTVAVVAFLNLSTSAALASQAYNQMSQVG
VEALAGFTSAYVNVRLATPASSAFAFAATIGAGTTAQLGAMKINEEIDAL
AVMGIRPIAYLASTRLLAGVIVVVPLYCVALLMSFFSVRVITTAFYGQGS
GVFDHYFDTFLNPQAVFFSFAVTVAAALVIMLIHTYYGLNATGGPAGVGE
AVGRATRTSLIASQMVILLVTLALYGQTGTFNYAG
119867716YP_937668.1 intradiol ring-cleavage dioxygenase [Mycobacterium sp. KMS]MAASPRWQCDRAAGASGAIQFHGVITDEDGRPVPNVLIETWHAAGDDDNA
ATKIGRPRCDGRNYTRPKSVITDQQGRYSMRMVPPRAPEHGAAPFIAVSV
HARGLLDRLITRAYLPGCHLAKDPLLRRLPAERRQALIATRDDIGLRFDI
TLRPAHGVRVETFVEPQQEAAT
119867714YP_937666.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMLKSSVEDRRARAAYLVDELLGAYARAVDDQDFTAWLALFATECAYEVRA
MENVREGLPLAYMMDDCRERLADRVKMIQEVWAGTVEPYDTRHFQQRTAM
RELGEDRWEVRSNVLVTYTGAPGEPGILVSGYSEDVVVLDDETALFQQKF
VVVDNTPPRYLVYPV
119867712YP_937664.1 hypothetical protein Mkms_1671 [Mycobacterium sp. KMS]MVVAATSRGVFTVSGDGKARAWPELPGQVMAMAVQDERVAVAVHKHGVFL
ATVGADHWTDLGDGLAHRDVRALAFDPHTPNALYAGTEPAHLLRWQDGIW
AECGNVLGVPEAKRWSFPIRPGIAHVRTIAVHPLEADVVYVGIEVGSLLI
TRDRGQTWEEIDGLGHDIHRVVLHPEAPDRLIVTTGQDTKPYRGGKGIYR
STDRGSSWVQSNNGLGERNYTEDAIVVHPADPDVVFLAAADGIPPKWAAV
RRLVMGAINGNVYFLSPSKLRRRRGADVGFFRSNDGGASWVRLNSEDDRG
LFDMVWALEGELTEGGELLLYHGTTAGGLYVSEDEGHTWKCLADGLGAIT
HIATPKKGTAQ
119867710YP_937662.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MTAGDRRVAIVTAAAAGIGKAIALRWCREGGCCVMADTDGEGLDAAVHEL
AESGAAVCGVAGDVCLSDVANSVVERALTEFGRLDTLFNVVGGSLARNVE
EISEEQWRSQIDMNLGSVFQMSKPVIPLLRQGGGGSIVNVASTAGILAEN
RCSAYSASKGGVVLLTKNMALDFARDNIRVNAIAPGGTRTPRIERFLAEH
PEHASMMVDLCAMQRFAGPEEIAAPAVFLASPEASYITGAVLPVDGGMTA
GVTFRAFEAV
119867708YP_937660.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMNAVAVDRDTREAVEAFMFREAELLDGGQFREWLGLLDPDIRYVVPVRTT
REDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRTRHFVSNIR
TVAGPEADELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLAR
REVLLDHSTLPIDNLSVVL
119867706YP_937658.1 4Fe-4S ferredoxin [Mycobacterium sp. KMS]MIESIDETTCDGCNVCIDSCPTGVIRLVEGDEPWSTTKWRAKIIYPNDCH
SCRLCAIDCHVDAIVVSHALVIPDPFLPGVEPLDGSRDAPPDEKKT
119867704YP_937656.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMNAVAVDRDTREAVEAFMFREAELLDGGQFREWLGLLDPDIRYVVPVRTT
REDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRTRHFVSNIR
TVAGPEADELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLAR
REVLLDHSTLPIDNLSVVL
119867702YP_937654.1 hypothetical protein Mkms_1657 [Mycobacterium sp. KMS]MAIQFLTDDWATAVTDAANADERFRIAAKGHDVVLRVSVSQSPASDDYYM
HFSDGSLIVGIGSPPRTPDVEAELSYETNVELSRGALNGQTATMTGQMKA
VGNMMKMMSIGKAQDRLAELESGLDIDY
119867700YP_937652.1 dihydrodipicolinate synthetase [Mycobacterium sp. KMS]MRDTKLTVDDITGVVGIIPTPSIPTADQPGTAFSVDLDEAAKLADAMVRG
GVDVLMTTGTFGECASLTWDELQSFVATVVDAVAGRIPVFAGATTLNTRD
TITRGRRLGELGADGLFVGRPMWLPLDDAGIVRFYRDVAEAVPNMALVVY
DNPGAFKGKIGTPAYEALSQIPQVVAAKHLGLLSGSAFLSDLRAVSGRVR
LLPLETDWYYFARLFPEEVTACWSGNVACGPAPVTHLRDLIRAGRWDDCQ
ALTDELEGALETLYPGGNFAEFLKYSIQIDNAQFQAAGFMRTGPTRPPYT
EVPESYLAGGREAGKNWAALQQRYASLAVSNH
119867698YP_937650.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
119867696YP_937648.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMSGIRELCRSRRGLLRHRRPGTRGGPQDGGPFRGQDPGRGGCAQLSGGSV
GSRRRMTSRVVIVGSSVGGVRTAQALRSQGYDGDIVLVGEETALPYDKPP
LSKALLAGTSDIAAATLLTRDAAAADAIELLLGRRAIGVDVAACQVEFAD
DEPLRYDHLVVATGASARPSPWGHGSGVHVLRTLEDCLRLRADLVAGARL
VVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSRVLTEEIGGWFVDLHR
DHGVHTRFGVGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVPNDGWL
MPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTN
AVDQASCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPLV
VGDRLSDNRFTALYPDREQRLSGAAIVNWPRALIECRRALKAGSDLETVR
ERLELLTNPPDTAATRSP
119867694YP_937646.1 hypothetical protein Mkms_1649 [Mycobacterium sp. KMS]MSSNRPGEGAQSPPQSGCEELATLLAGATGDALNVANEFAEVVVRRVTTR
NGARLLIQAPKSAQWVSLDALEIEALTWQNPATLAAMVGNAGTPLILGDE
I
119867692YP_937644.1 ring hydroxylating dioxygenase subunit alpha [Mycobacterium sp. KMS]MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQ
PGDYVVRQVLQDSFIVARDSAGEIRVMFNMCLHRGMQVCRAEMGNASNFR
CPYHGWSYRNDGRIIGLPFHQEAYGGDAGFNKTGQTLLPAPSVASYNGLI
FLSMDPDAESLEDYLGDFRFYLDFYTKQGPNGLEVRGPQRWRVKANWKIA
AENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWAGRGGGTTYKL
PEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKA
DSYKAYLMCFGSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLAD
DARVVDTLSSAQFHGPGYAQLGYNENNQRELLRLWADYLDMPPLRVDPAT
VLTDNPQGIEPMVQTNGGAVAGIDSESATTSVTL
119867690YP_937642.1 hypothetical protein Mkms_1645 [Mycobacterium sp. KMS]MTSEKSEADTEMPGGAPDLPAFIATIDAFLRLEKRRKSEPMFAAVLTDDF
QIGFRGGHQWKGRDGLQMYLNQRDGIFDERLELRHVLSYAPVNGGVVELT
TRLEFYFRRWKAPSLVSEEFTGSAFRTWLIRIADDEMRVKRVIIDGFANL
NENARAVFAIPDEGFDE
119867688YP_937640.1 putative PAS/PAC sensor protein [Mycobacterium sp. KMS]MGSFDQDGADCTGICRRKASTSGWWRFYFADERWQWSPEVERIYGYQART
ARPTTELVLSHKHPDDYEHVAATLKDIRRLHNPFSTRHRIVTVQGDTRDV
IVIGERLRKNCGNTIGFYIGVTPSPQSRAALVREAVAEFKDRRAH
119867686YP_937638.1 hypothetical protein Mkms_1641 [Mycobacterium sp. KMS]MTRKDGTGYVQVLYRLDGRQTSMSFEDLKSATKFKKLADRFGPAKALEVI
GTDPELSTMTVGEWLEHHITHLTGVRKSTLYDYRSYAQKDIGPVLGGLPL
AALSRDDVASWMQTLADKGASGKTIANKHGFLSSALNAAVRAGRIPSNPA
SGHRLPTSERREMVCLSRGDSDMWDDEAIDTERQREQDHAALARLLQARG
ESHAAAIVAVSYYSDVCVDNWNGGQYEACLAVPAELYAQAGSEFRDAIDQ
PCQAIVGEDCYRSLNISVRRSPVEPEWIATIVNAIDRRWVASERVDIEAL
GPAQWPSNSVQLVHRG
119867684YP_937636.1 hypothetical protein Mkms_1639 [Mycobacterium sp. KMS]MVLISYPIAMVLLAVLAVVVGGEISQGALMWGALCGVSQGFGVWWFYAAL
GSGPISVVSPLTAVLVAGLPVAVGLALGERPGLLAAVGIPVALVAVVLVS
