Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is Mycobacterium_sp_MCS
Gene IDProtein IDProtein DetailsSequence
161407225YP_638154.2 30S ribosomal protein S12 [Mycobacterium sp. MCS]MPTINQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
161407223YP_638514.2 thymidylate kinase [Mycobacterium sp. MCS]MLIAIEGVDGAGKRTLTTGMRAAFEGAGRSVATLAFPRYHRSVTADLAAE
ALHGRHGDLAESVYAMAVLFALDRADARDEIAHLAAAHDVVILDRYVASN
AAYSAARLHQSADGEAVEWVRSLEYDRLGLPAADWQILLDVPTALAAERA
ERRAEQEADRARDAYERDDGLQRRTGEVYQALAATDWCGRWIVAGPDVDA
AALADGLTAS
161407221YP_640476.2 dihydrolipoamide acetyltransferase [Mycobacterium sp. MCS]MAVSVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPS
PASGVLQKIVAQEDDTVEVGGELAVIGEGGEDSGDSSDDSSSDEDEDEEP
AEEAESETTSEESDSSEETDSSEETESEPEPEPEPKKESKPKPKSSGSAT
PVTMPELGESVTEGTVTRWLKKVGDSVEVDEPLLEVSTDKVDTEIPSPVA
GTLLEIIAEEDDTVEVGGELAKIGDADQAEAEEPEPEPEPEPEPEPEPEP
EPEPKQESKPEPKPEPKQESKQEAKPEPKKEPEPQQDAEPSDGSGPYVTP
LVRKLAAEHDVDLAAVKGTGVGGRIRKQDVLAAAEADKKAKSGPEDAAEA
PGKAPAAATASANASDAPLAHLRGTKQKANRIRQLTAKKTRESLQATAQL
TQTHEVDMTKIVALRAKAKNDFAEREGVNLTYLPFIARAVIDALKQHPNV
NASYNEDTKEITYYDAEHLGFAVDTDQGLLSPVIKNAGDLSLAGLARAIA
DIAARARSGDLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGA
IVKRPRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKRRL
EEGSFEADLGL
161407219YP_642026.2 putative glutamate synthase (NADPH) small subunit [Mycobacterium sp. MMGVERSGDSDTDGDVPGAASDLTRLPDLAHGTPRAGPVRLRYPVYVDLLP
PCNDACPAGENIQAWLSHVRAGRHEQAWRRLVSDNPFAAIHGRVCYHPCE
THCNRGQLDSPVAIHAVERFLGDLATQNRWEFAPPAARSGKRVLVVGAGP
SGLSAAYLLALRGHDVEIRDAGPEPGGMMRYGIPSYRLPREVVDAEVDRI
AALGVRLTCGHQVEDLAAERDSGDFDAVFVAVGAHLAKRVDIPGRDAGAL
LDAVTFLRSVAAGQPPELGRHVAVYGGGDTAMDVARVARRLGAEDSVIIY
RRTREQMSAHAEETEEAEREGVRINWLRTITAFDRPDLQVEVMDLDEHGQ
PRPTGRFEKLAADTVIMALGQKTESEFMRTLPGVRFDDDGTVQVSPTLMT
GCPGVFAGGDMVPGERTVTVGVGHGKRAARHIDAWLAGRSGERPPSHPPV
AFDDLHLWYFGDAPQRPQPHLDAERSVAGFDEVVGGLTEQAAVYEAARCL
SCGNCFECDGCYGACPEDAIIKVAEGHHGYEFVYDRCTGCGACFEQCPVH
AIEMLPETS
161407226YP_637784.2 chaperonin GroEL [Mycobacterium sp. MCS]MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITN
DGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVR
EGLRNVAAGANPLGLKRGIEKAVEKVTETLLKSAKEVETKEQIAATAGIS
AGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISG
YFVTDAERQEAVLEDPYILLVSSKISTVKDLLPLLEKVIQSGKPLLIIAE
DVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVIS
EEVGLSLETADISLLGQARKVVITKDETTIVEGAGDAEAIQGRVAQIRAE
IENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRN
AKAAVEEGIVAGGGVALLQAAPSLEELNLTGDEATGANIVRVALEAPLKQ
IAFNGGLEPGVVAEKVRNSAAGTGLNAATGEYEDLLAAGVADPVKVTRSA
LQNAASIAALFLTTEAVVADKPEKSAAPAGDPTGGMGGMDF
161407224YP_638299.2 50S ribosomal protein L13 [Mycobacterium sp. MCS]MPTYTPKAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDG
GDFVIVINAEKIAVSGDKLNNKYAYRHSGYPGGLRRRTIGELLIKHPTRV
VENAIVGMLPHTKLSRQVQKKLKVYAGPNHPHAAQQPIPFEIKQVAQ
161407222YP_640258.2 DNA polymerase IV [Mycobacterium sp. MCS]MDVRWVLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVVAGASYEAR
VHGARSAMPMHQARRLVGAPAVVLPPRGVVYGLASRRVFDTVRTLVPVLE
QLSFDEAFGEPQELAGASAADVEEFCELLRARVLEETGLVASVGAGSGKQ
IAKIASGLAKPDGIRVVRRADERRLLDSLAVRKLWGIGPVAEDKLHRLGI
ETIGQLAALSEAEVADILGATVGPALHRLARGIDERPVAERAEAKQISAE
STFPADLITLDQVREAIGPIADHAHRRLAKDGRGARTVTVKLKKSDMSTL
TRSATLPSATTDAATLSATARRLLVDPVEIGPIRLVGVGFSGLSEVRQES
LFPDLELVEDEPATRPAVPMSVSEAAAVPPAWRVGDDVAHPELGHGWIQG
AGHGVMTIRFETRSTGPGPAKTFPDTVPDVVRANPVDSLDWADYVDALPQ
ADLP
161407220YP_641822.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium sp. MCS]MTGQEYDVVVVGSGAAGMVAALTAAHQGLSTIVVEKAPHYGGSTARSGGG
VWIPNNEILKRDGVKDTPEAARQYLRAIIGDVVEPERIDTYLQRGPEMLT
FVLEHSPLKLCWVPGYSDYYPETPGGKPTGRSVEPKPFDAKKLGEDLPGL
EPPYGKVPMNMVVMQQDYVRLNQLKRHPRGVLRSLKVGIRATWAKATGKN
LVGMGRALIAPLRIALREAGVPVLLNTALTDLYVEDGVVRGIYVADTNAQ
TGTDSSEPRLIRARRGVILGSGGFEHNEQMRVKYQRAPITTEWTVGAKAN
TGDGILAAEKLGAALELMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNM
SGKRFMNESMPYVEACHHMYGGEYGQGPGPGENIPAWLIFDQQYRDRYIF
AGLQPGQRIPSKWLESGVIVKADTLAELAEKAGLPADALAATVQRFNGFA
RSGTDEDFHRGESAYDRYYGDPTNKPNPNLGEISHGPFYAAKMVPGDLGT
KGGVRTDVHGRALRDDGSVIEGLYAAGNVSSPVMGHTYPGPGGTIGPAMT
FGYLAALHLAGRS
108802371YP_642568.1 ribonuclease P [Mycobacterium sp. MCS]MLPARYRMTRSTEFSTTVSKGVRSAQPDLVLHMANVLDDPSGPRVGLVVA
KSVGNAVVRHRVSRRLRHSVHPMLDELQPGHRLVIRALPGAASATSARLH
QELSAALRRARPRVEASA
108802369YP_642566.1 putative inner membrane protein translocase component YidC [MycobacterMFNWFSLDIIYYPVSAIMWVWYKAFAFLLGPDNFFAWALSVMFLVFTLRA
ILYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQKEHGF
NPILGCLPMLAQIPVFLGLYHVLMSFNRTQTGIGRLGLSVEENRSLPNYL
FSATDVGHFLDANLFGAPLGATMIQQHGLEAFTEFNRVAVVVVGVPIMLL
AGIATHFNSRASVARQTPEAAANPQTALMNKLALYVFPLGVVVGGPFLPL
AVIMYWLANNIWTYGQQHYVFGKIEKEEEAKKVEALERRAANAPAPGAKP
KRTRKAQEAADAGADAVDGSVTDAAGADEAAGGPAAKASGNGAAKPSGGQ
AVSRTPKPGARPKKRKR
108802367YP_642564.1 16S rRNA methyltransferase GidB [Mycobacterium sp. MCS]MKHVAPPPTAEAVFGDRLPLAQRYAEFLATAGVERGLIGPRETDRIWDRH
ILNSAALGESVESGDRIADIGSGAGLPGIPLALARPDVHVTLIEPMQRRC
EFLTEVVDALGVAVIVVRGRAENPAVRREVGEMDVVTSRAVGSLDKLATW
SMGILREGGRMLALKGARAEAEIEENRRVLARAGAVDVRVLRCGADYLNP
PATVVEARRATPSNGRGRPGRSSRR
108802365YP_642562.1 chromosome segregation DNA-binding protein [Mycobacterium sp. MCS]MTQPTRKRSGLGRGLASLIPTGPTEDGSQAALGGPRMGNAAADVVIGGGP
VAAPPAPELGAVYREIDPSAIEPNPRQPRQVFDGEALAELVHSIREFGLM
QPIVVRALEPGDAGPRYQLVMGERRWRAAQEAGLATIPAIVRETADDSML
RDALLENIHRVQLNPLEEAAAYQQLLDEFGVTHDELAARIGRSRPVITNM
IRLLRLPIAVQRRVAAGVLSAGHARALLALEGGPERQEELAARIVAEGLS
VRATEEAVTLANHSGPAAPPAPRRKPIQMPGLQDVAEQLSTAFDTRVTVS
LGKRKGKIVVEFGSVDDLQRIVELMNSTKP
108802363YP_642560.1 peptidoglycan binding domain-containing protein [Mycobacterium sp. MCSMSSLRHGDRGAAVTEIRAALSALGLLDSPDDDLTTGRHVVADLFDDHLDQ
AVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLMHQFGAPMYGDDV
ATLQARLQDLGFYTGLVDGHFGLQTHHGLTSYQREYGLYPDGICGPETLR
SLYFLGSRVTGGSPHAIREEELVRRSGPRLSGKRVIIDPGRGGSDHGLIM
NGPQGPISEADILWDLASRLEGRMTAIGMDTFLSRPANRSPSDAERAATA
NTVGADLMISLRCAAQPTPAANGVASFHFGNSHGSVSTIGRNLADFIQRE
VVARTGLRDCRTHGRTWDLLRLTRMPTVQVDVGYITNPRDRELLVSNHNR
DAIAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELSVEQAGRLSSN
108802361YP_642558.1 thioredoxin reductase [Mycobacterium sp. MCS]MPVRNGRKAHMTSSSTVHDVIIIGSGPAGYTAAVYAARAQLKPLVFEGSQ
FGGALMTTTEVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVDEVS
LDGPVKTVTVGDETHRARAVILAMGAAARHLGVPGEDALLGMGVSTCATC
DGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTVIHRREEFRASRIMLD
RARANEKITFMTNTAVTEIEGDPKVTGIRLRDTVTGEESKLAVTGVFVAI
GHVPRSDIVRGQVDVDEDGYVLVEGRTTNTSVEGVFAAGDLVDRTYRQAI
TAAGSGCSAAIDAERWLAEIGVAPSDQEISAPI
108802359YP_642556.1 integral membrane protein MviN [Mycobacterium sp. MCS]MSTTGWEPGPPPNRPPDPPAQPFPPPRRIPPPPGAARPGPGRRPPPAPPR
QRVPRGPAPRRRAGRPELSDAAVVSRSWGMAVATLVSRITGFLRIVLLAA
ILGAALSSSFTVANQLPNLVAALVLEATFTAIFVPVLARAERDDPDGGTA
FVRRLVTLATTLLLAATVLSVAGAPLLVRLMLGDDPQVNNPLTTAFAYLL
LPQVLFYGLSSVFMAILNTRNVFGPPAWAPVVNNVVAIATLVLYLIVPGE
LSVDPVEMGNAKLLVLGIGTTLGVFAQTAVLLVAIRRERISLRPLWGIDD
RLKKFGTMAAAMVLYVLISQIGLIVTNQIASASAASGPAIYNYTWLVLML
PFGMIGVTVLTVVMPRLSRNAAADDIPAVLGDLSLATRLTMVTLIPIVAV
MTVGGPAIGTALFAYGNFGETDAGYLGMAITLSAFTLIPYALVLLQLRVF
YAREQPWTPIIVIIVVTTVKVIASLAAPAMTDDPELVAGYLGLANGLGFL
AGAVVGHFLLKSSLRPPGGRMFDVQVIRTILVTIAASLLAGLLAHVADQL
LGLESLTADAGGVGSLVRLAVLGLIMVPVIAGVLLAARVPEADAAVAFVR
RRLGRSAPAPAASISRPDQPRPAGAFPYSDGRSARPVRRSRGPATGRYDP
PVRGTPVHGAGAERWRGPAVSDDSAGDSAAAPDSASTTRISRPAADTHTR
PAAETHSRPAADDFQPDVPETPSAPADRSATAEMPTSGRPPADYGGDPTR
ESLPFDAPREPAIEAATSDEDVHLIPGATISGGRYRLLVFHGGPPNLQFW
QALDTALDRQVALTFVDPDATLPDERVQDILARTLKLSRLDMPGVARVLD
VANTGSGGLIVSEWIRGGSLAEVAETAPSPIGGARAIQSLAAAAEAAHRA
GVALSIDHPSRVRVSIEGDVALAFPATMPDATPEDDIRGIGAALYALLVN
RWPLPETGVPSGLAPADRDPAGDPLEPRAVDREIPFQISAAAAHAVQPDG
GIRSAPTLLNLLQQATAVADRTDLISPVDRPDGGTPSRFRGEPDDDPEAQ
ARRKRGLMVGLTVGGVIVVVALIVLATVLSRIFGDVGGGFDGDELGLNAP
TTSEEAEGGSTAPGNVVRPVRATVFSPAGGADSPDQAGNAIDGNSTTVWP
TDIYSDPNPFPNFKNGVGLMLELPQPTTISSVDVNVSSTGTSVQIRSAQS
AEPSSLESTTEMTPSTPLSTGNNTIEVSDASPTSFVLVWIDKLGTVNGES
RTDISEITLKGTS
108802357YP_642554.1 NUDIX hydrolase [Mycobacterium sp. MCS]MSEGEQPKPRRRRGRRRGRRAAGPPQAATDRSTASAEPANGSGPADTPGT
GTPGTGAKPTDQARKARPRRPQERLRTVHETSAGGLVIDGIDGPKDSQVA
ALIGRIDRRGRMLWSLPKGHIEMGETAEQTAIREVAEETGIRGDVLAALG
SIDYWFVTEGRRVHKTVHHYLMRFLGGELSDEDVEVTEVAWVPLEELPSR
LAYADERRLAEVAHELIDKLHADGPAALPPLPRSAPRRRPQTHSHTRNRR
RDESSQTPPGRRTNGCGQGQ
108802355YP_642552.1 hypothetical protein Mmcs_5396 [Mycobacterium sp. MCS]MEYCLGDADGSATMWTAEPDADTDGDGVFDAVALDLDGDGRVDDALADRD
GDGLAEVGARDLDDDDVAEAYVSDDGTGTWMLSVDRTGQVRWFGLDGVEH
TGGPMVDLDADGQVDDRLVDSDGNGLADRVFSGDTAHVDTDGDGRWDVRL
SDGDGDGRADAATGM
108802353YP_642550.1 hypothetical protein Mmcs_5394 [Mycobacterium sp. MCS]MAAADSVVADLRAESDELDALIADLPAAMWSTPTPAPGWTIAHQIAHLLW
TDRVALLSVTDEAGFNVVLGDAAKDPGGFVDRAAEDLAATPPAELLADWR
TTRGLLHDALLTVADGRKLPWFGPPMSAASMATARLMETWAHGLDVADAL
GVRRTPTTRLRSIAHIGVRTRDFAFAVHGLPAPAETFHVELTAPDGSPWT
WGPADAAQRVTGSAEHFCFLVTQRRPRTELDVTAVGPDAEQWLSIAQAFA
GPPGPGRG
108802351YP_642548.1 hypothetical protein Mmcs_5392 [Mycobacterium sp. MCS]MVNVAQSEDPEDFIAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHND
GGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLATL
RAGVEAAGVPGLRHVQGRMVMVDLDADPEPLAPALEGVRIFAGYSGWTIG
QLEGEIERDDWIVLSALPSDVLIEPRVDLWARVLRRQPLPLSLLATHPID
VSRN