REATDEDVRTHRFTKRVAWLTVGSGIAFGLNFVLIDQAPPAAGLWPLVFA
RVAATALVVLIAAISGEMKAPTGVPLKLAVLAGVLDTGANVAMLLALQAS
LLSLSGVLMSLYPAATVLLAIVVLRERVTRWQGLGMALALGAVAMIAAG
119867682YP_937634.1 cell division protein FtsX [Mycobacterium sp. KMS]MRFGFLINEVLTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSKD
IYLDRVESQVFLTPEVSANDPTCDEDPCQSLRTQLEERTDVQSVVFLNRD
DAYDDAIRKFPQYKDVAGKDAFPASFVVKLVDPEQHQEFDKAMVGQPGVQ
GVQNQKDLVDRLFAVLDGLSNAAFAVALVQAIGAVLLIANMVQVAAYTRR
TEVGIMRLVGASRWYTQLPFLLEAMLAALIGVVIAIAGLVVVRAAFLENA
LNQFYQANLIARIDYADILYISPILLIVGVAMAGVTAYVTLRLYVRR
119867680YP_937632.1 hypothetical protein Mkms_1635 [Mycobacterium sp. KMS]MILRRLLRFMQNDKRVWPRYMPGGRVRTSTLGLIVAFIALFWLYQVYEPP
VRPAQNPAQQVVPPGFVPDPDYTWVPRTQVEAPVTTTWRPPRTSTTTTTP
TTTSPTETPTTTTPTSPTTTPPSTTVIDPDGPGLLPPRTITETPAPGAGP
LPSPGLPPPLP
119867678YP_937630.1 peptide chain release factor 2 [Mycobacterium sp. KMS]MDPDRQADIAALAATLTTVERVLDVDGLRDRIQKLEQEASDPNLWDDQSR
AQKVTSELSHAQNELRRVEELRQRVEDLPVLYEMAAEEEGQDAENAGAEA
DAELAKLRVDIEAMEVRTLLSGEYDEREAVVTIRSGAGGVDAADWAEMLM
RMYIRWAEQHDYPVEVFDTSYAEEAGIKSATFAVHAPYAYGTLSVEQGTH
RLVRISPFDNQSRRQTSFADVEVLPVVETTDHIDVPETDLRVDVYRSSGP
GGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVAAMRVLQAKLLARK
KQEERAELDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPSAVL
DGDIDGFLEAGIRWRNRRDDD
119867676YP_937628.1 hypothetical protein Mkms_1631 [Mycobacterium sp. KMS]MSDHADILEHMFEASETALIERIAALERAKSAAAAAQARATALLDEKRRA
AEAAAGVPANKRGRGLASEVALARHDCPNKGGRHLGFARALVHEMPHTLA
ALECGALSEWRATLIVRESACLSVEDRRMLDAELCRDVSRLEGLGDKRIE
AEAKRIAYRLDPQAVVDRAAKAASERTVTCRPAPDTMTYVTALLPVAQGV
AVYAALKRSADTTFDDRSRGQVMADTLVERVTGCPAEVAVPVAVNLVITD
EALLGGDPEPAVISGYGPVPAAVGRRLVDAAVTDKRSKATLRRLYRRPRS
GALVAMESRSRCFPKGLAAFIDLRDQTCRTPYCDAPIRHHDHARPHRAGG
PTSAANGLGECAACNYAKEAPGWRVATSCDAEGRHRATFTTPTGTQYHST
APPSPGMTVVNLSDLEVRIGIELAAFRHAA
119867674YP_937626.1 histidinol-phosphate phosphatase [Mycobacterium sp. KMS]MSTGSSSVADDLALALRLADHADAVTVDRFRALDLHVETKPDLTPVTDAD
RSVENDLRRALAGERGDDSVLGEEFGGTAVFSGRQWVIDPIDGTKNFVRG
VPIWATLISLLNDGVPVVGVVSAPALHRRWWAADGLGAFVTVSGESPRRL
SVSKVAELDSASLSFSSLSGWAKRGLRDRFIDLTDAVWRVRGFGDFFSYC
LLAEGAVDIAAEPEVSLWDLAAIDILVREAGGTFTNLDGAAGPHGGSVVA
SNGLLHDAALGHLSR
119867672YP_937624.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMAINLELPKKLHAVIEKAHQGAAEMLRPISRKYDLREHDYPVELDTLATL
FEGISEANTISFAGAEAFRDAEDGPKGNVNGGNMSAVLNVTEISWGDVGL
MLSVPRQGLGNAAISGVATDEQLERLGKGVWAAMAITEPGFGSDSAAVST
TARLEGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGRAAIKSFIVPRD
HPGVTVERLEDKLGIKASDTAVIRFDNARIPKDNLLGDPEIHVEKGFAGV
METFDNTRPVVAGMAVGIGRAALEELRKILTDAGVEISYDKPAHAQSAAA
AEFLRLEADWEAGYLLTVRSAWQADNAIPNSKEASMAKAKAARVGSDITL
KVVEMAGTVGYSEESLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLTS
AQLK
119867670YP_937622.1 hypothetical protein Mkms_1625 [Mycobacterium sp. KMS]MRASLTACVLAAGLLVGCSGGGQPPTDAAAVHVHDAWVKAADGGMTAAFA
HLTNGADREVRITSATTPAAARVELHEVVRDGGMPTMQPKQGGIALPAGA
DVELLPGGDHLMLMDLTAPLTPGSDVEITATFDDGSTLPITAQVREFPGA
DEHYGGGHHG
119867668YP_937620.1 hypothetical protein Mkms_1623 [Mycobacterium sp. KMS]MTSRAGALCGVLVGACSGLFAVSAHALAGGDVPTGPTLVLVALVCAAVGA
FAGANGRAQAAGLIAAVGAGQLLTHIVLAVTAGHHGGGHEVLPSAPMMLA
HALAAVALGLLICLVGHLYRVCVSVLCWLTLTLVHRGRPSAPRRHRTTSI
VVQLLLLRSGLGMRAPPSAVSFGG
119867666YP_937618.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MNSFQALVARQSDDKIDTAVETLEESALPPGEVTIRVHYSSVNFKDALAV
TPKGGVVRDYPIVPGIDLTGEVVASQSDEFGVGDLVLAHGYDIGTGKHGG
YAEFARLPADQVVALGALSPREGAAIGTAGFTAAMSVEALTERGIRPDDG
PIVVTGASGGVGSVSVDLLSALGYHVVASTGKPEQADLLRALGATEVIGR
LPEDPDVKPRPLGKARWAGAVDCVGGATLADVLSTLAYGGAVAASGLTGG
PALNTTVMPFILRGAALLGIDSVLLPIGPRRELWARLGGALKPPHLADLS
HDVDVKDVVEVIDEVRAGRYSGRAVVRVAGGF
119867664YP_937616.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPRPRSSGGGRLSVDDWIHQGYVIVAEEGLAALKVDRLCDRLGVTKGSFY
WHFDDMPAYRAALVAAWGRLRDEDCRRLDDMAGLPPRERLSQMMSELVSA
PHWTMERAMREWARSDEAVAASMRAADRALVGRLRRALLDDGFDEEDADL
RANAIFAAGVGFIHLSGPTPEAGQASRRDRFLELMLRR
119867662YP_937614.1 hypothetical protein Mkms_1617 [Mycobacterium sp. KMS]MPGLRDTVTHTFQKRIANPVMRRLPFQTLLETTGRKSGQPRRTPLGGKRI
GDQFWFVSEFGERSQYIRNIKADPHVRVRLRGRWHTGVAHLVPEDDPHAR
LRELPQFNSFGVRTFGTDLLTVRVDLTG
119867660YP_937612.1 homogentisate 1-2-dioxygenase [Mycobacterium sp. KMS]MESFVHLRKGKTPRRPHADLDGQKDDELGRGGFTGRTANMYRRNDPTAFR
TVGPLRPIDVLGDQLKPGDATDADGAPLLMFSNADCQVLLSRRSQEMPYF
ARYVDGDLLSFVHTGSGLLETEFGPLRYRAGDWVYIPKACTFRQIPDTES
TLLMIQATDEFRVPPAGPLGRHFPFDPSQAEIPEPAPIDDGVGPQVDGEY
EVRLFHEGGPTSLFYQHHPLDVEGWRGDNFAFTFNIEDYNVVTSDSVHLP
ATAHLFMQATGVYVMNFLPKPAEGVPGTERTPWYHRNVDYDEIAFFHGGT
LYGIPMPPGLISHAPQGVHHGAPEKARERARRKFDEYQRVDWQVIAVDTR
RRLIPSPEVLANDLGQHS
119867658YP_937610.1 formyl-CoA transferase [Mycobacterium sp. KMS]MAGALDGIRVIEVGTLISGPFAGRLLGDMGAEVLKIEPPAAPDPLRTWGQ
AELDGHHFFWTVHARNKKAITLDLRTPRGREIFLELVEQTDVIVENFRPG
TLERWDLGYDVLRERNKGIILVRVSGYGQTGPDAHRAGYASVAEAASGLR
HLNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRTVTGEGQVVDTAL
TESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYRTADGSWVVIAA
NQDTVFRRLCAAMGQPELATDDRFADHRARGRNQDELDKIIGDWAAERQP
GDIIETLSAAGVIAGPINTVAEVVDDPQLRARGMLAEHWDERVDRAVLGP
GIVPVLSESPGSIRNAGPAHPGQHNIEVYTGLLGKTAEEVAQLQAEGVL
119867656YP_937608.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAPESSTLSSKGRQTRLAIEQAARKLFAERGFHGTTLADITSAAGKSPAV
FYRYFDDKEDLLAALAQSFLHDVVAPSGLSVPLPSSPDDREFFTTVVTGY
WNIFKQNIGIMIAVAQLAAAQQRFADLQHEFRRFGMDVIAASVRHAQSQG
YGAELNAEYTAAAIALLFENFTVVMVGTSGLGVQMSDADAIATLSTIWKK
TLYGY