108802349YP_642546.1 hypothetical protein Mmcs_5390 [Mycobacterium sp. MCS]MIEKARHWRVLAGGVAAGVAGLVGFAGATATAEPVFPQPPVPGPVAVSVA
PAAAPAAVPESATTRGIPGAVISPSAGTAPAAVAPPAPTILPASSGTIAE
FFKAKNVAMQPQVARDFNALNITLPMPRGWAYIPDPNVPEAFAVIADRVG
GDGLYSSNAQLKVYKLIGDFNPDEAISHGFIDSQALPAWRSTDASLAPYN
GMPSSLIEGTYRENSMTLNTSRRHVIASSGPDRYLVSLAVTTTVDQAVPA
ADATDAIVTGFKVTSPTAQPAVAPPPPAPAAPLAPGLAPLPQPLGQP
108802347YP_642544.1 hypothetical protein Mmcs_5388 [Mycobacterium sp. MCS]MYFVDDRPFTDAARVRALVWSYGRDAVGSALTAAWWHGFSRFCPEIVDVT
VPRNSNGRVHPGSRVRRRDLAGDDVAVSRGLRVTAAPLTAIEAAVRIRGG
AKIVDRALQNDIELRELWRAHLRNKGRYGSPAARILLQAADSGAHSEAER
LFVRLLDQAGITGWRTNHPVGGYVVDVAFLAAKVAVEIDGLAFHSDSEDF
QKDRVRQNAITLLGWQVLRFTWLDLTEYPDRVIAVLRTAISA
108802345YP_642542.1 hypothetical protein Mmcs_5386 [Mycobacterium sp. MCS]MIGLMPHDPSFAPTQLAARAAYLLRGNDLGAMTTAAPLLYPHMWSWDAAF
VAIGLAPLSVERAVVELDTLLSAQWRNGMIPHIVFANGVDGYFPGPARWA
TSALAADSPRTRHTSGITQPPVHAIAVQRILDHARTRGRSTRQVAEAFLD
RRWGDLVRWHRWLAECRDQNGRGRITLYHGWESGMDNSPRWDAAYANVIP
GAVPEYQREDNKINTDATQRPSDHEYDRYLWLLEEMKSARYDDHLLPKVM
SFAVEDVFVSAIFSVACQVLAEIGEDYKRPNADVRDLYAWAERFRAGVIE
TTDQRTGAARDFDVRTEKWVATETVAQFAPLLCGGLPHHRERALLRLLEG
PRFCGHPDLRYACIPSTSPVSRDFRPREYWRGPVWPVMTWLFAWCFARRG
WAERARVLRHEGLRQASDGTFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
108802343YP_642540.1 ABC transporter-like protein [Mycobacterium sp. MCS]MADTSVDPVSLSANDIHVAFGPNKVLRGVDIDVPAGTTAAVIGPSGSGKS
TLLRTLNRLYEPDRGDILLDGRSVLKDNPDELRQRIGMVFQQFNLFPHRS
VLDNVTLAPRKLKRLPADQARELGLAQLDRVGLRQKAEVRPGTLSGGQQQ
RVAIARALAMSPQIMFFDEATSALDPELVKGILALMAELAADGMTMVVVT
HEMGFARSTADSVVFMDQGQVIEAGPPQQIFDAAQTDRLQRFLSQVL
108802341YP_642538.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MPKRYGVKEKDQVVAYVVDLVLTGRLRGGHRIDRNAIAEALGVSRVPVQE
AMVQLEHDGIVSTRYHRGAFVERFDAATLHEHHELYGVLTGIASARAATD
PNPELLGELDDTLQHMRKGKDRRLFHEGCQRFRDIVNEAYAGPRLHAAIR
ASQCFAASDFWVSYPRVRAELLPTYQQEATAIAARDAAGARTACLERSDL
MATIMVAELTRRGVLAGDGG
108802339YP_642536.1 hypothetical protein Mmcs_5380 [Mycobacterium sp. MCS]MTSPALTTVDLAHEGNEASDLVHVDNEALLEAHGWDLGFWTVLDEGPVED
CVAVLGHARGAAPDRGWEIHRLPVDAGDEKGRTEDAEAVARHDGWVYVVG
SHYGSKAGPLQAKRAFLARFDEQSIDRTVPESELPIIVRRNKFHLHRLIN
DALDASHVVAITPGDTVRTRFIARTIERGTQRSKSWVDRLTERDVPINIE
GAAFRPNGNLLLALRFPTTAAGEPILVELSGVPALFDDEVSSPTAVRVWE
LAGVSPPDALVGFRALSRSGDDVYDAILGSIDATDKGSVLLDDHPEGAVA
HCSHWRFTLTADEPADGAVRAELVHDFRDLRNVEGLSVESGQTFYVTDED
HRIQLRFG
108802337YP_642534.1 hypothetical protein Mmcs_5378 [Mycobacterium sp. MCS]MAVRRGARRAEGFAVRRWLQVGAASAGVGAGLLGFSLLGPQVGTAAADTA
GETTTSSNAPSSDDDARSTSTDQSDDTDDQDAEDAEAEDAEDADEEDAED
AEDEEDPDEEDEEDAPEGLEDEDPDEDTLDQDDEDDEESAADDDKRAARG
TTEDVAAETVSQPQARVTALEPKAPSGSWSDVTGRAISTWTRDSQGWINS
LPVDNQAKYHLEGALWATRRTFLNQAPDVAPIQISGKLDGPVVGTVGAVD
PDGDRLIYIVTRGPKTGSVKVNADGTYTYTPGAGFDGVDTFRVVAVDVGP
HVNLLDPFRRIGTSADNLVNQRAIRFTFAYRDGSEHWTPERRAALNDVAD
RLVEYFTVTRAVTLTYDILGENDATSRTLAWAWSDPLSQEPGYWRTVVQN
KIISGVDANGEASDGQIAYNFGHKWGLGDTVASDEYAFTPVAIHEILHSF
GFMSFIERPGENVERTWMVFDQFVVTADGSRPIDSDYGWDAEFDPYLTGQ
NGGMYFGGANAVAAYGGLVPLFTPNPWRPGSSMSHLDDATFTGVNVKVMN
AQAPIGPRVRILSPMEIGILRDLGYRASAPVTQL
108802335YP_642532.1 myo-inositol-1-phosphate synthase [Mycobacterium sp. MCS]MTEHAGDIRVAIVGVGNCASSLVQGVQYYKDADENATVPGLMHVRFGPYH
VRDVKFVAAFDVDAKKVGFDLSEAIFASENNTIKIADVPPTDVVVQRGPT
LDGIGKYYADTIEVSDAEAVDVVKALKDAKVDVLVSYLPVGSEEADKFYA
QCCIDAGVAFVNALPVFIASDPVWAKKFEDAGVPIVGDDIKSQVGATITH
RVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTS
NLQREFKTKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPLNLEYKLEV
WDSPNSAGVIIDAVRAAKIAKDRGVGGPVVAASAYLMKSPPQQLPDDVAR
TQLETFIEG
108802333YP_642530.1 hypothetical protein Mmcs_5374 [Mycobacterium sp. MCS]MAVSSSGRPTAGTRAKDSDRNDICKVLDTALGEGQLSMTEHGERVKAATH
AATLGELQALVSDLQTGNAPVQLPDLSRPRRPRLPLKAGWGVKAAMAVVL
VVLGMCIGWGLYGNTSSPLDFQSDPGAKSDGIGPVVLTPPRQLQSLNGLN
GLFEQMRKRFGSTMGYELDIRADTASLDRPDPSDNRRKQNYDYRGGWGDP
WGSPSTLDSDDRLVDLAKFDFEKTLGVLRGAPDTLGMNRADVTDTWLRVG
PSADPATPDLLTLEIIANSDFGTGRIELFPDGTTKAIWPPSS
108802331YP_642528.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MQRPPEPAPRNRPPRAPDDNRTAILPQVRHEPPPHLRDPIDVVKAALEGT
PPQKPPPPRGPGGGGDGPSGPPPGGHPHWRERVNWRWVRRGLIAAAVVLI
VLPLVTFGMAYMIVDVPNPGDIRTNQVSTILASDGSEIAKIVPPEGNRVD
VNIDQIPVHVRDAVMAAEDRDFYSNPGFSFTGFARAFKNNLFGGDIQGGS
TITQQYVKNALVGSERGGLGGITRKAKELVISTKMSGEWSKDQVLQSYLN
IIYFGRGAYGVAAASRAYFNKPVEELNVAEGALLAALIQRPSALDPAVDP
EGAADRWNWVLDGMVEIGALSEADRAAQVFPPTVPPDVAQTQNQTTGPNG
LIERQVQRELLELFNISEQQLNTEGLQITTTIDPKAQRAAEEAVAEYMDG
QDPDMRTAVVSIDPKNGGVKAYYGGSDANGFDFAQAGLPTGSSFKVFALV
AALQQGIGLGYQVDSSPLEVDGIKITNVEGNSCGTCNIAEALKRSLNTSY
YRLMLELNNGPQDVADAAHRAGIAESFPGVEHTLSEDGQGGPPNNGVVLG
QYQSRVIDMASAYATLAASGVYHKPHFVQKVVNSQGDVLFDASQEDNSGE
QRIDKAVADNATSAMQPIAAYSNGHALAGGRPSAAKTGTNQLGDTDANRD
AWMVGFTPSLSTAVWVGTVDGTKPLENQWGSPVYGSGLPSDIWKATMDGA
LEDTDNESFPKPEEIGGYAGVPQAPPPRPTQTSTLVPTPSETVIQPTLEV
APGITIPFGPPTTVPVGPPPPVGQPVPAPAPAPGVPLPPQPVAPGVPVPP
GPPPPP
108802329YP_642526.1 30S ribosomal protein S6 [Mycobacterium sp. MCS]MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVDKVDIWGRRRLAY
EIAKHAEGIYAVIDVKAAPATVTELDRQLSLNESVLRTKVMRTDKH
108802327YP_642524.1 30S ribosomal protein S18 [Mycobacterium sp. MCS]MAKSNKRRPAPEKPVKTRKCVFCSKKGQDIDYKDTALLRTYISERGKIRA
RRVTGNCVQHQRDIAVAVKNAREVALLPFGSSTR
108802325YP_642522.1 DnaB helicase-like protein [Mycobacterium sp. MCS]MAVVDDRGHPDMDAPPPSEDFGRQPPHDAAAEQAVLGGMLLSKDAIADVL
ERLRPGDFYRPAHQNVYDAVLDLYGRGEPADAVTVAAELDRRGLLRRIGG
APYLHTLISTVPTAANAGFYAGIVAEKALLRRLVEAGTRVVQYGYAGADG
ADVADVVDRAQAEVYDVVDRRSSEDFAVLESLLQPTMDEIDAIASQGGIA
RGVPTGFTELDELTNGLHSGQMVVIAARPGMGKALALDTPLPTPDGWTTM
GEVEVGDELIGADGRPTRVVAATDVMVGRPCYEVEFSDGTVIVADAQHQW
LTDTRASGRSARVAAAVRTTEQIAATLRCPTADRRLNHSVANAAPLQAPT
RELLVPPYTLGAWLGDGTSAAAQITTADPELVMRIEAEGVEFGTLQGRLR
TIGVLGDKHIPIEYLRASESQRRALLAGLLDTDGTVAVGGGVQFSVTNKR
LAADVAELVVSLGYRCRSTTKHVKGRSADSSVAYTLNFSTDDDVFGLARK
AILHKERRGASTTVRSDSRFIVDVRPVRSVPVRCVEVSNDSHMYLAGRSM
VPTHNSTLGLDFMRSCSIKHQLPSVIFSLEMSKSEIVMRLLSAEAKIKLA
DMRSGRMSDDDWTRLARRMSEISEAPLYIDDSPNLTMMEIRAKARRLHQK
AGLRLIVIDYLQLMTSGKKVESRQQEVSEFSRNMKLLAKELEVPVIAMSQ
LNRGPEQRTDKKPMLSDLRESGAIEQDADMVILLHRPDAFERDDPRGGEA
DLIVAKHRNGPTKTITVAHQLHLSRFANMAHA
108802323YP_642520.1 transposase- mutator type [Mycobacterium sp. MCS]MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWG
QPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAE
SALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQ
FRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVL
GMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGA
AWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAERLNKEIRRR
TDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITN
DNPEIGADDMPALTA
108802321YP_642518.1 hypothetical protein Mmcs_5362 [Mycobacterium sp. MCS]MPKHARVTKFSDQKQVKTLIATAVLTAGLGGSALVVSPDHPLTAAPVAQS
GVVVGANPVAAAAPATPKPVLAAAPAPKPVVVTADSSPQDIVNAIVSQGR
AVGLAEEQIKTIIATAKIESGFRPAVSGGAQPYGAPATAADEVLGLFQEK
ATFGTVAERQDPNKAIARFIVRYTEAFKRYGITDDTVQAATLAQNPQLLK
HRRGVGTGYYNTVKAAMGEAGHLYDQAAARPPQSVIR
108802319YP_642516.1 twin-arginine translocation pathway signal [Mycobacterium sp. MCS]MAQHDLGPGIGPLRDATIGRRSLLLLTGAVGAGAVLAACAKPPRPPGAGA
IPPMPVYAAALNEQIPPILKENGIPGAIVLIRSPDKGDWSATFGVAGIGS
DAPPSLHDHVRIASISKSMTATVILQLQQEGELAITDPISRYIPGVPDGD
SITIQQLAEMRSGLYSYADDPGFAATLEKQPDTVWTPQQLLGIAFAHPQN
FPPGRQYEYSNTNYVLLGLVIEKVTGTTAAAALKARIFDPLGLRNTMLPA
AADAALPDPHPRGYMWGPNEASDGPLPQAQLEAALAGDLQPADHTNDNPS
WAWTAGGVISRADYVADFIEAMVAGPLLDDATRQWRLVNMKPTDLSDPGG
ASKLGFGTYGFGLEGAGPMYGHPGNIVGFSGLAAHDPKVGTTVVILTTVY
LTPRGDSPQNALFAPILSQLYPDVAAQLPGLDSSRSTPPTSSTGPGR
108802317YP_642514.1 activator of Hsp90 ATPase 1-like protein [Mycobacterium sp. MCS]MPVTEFNTNIDDLTLTITAEFAAPVERVWQIYADPRQLEKIWGPPDYPAT
VVDHSLTPGGIVTYFMTGPDGDKYPGYWKVIAVDEPRSFSFEDGFADDDL
KPASDMPVAHSVYTFEPAGDGRTIATYVSRYASAEGLQKVLEMGVEEGST
QAINQIDAFLAG
108802315YP_642512.1 hypothetical protein Mmcs_5355 [Mycobacterium sp. MCS]MTGVRHTLRRTVCGSVVVLVLALSMGIVKADPAADALARLNELSSEAVQT
REAVTAAQREADARLAAQTAAEERHRADADALAGANAELAPYQAAVDRIA
AMTYMGGQDGQMAAALTAASPQQLIDKLSVQQVVAATTADQMKAYRATRE
RAAAAAQASEKSAADARAAAEQAAKVRADLQAKWSELMRKIAAAEAQYAA
LTPQQQAIVDNAPPPSAPAPQDPAIVAMPAPLPGVNGPSPAAGGFDIPEA
LPMGVASEAGLQPNTVLAARAVSARFPQIADIDGVRPDSKPWHPSGLAID
IMIPNPESPEGIALGDEILAFAMANAARLGLQDVIWRGTYYTPAGPQASG
YGHYDHVHITTTPRR
108802313YP_642510.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTRAPSQGGRPRRSGIVAEDPRGDILKAAAELFAANGFGSTRMEAIAQRA
GLGQSSLYYWFRSKDAILRGIMNQNRVSLEAARALTDRDESAAVRLYIVL
YQDVVQMCTAPLNFYDLEEAAKKQPDVFSDFQGDYEELAVRLRTIIESGV
RSGEFIDVSPEEFARTALCLNEGSQYRYHATGQSREDLHLFADAAARTSL
RAVMADVDQLAGVQEAARDGIAGFSSSP
108802311YP_642508.1 ABC transporter-like protein [Mycobacterium sp. MCS]MLVVSSLEKTYPVKGGGFTAVAGMSFSVAEGELFSIVGPSGAGKTTLLRC
VAGLDQPTSGSVTFNGQRVDGPPANFAVVFQDYARSLFPWITVAKNVELP
LMKKGLDAAERRARVTQALDEVGLADAAHKKPFQLSGGMQQRVAIARAIA
YRPAVLIMDEPFASVDAQTRADLEDLLLRVREETGTTILFVTHDVDESVY
LSNRVAIVTRSPSCVAEIVDIDLPDRRDQIETKSLPEFAHLRAHVFSRIR
EMVRNDAALASI
108802309YP_642506.1 binding-protein-dependent transport system inner membrane protein [MycMTAVTALSLPRPRRLPSVALDTHLWTAAFVVGLIVLQEVLTRTDILPAGY
FPPATQIAAAFVGELGGPALGPALWSTASTWLLALCIAVVLGTVAGIGLG
LLVPLEALLRPVIEFLRPVPSVALIPLVVLTIGTGSQSALFLAVFAAFWQ
VLVPAIAGVRAAHPVALETARSYHLTVWQRIRWIQLPSMLPYLATAIRLA
TSTTLILVVTAEIIIQMPGIGYEITMSRSAGDPARMYAYIAVSGLAGIVL
NALMRRLENRVLSAQGLGESR
108802307YP_642504.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MNVGFIGLGVMGKPMAGHLVDAGHHVVVFNRSRAKVDELEARGAVGATSP
AHAGEKADVVITMLPDSPEVEEVLFGPAGVTTTLRPGSLVIDCSTISPDA
AVAIGARLAEKDIAFVDAPVSGGEAGAIAGALAVMMGGDEDAVRRAATVL
DAVAATSVHVGPVGAGQLVKAANQMLVAGNIALVGEAVTLLQRTGVDVDA
ALAVLGGGLAASKVLEAKAPKMLARDFAPGFRIDLHYKDLKIALAAAEQA
RIAVPLTGIITQLVQALRSAGDGGLDHSALIKALERLSGADASGNRKEVE
SCQQH
108802305YP_642502.1 homoserine O-acetyltransferase [Mycobacterium sp. MCS]MTMDAARGERKELRVPTFSLESGAVLDDARISYRTHGALSADGDNAVLLF
TYYTGDDLSYQPWIGPGRPLDPSEHFVIIVNHFGGGVSSSPSTSAAGFPD
VAVGDSVRAAKLVLDDLGVQRLRLVAGWSLGGMQSLEFASRYPECAATVF
ALCSAARCSPVNQVFLDSVGAALTTGGRTVDADDPSAPERLDVFGRVYAG
WAYCERFFAEEVYREFGYAGPADVVEAWGRDHRSMHAGDLMASLRMWRTS
DDGGSLDVLGRRLGRIRARVILMPAVTDTYFTVTENHLEAGWLVDGEVRP
LASPLGHIAGRPGIRADEQSVVDACLRELVQPRAAAAHLTSIK
108802303YP_642500.1 DNA gyrase/topoisomerase IV subunit A [Mycobacterium sp. MCS]MTAIIEQNPDLVLDQSADDYWNHYQLTFALYSVSDRAIPSAFDGLKPGQR
RLLYQMHDSKLLPGNKPQKSSKVCSAVTGNLHPHGGASMYGAAALMAADF
QRVKVIDGQGAFPRIQGDIPAADRYTEMRLSAPGAALTAELDSHAVPMVA
TFDGEWTEPTVLPAQWPVLLCNGAVGIAEGWATKVPAHNPREVMAACRAL
LKTPNMTDDRLVKLIPGPDWGCGATVVGETGLREYITTGRGQFTVRGTVT
VDGKNCVVTELPPGVASNTVQERIRALVESGEMSGVADMSDLTDRRNGLR
IVVTAKRGHSAEQIREQLLALTPLESTFAASLVALDENRVPRWWSVRELI
AAFLSLRDKVVLHRSEYRLEKVTARRHLVAGLMLIHLDIDAAVAVIRGSD
TVDEARQGLQDRFAIDAVQADYVLALQLRRLTKLDVIELQAEAERLDAEF
AELTELVSNPDARRVVIDKELVETAKLFKGPEFDRRTVLDFEAIPITTGA
ADDGPRERKVNASWRLDDRGVFSDSHGDLLTSGLGWAVWTDGRVKFTTGA
GLPYKIRDIPVAPDITGLLRSGVLPDGAHLALVTRRGKILRIDPAAVNPQ
GAAGNGVAGVKLAAGDPMDTVIAALPLTCGNDEAILSISEKGWKVTEVPD
IPVKGRGGAGVGFHPFVGGEDALLSASVSPTGFMRGKKKVRAENRAKASV
KGSGDGVTPAE
108802301YP_642498.1 MerR family transcriptional regulator [Mycobacterium sp. MCS]MTANTAGVTIGRAAAFAGVTIKTVRHYHRIGLLDEPPRDGAGYRRYGSSD
LLRLIQVRTLAQAGVPLSDIGALLTADPEQFAGHLAAVKRQLTERVDELI
ARRDLLDRLTSDDLTLLPDQACALLDRTIVLGFTPDAVALFRESLVLVRA
LVPDGFSEYLTEAENVLTDPQFVDLVKQFWSAKDLDPDDPRIEELATAMA
ARFLANPALLAVSNGLQARTDVTRYGLLNHHGEDEAPALARLTTLVEAKL
RSAGIDIPHQ
108802299YP_642496.1 short chain dehydrogenase [Mycobacterium sp. MCS]MSTPIVAPEVPTAPILDLAGKTAVITGGSKGIGAATVARFVKGGARVVTS
GRAQPKSLPSGVEYVVADVSTVDGVDQLARRARDVLGDIDIIVNNAGAST
PHLGGVLDIDDAEWVKDLHINFLAAVRLNAALLPALYARGKGSIINVSSA
ATLSPPSTMLHYASAKAALATYTTGLAAEAGPRGVRVNTITPGNVASPGA
DAIRRALTEAGDVDSPAAGGMPIPLGRKGEASDIAEAIAFLASDRAAWIT
ASDLLVDGGQMQTR
108802297YP_642494.1 phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS]MADTDPRPTAVREQSRQHADEARRKMSERRTAHDGGINGWLNERAGRWDL
SGQDEATMQRQKYLWNFLVDHWFRMEFDGWENLPDPPVLLVGIHSGAPFV
WDAWTVGVQWWRRFGQERPLHGTAHDALMAIPLIGRYFRAMGVLPAAPDS
MATALAEGRDVAVWPGGEVDSLRPWVERDVANLAGRAGFVRMAIRAGVPI
VPIATVGGADAMPVLIRGDRLSRALRLDKMLRLKVFPLAVSLPWGIAPAA
LPQLPLPAKIRTRLMPAVSIDHDPDRAEDDDYVEQKYREVQDSIQRGMDA
LARKRALPLFG
108802295YP_642492.1 hypothetical protein Mmcs_5335 [Mycobacterium sp. MCS]MVGKAWVTPEGQVIIAYQGTTGGSHLLFNPLITIAQVLADLQVVFTGTTP
LAFHDALDFAEQVRAEAALQGYSDEDIFVTGHSLGGWEAQYVAQQTGLAG
VGFEAPGINTVVPGNGADSMFVNIGTYGSSAPYMSTDLPGLQPFMPPYVP
GGGAKPHYGPIIMIGDPAAMTPLYNASQLWGTSPIGSAVFLVDYLMNFFQ
YHLPGVQAYHLDVTPDPGIVLWLGTARGPVHTGYGDLTIPQLMKAASDDG
ILFRP
108802293YP_642490.1 ferredoxin-dependent glutamate synthase [Mycobacterium sp. MCS]MKKRTLAVLAPAATLAGVALQDLIQKEHALRRNFPVLARFRYLLESIGPE
LRQYIITSNDAERPFSRDQRRWVYTSAKKENNYFAFGTDNDTENAAYPII
KQATFSDVVPASPIHGRDIDLPGAKVLGGPRGRRHAFRPASVVNVSAMSF
GSLSPQAIEAINKAAKIAGFWHNTGEGGLSDHHRQGGDLVFQIGTGYFGC
RDEHGRFDLDRLVDVVGSGPVRAIEIKLSQGAKPGLGGHLPGAKVNAEIA
RIRGVQEGKDVASPSRHTAFRNVDEMLDVVERIAETTGLPVGIKSAVGGL
QFWHELADQMADGQRGVDFIAIDGGEGGTGAAPLVFADHVSFPFRLGFAE
VYGLFARAGLHDRVTWIGSGKLGLPGNAMVAFAMGVDLLNVAREAMLAIG
CIQAQKCHTDHCPTGVATQNPWLARGLDPEQKAHRLANYVLTLRRDLLKV
SEAAGVRHPAMVGPADIEILDGDRGHRTLAEVYGYQQGWGVPGPEITRDI
DEYMSRYDDRPGTDEVLEHAPLEVATEPNQATEP
108802291YP_642488.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MRRLPWLHRMDHLNRWETGMARAAQFAEYGDPDVLKLVDAPPPTPGPGQV
RISVRAAGVNPIDWKIVAGFMREQIPLQLPAGTGSDVAGVVDEIGSGVTE
WTIGDEVLGVSATPSFAEYAVAGAGDLVRKPDGMSWEVAGSLAGAGGTAY
TVLQKLGVRAGDTLLVHAAAGGVGTFAVQLATARGARVVGTASERNHEYL
RSIGATPVDYGDGLIDRVRAAAPQGVDAVLDASGRGEIPMSIELTGDPAR
VLSLVAFDAADTGIQLHVGGAGSVLGEALRELVTLIDRGRLTVAVSRTYP
LEEVVAALDESRAGHLNGKIVIVP
108802289YP_642486.1 gluconate transporter [Mycobacterium sp. MCS]MEAIDPAYGTATLLLIAAGAVAVLLFLIIKVKLHAFVALVLVSLLTALAA
GIPVADVPSALAFGFSNTLGSVALLVGFGVMIGRLLEITGGAQVLADTLI
GRFGEKRAPFALGVAALLFGFPIFFDAGLVVFLPIIMTVARRFGGSLLLY
AFPAAGAFAAMHALVPPHPGPVAAAELLGANIGLTLIIGVPVAVASWYVG
AFLVSQFIGRRVHVDIPTSLFGEINGGRDADESAPSAGGAVGTARTATRT
PPAFMTVLGVLLLPFVLISFNTVLDTLMTAGVIEEGATWAEYLKLLGTTS
IALLITVIVATLALGLRGRSMADVSNILDNALGPICAIILITGAGGMFGG
VLRLSGIGDALSSSLSNLGISLILQAFLISTLLRVAQGSATVALTTTAGL
LSAAVATADLSNVQLTALVMAIAAGATVLSHVNDSGFWLVSRFFGMDVKT
TLKTWTVMETTLGLSAFVLSLGLWAVA
108802287YP_642484.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MLDRPNAGALHGSLVTALGTAIVSGRYPPGAVLTLEGVSAEHGVSRSVAR
EAIRVLESMGMVESRRRVGITVRPAEKWNAFDPVLIRWRLDVGDRTALLV
SLSELRLGFEPAAAALAARRATPHQCRIMASAVSDMVVHGRAGDLDAYLV
ADKLFHQTLLEASGNEMFRALTGVVAEVLTGRTQHGMMPAKPNLAAIALH
DEVARAIRMGEAKMAEDAMRAIIDEAASAVVEDSREP
108802285YP_642482.1 hypothetical protein Mmcs_5325 [Mycobacterium sp. MCS]MRTLAFGALAAARETDDRSAASAARAAQMAVAVAYTHLDLNGVAAARQTK
HLLAPAVHAAQAREFSTSEPDAADTELIWAAEHSNADVRRAVRAMPVPDT
GRSRLGQLYRTLDAALRRRSGRRVSVDTLGAWVIKCNPARTAIEPMVAAG
ETKPHWCVADNYRSRLIAPGQRVLFWVSAHPLRGFWGAGRITGELLVDDG
TLQVPVHIPLFAEPVTAAGVSSVPQLRSLEVLRSPQQSNPSWVSVAELAL
IEPMLPLRW
108802283YP_642480.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MDDQQVAAQLADAFGRAAKSVVRAFDERLGDHGVSTPRSKLLAEIERLQP
VRSADAARAVGITQATASTLVDALVREGLVVRAPDENDRRAVRLTTTAEG
REQARAWRELYTEAAHEMFAGFSDDEKKLLTELLNKLGDALA
108802281YP_642478.1 YVTN beta-propeller repeat-containing protein [Mycobacterium sp. MCS]MKLRTEALLSALLLAVALAGCAGGDPETAGQSPPRPTPPPRSAGVTGSLW
VADEGGNSLTVLDTTADSVATTLTGIQAPHNVQVGRDAAVVYATSAGTDT
VVAIDADTYTVAATAETGSHPAHVIEAPNGKVYVADSEAGTVSVFQGQDL
RSLGRIEVGGMPHGLRAAPDGSVIVVANHMTGALDVIDARTDQKTFSVPV
GEGPAQVAVSADGWHAYTGVTDPASVVKVDLDSRTVVGRVAVSAAPVQVY
LSPDDAMVVSADQGSPDAPGHAASLIDTRTMSVRATVETGAGPHGVVIDS
SGRRAWVTNSYDDSVSVIDLAGERVSTTIPVGKGPNGISYSPRPPAAGAS
DIALNLTAPAHG
108802279YP_642476.1 P type cation/copper-transporter ATPase [Mycobacterium sp. MCS]MTDPHRHRDAPVAAGVRPVDHAGSDTHSHDTHGHDGHGGDHVAQFRRLFW
VNLVIAIPVVAFSTMFAMLIGYRLPDFPGARWIAPLLGTVMYAVGGRPFL
TGARSEIRSRKPGMMLLIGLAITVAFVASWGATLGLLHHELEFWWELALL
IVIMLLGHWVEMRSLAQTTSALDSLAALLPDEAEKIDGDRTVIVPPADLR
VGDVVVVRPGGSVPADGRIVDGRADMDESMVTGESRPIARGVGDAVTAGT
VATDSGLRVEITATGDDTTLAGIQRLVTEAQNSSSRAQRLADRAAGWLFW
FALATAAVTAVVWTMAGSPDASVVRAITVLVIACPHALGLAIPLVVSIAT
ERAARGGVLVKDRLSLESMRTVNAVLFDKTGTLTKGEPTLVAIEPVGTLG
ADGVLALAAAAESDSEHPLARAIVRAAEERGLTVPRATGFSSAPAVGVTA
TVDGREIRIGGPRLLDEVGAEEVGTAAAWREEGAIILHVVRDGDVVGGLR
LADEVRHESREAVEALHKLGIEVVMITGDAEAVAHAVGDELGIDRVFAGV
RPEDKAAKVSGLQREGRKVAMVGDGVNDAPALAQADVGIAIGAGTDVAIA
SAGVILASSDPRSVLSVIELSRASYRKMKQNLWWGAGYNLIAVPLAAGVL
APIGFVLPMSVGAILMSLSTVVVALNAQLLRRIDLRPEASTRAILDR
108802277YP_642474.1 hypothetical protein Mmcs_5317 [Mycobacterium sp. MCS]MSAGEQEPDYRFTLANERTFLAWIRTSLALIAGGIAVVQFVPSFGIPGVR
HGLSVALTAGGGVLAALAVRRWQRVQAAMRRDEDLPATRVPVLLGGTIFL
ITMVVLVVLVIWPPTGP
108802275YP_642472.1 hypothetical protein Mmcs_5315 [Mycobacterium sp. MCS]MVGDEDAIAAVLNRLRRAQGQLTGVISMIEQGRDCKDVVTQLAAVSRALD
KAGFKIVATGMRECMTGEAADGKEPLSETELEKLFLALA
108802273YP_642470.1 rhodanese-like protein [Mycobacterium sp. MCS]MSLSIPPAVSVSPGRSDERTFRMTAPVTIDSHDLSQMLGSATPPRVIDVR
TPGEFETAHIAGAYNVPLDLLREHRDEIIEHLDEDVVLVCRSGQRATQAE
ETLRQAGLTNVHILDGGITAWEAKGFAVNRGAQRWDLERQVRLVAGSIVL
TSILGSIAAPKLKWVAGAIGGGLTFAAVSNTCAMGMMLSKLPYNRGASCD
AQSIVAQLVDSAPAKKSVGRS
108802271YP_642468.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTTDKHRIVIIGGGTAGISVAARLLRKGHSDVAVIEPSDTHYYQPLWTLV
GGGQAKASTTARPEASVMPKGATWIRNAAATVDPDNNRVTCVDGADYEYD
VLVVSPGIQLDWNRTEGLQDALGKDGVSSNYRFDLAPRTWEFIRDLRSGT
AVFGMPSGPIKCAGAPQKIAYLASDYWRRQGVLSDIDVHLVVPTPRLFGI
PAIADNLDVIAADYGITVHTGAEITSVDAAAHKVGITHTADGGSDTVLPY
DVLHAVPRQSAPDWIKSSPLSTGDAAGYVEIDKHTMQHVRYPNVFSLGDA
GSSPNSKTGAAIRKQAPVVVENIESFLTGRPLNASYNGYGSCPIVTSSHA
MLLAEFDYDLNLTPSFPLLDPTKPHRGYWYLKKYGLPFMYWNLMLKGLA
108802269YP_642466.1 amidohydrolase 3 [Mycobacterium sp. MCS]MFDLKIVGGTVVDGTGADRFRADVGVKDGKIVEVRRVPPGGDGLAGDAAV
TLDATERIVAPGFVDIHTHYDGQVSWDSLLEPSSCHGVTTVVTGNCGVGF
APVRPGSEEWLIKLMEGVEDIPGSALTEGISWGWESYPEYLDVIGSQHFA
VDVGSQIAHGSVRAYAMGERGARNEPATPEDIAAMAHLVRESIEAGALGF
STSRTIAHRAMDGEPVPGTFAAEDELFGLGRAMAAGGRAVFELAPQGAAG
EDIVAPKRELEWMRRLGAEIERPLSFALIQVDADPNLWREQLEISADAHA
DGAMLYPQIAARPFGMLLGFPGHHAFTHRPTYRALKSELPREELAERLAD
PAVKAAILGESDLPVDTTRQFDGMFALVQHSLHRIYALGDPPDYEPTPDR
TVASIAADRGEDPLATLYDLMLEDGAGSMLMLPFFNYADGNHDAIHEMLT
HPAGVLGLSDGGAHCNLICDASYPTYLVTHWARDRHRGRKLSLEYVLRKQ
CRDTATLFGLTDRGTIEVGKRADLNVIDFDALTLHPARMAYDLPAGGNRL
VQGASGYDATVVNGTVTRRFGRDTGARPGRLVRGAR
108802267YP_642464.1 hypothetical protein Mmcs_5307 [Mycobacterium sp. MCS]MAGRTVESTSVSTLLLPVAVSLATAATLLVNYLANGLPINGQTTGDVTRR
FEVYFVPAGYVFSIWSVIYLGLIAYSVYLSLSLARRRSDSGAARAIAPWY
LVTAAANCSWLFAWHHNRFPLSMLLMLVLLGTLIVIYRLQAARPPVSTVE
RWTVHIPFRVYLGWISVATIANATITLDDAGWSGFGLSEPTWGVIMVLVA
AALGLTMTFLHRDIAYALVLVWALIGIAVRLHETTAILVVALAGAAALAL
SVLVIALRDRTDQRRNLASSAPSSSNKA
108802265YP_642462.1 alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]MLSVDLPSGPIAYDDTGGDGPVLVFGHGLLMDGRQWRKVIPLLPGYRCIT