119867654YP_937606.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MRTELEAVLRPILGEVAVENLTTLTGGASRTTWAFDAVTPDTRRALILRT
GPPDEVHAGMELEARAQQRAAAVGAPVPHILTADNDAAALGNPYLICEAI
GGETIVRRIYRSLDDAGRRRLLTQCAEALAAVHRADPNGIGLTESDEITE
WRERLDEMGDTTATFEWAFRWLAAHRPPPSPHRLVHGDFRMGNLIVDDTG
LVAVLDWELVHVGEIYEDLAWFCIRAWRFGASERLGAGGLGSVEDFLTAY
ETASGEALDRSAFRWWLTVATLRWGVICRFQAERHLSGQTPSVELAAIGR
RVCETEWDLLDLLEGGGPR
119867652YP_937604.1 type 11 methyltransferase [Mycobacterium sp. KMS]MPETTPPKSLFDDVYAGGAAPWVIGEPQPAVVDLERRGAISGAVLDAGCG
AGEHTILLTGLGYDVLGVDFSARAVELARANAAARGVNARFEVADATRLD
GGPRFDTVVDSALFHVFDDIDRRRYVDSLASVCRPGAVVHILALSDAGRG
FGPQVSEADIRTAFTDGWRVESVETTTYRGVVGPAHADALGLPVGARVDE
PAWLARVRRS
119867650YP_937602.1 response regulator receiver protein [Mycobacterium sp. KMS]MAAPPRTLRILVYSDNPQTREAVRLALGKRIHPDLPELGYLDVATAPMVI
KQLDAGGFDLAILDGEATPAGGMGVAKQIKDEIADAPPILVLTGRPDDAW
LATWSRAEAAVPHPIDPIRLGDAVVSLLRLSAQQ
119867648YP_937600.1 NADH dehydrogenase subunit C [Mycobacterium sp. KMS]MTEANGTTGGGAGDPEVIDVRRGMFGAKGSGDTSGYGRLIRSVALPGGSP
RPYGGHFDEVVDALAAALGQDLYDASVERIVVYRDELTLEIARARLPVVA
KTLRDDAALRFELCLGVSGVHYPGDAGRELHAAYPLMSITHNRRIRLEVA
APDDDPHIPSLFSVYPTTDWHERETYDFFGIIFDGHPSLTRIEMPDDWVG
HPQRKDYPLGGIPVEYHGARIPPPDERRAYN
119867646YP_937598.1 NADH dehydrogenase subunit E [Mycobacterium sp. KMS]MREEETAVSVFLELGQRPDEPGPPVGGPTAYPADVAARLIADAARIVTRY
PQARSALLPLLHLVQAEDGCLTSAGIAFCANQLGLTDAEVTAVATFYSMY
RRTPTGDYLVGVCTNTLCAIMGGDEILDALQDHLGVAAGQTTDPAEGLAA
VTLEHIECNAACDYAPVVMVNWEFFDNQTPASARDLVDSLRAGTPAAPTR
GAPLCTFRETARTLAGLADPRAATNPGGTGEATLAGLRVARANGMAAPDP
AETEGEGTQPDPEIVEAADSTRDEPAPGPSAAVPRPGDDSEPGS
119867644YP_937596.1 NADH dehydrogenase subunit G [Mycobacterium sp. KMS]MTQTADTGTSNAPAVEMVELTIDGATVSVPKGTLVIRAAELIGIQIPRFC
DHPLLDPVGACRQCLVEVEGQRKPMASCTTTVSQDMVVHTQFSSEAADKA
QRGVMELLLINHPLDCPVCDKGGECPLQNQAMSNGRAETRFTDVKRTFPK
PINISSQVLLDRERCVLCARCTRFSQQIAGDPFIELLERGALQQVGIAPG
EPFQSYFSGNTVQICPVGALTGTAYRFRARPFDLVSTPSVCEHCASGCAQ
RTDHRRGKVLRRLAGDDPQVNEEWNCDKGRWAFTYTDVGDRIATPLVRDA
DGVLQPASWSEALAVAAAGLAVANARAGVVVGGRATVEDAYAYAKFARMV
LGTNDVDFRVRPHSAEEADFLTAHVAGRPMQVTYADLENAPAVLLAGFEP
EDESPIVFLRLRKAVRKQGLQVLSVAPFAGRGLTKLSGRLVTAAPGGEAA
ALDALTDEPLLRLPGVVILVGERLATAPGALTAAARLAAATGARLAWIPR
RAGERGAVEAGALPTLLPGGRPVTDDSARAQVAAAWHTDALPDGPGRDTG
EILDAARSGALSALVCGGVDVTDLPDPHAALAALAAVPFVVSLELRESEV
TRAADVVFPVAPVAEKGGAFLDWEGRLRSFGPALPSNAIPDLRVLNFLAD
EMGVDLGLPDAQTAGAELGRLGWWDGPRPHCAHEAPAPPHVGPGQAVLTG
WRMLLDLGRMQDGEPHLAGTAPPAVVRLSGPTADAIGAAPGELVTVGTER
GQVTLPLTVTDMPDGVVWLPLSSRGSQVHRQLGVSTGAIVSIAASGGRTA
P
119867642YP_937594.1 NADH dehydrogenase subunit I [Mycobacterium sp. KMS]MPKLWDAVAGFAVTFGTLFKKPITEEYPEKPGPVAPRYHGRHQLNRYPDG
LEKCIGCELCAWACPADAIYVEGDDNTADERYSPGERYGRVYQINYLRCI
GCGLCIEACPTRALTMTNDYEMADDNRADLIWGKDKLLAPLQDGMLAPPH
PMAPGATDDDYYLGRIGPATEDVR
119867640YP_937592.1 NADH dehydrogenase subunit K [Mycobacterium sp. KMS]MNPDNYLHLSALLFTIGAAGVLLRRNVIVVFMCVELMLNAANLAFVAFSR
MHGQLDGQVVAFFTMVVAACEVVIGLAIIMTIYRARRSASVDDANLLKH
119867638YP_937590.1 hypothetical protein Mkms_1592 [Mycobacterium sp. KMS]MSPPDIATWLVAGYALALVLVAWGFDLMAKRASHRAAGWRTGGFVYHPDH
DAWKCPTDQWLWPTSFDPNNRVMRYRAKPTVCNSCPVKADCTTSPHGREI
SRQVDPWPFSEAGRFHRGIACAIAGLAFVMPLAQAAITHSTADVLVSATT
GLIVAVTCLPLFRHLWSTQVIAPEHLPHRTAHEESVAAAIDKYSTRWGVG
PSKKDSGAR
119867636YP_937588.1 NADH dehydrogenase subunit L [Mycobacterium sp. KMS]MSTAVWLLIALPLAGAVVLLLAGRRSDRWGHLLGTAAAVASFVVGVVLFA
GMLGRPAEDRAVHETLFSWVPVGDLQVDFGLQLDQLSMCFVLLITGVGSL
IHVYSIGYMAPGAQLAERPTDTGPSRRLFFAYLNLFLAAMLLLVLADNYL
GLYVGWEGVGLASYLLIGFWSYKPSAATAAKKAFVVNRVGDMGLAIALMI
MFATVGSVSFAGVFGAAPQLGEGTLTAIGLLLLLGACGKSAQVPLQSWLG
DAMEGPTPVSALIHAATMVTAGVYLIVRSGPVFDLAPTAQLAVVIVGTVT
LLFGAIIGCAKDDIKKALAASTMSQIGYMVLAAGLGPAGYAFAIMHLLTH
GFFKAGLFLGAGSVMHAMDDEVNMRRYGGLRKALPITFATFGLGYLAIIG
VPPLAGFFSKDGIIEAALGAGGVKGWILGGAAILGAGITAFYMTRVMLMT
FFGEKRWAAVGDGPEVHPHEAPAVMTVPMIVLAVGSVASGGLLAIGGALS
HWLEPVVGTHEETHAVPVVVATIVILSVVAVGIAVAYRMYATREVPAEVP
VGSALTVAARRDLYGDALNEAVFMRPGQAVTAGMVSVDDRAIDGAATGLA
TLVARASNGLRGLQTGFARSYALGMLGGAALVVAAILAVNLW
119867634YP_937586.1 NADH dehydrogenase subunit N [Mycobacterium sp. KMS]MIPTPTVEYGLISPMLIVVGAAIAGVLVEAFLPRRSRYAAQLTLALGATV
AALAAVVVVSRQMSGEIGRSAVMGSVVVDRPALFLQGTILLVAVLGILLI
AERQIPAGTETEDAAAGLDAFTPQASAVPGSVAERVATRAGVAQTEVFPL
TMFAVAGMLLFPASDDLLTMFIALEVLSLPLYLLCGLARRRRLLSQEAAL
KYFLLGAFSSAFFLYGIAMLYGYAGTLDLRGIAAVVAEDTGTTSLALTGT
GLILVGVLFKVGAAPFHSWIPDVYQGAPTPVTAFMAAATKIAAFGALLRI
FYVALPELRDDWRPVLWAVAILTMVVGTVTAVTQTDVKRMLAYSAIAHSG
FILTGVIAENRPGLSSVLFYLFAYGFSTLGAFAVVGLVRDANGQEDTAMA
RWAGLGRRNPLVGAVFSLFLLAFAGIPLTSGFVSKFAVFKAAGQGGAIPL
VVVGVIASAIAAYFYVRLIVLMFFTDSPADAPTVVVPSGLTTAAITVTAA
VTLALGALPQPLLDLANNADLFLR
119867632YP_937584.1 ABC transporter-like protein [Mycobacterium sp. KMS]MTAVLRVEDIGFVRGGRHLLADVSVTIEAGQSWVVLGPNGAGKSTLLSLF
GAVAHPTSGTVDVLGHRLGRVDMRELRTHIGHVNPRHRVDAPLTAREVVL
TGLTNTPDFVPRWSPTSGQIRRADELIGSLGLADRAESQWQVMSQGERGR
TLIARALIGEPHLLILDEPATGLDLAAREQLLAAMDGLRRSDPQLATVLV
THHIEEIPATTSHALLLRDGRIIAQGEAADVLTSEAISACFDHPITLARS
NGRWFAQAV
119867630YP_937582.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MPHEPAVEDVSRLQRASRDVTTLPGIMSRWLATRLPDGQAPEVLVESGVD
ANGMSSETIILTVRSDAGEQRLVARVAPAAEDVPVFSEYRLDHQFEVIRL
VGKKTDVPVPRVRWLEPTGEVLGTPFFLMDHVDGVVPPDVMPYTFGGNWF
YDAPVERQRELQDSTVEVLTKLHSIPDPQTTFGFLATGPGDNALTRNLNW
LKSWYEFAVPDIGRSSLIEDALGWLDAHWPSDVAAGDPVLVWGDARVGNV
LYRDFRPVAVLDWEMATLGPREMDVAWMIFAHMVFQELTGLAGLDGMPHF
MREEDVKATYAERTGVQLGDLHWFYVYSAVIWACVFMRTSARRVHFGEIE
PPTDVESLFYHGALLRRLIGEDS
119867628YP_937580.1 FAD dependent oxidoreductase [Mycobacterium sp. KMS]MSGVDADQTDVLIIGAGISGIGAAYRLQERNPRLTYTILERRGRIGGTWD
LFRYPGIRSDSDIFTLSFPFERWTRPENVADGDDIREYLTQTAHKHGIDS
HIRFDTHVLSADWDSATDTWTVHTQQDGQPRTYRSRFLFFGTGYYNYDEP
YRPEFPGLDNFAGEVVHPQHWPESLDYTGKNVVVIGSGATAISMVPALAR
QAGHVTMLQRSPTYVLSSPRINPVVQAIRKVFPARIAFHLVRLYNLAFIV
STYALSRKAPRLVRRFIRNQAAKTLPDGYPVDVHFNPRYDPWDQRMCLSL
DDDLYSAIADGRAEVVTDHIDTFDEKGVVLRSGERIDADIIVTATGLQLQ
ALGGIALSIDGAEIKPQDRFVFKEHMLEDVPNLAWCVGYINASWTLRADL
TARAFARLIAFMDEHGYTHAYPHLGDKPMAEKPAWNINAGYVQRAPHALP
KSGTQRPWNVRHNYVLDAIDHRFDRIEESMVFGRVPASERVISA
119867626YP_937578.1 amine oxidase [Mycobacterium sp. KMS]MTAPAGADVVVVGAGFAGLTAARELTRRGHDVVVFEGRDRVGGRAYTTTV
AGVPVDLGASFIGPTQDAVIALAAELGCDTVRTYNRGNNLIRWRGRVRSY
RSTIPRLSIIELLDVSRIQWRFERLCKQIPLAAPWTAPAAHRLDDLSLES
WLRSVHASASTRDLMAIMSRVTWGCEPDAVSLLHAARYVKAAGGIGCMLD
VEGGAQQDRFPGGSQQIAVRMAAELGDRVVTGAPVRRIGRDTDGALHVHT
ERGSTAARAVIVAVAPAHRETIEFEPRLPAGYADLAAHWPQGRLSKAYAA
YDTPFWRDGGCSGEALSDEGPVFITFDVSPSDKGPGILLGFTNAASFDLL
SPDERRSRALAGFAALFGDAASSPIDYVDHLWGADEFAPGGPTAAVPPGA
WLAYGQWLRTPVHGIHWAGTETADEWTGFLDGAVRSGQRAATEVHDLLSR
119867624YP_937576.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MVPVDGRKATMRAVQIDRLDGPGSVQVVDVDEPDSADGVLIDVHAAGVAF
PDALLTRGLYQYKPDLPFTPGAEIAGVVRSAPAGSGVSPGDRVAGLTMLS
GGMAEVIALAPDRVFPLPDAVSFEAGAGLLFNDLTVHCALRTRGRLAKGE
TVLVHGAAGGIGTSTLRLAPAFGAGRTIAVVSTEEKIPVAQAAGADEVVL
ADGFKDAVKELTDGRGVDVVVDPVGGDRFTDSLRSLAPGGRLLVIGFTGG
EIPTVKVNRLLLNNVDVVGVGWGAWTFAHPGYVREQWAELEPLLASGAVS
APQPDVFPLERAAEAIAALENRSAKGKVVIAVR
119867622YP_937574.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MSSTMSRVVAITGASSGIGEATARELARRGAAVVLGARRADHLDRVAAEI
REAGGAAVVCTADVTRLDDVRRLADRAVDEFGRLDVMVNNAGIGRIGPIS
DLDVDGWSAMIDVNLRGVLHGIAAALPIFRRQGHGHFVTTVSTAGLKIVP
DQGVYAATKNAVRTVLEALRQESTDGVVRTTAISPGFVNTKMDGSIDDPV
LRERIRRSMDDVGLEPEAVAQAIAFAIEAPAHVEIGELTIRPAVQN
119867620YP_937572.1 hypothetical protein Mkms_1573 [Mycobacterium sp. KMS]MALSATLHCLTGCAIGEIAGLIIGTALGLGNLATIGLAVALAFLFGYALS
TLPLLKAGLALGTALSVVLAADTLSILTMEVVDNLVMAVIPGAMNAGLVN
PVFWLGMMIALAAAFLAAYPVNRHLLRRGKGHALTNEYHHGATDPSGVRR
FIPSLGAGALAATIIAFMLGGLVVSIAAELGESDIGSHAQAVSGAVPQG
119867618YP_937570.1 putative ABC transporter [Mycobacterium sp. KMS]MNLVQRLAALSAVASLGAGRLPEDVLAEVHSLDARAGTRLRLSGEHTVVA
LAGATGSGKSSLFNAIAGAPLAQVGIRRPTTSATQAVVFGPSPAAELLDW
LEIGNRQAGDASATPQLSGLVLLDLPDHDSVEVAHRAEVDRLIRLVDAFV
WVLDPQKYADAMLHEEYLRPLAPHREVMVVVLNQADRLPLPDLASCMHDL
HRLIAEDGLAGVPVLATSAVKPDGASELHEFLVSTVADHRARTARVSADL
DAMAARLDPLAPARSEPALRDAERQLRGALAGAAAVPTVVDAVGRAYTRR
GLAATGWPPVRWIPKIRPDPLRRLGLDAPDTQGEILRRTSMPSGSAAARA
GVDSAVRTLADTASDGLPAPWPRIMREAARSRADAVPDALDRAVGGADLG
MSRSPRWWRFFGALQWLLIAVAVAGGVWLGALAVLAYLQIDLDAPSLGPF
ALPTVLLLGGLALGLLLRIVVRPFVAVGAARRRRKVASELHRRVDGVADE
FVLAPLRNELTRYGQLSAAVHGLSR
119867616YP_937568.1 methylenetetrahydrofolate reductase [Mycobacterium sp. KMS]MTSTDLQCPKRMQFGPCGGVRPDGQCEMRTGPCAFPDVVPWSGVEPASRP
AQAPLVLTDFSCAPFDEDDVAATARILGRSCDAVLVGEHQNRPDFPPTLM
GRLLLEAGVTPWITLSCRDRNRIVLEQELRGLRSLGVGTVLCVTGDGRGY
DVRPDVTQTFDLDGPRLVSLAASVGMVPAVPETPTAPPVHARPARLVEKQ
RAGASLAVLNHVPYPDTITDFMATARTAGLSMPVVAAVAVFTDVVSAAVL
QGLPGLELDQSVVDEVLGAADPVSAGIAAAVAEARALLAIDGVDGVNVSG
LASASGTRVGAEIKAEVGRLVKAEVGA
119867614YP_937566.1 FAD-binding monooxygenase [Mycobacterium sp. KMS]MTTAVDVVIVGAGPTGLTAAGDLARAGRTVVVFEKRSTPNPSSRAFATMA
RTLEVLDARGLAGDLIAQGHRAPGVSLFAGAQIDLSHLDSPYPFVLVTPQ
TNVDRTLLDYAQRYGADIRRGVAVVGIDQDADGVTVTARSQDSSRDIAWR
ADYVVGADGAHSTVRELLRIDFPGRTILSSLVLADVKLSDGPAGGGLTVG
STRDVFGFLAPYDRHDADGSWYRAMLWDRHHQVPDHVPADRTEISGVLAR
AFDTDPGLVNVDWTSRFHCDERQVAQYRHGRVFLAGDAAHVHSPMGGQGM
NTGIQDAANLAWKLDAVLAGADDALLDTYHCERHPIGRRVLRQSGLMARG
ITLRPRVARWVRNRLAPRLLQVPMIRDGVAGSFAGTGLRYPGAGLVGTRA
TQIPLTEGRLSELLRTPGFVLIRERGAAVVDSFSGHQAERTDDGPAVLIR
PDGYVAWAGDSADHPPWVTCPSSSAVRG
119867612YP_937564.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MSEKSYAVIVGGASGIGATIVRAMADRGYAVVVADRNIDAANALVEQLGA
GGHTAAEVDVVDEAGVATLFESVAALPGRFEVAVNCAGITALGLVTDLPV
NKFRRVVDVCLAGAFLVIQHAGRHLADGGTIISLSSLNARQPAVGMSAYS
SAKAGLSMLTQVAALELAPRLRVNAVAPGLVRTPLTSGALGVPGVEDEYV
ENIPLGRPGTPEEIADAVMYLATAEWITGEVLDLNGGAHLMRYPNVHAHF
EQARTR
119867610YP_937562.1 hypothetical protein Mkms_1563 [Mycobacterium sp. KMS]MMSTASLKGYTWPESTVDVERGRVAMFAKAIGETDPVYFDVEAARAAGHP
DLLAPPTFVFGLDLEHSDTLGVLEAHGVNLSAVLHGEQRFTYHREVHAGD
SLTLQAEFTDYYAKRGGALEFLVRRSQLTSAGELVAEMESVSVIRNGASS
119867608YP_937560.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MAQAVRQHARSSVRKLQLSQAAARLFTERGYHNVSMDDVASAVGLTGPAL
YRHFRKKHDILAQAISEQLASVEAVAVRAVEADLAPPERSAMFLSELADL
VLEREEVLLWKRERRELSESEQDEFRSRLNDVLRLTVQALGLGDDGEPTS
DAELRAWSVLAVYSSVSPARRGMDDASAKRILQSMADGVLNCELDAAATT
SRPPLAPPRRPPGRRERILSTATRLFHAQSYHSVGIEEIAAESDTAIATF
YQYFTGKAELLQAVLNRGAEGLHYVTNHRLPTASTPQEAVDIIACTLIEL
ALGPHQPILAILAADLIYLPEKAQEAIRTSQREYIDEWVVAINGVRPELS
AHHARLLARASIGLVTDITQTQSMRKRPGIAGELHRLVSAVLAA
119867606YP_937558.1 flavin reductase domain-containing protein [Mycobacterium sp. KMS]MAQAQLGSLTDAFRDAMASVCTPVAVITAMDDTRPHGTTVSAFASLSMSP
PSLLVSLDQGSDLLSLIRRTSAFGVNILGSGQSSLASCFAKKGRDKFTDV
DWSLAEGLPRLAGVPGWFACDVIQLVEAADHVIVIGAVRSVESRDTPPLT
YHGREFGTHRVLD
119867604YP_937556.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MPRLSNRVALVTGATAVEPGGLNIGGAAATEVVAEGARVVLADINIEGAS
ALAEQLNQKYGPDVAIAVQTDLRDEDAIQRLVATTVSTFGKIDVLFNIAG
VFPAGDGDVATMPIEVWDDVMAVNVRSAMLTTKHALPHLRVEGGSIVNTA
STHAFAGDTSLTGYGATKAALLALTKYTATQYGRERVRCNAICPGTTTTP
PAQQLPEAVKDIYRRHTPAPDLNGPADLAKVYAFLASDDSRGINGETIRV