PTLPMGAHTVPMNDGADLTQTGMANIVADFLDALDLDDVTLVLNDWGGGQ
FVVTEGRDKRIGRLVLASCEAFDNFPPKPARPAALLCRLPGGGWVLSRML
GTRFFRHSRQAYGGLAKSGLPDALFDEWFRPAVENAAIRRDLVRFATGAP
PRRRLLELSGKLGTFDRPVLVVWAREDRMMPPAHADRLVELFPDARKVIV
DDSWTLIPEDQPEAMARALREFVG
108802263YP_642460.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MELDKQIALVTGGTSGIGLASARLLAAEGAEVVVSGRDAERGAQAVAEIG
GAVRFVQADMSDPQSVKDLAEQAGDVDILVNNAGVFPAAPTLDQDLASFE
TMFDTNVRGAYFLVAEVARGMVARGRGAIVNITSPAGDKGFPGTSAYGAT
KAALASLTRTWAAEFGANGVRVNSVSPGPTRTPGTADMGDFIDDVAGALP
LGRTARPRGGRSGGAVPDVAAVEFRDGVDAVRRRRRLGGVTRRR
108802261YP_642458.1 cellulase [Mycobacterium sp. MCS]MSSAVGAVARWVAPFLTVAAVAGTAAVAEPVNVDPAPAVRLVSDANPLVG
RPFYVNPASKAMRAVQGNSDPLLASVANTPTAYWMDHLSTPSVDSKYIAD
AQAAGTTPILALYGIPNRDCGSFAAGGFGSAGAYRAWIDGVAGAIGGGPA
AVVLEPDALAMIDCLSPGQQQERLELIGYAVDTLTRNPATAVYVDAGHPR
WVAADVMAGRLNQVGVAKARGFSLNTANFFTTEESIGYGQAVSGMTNGSH
FVIDTSRNGVGPVDSDSWCNPPGRALGTPPTTATGHPQVDAFLWVKRPGE
SDGSCGGGAPSAGTFVAQYAIDLARTAGW
108802259YP_642456.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTATLVAKNVAGGFAHRTLFEGLDLTVAPGDVVGVLGANGAGKSTLLRIL
AGDLEPLDGIVSLAPADAFVGWLPQEHERVPGETVAAYIARRAGCTAATQ
AMEAAAAALAEPESASIPDPAAAYSAALDHWLATGAADLDERLPAVLADL
GLDTDAVRPHSTPMTALSGGQAARVGLAALLVSRFDVVLLDEPTNDLDLD
GLARLEQFVRDLRGGVVVVSHDREFLSRSVTHVLELDLAQNTTTVFGGGY
ESYLEEREIGRRHRREQYEEFAEKKADLVARARVQREWSSQGVRNAIRKA
PDNDKIRRRAATESSEKQAQKVRQMESRIARLEEVAEPRKEWTLQFTIGA
APRSSSVVASLDNAVVRQGDHVLGPVSLQVDAGERIGITGPNGAGKSTLL
RLLLGHRTPDEGRASLGANVAVGEIDQARADFTGPERLIDRFEEKVPTWS
TADVRTLLAKFGLRADHVERPVDDLSPGERTRAGLALLQARGTNVLVLDE
PTNHLDLPAIEQLEQALETYDGALLLVTHDRRMLQNVRLDRTWRVDNGRV
VEL
108802257YP_642454.1 FAD-binding monooxygenase protein [Mycobacterium sp. MCS]MSPAYRVDDLPVTDTDVLIVGAGPTGLMAALALHRRGVPAVLVDRKAGPT
RESRALAVQARTMEVYDQLGLADTVLANSNSALRIQVGGSSRGIGPNLAK
LQDGHTRFPGVHIFEQSRNEDMLAGALTAGGGDIRWRHRLVDLQDRTAAP
DGRVEALLEGPDGTLLRVRARWCIGADGAASAVRRALNLPFEGRTDEATF
WVADVRAVRGVPDDAVNIRPGKRTFAAVFPLGPGGHVRLLGLAAKDTITQ
DEALATVAAEFGLTHGPVEWFSTYRVHHRVSARFRVGSIFLAGDAAHVHS
PVGGQGMNTGLQDAHNLAMLLADVAQNRVDGRALDRYERERRPVALTLVN
VTDRAFTVIGRRGSSAGLVRATIGALAFGVFPLVTRTSLGTRLGGYIGQY
RIRYRYTANQTERERDPAVGLRLPPVADNQRALDTMTWQLHAYGAGTIVR
PDVPEWIDGPREFGADPRGRLRSDRLYLVRPDQFVAASIPLRDNVVDEAH
LRAALATHQILHAGP
108802255YP_642452.1 DGPFAETKE domain-containing protein [Mycobacterium sp. MCS]MAKYLFLKHYRGAPAAVNDVPMDRWTPAEIEAHLKYMEDFADRLRASGEF
VDSQALAADGAWVRYDGEGKPPVTDGPFAETKDLIAGFMIIDVDSYARAL
ELAAELSAAPGAGGEPIHEWLEVRPFMGAPTTVTE
108802253YP_642450.1 amidase [Mycobacterium sp. MCS]MNFEEYRTHDAVGLAKLVADKQVTAAELLDLAKQRAAAVNPRINAIVRDV
PGSPSPDSGGPFAGVPFLIKDLAQDYAGLPTSAGSRALMSTPVAEHATVV
QRWLEAGLAIFGKTNTPEFGAKGITEPDAWGPARNPWDLSRTPGGSSGGS
AAAVAAGIVPCAGANDGGGSIRIPAACCGLVGLKPGRGLTPSGPAVGESM
HGAAVQGVVSRTVRDTAAMLDVLKGGEACGPYVPAVPTDSFMSCVGQEPG
TLRIGLRVPSAINPTPHPEARAAVERTVLALTDLGHHVEELPVAPFDDAA
LARDFLLTWFVYTAWELDDAKRVSGAGDDAFERDTLILAAIGRATSSVDY
IDAVQRRHEHTRRLTTFFESYDLLLTPTLATPPPRIGEFDLPAALQRASD
VLIKTRTARLLRHTNIVDDMVDKNLSWVPYTQLANLTGRPAISLPLHWTA
DGLPLGVQFVAPLAGEALLIRLAAQLEQALPWADRVAPV
108802251YP_642448.1 hypothetical protein Mmcs_5291 [Mycobacterium sp. MCS]MSTDHAIAAPVLTSPAFDPPRRDLTTRADVESLLRRFYSEAFEDELLALP
FAELSSHGLEEHLPVMCDFWETVLFRAGLYRRNALHVHRRIHHQTPLDAT
HFVRWLSLWSATIDDMYRGPVAEHAKIQATRIATAMHRRLAGAHGGTTIA
GANPLKENPCVS
108802249YP_642446.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MTYVIGKACVDVMDRSCVEECPVDCIYEGGRSLYIHPDECVDCGACEPVC
PVEAIYYEDDLPADQREHLADNAAFFFDTLAGRDEPLGSPGGAAKVGPVQ
ADAPLVVGLPRQEQS
108802247YP_642444.1 CdaR family transcriptional regulator [Mycobacterium sp. MCS]MRALVDASRLGLAVPDGAPQDLDRPISWAHITEMRDPSRYLRGGELVCTV
GLSLQTPQDCRTFADALAAAAVAGVCFGVGDGHDEVPVALLDQCRRHGLP
VLIASPSVPFSMVSRFVAEYEMGAEIAVARATYALVPELLSALRRHASAD
ELLDTAGQILGCRFLLDPDGGPPSWIGGGTPPEPALLDLIARFVRATQGE
RDVEAALARERVGQLLSLVERRMLLPDALGQLLDWPGLTAGQLTCSAWPA
GAGALLSIAFPDALVGDAPDLCLMVMTHPLDLTDDLSLPSGHSALVPLTE
IGSAIGQARSALELAQRSGRRVGPDQLSTLDSLLEQLPPAQLAPFRQQLI
EPLAEMDRRRGTQHVRTLRAFLAANGSLSDTARDLYLHTNTVRHRLARIV
ELTGRDPLNHNDQAAFSIGLHAADRESTR
108802245YP_642442.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MSDAVALVTGGASGIGAAVVDALAKRGYTVGCLDRNPAPNVEHAVAVDIS
DGRAVEAAVAQLRERLGPVSAVVNSAGHYEMVPVADISPEAWRTMLRVHL
GGLVNVARSCLPDLLETRGTLVAITSELAVGGGDGDAHYAAAKGAVIGLV
RSLAAEVAARGVRVNAVAPGPTDTPLLAADNPCRTPQYLASLPLRRLTTP
QEVARCVEYLVCDATFSVGDVVNVNAGAVI
108802243YP_642440.1 agmatinase [Mycobacterium sp. MCS]MTTEGGHVQYVQSETGVLGQVDAQAVPRYAGIATFARLPQRHEVGDYDIA
VVGVPFDSGVTYRPGARFGPSAIRQASRLLKPYHPALDVSPFAAAQVVDA
GDIAANPFDIATAVDEIRAGVLGLLTRPEQRVVLLGGDHTIALPALQAVN
EVHGPVALVHFDAHLDTWDTYFGAPCTHGTPFRRASEQGLLVKDRSAHVG
IRGSLYDRADLLEDAELGFTVVHCRDIDRIGVDGVIERVLDRVGDHPVYV
SIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLRAMRGCNIVAADIVEVAP
AYDQAEVTAVAGANLAYELITLMADR
108802241YP_642438.1 BioY protein [Mycobacterium sp. MCS]MDGKVDAPRRRAVTAGDLTQAAVFAALIAALGLPGTITVGPSGVPITVQT
LGVMLAGSILGPRKGALAVALFAILAIAGLPILAGARTGLVSLSSPTAGF
FVGWLPAAVVIGALTAMMMPRYRISWGIAINVVGGMAVIYAFGTVGLMIR
TDLSWWAALSTNGIYVPGDVAKAVVTAFVAAQVHRARPGLITPWRRRRTS
DG
108802239YP_642436.1 cobalt transport protein [Mycobacterium sp. MCS]MTVLGVYRPGKSLLHRLPAGVKLVGLGALIALMSVVVDTPAHLGVAALGV
LAVLASARMGPRIVVTQLRPVLWVVAVIFAFQLLFTDWQRALVVCGILAL
SVALAAAVTTSTRTTDMLAAMTRAMRPLGRVGFPVEQVALGLALTIRAIP
LMVETVRQVEEARRARGLRFSPRIVVAPVVVAALRTADGFADALAARGLD
108802237YP_642434.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMSDAYDPPLAGIRILDLSSGPMTAIGRLLADLGAHVTAVGLAGATAHAAG
GPVSLATAINRRGVAAVDIDTSTPAGRQQWTDLLGAADVLIEDTRPGSSA
ERLLAVHELRTAHPGLIVLSLSDFGRDSDFSGWQATTPVLHALTSELSRS
GIPGRAPLVPPGEQLPYHVAAAQAGVAVLAVLLDRLRTGIGDRIDFAILE
GAMQALDPPFGTMGTASAGVPTAQQQRNWDAERLRYPIVPCQDGYIRICL
LAKRQWHGMFEWMGRPEEFADPKFEGLLDRLTSIPLWAAIEAFCADKTRN
ELEHEGQRHGVPTAAVLSLTEALATEQVVARGFFGDTELAPGLVAPVPRG
VVEIDGCRASAGTAPDPGAPTLQGAPVLEQRPRTDQGLPLEGLRVLDLGV
IVVGADTGRLFGDLGADVIKIENAAFPDGMRPGRRPMNASFAGGHRNKRA
IGIDLRSAEGRELAHRLVREADVVLTNFKPGVAAALAMDYDTLKSVNPGI
VVVDSSAFGPTGPWAQRLGYGPLVRAAAGFTKQWVYPSDPDEFCDTVTVY
PDHVSARIGVLAALSLLLRRERTGLGGSASIAQSEVMLSHLAAEIAGEAL
IRAGHQRSDAPDHDAPWGLFRADGDDAWVAVTVRDDADWQALCRVLGRQD
LAGDPELGDRTGRDRNRTRIDGAVTDWTVRHSPGDAMDLLQAAGVPAGAV
MHAAELPGWEFYAQRRAFREELHPHGREPYVLENAQLHSERIADPPLGQA
PLLGEHTVEIATTLLGLDEAAVADLVERGVLQTHRL
108802235YP_642432.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MIYTPRPGAEAGSDDREGGSPMTIDVAEREALQEAVRDLLRSRCTEQDVR
QVLTGDDGFDRDLWRRLAEQGVTGIVIGSEYGGVGLGAVELEAVAEETGA
ALLPSPFISSAVLTAALVQAAGSEDDKQRLLPGLADGTAIGTVAVTGRAG
TWTAEGVDVRAGTDGTLTGSAHYVTDGQVADVLLVVANGTDGVGVYEVDP
GASGFERVAATVFDPSVRLSTFTFTGTPARRLGAAGWDAVQQALDLATIA
LAGEQCGGTRRIFEITVEYLKTRIQFGRPIGSFQALKHMAADLLLKVESS
TSAAQNAAAQRDADPDTAGGAIALAGFACAEAYRDTAAAAIQMHGGIGFT
WEHPAHLYLRRARTGLQLFGGPRLHRERYLQSKGA
108802233YP_642430.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTTGGVAVAAQSWHWRHAGRSSWAVRDLDLTVEPGERVLLLGASGSGKST
LLQGLAGVLGGSEDGDEAGRLLVDGVAPAQRRGRIGMVLQNPDSQVILSR
VGDDVAFGMENLNVAPEVIWPRARRALAAVGLNLPLRHDTSRLSGGQQQR
LALAGVLAMDPGLILLDEPTANLDPAGVVEVRDAVAAVAERTGATLIVVE
HRTAVWLPVVDRVVVLGTRGEVVADGPPAETVLRQSAHLARAGVWVPGAD
LPAVERRGVPGEPLADAVELSVGYRGGPRTDELTFEIPRAAISVVTGPNG
VGKTALALTLGGLLPPRAGRVEARNGFAPTADRREPIRWRSRELLTRIGS
VFQNPEHQFLTGAVRDELALGPRALGSDAAAVARQCDALMERLHLTDLAD
ANPYTLSGGEQRRLSVATVLATRPALVVLDEPTFGQDRNTWEELVRLLAE
IADDGTAVVAVTHDLDFAAVLGDRRIDIGTPTVTGRVR
108802231YP_642428.1 hypothetical protein Mmcs_5271 [Mycobacterium sp. MCS]MEVADLARRLCDGDARTVLIDGRSGSGKSTLAAALTRNWESSVVVALDDV
YAGWDGLAWAVDHLRESLLEPRADGRPGRWRGWDWARGTPAGWHTVDPGQ
RLIVEGVGALTAANRALADLGIWVEAGEADRKRRALTRDGDTYEPHWDRW
AAQEEAFIARYDPRSVADWIATYSAEGLRWAANLT
108802229YP_642426.1 hypothetical protein Mmcs_5269 [Mycobacterium sp. MCS]MSGAACDTETEVEAGDRTLTSTPDVPEANPRRPFARRAALKLPALLTASA
AASALPRASAASRRWSAARAHAWYQQQGWLVGANFITSNAVNQLEMFQAA
TFDRRRIDTELMLARRIGLNTVRVFLHDQLWAQDRNGFQRRLAQFVAIAA
RHDIRPLFVLFDSCWDPLPRLGRQRPPRPGVHNSGWVQSPGAQYLGDPRY
RRVLRDYVTGVLTQFRDDERVLGWDLWNEPDNPANQYRQVERKDKIERVA
ELLPQVFGWAREVDPVQPLTSAVWDGEWGDPARRSTICRIQLDNSDVITF
HNYGDADEFDARITELRPLGRPIVCTEYLAREFGNTVEGILPLAKRRNVG
AYNWGLVMGKTQTHLPWDSWDKPYTSPPSVWFHELLRPDGQPYRDSEVRT
IRWLTGRVGPT
108802227YP_642424.1 hypothetical protein Mmcs_5267 [Mycobacterium sp. MCS]MRIVRRSVTALVLTAGSLGAAIPATAQPATPTITQIPERAQPDGFTSFVA
TPGIVDPRPHAIESWGRLPDDRQISVRFTAGTPECYGVHAEVQETADIVA
VKLRSGVLPEAVNRACIAIGVFASLPVALQSPVGNRAVVSIT
108802225YP_642422.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MKIHLTSVLVDDQDKALRFYTDILGFTPKHDIPMGPARWLTVVSPENPDG
TELVLEPDGHPAVKPFKEALVADGIPFTSFAVDDVQAEFERLTSLGVRFT
QEPVDMGPVTTAVLDDTCGNLIQIAQQK
108802223YP_642420.1 L-threonine aldolase [Mycobacterium sp. MCS]MTLSTLHDPDWRGFASDNYAGVHPEVLAALAAANGGHQPAYGEDRYTARL
RHVVREHFGDRAEVFPVFNGTGANVVSLTSVLPRWGAVIAASTAHIHTDE
AGAPERMTGLKLLTVAAPDGKLTGELIEREAWGWGNEHRAQPLAVSVTQT
TELGTLYSPAEVRALADLAHSRGMAVHMDGARLWNAAAALGVPFGDFTTD
AGVDVLSLGGTKNGLLGVEAVVVLDPDRATGLSYLRKLTMQLSSKMRFAS
AQLLTLFDDDLGVRSAAHANAMAARLRSALEAGIADGTLPGLAFTQDTAA
NAVFATLPVGAVDRIRERVRFYDWDRTRGEVRWMTAWDTTAADVDRFVDV
IREELVRR
108802221YP_642418.1 DEAD/DEAH box helicase [Mycobacterium sp. MCS]MTTPLLDDPSDLSTLRAKGEDPDELFASFAAWAEAGGTALYPAQEEALIE
LVSGANVILATPTGSGKSLVATGAQYAALAGNLRSYYTAPIKALVSEKFF
ALCGVFGAENVGMLTGDAAVNAAAPIIACTAEVLANIALREGADADIGLV
VMDEFHFYGDPDRGWAWQVPLLELPHAQFLLMSATLGDVTFLREDLTRRT
GRPTALVAHAERPVPLFYSYATTPMHETIGDLLETRQAPIYVVHFTQASA
LERAQALMSINVCTKAEKAAIADLIGAFRFSTAFGSTLSRLVRHGIGVHH
AGMLPKYRRLVEQLAQAGLLKVICGTDTLGVGINVPIRTVVFSALSKYDG
TRTRLLNAREFHQIAGRAGRAGYDTAGTVVVQAPDHEVENLKQFAKVADD
PKKRRKLVRRKVPEGMVPWSESTMTRLVEAVPEPLHSNMRVSTAMILDVV
ARASEATGDGSRTGDPFVAMRRLLTDNHEPRKRQLQLIREAVGIARSLLQ
AGIIERVDTPDGRRYRLTVDLPRDFALNQPLSTFALAAIEVLDASAETYA
LDVVSVIEATLEDPRQILAAQLKKARGEAVAAMKAEGIEYDERIELLDDV
TYPKPLEELLEHTFEVYLQTNPWAADGRLSPKSVVREMWERAFTFREYVS
VYGLTRSEGAVLRYLSDAYKALRSGVPAAARTDEVTDIVEWLGELVRQVD
SSLLDEWEQLTSPDRPLDAPVAVPARPRPLTGNERAFTAMVRNALFRRVE
LFARRRWAELGELDAASGWTAQDWAQVGDEYFAEHDDVGTGADARGPALL
IFDREPGVWRVRQILDDPAGDHDWGFDVEVDLEASDEEGTAVVRLVDAGR
LD
108802219YP_642416.1 hypothetical protein Mmcs_5259 [Mycobacterium sp. MCS]MTAPEPIETLARIVERGQVWPRMAAKYGVENPVPPWKTSLDGLCDALDHG
ACRDTNVPTFKERRDEEDSLSATVYADLPYPENQLVSLAHSLLARGVIDE
AELRQRLSSIRARLEA
108802217YP_642414.1 hypothetical protein Mmcs_5257 [Mycobacterium sp. MCS]MSTAADRAAQLNLVARLKSAYPELPDAPTPDLLDHGRITAYLKPVHDVGG
EPDAPMKYENKQYEQWEEATYVICEVLAWRGIWLSEERRRIGNVDVGRAQ
YLGLPYYGRWLLAVARVLVEKHHIGLTELTERMAEVKARYADGLDGGKPE
AQPKFEGDGSQVKRNEHHRHAVGKGDPQVYAGLAGQPKFAVGDAVRVREL
PVLFYTRTPEYTRGATGVIAKVAYESPAAEDETWDRPDATPEWFYVVRFN
QSELWHGYTGTATDTLQTELPERWLEAAS
108802215YP_642412.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MLPPVTTAPAGRRGRGARERIIRAASALFYRRGIHATGVDLLTQEAQVSK
RTFYQHFPSKVELVETYLREIAENGGSPAERRLDLPGLGPRERLLAIFDA
SAVKRFRGCPFHNAAVESAGALECVDEIVREHKRWFADRLAQVSTEAGAR
DPYLLGEQLLVLFEGATALSTSMGDTAPMVHARSAAAQLIDDACRV
108802213YP_642410.1 phenylacetic acid degradation-like protein [Mycobacterium sp. MCS]MTQDATLTARSGHWGAENTRTVSWHDPGPTTNEGLRMAGIDYLRAMLDGR
LPPPPIANLLQMGLTAVEPGRVTFTCTPDQSTYNPIGAVHGGLVCTLLDS
AAGCAMHSVLAAGRGYTSVEIKVNYLRGVRLDTGRLTATGTVIKAGARVG
FTEATVTDDTGTLIASASSTLLIFDL
108802211YP_642408.1 sucraseferredoxin-like protein [Mycobacterium sp. MCS]MTLRKRAPCSDQSLLRRDPMYGTASAGSSWVLLELPGGWGPSAFLQSPAV
IDPELGRAIVRRVEGAKMRIAAIRRHGRRTDTPRWRWFIARAVVGGEALY
AGEVDNPRDYLDLALDGSDGTLSTDPVVAVCAHGRHDQCCAVRGRGAIAA
IADAYPEMAWECSHLGGDRFAATMLILPEGLCYGRVDSTDAAELVRLYLD
GRLDNRYLRGRTSLPHAVQAAQYFAREKYGDDRIAGLPTLSAEHTDHRHR
VVLGGESGPVEVTVEEGWSEPLLSQCHAKVPGRVKIFSLVSITPA
108802209YP_642406.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MHLRRVNHVVLSVSDLDRSLTFYRDLLGLLPVAELPGSEHWPAMVFLRSP
APSSNHHDLALIANAEAPAPTSAPRPAGMFHVALEVGTLDELAAVQQTLD
SAGVLRGAVDQGMHLSVYTADPDGIEVEIIWRAPDDAWSYDDALTRRPLD
VASARERWGGHLATGSAAGAPA
108802207YP_642404.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MLIGVTGGTGYVGAHCVRALLADGHRVRLLVGPDAEGAPVLEHLAELGDV
DVFSGDIRDAMTIDLLLDGCDAVLHGAGVVGTDNRRAALMWEVNAYATEA
LLTQAVRAGLDPVISVSSYSSLFPPPDGIIGPDTPPANGRSAYAKTKGYA
DRVARRLQAEGAPVVVTYPSSVVGPAFHTAPGVTERGWAPIVRFGVAPRL
RGGMQMIDVRDVAAVHAAAMKPGRGPRRYVCGGELITFDGMIDALERGSG
RRFRRIPVSQAVFRGMSRIGDTLAGIVPLGDGLSYEAALLLTAATPTDDS
ATLADFGLTWRSPTDAIIASFA
108802205YP_642402.1 Bcr/CflA subfamily drug resistance transporter [Mycobacterium sp. MCS]MSQKIAAVASPPSAVLIAVLALLNAVTPFSIDMYLSAFPEMASEFGVSPS
TIQLSLTTFLIGLAVGQLIIGTLSDRYGRRRPLIIGTVACVAVSVACAVA
PSIALLIGLRFAQGFCGAAGVVISRAVIADRSRGSRAARLFAVMMLIGVL
APITAPILGGVIVTGFGWRAVFLALAVLNLATLLGVVLTVRESLSEEHRR
PGGLKALGVSARTVLGNRHYLGYTLVMAFAAAAMFGYISASPFVVQNILG
FSPAAYSVTFGSCALAVGAGSLISARLVRTVAPRRVLMGGVTALLVVATL
MLLNVTAGHVIGWATIALMACFMGSIGFVYANATALALGEVPRAAGTGSA
VLGFLQYGMGAITPPLVGLAGQSSAVPMGLVMFGAATLAALSMFVLTRGH
VPFGDEDDDAGDAPVTVSAGGTTSR
108802203YP_642400.1 5-oxoprolinase [Mycobacterium sp. MCS]MAYFVGIDIGGTFTDAVLLDDSGTARLLKTPTTLHDPSEGVNNALALAEK
ELDLPAGSILRQVDYFGLGTTVATNALIERKGVKTGIITTRGFRDAILMQ
RATGHWAGRELHEIRHDSQRTQVEPVVPRPLIREVTERIDYKGAVIVALD
EDEVRTEVQALIDAGVQAIAVCLLWSFREPSHEQRVAAIIREMAPQIYLT
ISSELAPVLGEYERTATTALNAYLGPAVQGYMTKLNGSLRDRGLKGSLRI
LDSGGGVITPERAGDTAVSILTSGPAGGVLASAQLARRIGTPNVLTTDMG
GTSFDVGMITDYEPVISPQQQVNGYQVLKPAVKVTAIGAGGGSIARVVDG
RLVVGPTSAGSVPGPVCYRRGGTEPTVTDADVVLGIIDPTYFLGGSMGLD
KEGAERAMYDRIAKPLGLSVQEAAYGIKAIADHRMADLLDTLTVGQGHDP
RDFVVFAYGGAGGAHCHQFGAELGAQSILVPATATVHSAFGAAMSDLHVS
AEISDPMHSATWDGAEDAFDPERLTRHFEDLEAEVTKELLGSGAVTERIV
VQRFADVRFRMQSKGLSVPVEPGNLDTGAIVRMMDAFRTQFVELYGREAL
FLGAGVEIVSLRVQAKGELDKPRVTHVVSAAGQSAGTRHHGRCTSVPSTG
RRSPTSPAAPNCARATGCRGRPSSNTRARPSSSDPARPPSSTKWRTPSST
PARRIPEREHSHRHSRRRGCHHLRGGPQPPHRHRRPAVGGAQERLRLTAG
DRGQRLQHRRLPGRR
108802201YP_642398.1 hypothetical protein Mmcs_5241 [Mycobacterium sp. MCS]MLLGIDAAAISLVFDGANTGTLGASGTLARSCDELQFTLGEGPCLDTVTH
RAPVFVVDLADPDETRWPVYGPAMLDMRIRGVFAMPVLIAGEYVGALDLF
RTEPGGLRAGQLAGAIAAAELAGIPLLDLLDTDLRAAVDEPGSDAWAELN
ALSRTEVSQATGMLVAQLGVDPPEALLRLRAHAYSTGRSASDVARDILER
RLRLEAD
108802199YP_642396.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMYAFPAADDQRFAGQRSTVAALRRPGREDGRALASRAVIDQAIGIIRSRS
GVSGEEAFARLTRISQSENVKLHIVAERLVEEAVRRAQARRQ
108802197YP_642394.1 GreA/GreB family elongation factor [Mycobacterium sp. MCS]MTTAQRVWMTPVAYRRLQDELTELRTLIANEAPDDGQENTVAVQRARQTR
IQQIHDLLLNAVVGEDPPDDGVAEPGMVLTVRFDQTGDEETFLLGVRGAE
YGDLEVYSVSSPLGEALIGARPGDRRTYEVPSGASVPVTLLKAVPFGMHH
PRG
108802195YP_642392.1 putative DNA-binding protein [Mycobacterium sp. MCS]MVTLDRLVNVLGGYGVQFRAGSAPRSTELRTVVIHEDRHVVGDVLLAVGA
DSVATALEWARAARAAVVLVRGDDVGVDATPAGGPAVLTVDPDVSWSELA
ALVFGLVLEGRETESGRGPTDLFALADSLADAIGGAVTIEDRHWRVLAYS
RMQQHADDARVATILGRQAPDRLRALFTERGVARHLANSDEPMFVAPAPA
DGLAGRMVIAARAGRELLGSVWVACAEELRGDQLRALADGARMVALHLLR
SRASADLERQVESDLVIGLLEGTVDAPTVVSKLALPPAGLRVIALRARLG
EERHAALLLAFERATTGFGWSRPGRSTLSATTVYTVLPSEPAETARRWVD
SLRAALPERAAILAGISSTATVLELPTARDEADECLALHELQGGVGEAPA
YDESWDDIVLRRLRIAARVGRTPQRGPVADLRRHDEHHGTRYVDTLRAWL
AAQGDLHEAAERLGVHENTVRYRLRKMAEVTDLDLTDARKRLAMTVELAA
TDDDGFTLSEADKIS
108802193YP_642390.1 O-methyltransferase-like protein [Mycobacterium sp. MCS]MLSGVSETALLTLNGRAHQARHPKAIIDDPMAIRLVDSIDFDFDKFGRKG
QEMALRSLAFDRAAIQYLDAHPSATVVALAEGLQTSFWRLTSARPDLDFH
WVTVDFEPIIALRERLLPHSDRISTLAQSALDFSWMDHVDTSNGVFITAE
GLLMYLQPHESMRLITECARRFPGGQMIFDLPPVLVKKLAPNGMRASRRY
RVPPMPFSLTPNQLADLAITVPGVRAVHDLPMPRGRGLLFEKLYPAFWEF
KPTKQMRGAYTLLEFG
108802191YP_642388.1 hypothetical protein Mmcs_5230 [Mycobacterium sp. MCS]MPEPLTPPFTRDTAIAKVRAGEDLWNTRDPARVALGYTTDSRWRNRSTFL
RGREEIVEFLTDKWARELEYRLIKELWAFGDDRIAVRFAYEFHDDAGRWF
RAYGNENWEFTSDGLMKTRHASINDVPIGEADRLFGWNRSGPRPQDHPGL
SDLGL
108802189YP_642386.1 hypothetical protein Mmcs_5228 [Mycobacterium sp. MCS]MALTNLDQPLSPDAGATKRDLVDYLDAVADRIVPGLAGRPLTVLRVLRGQ
APFMQKNAPKYTPEWVKTVAIWAESSHREVRYPLCDDRRTLLWLANQRAV
EYHPTLGLAENIYRPTHLVLDLDPPTETDFAAVVDVAQLVRQALADSGLA
GEVKTSGAKGLHVFVPVDDSAPVEDVAAATRALAARAEALDPSIATTAFI
VEDRHGKVFVDSTRAGGATVAAAYSPRLRPGTPVSFPLDWSELSAVTPGD
FTVHTAVEALDGRDPWAESMPAPQRLPDELIEHGRTIPVARVAAMHEGKR
RAKARRTGGA
108802187YP_642384.1 hypothetical protein Mmcs_5226 [Mycobacterium sp. MCS]MSESAPPLQNLLARAGGIRGLVSTALPVAAFAPTSALFGLVPAIVAALTA
AAVVLVWQLARGESTRPAVLGFAAVGLCAAVAWITGRSKDFYLPGIWMYL
GLAVVFTLSVVIRRPAVGVVWAWFTGRDGSWRRVRRVRRIFDGATLMMAA
VSWTRFLVQYHLYDSDREALLAVARIAMGWPVFVVTTTVIYLSIRAANRA
LTVSET
108802185YP_642382.1 cobalamin synthesis protein- P47K [Mycobacterium sp. MCS]MSAIPVIALTGYLGAGKTSLLNHVLRAPDARVGVVINDFGELNVDAALVT
GQVDEPASIAGGCICCLPDEGGLDAALEKLADPKLGLDAIIVEASGLADP
VAVSRIIRFSGVDRVRPGGVVDVIDAAMHFDTVDRGGAPPARYAAASLVV
VNKLDQIPDDDRAAALERIESRVRERHPEAHIVGAVGGRVDPALLYDVAD
TELATGQLSFRELLIADDTHHHVHAVSVTATSEGCVDPGALFDLLEDPPA
GVYRLKGTVAVRYRDRARRYVVNVVGPSVHVAAGTPGSANVLVAIGTGFD
VDAVRAHVEAALRPCDKPVPTAGLRRLQRYRRLSA
108802183YP_642380.1 polysulfide reductase- NrfD [Mycobacterium sp. MCS]MKERLAVPKAEFRSYYGRQILKTPVWNWMIAAYLFSGGLSAGSAMLGAGA
DLTGRPGLRKVSRIGSLVSLVASMYFLIGDLGRPERFHHMLRVAKPSSPM
SMGTWILGAYGPGAGVAAVAEVAELMPARLRRTRLGRLLGWAARPAGLEA
AVVAPGVASYTAVLLSHTAVPAWNEAHPYLPFVFTGSAAASGGGLGMLLA
PLDESGPARRMAVAGAALEVAASRTMERRLGVVGEAYTTGRAHRLRQWSE
VLTLGGVAGAVIGRNRAVLAVSGAVLLAGSALQRFGVFEAGVESTRDPKY
VVVPQRERLAAGEPARAR
108802181YP_642378.1 formate dehydrogenase [Mycobacterium sp. MCS]MGSNMAEAHPVGFQWVVEAKARGTDVVHIDPRFTRTSALADRYVSLRAGS
DIALLGGVINYILSNELDFREYVTAYTNASFIVDERFSDAEDLDGLFSGY
DDATASYDPSTWQYQTTDPEEGGAEAKEQSSGDRSGSGGPPVEGGAGDIP
RDPTLQDPRCVYQILKRHYARYTPEMVERVCGVPAEQFLEVARKWAENSG
RERTAALVYSVGWTQHTMGAQFIRAGAIIQLLLGNIGRPGGGVFALRGHA
SIQGSTDVPTLFNLLPGYLAMPHAGQETLADYLDDIKSRNQKGFWFNADA
YMVSLLKEYWGEHARADNDFCFDYLPRISGDHGTYRTVMDMVDGKVFGYF
LLGQNPAVGSAHGRLQRLGMANLDWLVVRDLVEIESATFWKSGPEVETGE
ITPQTCRTEVFLFPAASHVEKAGTFTQTQRMLQWREKAVEPPGDARSELW
FFYHLGRILREKLAGSTDERNRPLLELSWDYVMDGDEPSGEDVLRRISGV
DLTTGRAVDDYMSLRADGTTMSGCWIYSGVYADEVNQAARRKPHDQQGPY
ENEWGWTWPMNRRVLYNRASADPQGRPWSERKKLVWWDTEKQEWTGYDVP
DFEKHKPPDYRPAPGAVGVEALHGDDPFIMQADGKAWLFAPNGLADGPLP
THYEPHESPVRNPLYAQQGNPARKVYGRADNPSNPSPPELHGEVFPYVFT
AARLTEHHTAGGMSRQLPYLAELQPGLFVEVSPQLAAERGLTHMEWAHVI
TSRAAVDARVFVTDRMRPLRIDDHVVHQIWMPYHWGNAGLIDGDVVNDLL
GVVADPNVFIQESKVATCDIQPGRRPRGPALLEYIAMYRDRARITVDTGT
DLDTTKRSTEHTEET
108802179YP_642376.1 hypothetical protein Mmcs_5218 [Mycobacterium sp. MCS]MDADTALESQIAQWRGYVERHQTISAADADEMEDHLRSQISDLTAAGLMG
DEAFLVAVKRMGNMNGISREFAHEHSDRLWKQLVLMPAAPDARAGGPTRE
LWMVLALAVGAAVAVKVGSALMGEQAFARNAALFVLPFLTAYFAWKRQMS
PRAAAALSVPFVVAAAALNGYPFRPEGATEVIAAIHTPIVLWFVVGLAYA
GGRWRSDRRRMDFIRFTGEWIVYLALLGIGGGVLVGLTVGAFDALGMDVE
WVIESWVLPFGVAGAVVVSAWLVEAKQNVVENIAPVLTRVFTPLTILMLL
VLLVAFAAAGTVVGVDRNLLILMDLILVLVLGLVLYAISARDPQAPADLF
DRLQLVLVLSALAVDLLMLVAMLTRIAEFGVTPNKVTALGLNLVLLVNLT
WSARLLAGFLRGRVPFSAAERWQTRYLPVFGLWAAVALVVIPPAFDFV
108802177YP_642374.1 selenocysteine-specific translation elongation factor SelB [MycobacterMYVVATAGHVDHGKSTLVQRLTGMWPDRLAEEQRRGLTIDLGFAWADIGG