DGGLLAHQPFVPDMDSLGAATATSQ
119867602YP_937554.1 hypothetical protein Mkms_1555 [Mycobacterium sp. KMS]MVAEPPTAHADAVAYLVNVTVRPGYNFANADAALSYGNGVCRKIADGRSY
GDLIADVKADFRTTDEYQASYLITQAANELCPAMIWQLRNSAAGYRSPTG
119867600YP_937552.1 hypothetical protein Mkms_1553 [Mycobacterium sp. KMS]MPAPQRHNGIRLAVAFSVVAIVGLGGVAGWLGYRIVDDRRAQAELNEFVE
AARQGAINLTTIDHTSVDADIKRILDSSTGTFRDDFEKRSQTFAEVVKQA
QSTSEGTVTSAGLESREGDTAQVLVVMSVNMSNAGAAEQSPRSWRMRVGV
EQTGDAAKVSDVQLVS
119867598YP_937550.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MAGRKALCYRSFSLVLAVAVALLTGCQWRGLNSLPMPGTQGGDARSYVVQ
AQLPDVGTIEPNSRVRVGDVNVGTVTKIERQGWHALITMRLNGDVELPAN
TTATVGQTSLLGSLHVELNPPIDAPARGKLGAGSLIPLAAGASYPTTDQT
LAALSLLLNGGGVGQLQDITAAFATAFAGRESDLRSLIEQLDLFVGRLNT
QTGDIVAATESFNGLVGQLADQKPVLDNAMRTIPDALQVLSEQRENVTGA
VDGFGKFSALTTDAVNQTKQNLVAELQAVGPVLKSLADAGPDMTRSLSLL
STLPWPKENIDKIVRGDYLNTDVIFDLTLSRLGDGLLNGTRFEGDLTELE
MQWGRTIGQLPSPYTARNPLVAPYQVNQGP
119867596YP_937548.1 virulence factor Mce family protein [Mycobacterium sp. KMS]MKPFAERNPFVIGLAGITVTAGIAVIALQYDKLPFSTSDNDYSAYFAEAG
GLQAGAPVQVAGFRVGQVSAVELDGTRVLVDFDVDENVHLGELTEAHIRT
KSLLGSKVLEVTPRGDGDLTSTIPLERTRSPYQLPDALGDLSTTISGLNT
DTVSAALATLADTFQNTPPDLRAAVEGVGRFSQTLGERDAELRNLLSNAS
KATGVLSQRADEVAKLVADSNALLAALREQSTALEQISRNLSAFATQLGA
FIAENREQMRPALDKLNGVLTIVDNRKERIMLAIKYLNQYTMGLGETVGS
GPFFKAYLANLPGQLVQPFIDAAFSDLGLDPNVLPPSQLSDPQTGQPATP
ALPVPFPRTGQGGEPRLTLPDAITGNPGDPRYPYREPLPAPPPGGPPPGP
PAPWPTGQQPTAQPTPSPVFEPAPGEPTAAPEPVNGGQ
119867594YP_937546.1 hypothetical protein Mkms_1546 [Mycobacterium sp. KMS]MTAGSPSRFRPRVHRRVAGWVDGLSRIGTQAQFYFQTLGSTKDVVIHYKV
ELFRLVAQMSLGVGALAVVGGTVVIVGFLTLSTGALVAVQGYNQFADVGV
EALTGFASAYFNVRLIGPVIAGIGLAATIGAGATAQLGAMRINEEIDALE
VMGVRSVAYLASSRVLAGVIVVIPLYCVAVLSAFWAARFGTIAIYGQSSG
VYDHYFTTFLNSTDIIWSFFQAIAMAIVIMLVHTYYGFTATGGPAGVGEA
VGRAVRTSLIAAVLVVLFLSLAIYGQSGNFHLAG
119867592YP_937544.1 cytochrome P450 [Mycobacterium sp. KMS]MTTSEQTANVDSGAQDANSQELPVFPFKRQCPFAPADDYADGGSIRKVSF
KSLVPAWLVTDYSDVKAVLADRRSSVRNIPDPSRGDEGGEPLPGFFVAMD
PPDQTRLRKMLSREFTPRRMEAMRPAVERITNKLIDQILEQDGPVDLVQA
LALPLPSLVICELLGIPYDRHDWFQEETVKFLRLDTSPEEAAQTVASVMG
YLGELTVSKMDDPGDDLISLLLNHVRSGDLTIPEVAGMAAFLLMAGHETT
GNMISLGVYALLEHPDQLELLRQDPSRVPAAVEELLRFLDIIGNLPRYLT
EDIELAGQTIPAGDIVMVAMDKANRDPKQFEDPDTLNILRTDAKGHVAFG
HGIHVCLGAPLARVELQSVISTLFSRIPTLKVAVPSDEIQVKTEAKIFGL
KSLPVTW
119867590YP_937542.1 luciferase family protein [Mycobacterium sp. KMS]MRIGTVLDFGRPMSDVGDEIAAWEAAGLSSVTLGEAYSFDAPTQLAYLAA
RTKSLELATGVLPLDTRTPTLIATTAAGLDYVSAGRARLGLGPSGPQVVE
GFHGIPFADTLGKTRETIEICRSVWRRETLVHEGRHYRVPLDPSRGTGLG
KPLKLINHPVRERIPISIASLGPRMVELTAELADAWEPIFFYPEKLQDVW
GEALARGTAKRQPDLGPLEIIARAPLAVTDGDSSAWVDAAKPQLALYVGG
MGSREKNFYNQLVASYGFAEEAAVIQDHFLAGRAKEAAAAVPDELVHATA
LIGDADHIRQRLTVLHEAGVTLVNVTPMATDPNQRLDAVKTVVALSKEI
119867588YP_937540.1 acetyl-CoA acetyltransferase [Mycobacterium sp. KMS]MPEEAFIYEAIRTPRGKQRGGALHEVKPISLVVGLVDEIRSRFPDLDESL
ISDLILGVVSPLGDQGAVLARTAVLAAKLPDTTGGVQLNRFCGSGLEAVN
TAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAWANDPETNYAVSFVPQG
IGADLIATMEGFSREDVDAYAVRSQQRAAAAWSGGYFAKSVVPVKDQNGL
VILDHDEHMRPNTTLESLSKLKPAFTDIGAMGGFNEVALQKYHTVEKINH
VHHGGNSSGIVDGAALVLIGSENAGVSQGLTPRARIVATATSGADGTIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLGIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRGAKRALITLCIGGGMGVATII
ERV
119867586YP_937538.1 AMP-dependent synthetase and ligase [Mycobacterium sp. KMS]MYLTQALHRAVQQTPDLPATVFGERVRTWAQTADRAARLASAFQGLGVRS
GDRVALLAQNCDAYHDFLFAVPWADGVAVPVNTRWSVHEIAFSLEDAGAL
VLVVDDVFLDMVEELRELAPTVQAYIHAGDRARPEGVLDFEDIITAHDPI
EDARRGGDALAAIYYTGGTTGTPKGVMLSHANLMAAALGALSTGQFLEPR
GRLLHSAPMFHLADGSGWLARNLVGGTHVILPSFTPDAVAVAVERYQITD
MFLAPTMIQMFVDSPAAAQHDLSSLKHLIYGASPISQAVLERAMRLLPQV
KLLQAYGMTELSPTTTVLTGEEHLDPALLRSAGRAVPIAEVKIVDEDDNE
VPRGTVGEVAARGPHVMLGYWNRPEETAQALRGGWMHTGDGGYLDDNGYL
FIVDRIKDMIVTGGENVYSAEVENALAQHASVATCAVIGVPDADWGERVH
AVVVLQEGMTATAQELRDHCGSLIARYKAPRTVDFVDSLPLTAAAKVSKV
DLRQRYWKGASRSVN
119867584YP_937536.1 alpha/beta hydrolase domain-containing protein [Mycobacterium sp. KMS]MARTEALARVEKMYVEGFPDPATASVEDLRTAYDELLLQFELPAGVEPVS
GEIGGVPVLTVTAEGATRDKVLVWCHGGGYVLGSARGFQDLGHTLSRASG
VTVVLPDYRRAPENKFPAAVDDGAAVISDLVSTLGATNVAVGGDSAGGGL
TLAALTALRDGGTPLPAAAVFISPLLDFTASGASVDLYDGRDVAVSRGSI
ANLREAYLQGHDPQDPLASPVFADLGALPPSLFLVGSGEVLLDDSCRAAM
AITEQGGTATVSVYDDMVHVWPLFSSILPEGVDAANEAGAFIRKNLGL
119867582YP_937534.1 integrase catalytic subunit [Mycobacterium sp. KMS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGLIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALVTCSRLSGRFLLGVHAAVLVV
119867580YP_937532.1 transposase IS3/IS911 family protein [Mycobacterium sp. KMS]MPAAHPEEFRRRAVELARLREKPIAQIAKDLGISESCLRRWMDQADVDEG
HKEGLSRDERAELVRLRREKRVLEMEVEILKRASAYFARENILPK
119867578YP_937530.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MPRATAARAETVKATLRSSARGRHRTEQVARAAAHLFQDYGYQNVSIDRI
GAAVGLTGPAVYRHFKGKHDILVHALMTQVHLVEELHTVTAEQGTTALEQ
LQLLLAGLGDITANGNEATLWRREQRHLEDAEREVFRRHFDENQERITAK
LLAVRPEVGEHKAELLGFAVLAMYSNTPNFRGNLSAERLQEIQSAAAWAI
IDCDLPAPAEGAGPIPDLGQRQPAGRRERIIDAAARLFTERGFYDVHIDD
IAKASEMSTATLYQHVSSKSEVLRAVLERGAEGLLYVTSDALAYAFTAEQ
ALDALITTYVRQALGVYGRIMHILATDLLYLPEEEQSALRNAQREYVAEW
VEAIEALSDDLSSADARALAQAAIGVVTDISQHPRLRQRPGIADELAALM
RAIVVPSGPTTA
119867576YP_937528.1 aminoglycoside phosphotransferase [Mycobacterium sp. KMS]MMTVVAEEETSMSDSASEFLTELAEVLGGRVAGGRPVELVDVDQRSEGNS
WETYLVAAAWDSGKHSASYAVKRQPLSGIVGSYDVGREVALLRAAQSIGL