REMAFVDVPGHERFVANMLAGVGPVPAVMFVVAATEGWMPQSEEHLAALD
ALGVRHALLVVTKADLTDPAPAVEQALHAFADTGLAAPPVAVSTDLDHVR
AELVDLVDRLPAPDAGADVRLWVDRSFSVRGAGTVVTGTLTAGTLGVGDE
LDHAGRRVTVRGLQSLGQQRSAVGPVARVAVNLRGVDRREIGRGDALRTA
GAWLDTDEVDVALRAADGVHRQLVLHIGSAAVPVHVRPLGAAARLRLSHP
LPLRVGDVGLLRDPGQHRIAAGVEVLDVRPPPLRRRGAARERAAELAEGR
IRPPVCARASDLRAMGLPQTGRRIGAWVVDETWWAQRREQAVAAVRRWSA
DHDVAAGMPLETLRRETGLPAAELVTPLLAGTTLEVSDGRVRRPGMTLPT
RIDEAVRAVEKSLADDPFRAPDADTLGQLGLGTPELAAAVRSGRLTRIAE
GVVLGADALERAAEILTALPQPFTVAEAKRALGTTRRVAVPLLEQLDAQR
ITRRDADGTRTVAKR
108802175YP_642372.1 selenophosphate synthase [Mycobacterium sp. MCS]MTSVTYRLTQYAHGGGCACKIPPGELEEVVRGLSAAQPDSPFGELLVGLD
DGDDAAAVRISGDTALIATTDFFTPVVDDPYDWGRIAATNALSDVYAMGG
RPVVAVNLLGWPRDVLPFELAAETLRGGLDVCNAAGCHLAGGHSVDDPEP
KYGLAVTGIADPNRLLRNDAGKPGTPLSLTKPLGIGVLNTRHKATGERSE
EAIAVMTTLNAQAAVAALEAGAECATDVTGFGLLGHLYKLARASGVTAVV
DAAAVPYIAGAREALAAGHVSGGTRRNLEWVAPHADLSAVGADEALLMAD
AQTSGGLLIAGEIPGAPVIGELVPRGEHTLVVR
108802173YP_642370.1 short chain dehydrogenase [Mycobacterium sp. MCS]MAAARGVCGVAAPGAQEVGVGARRAVLPESSAQNPLTVIDDAVRLAGRTA
IRLARGIPVVGNRFGAPPHLDLDGRVVFVTGAARGLGAQIARQAHARGAQ
VVLVGRTLKPLEDLAAELGDGAAAFEADVTDAPALRRAAEGAVAAFGGID
VVVANAGIAPPSETVATIDPDEFEHTVEVDLLGQWRTVRATLPAVIAARG
HIAFVGSIYAFFNGVLAAPYAVSKAGVEQLSRALRVELAQHGVTAGIAYL
GFIDTDLTSDAFADEHAAAIRSAAPGFITRPMSAESAAAAVLSGVERRAA
QVTAPAWVGPVLAARSLTTAVMDDVLMHNPRVSDAVLSAEDDVAQRDS
108802171YP_642368.1 diguanylate cyclase [Mycobacterium sp. MCS]MDNRSVTSRMDSVRRWWMLPDHFDWVTGYLRSRGMMVAARTILSVMVGSL
ALVPILLVFSNFGPKSTIGVVVSWLAGIGGWATMLPYVQRWPTRVQSLVV
SYIATACVAAICLVQSDPTIALVGCFGFVTPAAYVAFLHTSRYTAYVFAA
AVAVGAIAATRLASSGQLVGALALLWFVIVLNAVIPFGVQTIVHALGVDV
VRSEWDPLTGLLTRRAFYQRLSTLVAGDQPADRNLLVAVIDLDRFKNLND
TQGHAAGDRALIAVGRALSRSSDDDALVGRTGGEEFVVATVSASANPTQP
AMRLLSAIEKAAPLTASVGTASVPLMRLRVTGWRAGIDEAITAADAAMYD
AKRAGGNQVRHRELPMTADDDPS
108802169YP_642366.1 hypothetical protein Mmcs_5208 [Mycobacterium sp. MCS]MLAIGLSGCTPTDSSPAPSAPGLPTSSSSESSAPTSAPKENSSAVVDYSR
LLIEPTDINSAYDTFVTRSTVPNRRGGKGISALFVNQDDTRAIGVTISIL
PDEAAAKAALDASLTAIGATVTGGPPAPSPVGTDGTVIVGTSPDGAKDVT
ALLFTKGPAVARLEFQSAPGDPTPPDVVTDIGIKQAIALRVGLPSVTG
108802167YP_642364.1 aminopeptidase DmpA [Mycobacterium sp. MCS]MRTRDLGVVIGEHPTGPHNAITDVPGVRVGHTTLQQAGPPAVNTGVTVVV
PHDHIWTEPVFAGAHRLNGSGEMTGLEWIRESGELTSAVGLTNTHSVGVV
RDALVDAQVSARGEGLYWSLPVVGETYDGVLNDINGHHVRAEHVHTALTG
ANDGPVAEGNVGGGTGMICHGFKGGIGTSSRVADTAAGRYTVGVLVQANH
GRRERFRVNGVPVGEIIGPDAVPLPDMPVAYEPGSGSIIVIVATDAPLLP
HQCTRLAQRSALAVSRIGGSGEQYSGDLMLAFSTGNRGIPPYSWDEDTAT
DRPEIAVRMVAPQLMTLLFDLTIEATEEAIVNAVVAATTVTGRDGRTAHA
LDHNLFRQALRHTREVR
108802165YP_642362.1 HpcH/HpaI aldolase [Mycobacterium sp. MCS]MYDEVPFHSHDSGSHDPGEVGSRIDPVLARSWLLVNGAHGDRFEAAVRSR
ADIVVLDIEDAVAPKDKVLARDNVVRWLGAGNSDWVRINGFGTPWWADDL
AALAGTSVGGVMLAMAESVDHVSETAKRLPGVPIVALVETARGLERITEI
AAAKGTFRLAFGIGDFRRDTGFGDNPATLAYARSRFTIAAKAAHLPSAID
GPTIGSSALRLIEATAVSVEFGMTGKICLSPEQCSVVNEGLSPSHDEIAW
ANEFFAEFERDGGEIRNGSDLPRIARANKILDLARAYGIVATEFEDEPVH
MPAPSDTYHY
108802163YP_642360.1 hypothetical protein Mmcs_5202 [Mycobacterium sp. MCS]MTNLSLDGRFARELPEMAVRWKAEEAPDPRLLVLNDELASGLGLDADWLR
SPDGVRLLVGNSVPDGATPVAQAYAGHQFGGFAPRLGDGRALLLGELVDG
DGRMRDVHLKGSGHTPFARAGDGLAAVGPMLREYLVSEAMHALGIPTTRS
LAVVATGRPVRRESVLDGAVLTRVASSHLRVGSFQYAAVTGDTDLVRRLA
GHAIARHHPEVAGAADPYLGLFEAVCSAQAQLIARWMLVGFVHGVMNTDN
MTISGETIDYGPCAFMDVYDPETVFSSIDSWGRYAYGNQPSIAAWNLARF
AETLLPLFDDDIDRAITLAQNALGAFGRHYEGALTAGMQAKLGLTGVDGP
AVAPLLDELLKLLQDNHIDFTSFFRALGLAARGDNEPVRGLFVDLAGFDA
WLDSWRALGPDGAAMDRVNPVYIPRNHLVEEALTAAAAGDMEPFETLLDA
VTGPFDERPGLQRYAEPAPEAFGRYRTFCGT
108802161YP_642358.1 putative FAD-binding dehydrogenase [Mycobacterium sp. MCS]MDADVIVVGAGLAGLVATHELTRRGKRVALVDQENAANLGGQAYWSFGGL
FLVDSPEQRRMRIKDSFELAWSDWQGSAAFDRLDDEDVWAAKWARAYVEW
AAGEKRDYLTGHGISFLPTVGWAERGDLTATGHGNSVPRFHVAWGTGTGV
VGPFADSALTAAQRGLVRFHHRHRVDGLVYTDGAVTGVRGTVLAPDNAKR
GAPSNRDTVGDFELSAQAVVVTTGGIGANHEIVRRFWPERMGTAPKSMIT
GVPAHVDGRMLDIAADSGVRLVNRDRMWHYTEGIVNWDPIWPNHAIRILP
GPSSMWFDALGRRLPAPCLPGYDTLGTLRYLRTTPGIAEHDHSWFILTQR
IIEKEFALSGSEQNPDITAKDRRGFLKERLFSKGAPGPVEAFKRNGVDFV
VADDLEELVRKMNALTDEPLLDATVIRRQIEARDLQVRNPFSKDAQIQGI
HNSRRALADRIGRTTAPHRILDPAAGPLIGIKLHILTRKTLGGIQTDLAS
RAIGLDGAPIEGLYAAGEVAGFGGGGVHGYNALEGTFLGGCIFSGRAAGR
ALADRV
108802159YP_642356.1 hypothetical protein Mmcs_5198 [Mycobacterium sp. MCS]MAGRMRWLRGLLLVALLTFAVSAAHTLGDDVRRVTVAYEVTGVAGHVEIR
FEEADGALSTAAPVTLPWRRQFTVTADSRFLSLSAGRTDSSPGDVTCRIT
ADGALIALDGLSGGYTQCTGMLTR
108802157YP_642354.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MTGVSGHCFGEQVTAPKPLSIENFSHICVGVSDMESSLAFYTGVLGMDIV
FDVELAGAGLEEVTGTAGAAGRMVGGLIGASMVELLALGDVPAVVEGPHL
GYTNMSFRVGDLDAAHEALGRHAGVQFTPPTDIGGVRMLFVHDPDGTPIE
LIELPGGLTSTVQMWRDA
108802155YP_642352.1 uracil phosphoribosyltransferase [Mycobacterium sp. MCS]MSEVHLVDHPLVAHKLTLLRRKDASTHSFRQLLHEISALMAYEVLRDIPT
QDFEVETPLETTVGQVIDGKKLVFVSILRAGTGILDGMLAVVPGARVGHI
GLYRDPKTLVAVEYYFKMPADLEERDVVVVDPMLATGHSAVAAVDRIKEC
GPKSIKFVCLLTCPEGIAAMQDAHPDVPIFTAAVDRQLDEHGYIVPGLGD
AGDRIFGTK
108802153YP_642350.1 hypothetical protein Mmcs_5190 [Mycobacterium sp. MCS]MLAPFPLRTGGAMSTGSGHIRLTSHSGAVGTPTIHWGAPTAAERGPVIGT
TANRSHRNVIGTHSGSYSVYRALAVAAGALKREHRADLTDTSPTDTIGPY
PQWGEPATIVSMDPWGASVADVFTAELAAGLDIRPTIAITKAHVILPEIT
DAIAKGRLVPDGRVLLASGAALVTKAAVEPVWWLPGVAQRFGCSETDLRR
VLFEETGGMYPELVTRSDLEVFLPPIGGQTVYIFGSATDLADPSVELTAR
VHDECNGSDVFGSDICTCRPYLTHAIEECIRGAQNGGVGLVAYSRKEGRA
LGEVTKFLVYNARKRQVGGDTADQYFARTECVAGVQDMRFQELMPDVLHW
FGIRKIHRLVSMSNMKYDAITGSGIEVGERVNIPEELIPPDARVEIDAKM
AAGYFTPGPVPDAEKLKQVKGRGLSQ
108802151YP_642348.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MSTAADIDRVTELANRVVAEYDPKTVLIPEYLGACYDAGLSWVHFPEGLG
GLGVSRGLQAVADGILQGAGGPVPLGLNPMGYGMAAPTIREHAQNDDIKR
AWLRPLATTEHIWCQLFSEPGAGSDLAGLATSAVPDGDDWVINGQKVWTS
LAHRARWGLLLARTNPDVPKHKGLTYFVIDMHAPGVETRPLRQMTGHAEF
NEVYFSDARIPDAHRLGGVGDGWRVAMTTLMNERSALGASGSRRGAGTIA
DAVALWASRPERHTPVLRDRLSELWLRAEAQRLTSERSRASATVGGPGPE
GSIGKLVGAELNQRIYQWCMDFLGPEGTLYHSYAMDSGDKSDWRGPIQQR
FLRSRANTIEGGTSDVMRNILGERVLGLPGDLRADAGMPWKEVPRG
108802149YP_642346.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMSRPRVVVAGLGDSGLLTAIRLAGHFDVVGVSARPGLVSGQELGVRLARP
DDWARDYWIPFDRFRALDRVRTEHATLTRVDLAGRKLFGQRVTGGELAED
FDALVIATGVTNGFWRRPGYRSSDEVAAQLRADHERLAAARSVLVVGGGA
AAVSSAANLALTWPGTRVELCFPGDRPLPQHHTRVWARIARRLDGLGVAL
RPGHRAVVPDGFACDRITDAPVEWSTGQPASTADAVLWAIGRVRPNTDWL
PAEVLDGDGFVRVTAQLKVPAVQRVYAIGDVAATDPLRSSARNRADKLLA
HNLRADFAGRPLRDYRAPTRRWGSVLGNQPDGLEVFAPNGTVFRFPAWSV
ERVLQPWIVRRGIYRGVRPSPSGD
108802147YP_642344.1 putative PAS/PAC sensor protein [Mycobacterium sp. MCS]MPRTAGRRRFEDGESDGQLKHIGSFRFYFVGQRWEWSDEVARMHGYEPGA
VTPTTELLLSHKHPDDRRLVQDLLDHTLHTGESFSSRHRFLDTSGREHDV
LVVADRMFDDDGSVIGSTGYYVDLTASLDEARQEVLDEQLPGLFESRAVI
EQAKGALMVIYRISADQAFRVLQWRSQETNTKLRSLAAQLIAEIGELPPA
PSSTQGQFDHLLLTVHERVTTE
108802145YP_642342.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MAIDHLLAVVPVSDVDRSHRWYSALFGRPADNNPMPTLLEWQVRPGGWVQ
VFSDADRAGTGLLNFAVDDLEGHLAEVGARGIEAEPIVDAAKGVRLSTLT
DPDGNLLRLIGGFRVDY
108802143YP_642340.1 hypothetical protein Mmcs_5180 [Mycobacterium sp. MCS]MTKTDTTKLLAQLRAILDLTNTEIQVAETRVAQARTEAVRRELEQNAANG
RERAEAIEGAIRDLGGYPDVIGPFLGRAAAAVKALTEQAEPFDEALLGDL
ALEDQLLDRSRYLKALAVATKEQDVQALADRLITAHSATVDWLTTVLAED
ALGGPAALRRTPLQAAAGVAVRTVNLPLTWTTRGVDRTVEALRNTGPAFN
ELVNRGTRVGEVAGKALGASRDAALAAAEKVTRDEGAGKAADALHSVRDG
AGVLDPSELPINGYDELTVTEAVAEVKDLTDPSDIRTIIAWEEAHKNRSR
VVSAAQTRLAAIAQEVVGIS
108802141YP_642338.1 hypothetical protein Mmcs_5178 [Mycobacterium sp. MCS]MAERVPAPADATTEAIATTALFLNFTAVIALAVCLASVGMSDLAVAATAG
VIAVLSFAASILCFSAQARERQRQDIAPAQVVPATT
108802139YP_642336.1 hypothetical protein Mmcs_5176 [Mycobacterium sp. MCS]MKAIRLAAAAAVSVTLTVPLAAAAHADPEPSPPPAPPAPASTIEKDGTYK
VGVDILPGTYNAGASGDGMTCYWKRVGADGKLLDNALTKKAASVRIEATD
ASFTTNDCQTWQLAACGTACPPPPPPPGPLEMLGQLGGMLGRAKGPMP
108802137YP_642334.1 transporter [Mycobacterium sp. MCS]MSAPTTDARTDAFPPQKPPHRGFIPRTIRALAVPIILVWIAIVAVLNVIV
PQLEEVGQMRAVSMSPNDAPAMISMQRVGEVFEEGDSDSNVMIVLEGEEP
LGDAAHAFYDDMIDKLEADPKHVQSVQDFWSDPMTASGSQSNDGKAAYVQ
VKLAGNQGEALANESVEAVQHIVGSLEPPPGVKAFVTGPAALAADQHIAG
DRSMRLIEMVTFTVIIVMLLLVYRSIVTVLLMLVTVVLSLAAARGVVSFL
GYHEIIGLSTFATNLLVTLAIAAATDYAIFLIGRYQEARGLGEDKETAFY
TMFHGTAHVVVGSGLTIAGATFCLSFTRLPYFQTLGVPLAIGMVVVVLTS
LTLGAAMITVASKFGLLEPKRAMRVRGWRKVGAATVRWPGPILIATIALS
LIGLLTLPGYRTNYNDRNYLPADLPANEGYAAADRHFSNARLNPELLMIE
TDHDLRNSADFLVINKISKAIFGVEGISRVQSITRPDGKPISNTSIPFMI
GMQGTQQKLTEKYNEGLTAQMLKQAEDMQTTIDNMETMQGITVQMADVTH
SMVAKMKDMTVDVEELRDHIANFDDFFRPIRNYFYWEPHCYNIPVCFAIR
SVFDTLDGINVMTDDIKAIIPDMERLDTLMPQMVALMPKMIETMKTMKVM
MLNMYSTQKGMQDQATAMQGDTTVMGEAFDASMNDDSFYLPPEVFDNADF
KRGMEQFISPDGKSVRFIISHDGDPLTPEGIAKIDKIETAAKEAVKGTPL
EGSTIYLGGSAAMFKDMNDGNTYDLLIAAIASLALIFIIMLLITRSVVAS
AVIVGTVVLSLGASFGLSVLIWQHIIGIELHWMVMAMSVIILLAVGADYN
LLLVSRLKEEIGAGLRTGIIRAMGGSGSVVTAAGLVFAFTMISMAVSELT
VIAQVGTTIGLGLLFDTLVIRAFMTPSIAALLGKWFWWPQRVRNQPVPSP
WPSPGPGLPPKAPEPTSV
108802135YP_642332.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MAGRTIVITGASDGVGAAAAKRLSRSGENVVVVGRSPQKTAAVADALEAD
SFVADFSDLAQVRDLAQRLLDAYPRIDVLANNAGGMMNTRETTVDGFEKT
FQVNHLAPVLLTTLLLDRLVQCRASVLNTSSMANKFVRTGFDDLDAVQKQ
SGSVAYSSSKLANILFTKELHRRYHGAGISTAAFHPGPVASNFSAEVDNP
MFGVIYRSPLRHLALIGTEQGSDELVWLASATPGVDWRSGEYYHKHKVAK
ANKLADDAGMAERLWENSLELLGERAVS
108802133YP_642330.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVTPRSRRSDAFANVHRIVAAAREVFGRDGVNATLSQVAEAAGVANATLY
RHFPNRRALAAAVYEDIVVTDIKPAILALGRDAPRAAFIDALAHLEDVMF
RQRPLLTSIGDLADLTAQLFTRDREQFDDMIMQAQATGALRPDLTADDVA
TFVAMVTTASVAMNQPRPVRRRYLSLMFDALNPAAAEPLTTPDHR
108802131YP_642328.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MKVNDASAAAKPVRRTQAQRTAETRSRLVAAGRRLFAQQPFTDVSTQAIV
EAAGVTRGALYHQFADKSALFEAVYEEVEQELVAEIAGAIEAGEASDHLA
AMRAGARLFLERCASPDIHRIALVNAPAVLGWERWREIGAHYGLGVIEAM
LAQAIADGAIPEQPVRPTAHMVLGALDEAALYISRAEDAEQALVEMYAVC
DRLIDGIAGRFATPR
108802129YP_642326.1 hypothetical protein Mmcs_5166 [Mycobacterium sp. MCS]MNPGGSHTVGAMTTVSLRRSIGDLTFDHVLVPPDGPSDGTVSAPTILVFL
GMEGRSDAQIAIAVHHGWDDPPAPPEDVVAERAWRALGVFLSETFRTRTR
SPRRPGRGASTARWATAPGTRAPSAR
108802127YP_642324.1 hypothetical protein Mmcs_5164 [Mycobacterium sp. MCS]MGKHLNRARAHFGKDTRGLLDGGRYALLHTRSLEFDDLRPYVPGDDVRDI
DWKASARSGSVLIKRFVSEKHHKILLVADAGRNMSALAPSGECKRDVAAH
AMGAIGLISLNRLDEVGMVLGDARGSANLPARRGENHVESLLHRWYQHSL
ADPGPSDIACQLDYVATHYGHSRLVVVVSDEPDTTARLDEILSRLSARHD
IMWLMTSDLSPLGGPEDADGYDVSTGKVVLNGATLGRRVVAAYRRAEKAR
RRRLDALLTRHAIPYATLSGSGDIRRELVALNEVLARAG
108802125YP_642322.1 hypothetical protein Mmcs_5162 [Mycobacterium sp. MCS]MDLRWWPIAVIGLLGLLVCFALAVLLPLSPDRRRLRPMANIARLVRLPEY
ARAARLRSVSTIATLVLLVVLFGAAAVAAARPTGADDTFARAHPEDVMLC
VANPVTEPTTGALLRHFARQAGAFENERIGLTSRNTRVVPLTRDYQYAAG
RFTDLADPDRAVIDQFAAPVTYTDYASSVDDVLALCLSGFPDFDQKTSHR
RSVIYLGPPTLRAADEQRPALFDAQRVADLADAAGAQINVITSGEDTALR
ALTERTDGQYTVATTESAVTESLDQIDGRPAPLVLDDGTRVTGQTQDAPV
AVLAVVLVVTAMLSVTLVVLRR
108802123YP_642320.1 hypothetical protein Mmcs_5160 [Mycobacterium sp. MCS]MRRRTGPVPARLRTRRRLLLWSAPLTLAVILVAVKLLSVVFAGNAAVRDY
ADRDAEALATDAAILGVVNVIEPAKAPFVEGTQAVLERRLDDADALFTEA
LAGTPAADSCPVRVNVELVRERRGDDAAFIGRNADARDLYTQALDIVTQA
PADCFAGNTDPDEQRRAVRADAAARLQAKIDGLRGAPPVAPPPPPPPPPP
PPPPPAAPSIGADGEPEPDAPRQLNPRGADPLDRLRQILRDSAS
108802121YP_642318.1 serine phosphatase [Mycobacterium sp. MCS]MPRETATTVPDEPAARSRAQLTEDVEIGLAGTLNLRRTGLRLLTMLRPEL
ADWTALVLPDNRTGGVTFFGGDQVGFTDLVPRRPEAYPLLERTLRTGQPH
RVRLESADADPGALADIVHHPRLCDEVASRSPADVLALGLTARGATLGVL
LLARVGDRSWGGDADNDDVVFARRLAARAAVALDSARLYEERGRIAAALQ
RGLRPPVLPEVEGVRVAARYRPTAEHLEIGGDFYDVHGAAGDWLFALGDV
CGKGVEAAALTGRTRQSIRTAAHFDRRPEVVLEALNSVLHEAESDQFVTV
VCARVRPQPDGHADVDLAVAGHPAPIVLRADGRVEQLEVFGTAAGVRAQT
RYRPASVRLDRGDTMLMYTDGVDEARGDAGFYGVDRLTAFLPAYAGAAPD
VVCEAVEQDVLEFLDGQPHDDIALLAVTCGI
108802119YP_642316.1 putative anti-sigma regulatory factor [Mycobacterium sp. MCS]MSSSSVQPDGADLRFLRMGAADAHAVARLREEFTRWLAEEFELDDVRSSD
IVLVVNEALSNAAEFAYPDREMGDNITLQTSYAADTGTLAITVADRGQWR
RSDTSNQKRSRGRGIPLMRALSDRVDIDKTPQGTQVHLYFDRCQRRAPVQ
AEAAAQTEKV
108802117YP_642314.1 cytochrome P450 [Mycobacterium sp. MCS]MCWAVAQHRRGRMRSEDAVAGLVEAQVYYDPYDTDIVTDPYPTYARLREQ
APLYYNERYDFWALSRHADVEKALLDWQTFSNSRSDILELVQSEYDMPKG
VMMFEDPPVHTMLRGLMSRVFTPRRMAAIEDQIRRYCIGCLDPHVGSDGF
DVIAELASMMPMRVIGMLLGIPESEQVSVRDANDANLRTKPGAPMKVADP
DRIADGRIYADYVEWRSKNPSDDLMTALLNVEFTDSDGVTRKLTRREVLH
YTQVVAGAGNETTGRLIGWLAKVLAEHPDQRREVYEDRSLLNRVVDETLR
YEPTGPHVARWTARDFEAYGTTVPAGSAMLLLFGAANRDPRRYPDPDAYD
IHRDNISHLTFGKGLHYCLGANLARLEGRVALDEMLNRFPEWDIDYDTAQ
LAPTSTVRGWERLRIVLR
108802115YP_642312.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. MCS]MSDDTLLDGDLDFLRRPLLGFLSMAAGPTPLQPRPVWFETTTDRTIQLFT
DPDSVKVRQLRRDPRASLVVAAPADERERWVSVAGRVTIEPDGARDLAAR
LAARYWDLDDPVRKRDLAGILDGHWVRFVIHPETVRRYAM
108802113YP_642310.1 amidase [Mycobacterium sp. MCS]MKSGDVVEASIADLRSALDAGKVTAVGLLEAYLARIAAYDHSGIRLNSIV
VLDPGAHAAAAESDARRARGRTLGPLDGIPYTAKDSYLARGLTAAAGSPA
FADLVAQRDAFAIERLRAAGAVLIGLTNMPPMANGGMQRGLYGRAESPYS
AAYLTAAFGSGSSNGSGTATAASLCAFGLAEETWSSGRSPASNNALCAYT
PSRGVISVRGNWPLVPTMDVVVPHTRTMADLLEILDVIVADDPDTRGDFW
RTQPWVPVPEVADVRPPSYPALAAGPKVLAGKRFGVPRMYINADPDAGTA
ASPGIGGPTGRRIDTRPSVLALFDGARRDLEAAGASVVDVDFPVVSNYEG
DRPGAPTIFTRGLVSPEYLRRELLDLSAWAWDEFLTANGDPALHTVRDVD
GAQIFPHPEGALPDRYDGFDPWFEADIAAYPQWVRDHPIGSMLDIPGLAD
GVRGLEETRRADLEEWMDELGLDAVIFPAAADVGPADMDVDAESADLGWR
NGVWVSNGNLVPRHLGIPTVTVPMGTMADTGMPVGLTFAGRAYSDTALLR
WACAFEATGARRTPPPRTPPLA
108802111YP_642308.1 rhomboid-like protein [Mycobacterium sp. MCS]MSYPQYPQSPAQAPTCYRHPDRQTYVQCTRCGRFICPECMRSAAVGHQCP
DCVGEAARSAPQARAPFGGRLSDSKPVVTFALIAVNVLVFLMQTTSGQLE
REFVLWTPGVADGEWYRLATSAFLHYGAMHLLFNMWALYVVGPPLEMWLG
RLRFGALYALSALGGSVLVYLLSPINAATAGASGAVFGLFGAMFVVARKL
NLDIRGIAAIIILNLVFTFVYPLISGQGISWQGHVGGLVTGAAIAGVYAY
APAGRRNLVQGGVTAAVLLLFVVLIWWRTEEIFAMFGVR
108802109YP_642306.1 hypothetical protein Mmcs_5146 [Mycobacterium sp. MCS]METKLRRFLSYKLTIAELIGIGLLLGTPYLIIGVIWSSTHTDHLSDMHGV
DLAISFLGSIASWPVLLFSDVCMT
108802107YP_642304.1 hypothetical protein Mmcs_5144 [Mycobacterium sp. MCS]MLAALRRLLFAEVSIADLIETAMWLAVPYLVIGVGFTFLHPEYVQFFEAQ
LTTRVPAGADLAAFGQTTLLWPVLLIADYICAA
108802105YP_642302.1 hypothetical protein Mmcs_5142 [Mycobacterium sp. MCS]MATFLHRIGRFAFHRPWHVIAGWIVLIAVVAGVLTVNPPKISNEMRINGT
PAQEVIDQLAERMPQSSGGQGSIAFAAPQGQRIDEGANLDAVLAAVDAVS
RTDHVLDPREIAAAEMAKGPASPTLSAAAAVTRAQVNAPASPEAPRPLTI
DGQPVPGVTVSADGAAALYQFQFDKQTAELPTGAVENTIDAAREAVGDRG
IEVLPSASMAQMPEMVGAGEVIGLMVAAVVLIVTLGSLIAAGLPLVTALI
SVAVGVGGTFLFSHLFDMQSMTAVLALMLGLAVGIDYAMFIVNRQRRLIL
DRGLSAADAAARAIGTAGSAVVFAGMTVVIALVALTVVGISLLTPMALAA
AATVVVAVVAAITLLPALLGLVGERIASPKGRHSVSTEESNHRFASAWVG
AILRNRVPAALAGLAVTGVIALPALSMTLGMPDGGSYNEGTPQRESYDVI
AEHYGDGYNGPLVVVAEPTTAGQLTPADIAATYSDLRRVPGVADVTFGGV
NDASDTAVFSVVPENGPTEEATAQLVRDIRAQSGPLAELREVKLGVTGIT
AMGIDMSDRLGKAIPVYVGIVMGLSILVLMVVFRSIAVPLKATAGFLLTV
LATFGATTALFQWGWFQQLIGLSATGPILSMLPIMVIGVLYGLAMDYEVF
LVSSMKEAHVHGHRGDAAVAHGFTQASRVVVAAALIMMAVFAGFVFNADP
MIKQMGFALAFGVLIDAFVVRMTVVPAVMSMLGDRAWWLPKRLARVLPDL
DIEGDKLNRSLEAERSEQSVPA
108802103YP_642300.1 hypothetical protein Mmcs_5140 [Mycobacterium sp. MCS]MRYRLMPYVTLEVDDRLRRRVRSFGEHLRVTVRAYLLSAADDVDTAGERV
RGMCDKAVNRVDTVVASVNDKIAPSSSEPATPQSSREAS
108802101YP_642298.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MAGSGAASGSAWQRRVTRWRFDPPLRTAFLVTVLVVVLILTLVWMQFRGA
FTPEVKLRMIAERSGLSMDPGAKVTFNGVQIGQVDTVEEIDDDGRPAAEL
ALALRPEYVDLIPANAEVAIRATTVFGNKYISFSSPENPVPQRISSSDVI
RVDSVSTEFNTLFETIVSVAEQVDPIKLNQTLTATAEALDGLGDRFGQSL
IDGNTILADLNPQMPQIRRDTQLLADLADVYGDAAPDLFDGLDNAVTTAR
TLNEQRANLDQALMSAVGFGNTGGDVLERGGPYFVRGTNDLIPVSETLDR
NSPSLFCMIRNWHDAEPAFTEFNGGNGYSVNLHNTVQGASNPWVYPDNLP
RVNAKGGPEGRPGCWQKVTRDLWPAPYLVLDTGASLAPYNHLELGQPLAI
EYVWGRQIGENTINP
108802099YP_642296.1 elongation factor G [Mycobacterium sp. MCS]MADRTTPQTVPTADAPDAIRNIALVGPSGGGKTTLVESLLVAAGVLTRAG
AVTEGTTVCDSDEVEVSQQRSVGLALAPLLHDGVKINLIDTPGYADFVGE
LRAGLRAADCALFVIAANEGVDEPTKLLWQECDAVSMPRAVAITKLDHAR
ADYTGALAAARTAFGDKVVPLYFLADAGVIGLLTGRHYEYRDGVRTVHDP
GAPHLDEYTELRGSLIEGIIEESEDESLMERYLGGEDIDQALLIADLEKA
VARGSFFPVIPVCSSSGVGTMELLEVATRGFPSPKEHPLPEVFTPQGAPR
PNPGCDPAGPLLAEVVKTTSDPYVGRVSLTRVFSGTIRPDMTVHVSGHFS
SFFGAAADSATGSGHPDHDEDERIGTLSFPLGRQQRPAPSVVAGDICAIG
RLTRAETGDTLSGKDDPLVLKPWTMPEPLLPIAVQPRAKTDEDKLSVGLT
RLAAEDPTLRIEQNPQTHQIVLWCMGEAHAAVVLDALSRRYGVTVDVIEL
RIPLRETFGGSAKGHGRHVKQSGGHGQYAVCDIEVEPLPEGAGFEFVDKV
VGGAVPRQFIPSVEKGVRAQMDKGVGPGYPVVDIRVTLVDGKAHSVDSSD
YAFQMAGALALREAAAATTVNLLEPVDAVTITVPDDLVGTVMGDLSGRRG
RVLGTEQAGADRTVVRAEVPQVELTRYAVDLRSLAHGAGVFHRSFARYEP
MPENAAAKVRAAS
108802097YP_642294.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MRAMSDAPRRRPRQSRSRETVDVVLEAAAQMFAREGLKTTTNRIAGRAGV
SIGSVYQYFPNKQALLYALAERHVRQAREHLGEVFAELRARQLPFDETMR
VILDEVVALHRDRPGLHRLMHRLAPRHPAELASVQDFEDRIIDEVAYHLR
RCGRGGDDPVATAQMLVHTVDAHLHRVMTRRTPDSAQLVALVDRLLAD
108802095YP_642292.1 hypothetical protein Mmcs_5132 [Mycobacterium sp. MCS]MVTIHVERTIGAPPERVFSWLADPASLTAAPLVLRAAWTRESPGPGVGAL
RQVIAAGMWFREEITAYDPPHSYSYRIVRSVPAFDHEGGTITFTPSGDGT
HVSWTSTYSHPAYGGGKAMEALSARLLPWNFKAILARCARVLES
108802093YP_642290.1 hypothetical protein Mmcs_5130 [Mycobacterium sp. MCS]MERLIREEIPTVVEAEGVDFRSQEVGEMSIAWVRLAAGTDLRPALVGLDD
DLCQCPHWGYMLSGQLRMHTRERQHVYTAGDAFYWAAGHAPEAITDCEYV
DFSPTESIKTVLDHITGTGG
108802091YP_642288.1 hypothetical protein Mmcs_5128 [Mycobacterium sp. MCS]MAEREAPGDFDYRWDEPPHVGGARAEHGPAAEPDYDDVYQPTVAEYAAEP
DYTAPDYTAPDYAEPEYTEPEFSEPEYTAPLPDDRFDAFNANTWTFRPPP
PPWYRTRQAVTALMIVALAAIALVVSAVLLILGGLGGADSDEESTVAPTP
SSTVAPSPSPSRTSEPPPPPPPPPPPPPPPPSAEAPVNTGPTWRPTQRPS
QTKKPEIGVTKNPAIRKPNNPREPD
108802089YP_642286.1 binding-protein-dependent transport system inner membrane protein [MycMSTLGRRLRDGVPLLPFFAVLTIFLLIPTVTVVVNAFVADGAFSLDRIEA
LFSATALSALWKSVLLSGSTALIGAVLGALLSWLIVSSPPESMVRRAVLA
LCSVLAQFGGVALAFAFLATVGLNGVLTLWIQQALGWNLAGSGWLYSLSG
LILVYTYFQIPLMVIVFVPALEGLREQWREAAVNLGASTWQYWREVGFPL
LTPAFLGSLLLLFANAFAAYATAAALVSQGSPIVPLLIRSALTSEVVLGQ
SGFAYALALEMIVVVAVVMVAYNALVRRTARWLQ
108802087YP_642284.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTAGVAVELNDLTRVYGTVHALDGLTLHMQPGELVALLGPSGCGKTTALR
ILAGLDEATSGSVSVDGRDVSRVPANKRDMGMVFQAYSLFPHLTVLDNVA
FGLKMRGKAKADRLSRAADMLDLVGLSAHKHKYANELSGGQQQRVALARA
LAVQPRVLLLDEPLSALDAKVRAQLRDEIRRVQLEVGTTTLFVTHDQEEA
LAVADRVGVMNQGRLEQLAAPAELYAHPATPFVAQFVGLNNEVPATVSAG
SARLLGTEVPVLDGSATGGDGVALVRPESVTVTTGGAPNATVTSVAFLGS
ISRVYCTLSDGTVLSAQLPSSQATKFTSGDAVTVGVEPTAVLVVSR
108802085YP_642282.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. MCS]MANRDHGDPGDAPSVPPPLRPAVEAVRPSAAEEARTIAASTNTATLATLT
ADGDPWASFVTYGLLHGAPVLCVSNLAEHGRNLAADPRASLAIVAPASES
DPLASGRVTLAGVVERPAGEEAGAARDAHLAAVSAAKYYIDYSDFTVWVL