PVPGVVAHRVGEPGNRGFFVMERLEGVVPMPHNVSRMIADADDRAALGRR
VAREMATLHAAAPEALALPELDAPPAPGDTGRVENDQWRRTYDEVATVRI
PVLDLALAWLDHRSDHVSGRVSLVHNDFRVGNLVVNPGDGGLVGILDWET
AHFSDPVADLAWFFQRTSRGRSPLACKLLGVEDFLDEYAQAAGWRPDPRT
LTWWAVQSLTKTAIGCLQAVAIFQRGDRRDLRYANMAHSVYYSLGWLNQM
LRDGEWGS
119867574YP_937526.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium sp. KMMRRTLYTEEHEAFRKAFRAFIDHDAVPHVEAWENSGTVDRAFIRAAGENG
FLGFEFGSEYGGLGIEDFRYNAVMTEEVVASGMAGDLFSMQNDIIVPYLR
DLTTAEQRDRWLPAFTRGECVTALGLTEPGAGSDLAAIKTSARRDGDHLV
LNGQKTFITSGATCDLAIVLVRTGERDGRGTTFVAVENGTPGFERGRPMH
KIGRRAQDTAELFFDDCRVPVSNIIGEPGRGFGCAIANLPRERLSIAVAA
VASARHALELGLEHARQRSAFGAPLAQLQSVRMQIAGMHTDIVVLQEYVD
RCVVALNDGELTAAEAAGAKYKATELQWEVLDRVLQLFGGYGYMEEYPIA
RMWRDARIQRIYGGANEVMKDLVGRAVVG
119867572YP_937524.1 hypothetical protein Mkms_1524 [Mycobacterium sp. KMS]MDTSAPFTACQYGPDAEFTHEFAGIEKFNESVYVNFVDPVSEVSALMRIG
NRPTLGYSEATVQLTLPGGKIALRAGRQPNETNDKWSTQGLEIAPKDATR
TWEVNYRNTVALISTPSLLADRGRQALKNSPSLECEISLTFEASVPMFTI
EEGGDCTPGSSQIATDHYEQFGHVSGSVRVGSTTWTVDRATSFRDHSWGP
REWASYNGEWLAAWLADGTAITAYGEFEPNGVRVSGGVVITPDGVFHPIR
DYTVYTDYAGEATYDGRNTAVIAADGLPTMVLDGTINHFVPVTQRTADRA
ARMGQMSVRYANGHGGWGIGEFLRPISAR
119867570YP_937522.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MAAGHLDGKVALVSGSGRGIGRAVAEKLAAEGARVVINDLDAEPAKEVVA
AIEAAGGQATACVGSVTDPEFADRFVSTAVDNYGGLDIIVNNAGYTWDSV
IQKMTDQQWNDIIDVHLTAPFRILRAAQPVISGLAKKEKAENGVASRRAI
VNTSSTSGLQGNPGQVNYSTAKAGLIGMTKTLAKEWGRYNVTVNAIAYGV
INTRLTTITTEAKTIDVAGREIKVGVNPEVYEAVTTQIALGRGGSVEEAA
GAVYLLCAPESSYITAQTLVCSGGA
119867568YP_937520.1 hypothetical protein Mkms_1520 [Mycobacterium sp. KMS]MIVTVGLVILVLAVIVGAVGLLGNAGPTHQMAEPFSVFGYHVTGSTGTLF
LVGIAVGAAAALGLAVLLAGARRTAERGRDARRQLALSRRESAFINRDPV
DVLEYRNPHTTSTSGVTAQPQGGVLGRWRHRKATRDRVDHGW
119867566YP_937518.1 hypothetical protein Mkms_1518 [Mycobacterium sp. KMS]MSTNTIVLIIVVALAALVLVAALVWAARNKRNQSRHDEAETIRSEARDEN
RRVAQREARAEETAAKARAVQAEADVKTAQAKGLQQEAAGHRHEATNSRD
ELNEQFERADALDPATRTPNGRNTGNSGRNADNDQQRPTAGTR
119867564YP_937516.1 peptide chain release factor 3 [Mycobacterium sp. KMS]MTDTASGVSTATESRPDRVSAEAQRRRTFAVISHPDAGKSTLTEALVLHA
KAITEAGAIHGKAGRRATVSDWMEMEKARGISITSTALQFPYRTQAGDTC
IINLLDTPGHADFSEDTYRVLTAVDCAVMLIDAAKGLEPQTLKLFQVCRH
RGIPIITVVNKWDRPGRHALELMDEIHDRIQLQTTPLTWPVGIAGDFKGV
LDRRSGTFIRFTRTAGGATAAPEEHIDASQAHEAAGTDWDTAVEESELLS
ADGADFDRDSFLRCTSTPVLFTSAVLNFGVNQLLDVLAQLAPPPRGQLDI
DGSRRETTAPFSAFVFKVQAGMDSAHRDRIAYARVVSGTFERGDVLTHAT
TGKPFVTKYAQSVFGQQRSTLDTAWPGDVIGLANAAALRPGDTLYRDVPV
QYPPIPSFSPEHFAVARGTDPSKHKQFRKGIEQLDQEGVIQVLRSDRRGD
QAPVFAAVGPMQFEVATHRMAGEFNAPIALEPLPYTVARVADPDDVEILQ
KQASVEVFTRTDGVVIAVFSNKWRLENVERELPDVRLRSLVAAAD
119867562YP_937514.1 hypothetical protein Mkms_1514 [Mycobacterium sp. KMS]MSGVFDGDAELDVAGVRCPVRVRLTGHLSPIDGRYHWQGLAYGAPDDVQA
GKQAQLRIGNRSAAVRLVEKIPSGQLMVSGVGEPPYDLWLV
119867560YP_937512.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MKYSGLLAKAVQRFGSPTAEGNAERILDAALKQFELLGIRRSTVEDITRR
SGLARVTLYRNFANKDAIVEAVLLRELERFLSDLAAEAGGYAEAEDKLVE
GFVFTLTTLRDHALLQRLLATEPETVLPFLTVEGDSVVRTASSFLAHQLA
VALPDDSRTQIELLEVAEVTVRIIVSFVLTPSQNVALGDDDAARSFARRY
LVPPLLGLTR
119867558YP_937510.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MVFHPVGPVYYLRMNADSARCGRRLPGDEANLVAEVFRMLADATRVQILW
ALVSHEKSVNDLATHVGKPAPSVSQHLAKLRMARLVRTRREGTTIYYSLD
NNHVAQLVTDAVFNAEHAGPGVPGHHRDASDLAALHADVPAASPSKNGRR
A
119867556YP_937508.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MRSRGWAGVTPTSDEEAIGRILDAVDEVVAEHGSAIRLADVARRLGVTRQ
TVYRYFPNADALLMASAMRAVDGFIDQVVDYVRGVNDPVTAIVESVSFGI
EILAGDPQLENLLTRRQDGEALTSLTSDTAITFCLSVFRRFDVDWRLHGF
DDAALRELVEMTLRSVQSLLIDHGQPQRKGSELRRFLARWLGPAILYPRL
SSLPT
119867554YP_937506.1 hypothetical protein Mkms_1506 [Mycobacterium sp. KMS]MITLYAVAGVVALTLLCLVSNVRVIQQFERGVVYRFGQVQSRVREPGLTL
LVPVADRLQKVNMQIITMPVPAQDGITRDNVTVRVDAVIYFKVADPVRAA
VDVQDYMSAIGQVAQTSLRSIIGKSNLDDLLSNREHLNQGLELMIDSPAL
GWGIHIDRVEIKDVVLPDSMKRSIARQAEAERERRARVITADGELQASQK
LAAAAGVMSERPAALQLRLLQTVVEVAAEKNSTLVLPFPVELLRFLERST
PRAQCESAAEDDVSCSDADVQAALAASLSGISSALTQSQREATPAT
119867552YP_937504.1 alcohol dehydrogenase [Mycobacterium sp. KMS]MRQLVFVEPGRLEWQDVPDPEPGPGQAVIHPLAVARCDLDSAMAGFGIFP
GPYPVGHEIAGEVADVGDGVESVRPGQRVAVPFQVSCGHCAFCDRGRYAA
CEPRYARAGAAFGFGPAGGGHGGGIADLLVVPDADHMLLAAPDAISDVAL
ATIPDNVVDAYRTVVDGLRERPGADVLIVGGDAPSISLYAVLCARALGAG
AVRYADNDPLRLHVASDLGAETIDVGAQFPRRLPRSPIVVGASLSVEGLH
CAIRSTEAYGRLTVVTIHFAAQTPLPLLEMYTRGITVHTSRADSRRYLPD
VLAMVAAGRIDPLAVPTTVIGWDDAAEHWLDPGLKIVVTR
119867550YP_937502.1 TetR family transcriptional regulator [Mycobacterium sp. KMS]MRGDLPEHHSPTAARLLTAANDLLLGRGAKGFTVADVAARAHVAKGTVYL
YWPTKEDLLIGLIGRGFLHVLDDLVQQLGDDPALARPSRFCPRMLHIAVS
QPLVAALQRHDDDLLGMLAEHPRSVALNTALGPGAVLEAVIPLWRRNGLA
RTDWDIADQTFALHALISGVALSLAGPSAEPTAVDDRLRVLGTAVTALLG
PERAGQKQIRNTAAGIIGFLRNGQSAALQLIEQPG
119867548YP_937500.1 hypothetical protein Mkms_1500 [Mycobacterium sp. KMS]MRISTSDSTLPADHREPAAKRVWVGIRRCECGATVAERPVPSRLRRDDAS
VKTRSLDEIRGALEHCYDAFEGLCTDLSDDEWQAQSLCPDWKVRGVVDHV
TSIEAVMAGWLPDDDTTPPPFERAGEFLADETPYVDKVRGVYDRRRRDLA
SLTDQDLARPSWMPVGPGTYGRFLAIRVFDFWVHERDITTPLGRETDDGG
VAAELALEQVENSIGYIVGKKVGLPDGKSLTFDLTGPLARRLHVAVDGRA
ARVDHVDHPDVTVTTDSTTFIQLACGRIDPQEQIDSGAISWTGDDELGDR
AARNLRFTM
119867546YP_937498.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]MRLANKVTLVTGGSAGLGLAIAQRFGSEGAHVYITGRRREALEAARASIE
GRVTALTADATVPGDLDLLIETIRRESGHLDVVVANAGSIERMNFGDVTE
EHFDRTFDLNARGTLFTVQKALLTVQKALPLLRTGGSIVLLGSVTALQGH
PGAGTYSAAKAAVRSYARTWSAEFGDKGLRVNVLSPGPIDTPIIDGQADY
FGQDPVALRAQMSTLVPMGRLGRPEEIANGALFLASDESSFMTGAELCID
GGMARV
119867544YP_937496.1 TIR protein [Mycobacterium sp. KMS]MSDHHCTMGCSQHPGRPDMPQAQFTRYDLGQQKRGAAAVVTLRGNAANVL
LLDASNFNSYRSGRSYRYAAGGLVTRSPFRLVIPSDGHWYVTVDLRSQGP
SARVNSTISMEPAPLPIARSAAPPSLQQIEVNRPPEGALRGGETWDVFIS
HASEDKASVARPLFESLRDLGVSVWFDEAELRIGDSLRRKIDQGLARSAF
GVVIFSEAFFAKGWPQYGLDGIVTRTVAGEQNLLPIWHKISKDEVRAQSP
SLADKVARSTSDLGIAEIADEIARRVRPDLFES
119867542YP_937494.1 hypothetical protein Mkms_1494 [Mycobacterium sp. KMS]MTRISDQAALVYRNEMTAAKNAADASTRWRHLERAHIVSQPDPRLHTCNH
AAMLALALRQRDRREALGQVVRIIVAAPGSLSGRYPVGNTGRVAAGLMTP
MPIPDDLADLTS
119867540YP_937492.1 ArsR family transcriptional regulator [Mycobacterium sp. KMS]MSEPLDTCDLLCLDLPHAEQIRATVPDSDTVAAAAAAARGLSDATRLSIA
AALAAGDELCVCDMAWVIGLSQGLVSHHLRQLKNASLVSSRRQGKLVMYR
LTERGRQLTAAVLPAVNVAARKESDRV
119867538YP_937490.1 ATPase central domain-containing protein [Mycobacterium sp. KMS]MIRRASSCEEGVMARSDLVIDLVEAQQRGDVARFRMLVEAIIAEERGNQH
HLVADRLSELITTAGARSLLARDDSARQVADLVTEIVPKRRLSEVQMAPA
VAAAVTEIIEEHHRSELLRSHGLEPRNRVLLEGPPGNGKTSLAEALAAEL
MVPFYAVRYEGVVSSFLGETTSRIDHVFEFARTRRCVLFFDEFDTIAKER
ADAHETGEIKRVVSTLLLQIDRLPSHVVAVCATNHGELLDRAAWRRFQVR
LTLSAPSRAQATEFLEQLRVRLGGNLGMAPRTLADKLASSSYAEIEEFAL
DVMRRYVLSLPDGRVEDVVRERLKQRTATREM
119867536YP_937488.1 transposase- mutator type [Mycobacterium sp. KMS]MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWG
QPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAE
SALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQ
FRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVL
GMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGA
AWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAERLNKEIRRR
TDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITN
DNPEIGADDMPALTA
119867534YP_937486.1 hypothetical protein Mkms_1486 [Mycobacterium sp. KMS]MEGVAVMFWYDHNMGWWGYAGMGVGMVLFWALLILGIVTLIRLSTDGDNR
LVSPPSSPEQVLAERFARGEISETQYREGLAILRDHAPH
119867532YP_937484.1 Fis family transcriptional regulator [Mycobacterium sp. KMS]MPKEQSPGKPTTRRYSSEEKAAAVRMVRTLREELGTEQGTVTRVAHQLGY
GVESVRSWVRQADIDDGHAPGVTSTESAKVKELEQEIRELKRANEILKRA
ASFFGAELDRQHKK
119867530YP_937482.1 hypothetical protein Mkms_1480 [Mycobacterium sp. KMS]MTVAAWLFVSGGVIMVGIGTFFLFTRPALLPEDLRYLGQTASDIDAAIPP
LRRWLRLVFTVLGGYAVATGILTIYLAANEIPDANSSAVAVLAVTGASSL
GVMTVVNFLLHSAFRWPLSAAAALWIAACAVSAAS
119867528YP_937480.1 ABC transporter-like protein [Mycobacterium sp. KMS]MSHRQQVLRGADLSLMPGEIVGLVGENGSGKSTMMKILVGELAADGGTVT
RSGVLGYCPQQPVVYERLTCDEHIELFARAYRMTHEAEGRARRDLYDALG
FERYASTRADRLSGGTLAKLNLALAMLADPPVLLLDEPYAGFDWDTYLKF
WDLVGRRRDGGRSVLIISHFVTDEHRFDRIVKLCEGRLCHGQCDADETCR
119867526YP_937478.1 hypothetical protein Mkms_1476 [Mycobacterium sp. KMS]MKRQYIPWYTAALVAAVIGAVAFGLPLSTVLLPLVLLACPLMMMFMMGGM
GGGQGGGRNRGSSDIGEHHDPAARP
119867524YP_937476.1 integrase catalytic subunit [Mycobacterium sp. KMS]MRLTPAPVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRI
RRLWREEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTAD
GRTLKMLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRF
DNGPEFVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNL
WRFDSLLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
119867522YP_937474.1 hypothetical protein Mkms_1472 [Mycobacterium sp. KMS]MTPADDTDHCPASGSTPHGYITDKEKYLKRLKRIEGQARGISRMIEEERY
CIDILTQADALTKALQGVALALLDDHLRHCVLDAAAVGGPAADNKLTEAS
EAIARLVRS
119867520YP_937472.1 heavy metal translocating P-type ATPase [Mycobacterium sp. KMS]MTTSTPVTEASVELQIGGMTCASCANRIERKLNKLDGVVATVNYATEKAT
VTVPEGYDPAQLIAVVEKTGYRASLPAPPTPPATASGQPEPARQTDDPEL
VSLRQRLIASTVLSVPVIAMAMIPVLQFTYWQWASLTLAAPVIVWAAWPF
HRAAWTNLRHGTATMDTLISLGTVSAFLWSLYALFFGTAGTAGMTHPFAL
TLAPSHGAANIYLEVAAGVTTFILAGRYFEKRSKRQAGAALRALLDLGAK
DVSVLRDGVESKIAIDDLVVGDEFVVRPGEKIATDGEVVSGTSAVDASML
TGESVPVEVSAGDTVVGATVNAGGRLVVRASRVGSDTQLAQMAALVERAQ
TGKAEVQRLADRISGVFVPIVIAIAVITLGAWLGAGFSVAAAFTAAVAVL
VIACPCALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRKVDTVVLDKT
GTVTTGTMTLVDVITTPGTERRELLRLAGALENASEHPIARAVATAAAEE
VGTLPTPQDFANAEGKGVHGVVDGHAVLVGRESMLTDWAQHLSAELAHAK
TRAEADGKTVVAVGWDGQPRGLLIIADTVKPTSAQAISQMRALGLTPILL
TGDNAAAARHIAAEVGIDTVIAEVMPQDKVDVIARLQAQGKTVAMVGDGV
NDAPALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRRTLA
TIKTNLFWAFAYNVAAIPVAALGMLNPMLAGAAMAFSSVFVVGNSLRLRG
FTSTSFNTTH
119867518YP_937470.1 heavy metal transport/detoxification protein [Mycobacterium sp. KMS]MSTSTYTVTGMTCGHCEMSVREEVSDVDGVQNVEVSAQTGTLIVTASDAI
DDAKILHAVEEAGYSAVPVS
119867516YP_937468.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium sp. KMS]MPKAACPPPYRVTQWLRTAAIALAVVFVAAACAPSPSAAPQADVITEKGT
PFADLLVPKLQASVTDGAIGVSVDAPVTVSAGDGVLGQISLINEAGELVD
GQLSPDGVSWASAEPLGYNKQYTLRAEALGLGGATSTTATFETHSPDNLT
MPYVLPNDGETVGIGQPIAIRFDENITDRLAAQRAITVTTTPAVEGAFYW
LSNREVRWRPAEYWKPGTTVEVDVNAYGVDFGDGLFGQDDVTTRFTVGDQ
IIATADDATKTMTVRRNGEVVKTMPISMGKAKTPTDNGVYIIGDRYSFLV
MDSSTYGVPVNSPDGYRTEVEWATQMSYSGIYVHSAPWSVGSQGVANVSH
GCLNVNPANARWFYDNTRRGDIVEVINTTGPTLSGTDGLGDWNIPWQQWK
AGNANL
119867514YP_937466.1 response regulator receiver protein [Mycobacterium sp. KMS]MPSVEASTGEESATSIEPHHRWSRSAPAPAPAAAGRIRVLVVEPRRIYAT
MLARHLHAGDFTVEVRHSYDGAVSDLRDLDPDVVVVCAGPHEVGLALVDR
IRHVSRAAVVALDDTVLSSLLANADPGHSPEADMLGRRIRHALRRYGAAD
AIDAGGGGSRAVQRREIADLVIDLAAHRVYQRGTVIALTRLEFAILAALS
ESPGEPLTCRHLQAILWGTSHAGGRSALGVHVSNLRRKLGDDPVLPRYVR
TVRGLGYCLVG
119867512YP_937464.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium spMNHVLPSPYQAHRAQHSPRRAGRFERPATMVGQTPVLRIGEPFTPSGRGF
WAKLEGFNPGGMKDRPALHMVQRARARGELRPDARIVESTSGTLGLGLAL
AGTVYGHPVTLVTDPGMEPIIQHMLAAFGAQIELVTQPHPQGGWQEARRQ
RVGELLAADPQAWHPDQYSNPDNVEAYRGLAMELIEQLGAVDVLVCSVGT
GGHSAGVARVLRERNPQMRLIGVDTIGSTIFGQPASTRLMRGLGSSIYPG
NVDYDAFNEVHWVAPSEAVWACRTLASTHYASGGWSVGAVALVAGWAARQ
GDSGTTVAAVFPDNPQRYFDTIYNDDYCRTHGLLDTAPPSEPATIEDPLA
HTVTAWTRCATVIDPTQELPR
119867510YP_937462.1 hypothetical protein Mkms_1460 [Mycobacterium sp. KMS]MMTTALWLIVYGLMLAWVAPPILRRMTSHGISPHMSVAAWLATVAATAGA
WLIALVLIVAATSVSIQDNSVVTLCLELFGFSEHTPLAGRIGSVALIGGG
LLGAGVVAVRLGRCLSGLRARSHEHAHAARIIGRPTDHPDVFIVEADRPA
AYCVIGRPNAIVVTSAAMQSLNRSQLKAVLAHEDAHIAGRHHHILMVLRA
LADALPRLPLFARAHREVAGLLEMCADDAAARRVGIRPLLGGLLALAGHP
AVLPEGLAAAATAVVARAERLVAPTQRHVRWRHRIVLAVAIVGMLVMPAF
IQVLCHH
119867508YP_937460.1 NLP/P60 protein [Mycobacterium sp. KMS]MRRFTSLLGIAAITVTLPVNATGVATATHETRPSPNTDLPTLVASVAEAN
QRVADIGADIQSKQEGFNKALVDTAAARDILATRQQELTASEQALTASQT
DIDNAQSRFDQFAASMYMNGPSRALPLARSPEEILGAAATEQTLTLSFRQ
AEDNLHRTQTERANKVAAAQAARLRADEAAAEAQRRQDAAVAELTAVQQA
FASQQTQLNTIVAQRDSARARLNEARPTTRATAPPSPGRAQPDSAPPPTQ
WDSATPPSGPDAGLWDTTLPMVPSANVAGDPIAIINAVLKIMATSGQLTA
DMGRKFLTKLGILSPASAAADPGITNGRIPRVYGQQASELVIRRAMSQLG
VPYSWGGGNANGPARGIDQGANTVGFDCSGLMLYAFAGVGIKLDHYSGSQ
YNAGRKIPSAQMRRGDLIFYGPNASQHEAMYLGNGMMIEAPYTGSVVKIS
PVRSSGMTPYVTRLIEY
119867506YP_937458.1 integral membrane sensor signal transduction histidine kinase [MycobacMSTAAPASPTRGPRWRRPGIGLRLLAAQAIVLAAGAATTSIVAAVVGPPL
FREHLHMAGVAVDSLEEIHAEEAYGYATVISIGGALAVSALAALAVSFYV
SRRLQRSVTEVASAARAVAEGHYDIRVSPPRLGDDFDSLAVAFNKMASRL
QAVDTTRQQLFGDLAHEIRTPVAVLDAYIEALEDGVRTLTPQTAAMLRDQ
TRRLVRFSGDVAALARAEESAVSMAYNVIDAETLARGCLAAAQTRYDTKG
VALELSTAQNLPPLWADEQRLSQVIGNLLDNALRHTPTGGTVRLECSYNQ
NQLWIRVADNGEGIGIDHLPRVFERFYRADSARDRQHGGAGLGLAIAKAL
IEAHGGDISVSSDGPGTGAAFTVKLPIAQHHNSAAAGPARPVRA
119867504YP_937456.1 hypothetical protein Mkms_1454 [Mycobacterium sp. KMS]MTALRILAVSLTAAVVAACSSNTVDSTPAIVPGMVHIHGLGINPADDQLY
VATHYGLFRAGEDQAPQRVGDLAQDFMGFTVTGGDEFLASGHPDPADRSQ
PPHLGLIKSDDAGRSWESLSLKGSADFHALEYRHNRIYGHDSQSGRVMMS
TDEKSWQQRAEIAAHDLAVSPADANDILATTQQGLFRSADGAMTFGAVAG
APALVFVSWPDSGPLIGADAQGTLYTSIDGQTWQPQHRLNATPQALLAAG
DRQVYVATDTAIYQSGDDGATVSVLSTVD
119867502YP_937454.1 AraC family transcriptional regulator [Mycobacterium sp. KMS]MNGSHRGDHRPPPQPRWAGTALLRPGVLAFAGSIGTTDVHAHHAIQILTA
TTPLTIADAHGSRYRATKVVIPADVAHQIEVGAVDGTVVFLEPESAAGRS
AHLRALRSGWAVTPALAHTRRRPLATVVRELLEQFGPQQADSEIALHHPA
VDDALHLLPNMVATGPLRVADLAPQVGISVSRLTHLFTEQVEIPLRRYVL
WTRLRIAITRVQAGDDLTEAAHQAGFADSAHLTRTTRDMFGLAPSALSKH
VSWNLEA
119867500YP_937452.1 hypothetical protein Mkms_1450 [Mycobacterium sp. KMS]MLVSGPRVNGHEERGSAGRGSAGARRRIARFHSHVVCGSTPSDCNIWTGA
IGADGYGGSTSPATAWGLCVRPHRYALAIAEGSVAAGVLGLHQCDNPVCV
KIAASSDPQQHVVSGSQGDNFKRMAWMCGGGGRHAARRCESRGVRRERSV
GLREAVHHGWMPPRCRRRCLATSPTLWCISTLAEVDDSTGSSR
119867498YP_937450.1 exonuclease V subunit alpha [Mycobacterium sp. KMS]MHVMVMTLHKLTAGDGYVYLVRQVAAADSTERGRSPLADYYSAKGESPGR
WTGRGLAALADTGAREVSDEVRQQMWTVEGGSVVTEEQMKALFGLGLHPN
ADRISDHLSPRLNVRPSIAATQLGRKYAVRDESSEFTRRVGKAFRAHNIA
AGLPGAATIDDDVRAGIRTRVATEMFAEQFDRAPADARELSGFIARATRA
RTTAVAGYDLTFSPVKSISALWAIAPPEVSEQIEAAHEAAVAEVLEWLQD
NAAFTRTGTNGVAQVDTQGLIAAVFTHRDSRAGDPDLHTHVAISNKVSYL
DHNGVRRWLALDGQPLHRVIVAASEMYNTRMEAHTIDRLGVDFAETSRGR
GKRTVREIVGMSTELMTRWSSRRTAIKARTAELAKAFQHDHGREPTTIES
LALAQQATLESREAKHEPRSLAEQRDTWRHQAVEVLGHDGVDRMLANVLT
PERGHTTPEITDEWVAAQAGALIATVSESRATWQRHHVHAEALRVVRNEG
VARVSQLVERLTDTALSEAFSVPHARTADAELGEPVALRRSDGSSVYSRH
GTATYTSRDILTAERRILAAAHQLDGRVAAATDVRLALADAAAHGKNLND
GQAALVAQMALGGRRVGLALAPAGAGKTTAMAALAHAWRSSGGQVLGLAP
TAAAAIVLGEDLGATTDTLEKYVHCTDENNAAIYGTPDWFTQVGPDTLIV
VDEAGMASTPGLDALITHALSAGASVRLVGDDAQLASISAGGVLRDIATD
TGALTLSEVVRFHSRAEAAASLALRGGDPAGIGFYLDAGRIHIGTEQTSA
DAAFTAWQADQDAGRDSLLLAPTNAIVNELNVRARTARLAAALEADPQAT
PGRETTLSDGLTASVGDVIRTRRNNRQLPLSGTDYVRNGYTFTIVDIATD
GALTARHRGTGREITLPTDYVTDHVTLGYATTIDAAQGSTAGHACHVVGA
EHLTRQHLYVALTRGRAENHLYLSTAETDPHRILAPKATHPDTAVDVLSR
IVARDGAQVSATTAARQAADPSRRLAAAANMFTDALATAAENQLGEGARA
RLDALAESVHPDLTTCTAWPVLRRSLAMRALSGADPGRLLTAAYARGGLD
DAADAAAVLDYRIDLTDGDGRGSGPLRWLPAIPTVLADNPHWGDYLHRRE
HLVTDLADQIRDHARSWTTEIAPPWARPLIAANANPTLTAEIAVFRAATA
VTAADTRLTGSPQYPVATRAVQDLLQRHGIDAIAHSRPDTTQWHDLIDAI
DPRVRADEYWPTLAAQLAEAAPTNNIPQLLADAAHQGPLPDEMPAAALWW
RITETLAPTAAVPEPQESVEHASDAALVEVLAAAHRNGDPLRLPAPQPDP
VAPALTAPYVVTTLAADHDTPELAEAIAAAAADAGRSYLRVPATPQSDRY
SLAELADKITDRRPPRAALVVVEDAAAADPAQLATVATALADAHGRLLLI
DNGEPGPGRRLLDGMGLPWSENSRPTITIEDTALADSADNHRAAAAKRWR
TLTNRHGRDRGRDRDQQYGLDID
119867496YP_937448.1 hypothetical protein Mkms_1446 [Mycobacterium sp. KMS]MPATGGSAGSYGRLIVTPDMEPPDAAHWDAQEQTYRTGATAWDGIHQKIV
TDNAQFRDAADSQGFDEAHRAGAVLAEEAKTIAEWHDKCATKCADIATVL
RDTRAGQEQLIREADPKIAAAKLPGEAEALVTEYHGIAMYRTEAGVTAAI
AAHTSFKKSSENTRALDLLAKWGDVPTAPPVAPVDHTSPGIEQDENPYRY
TEKPEAGADAPEPVADAPTDTAGTSVTQPGVSPGSEAGQGRSAVSDEGLA
ASGPVTQAMSGVAATPRTGTTSPLGGVGVPSMGGLGSGGGGGLGSGGGVP
KMPGGLGGSGLSGSNPLSGGVGQMPGAAGWLPNSGAVSAAGGASPLSSAF
NQGMATTAGMGGGIPSTQPPAPASPSPALSAGGGHAAPVSAAPGGGVSPA
AAQPGMVAPAAPSALTGTGVSSGGGAPMMLPPGSMGPPAGAVPPPAPTVP
AGGPGAANVLAPSAPSAAGAAAGPTLIPASVVAAGQTAAARERRESADAA
AAKDLAWKLQHAAEEVKYPVEWAVGIFRSPSGTETVITSNDGASYIPAGV
FVPRSVGVLSSDPLVDDHFRQLWFGWGDPARVLIEYAQLRVETGWRLVAA
ATTGVVNVLRDAGVEHPPSCSRLTNPWRQEGVEVPAPILDGMHEHRLAVL
WPDVYPRLLRVMTADPIFQDRIVSGVSASLTHSATTQAQAIDDGIPDPIR
QVWTERGGDREPTVQQWADYDAAAKSFNAASAIFRPAFVNGCIADPGDTL
QERARYRAHWLVARTAEHIGGWSSRPLPLPDMCYAAAATGELPHLRDVIV
KALVSVEGDLQYEAPR