RVRRVRWVGGYGRMDSCSGADYAAAEPDPVAPHASGAVAHLNADHAESLL
AMARVLGGYPDATTAMCTGADRYGLDLRLETERGIAYTRVGYAAPLNSPA
ELRSAAVELTRRARQG
108802083YP_642280.1 hypothetical protein Mmcs_5120 [Mycobacterium sp. MCS]MNLPFDDWLPQQRWYGGRSREFSSATPDVVVTLRDDLDLVLLTVNYAEGR
PEHYQILVRWDAAPIDEYSVVARIGSDTEHGERTGYDALYDPAAAHFLMT
LIDSSAQVGDIRFAKEPEVTLPLQAAPRVSSAEQSNTSVIFDQDAILKVF
RRITPGINPDIELNRVLARAGNPHVARLLGSFETTLDREPYALGMVTEFA
ANSAEGWDMALTSTRDLFAEGDLYADEVGGDFAGESHRLGEAVASVHSTL
AAELGTSQVPFPLDTVLERLQSVADAVPELQPHAQSIEERYRKLADQEIT
VHRVHGDLHLGQVLRTTEGWLLIDFEGEPGQPLDERRRPDSPMRDVAGML
RSYEYAAYQRLIERGGDAQHDKQLAARAREWVNRNVSSFCDGYAAASGTD
PRDHAELLAAYELDKAVYEVGYEARYRPSWLPIPMKSILRILGV
108802081YP_642278.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MNSGPQSPIRESHMQLALTEEEAAFRDELRTFYRTEIPAEIRERSRRGGE
VSKDDIVTTHKILNDHGLAVPNWPVEWGGKDWTPVQHQIWLDEMQLACVP
EPLTFNSKMIGPVIAEFGSQEMKERFLPPTAALDIWWCQGFSEPEAGSDL
ASLRTTAVRDGDTYIVNGQKTWTTLGQHADWIFNLVRTDPQAPKRQAGIS
MLLMDMNTPGITLRPIKLIDGSFEVNEVFFEDVRVPADQLVGEENKGWSY
AKFLLGNERTGITQVGRTKVKLAEAKARAKESGLIDDPLFAARLAEAEND
VIALELTQMRVASGSADGQPNPASSVLKLRGSQLQQLATELLVEVAGPDA
LPFGAGADLASPEWAQRSAPTYLNYRKTSIYGGSNEVQRTIIASTILGL
108802079YP_642276.1 hypothetical protein Mmcs_5116 [Mycobacterium sp. MCS]MSDNIDFESANDTEGPGDTLSPMEALDSDDIRNDDGDNVVDPPEDWSEAN
RSDQLPRGEVGGGESLDEKLAAEVPDDTAGAAPADDSAPAGEVEPMPEDR
IDNLEADHHGTDAGQVSGTPEDGDSFFTVVE
108802077YP_642274.1 isochorismatase hydrolase [Mycobacterium sp. MCS]MRALIVVDVQNDFCEGGSLAVTGGAAVARRISDLLADGTARYDHIVATKD
FHIDPGEHFSDTPDYRVSWPRHCVVGTDGAEFHPDLDPSPVEAVFTKGEY
SAAYSGFEGSDASGTPLGDWLRERGVDEVDVVGIATDYCVRATAADAAAA
GFTTRVLLDLTAGVAEDSTADAVRALRDAGVAVV
108802075YP_642272.1 hypothetical protein Mmcs_5112 [Mycobacterium sp. MCS]MTPAAHVTVLAHGLGGSTDLPIPYTYALLGAAWALTATFAVVALAWRKPR
FDETRPGRALPQWVTSVVDASVTRWVIALAALAFTLWVALAAFFGPQNAE
NPLPGVFYVLIWVGLVALSWAIGPVWRVLSPVRALFRVLQLHRRENRPPY
PVRLGYWPAAFGLFAFVWLELASPDPGSVTAIRTWLLVYVGVTFAGALWF
GERWCARADPFEVYSVVASRLSLFRRQRDTGRIAIGNPFDHLPTLPVRPG
TVAVLAVLLGSTAFDSFSAMPVWRDFVDSTAGGAWTATLLKTAGLAVFAL
VVAGTFSAAAMATAGVDRQRRRELPGLMAHSLIPIVIGYVFAHYLTYLVE
RGQQTVILLADPLQRGWNPFGLADAEVGYLLSMHPSVLATLKVAFVVAGH
MAGVVAAHDRALKLLPSAHQITGQLGMMLVMVGYTFTGLYLLFGG
108802073YP_642270.1 hypothetical protein Mmcs_5110 [Mycobacterium sp. MCS]MEFFSEVSGVSVLAQGEEGGGTAIHEVIGLSVAAVIVTAVLLYIGYLHRN
HKISWLTSLADWSGRRFKRPPWVALPVAMFTASIICALFGFIWDVSLHIG
NGRDDGALANPAHYFILIGLFGIFVAGCTAVVLPFDRPGPAAVRITDHWH
APVGGLVMAGCGLYALMGFPLDDVWHRIFGQDVTLWGPTHLMMIGGAGFS
TLAAAYLEYEGKRAVGPDAPRDGLGLKFVLYLAFAGVLIGASVYQIEFDF
GVPQFRQVFQPMLIAAAAALALVMARIFLGRGAALIAALIAIGLRGIVAF
LVAPVLDAPVNWFPLYLGAAVVVELVALTPLLKRPIVFGLVSGLGIATVG
LWLESLWINAVYPLTWPTSIWPEALAMSVPVAMLVGACGAMAGMVITGQR
LPKRAVGVGLVALTVVAIGGAAANGLQYKVPENATAAVTLTEAPAVNGAR
YVTADVRFNPPDVIGEDPNWVAVLGWQGGLENQRGQFVDNLEKVGSGHYV
STQPLPVSGTWKTLLRVHDGKTLAAVPIYLAGDPGIGAEEVPADPQFTRP
FVSEVTILQRERSPDIPQSLWLIGCLVVLVCTLAMVAGITWGGGRINNSE
PSGSEAELQPSAQA
108802071YP_642268.1 hypothetical protein Mmcs_5108 [Mycobacterium sp. MCS]MAQQMSGIVHAAFDTLRYEPTAKRIRVTLAGEPVAETDRARLVWEPRRIV
PTYAVPLDALIAHLVPAGAESGAEEATRSTLDPTVPFTNHTCEGTEYDVV
AGEETGGAAAFRPDDADLADYVVLDFAAFHWHEESEPLVSHPRDPFHRID
VLRSTRRVRVEYEGRLLAESSRPLLLFETNLPMRCYLPPGDVTELAPSNT
VSYCAYKGRAAYYSLADGPRDIAWTYRDPLHDGEPVRDHICFFDERVDVI
VDGVRAERPMTQWSEPGV
108802069YP_642266.1 hypothetical protein Mmcs_5106 [Mycobacterium sp. MCS]MNKLGFATIIAGGLATAFLGLATPAQAAPAGPGNAQNTIEKLDDRGYAVR
VNHQGMVKPLDESSIVSIRYDNDDRVVYVTVR
108802067YP_642264.1 hypothetical protein Mmcs_5104 [Mycobacterium sp. MCS]MDAMDAVEALSARLATLPVTGMSRAEAQAALMRLGRLREQLQEVERRLTG
RLVASGSPSQFGARTWADVLAQRLRISPGEAQRRIAEAVSEGPSAA
108802065YP_642262.1 group 1 glycosyl transferase [Mycobacterium sp. MCS]MRIALLSYRSKTHCGGQGVYVRHLSRGLVELGHDVEVFSGQPYPEGLDPR
VRLTKVPSLDLYREPDPFRVPRPSEIRDRIDLQELLTTWTAGFPEPKTFT
MRVARILAGRRGDFDVVHDNQSLGTGLLKIAATGLPVVATVHHPITRDKV
LDVAAARWWRKPLVRRWYGFAEMQKQVARQIPELLTVSSSSATDIADDFG
VSPEQLHVVPLGVDTALFRPVENRVSGRIIAIASADVPLKGISHLLHAVA
RLRVERNLDVQLVSKLEPNGPTEKLIAELGISDIVHSSSGLSDEELAALL
ASAEVACIPSLYEGFSLPAVEAMASGTPIVASRAGALPEVVGADGECARL
VRPGDVDELTRALGELLDSPAQRQRLGAAGRRRALEVFSWESVAAQTVSV
YERAMATC
108802063YP_642260.1 hypothetical protein Mmcs_5100 [Mycobacterium sp. MCS]MPAADLPGIPGVFTPDQCRQTAESIAAEQESSGAIPWFTGGHTDPWDHVE
SAMALTVAGLLEPARAAYEWCRITQRPDGSWPIQFRNGVIEDANSDSNFC
AYIAAGVWHHLLITRDRSFAETMWPVVAKAIDFVLGLQRPNGEISWAQSE
DGPIPEALLTGCASIHHSIRCALALADYIGEPQPEWEVAVGRLGHAIIAH
PGSFVPKDRHAMEWYYPVLCGALRGAAAHDRIHERWDDFVVPGLGIRCVD
DRPWVTGAETCELVMALDAIGDSARAHQQFAAMHHLREGDGSYWTGLVFA
DGKRWPEERTTWTGAAVILAADALTGTTPGSGIFRGADLPRGLEDEFDCA
CAVSDR
108802061YP_642258.1 integral membrane protein TerC [Mycobacterium sp. MCS]MTDPVIVPLWGWVALTAAIAVMLAVDLFLHRDNHVIGFREAAVWSAIWIA
AGLGFGAIVWWAYGGDVAGTYYAGYLIEKALSVDNVFVFALIFTYFAVPD
EYQHKVLFYGVIGALLFRLVFIFVGAELLAAFFWTAYLFGAFLIYTAYKM
AFQHDKDLEPDKNLMVRLVRRLVPIDTRYHGDRLFTRVDGKRVATLLFVV
LIAVEATDLIFAIDSVAAVLAITTSTFIVWTANAFAVLGLRSLYFCLSGL
LRRFTHLHYGLAILLAFAGVKLILSETPVGKLPIPLTLSVIVVTLTASVV
WSLVATRASDAPRQSPSPKPNT
108802059YP_642256.1 hypothetical protein Mmcs_5096 [Mycobacterium sp. MCS]MSVTDTDLPPRAARLFALADKAVGFMPADEGRTLYDTAVRYLGDGIGVEI
GTYCGKSTLMLGAAAQETGGVVYTVDHHHGSEEHQPGWEYHDTTMVDPVT
GRFDTLPTMRHTLDAADLDDHVVAVVGRSPVVARGWRTPLRLLFIDGGHT
EEAAQRDFDGWARWVEPGGALIIHDVFPNPDEGGQAPFHIYQRALATGAF
REVAATGSMRVLERTSGEAGESA
108802057YP_642254.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MQGCSGGDMSVVVQDDVYRGRLLDGLAASIAERGYRDTTVADIVRHAHTS
KRTFYGRFETKEECFIELLRANNDALIARVNAAVDPDADWDEQIRQAVGA
YVDHIAARPAITLSWIRELPALGARATPMHRWAIDRLTDMLIGLTGSAGF
RRAGKAPLSRPVAVVLLGGLRELTALFFEDGRDVRGILEPAVTASTALLG
G
108802055YP_642252.1 methionine sulfoxide reductase A [Mycobacterium sp. MCS]MSDHKKAILAGGCFWGMQDLIRKQPGVVSTRVGYTGGQNDHPTYRNHPGH
AESIEITYDPAQTDYRALLEFFFQIHDPTTKNRQGNDVGTSYRSAIFYVD
DEQKRVALDTIADVDASGLWPGKVVTEVTPAGEFWEAEPEHQDYLERMPW
GYTCHFPRPDWKLPKRADAKA
108802053YP_642250.1 hypothetical protein Mmcs_5090 [Mycobacterium sp. MCS]MTNTAPARFTRAELTAAFATFEETVAHAAQTRDWDPWVEQYTPDVLYVEH
AAGTMRGRDEVRTWIWKTMTSFPGSYMTAFPSLWSVADEESGRIICELDN
PMRDPGDGTIISATNISIVTYAGDGQWSRQEDVYNPLRFVKATMKWCRKA
AELGTLTDEAAAWMEQYGAHARSNDEGAHARSTESGAGDR
108802051YP_642248.1 O-methyltransferase-like protein [Mycobacterium sp. MCS]MTRVDLRGAPETMLATLYAKALDADAPRSILNDGFARDIVARIDYDWSRT
GIKPQNAPSVTLRAKHFDTWTKQFLAVHRDAVVVHLGCGLDGRYLRLDPG
PGVEWFDVDYPDVAALREQFYPRREHCHVVAASVTDPEWLTSVPSDRPTL
IVAEGLTMYLTEADGVALLRRLVGRFPSGELQFDSFNRLGISLQWTNTPV
RRSGARLYWAIDGPSDVLDAVPGTRLLAWVPVFESDAFSRLSAGYRAMAA
VMNRVPGLRTMAQFHRYAF
108802049YP_642246.1 FAD dependent oxidoreductase [Mycobacterium sp. MCS]MLTVNGQVSHWFDGQPAYRAPLPGDRDADVCIVGAGYTGLWTAYYLKRAD
PSLRIAILEARFAGFGASGRNGGWLSGLVPGNRNAMAERYGREPVVAWQR
ALNETVDEVSAVAAAEGIDAGIVKGGTMEIARNAAQAKRLADELHEDRRW
GVDGIAPLTKGEAADRIRFDGVVSAYHTPHCARIQPAHLARGLADAVERL
GVPIYEQSPVTAIGRGRAVTPHGTVRAPIVLRATEGFTPTLPGLRRRWLP
MNSSMIATAPIPDERWAAIGWDGCETVGDTAHGFFYAQRTVDNRIAIGGR
SVPYRYASRIDDDGRVPPRTITRLTAVLHSLLPQIRDVPIAHGWCGVLAV
PRDWESTVTLDRASGLGWAGGYVGHGVTATNLAGRTLADLVLGRSTPLTE
LPWVGHHSRGWEPEPLRWLGVRGLYLAYRLADRHEARGRSTTSPIARVAD
LITGRP
108802047YP_642244.1 hypothetical protein Mmcs_5084 [Mycobacterium sp. MCS]MSGRPVLEPTAAHPITVSPTGRHVTVTVNGTVIAETDEALTLQEADYPAV
QYIPLHDVNDSALVCSDTTSYCPYKGDAAYYHVNAAGETVEDVIWTYGQP
YPAVGAIAGHVAFYPDKADVTVG
108802045YP_642242.1 diacylglycerol O-acyltransferase [Mycobacterium sp. MCS]MKQLSGWDVLLLNSETPNVHQHTLKVAVVDTSAFEGEPSFEAFCETLRGR
MYLLEPLRYELVDVPLHLHRPMWRENADVDLGYHVRQVRVSAPGGRRELD
ALIGEIAGTALDRSRPLWELYYAEGLANGRVAVIGKVHHALADGVASANL
MARAMEWPDLVPGSGAVAGGTRGEPSAVELIRGAARDHARKLTELPDVLK
DGALGIHRLRRRSRQRRDNPDLAHQFHPPPTFLNHKLSPARSFAGATLSL
AEAKETSRRLGVTINDLVLATAAGGLRELLLAYDGRADEPIIASVPAATD
ISRDRITGNALSTMLVSLPVHVDDPLEQVRLTSLAAGIAKEDHDLLGPAT
VGRWLEYVPPTVLRTVFGWTSRRRAPNQLFNVIVSNVPGPRQRGRIAGAV
VSEIYSVGPLAAGSAMNVTVWSYVDQLSFSVLSDGETLADTHEATDAMVR
AFGRIRTAAGLSVG
108802043YP_642240.1 amine oxidase [Mycobacterium sp. MCS]MKDPRRVVHPASPGLPDATSLTTRPRAVVVGGGIAGLTAATGLAERGVEV
DVVEREPYLGGRVGGWADDVDGVGAAAMNRGFHAFFRQYYNLRDLLRRVD
PQLSMLFPVEDYPLIDGQGRRDTFRGLPQTPPFNAVAFALRSPTFRLRDL
ARLNARAAAPLATVSVPDIYDRLDHVDADQFLRDINFPEAARHLAFEVFS
RSFFAQPPDLSAAELATMFHIYFLGSSEGLVFDVANDNFDVALWNPLRRY
LEGRGVRFHTGVSVTAVEPGFTVHCDSGQPLSADGVVLATDVTGLRGIVS
GSAELGDDAWRTAVDGLGTAPPFLVHRIWLDRPVAPDRPAFLGTGGLTPL
DNVSVLERYERQAADWARRTNGSVVELHSYAVTDTSEELPRQLLARLHAI
FPETAQADIVGERLLLRGDCPRFAPGDFAVRPTVGTPVDGLALAGDGIRI
DLPVALMERAATTGWAAANRLLAHFGVAGHAVTTVPTTGRSATLRRLAER
GRQLQS
108802041YP_642238.1 hypothetical protein Mmcs_5078 [Mycobacterium sp. MCS]MIGLGYTLPAIVAVVVVVAWEVLWLRTGLFRRPAYWISMVIVVGFQIPVD
GWLTKLSDPIVIYNEEHTSGIRFPWDIPVEDFLFGFALVTGVLLLWERQR
TRGVKVGERVHDE
108802039YP_642236.1 phytoene synthase [Mycobacterium sp. MCS]MIGSELDAAGVRDPALRNAYRCCRVLNAEHGRTFYLATRLLAPEQRPAVH
ALYGFARRADDILDDLDSAATTAERADRLHRLATQLFDGLVQGNATGGDP
ALAAVVHTARRYGIPWELFDDFLASMRMDLTVTDYPDRASIDRYMYGSAE
VIGLQLLPVLGTVVPREEAAPYAAALGKAFQLTNFLRDVDEDLDRGRVYL
PADELAAHGVDRDLLMWCHTTKRTDTRVRNALAEQHAVTRRVYDYARHGV
DLLHPRSRACVGAAAVLYSEILDRIEAIDFDIFNQRATVGNGRRLRVAGA
GLLRAWRARIAHPAKV
108802037YP_642234.1 polyprenyl synthetase [Mycobacterium sp. MCS]MSGVDDRLLAAALRPAPARLTADSFDTWRRDVRRAAIDAVTEFVTDRCAD
DLRLTGVDVTLDVLSDFVSDGKCLRSTFAYLGWLAGAAPDDAALRAAASF
DLLHVFALLQDDVMDDSPLRRGRPAAHVRFAQWHRDNGLNGSAERFGASA
AVLLGDLCLVWAGQMMRESGLGDRALARAWPRYDAMRTELAVGQFADLVN
DAGGRPTLEDVLDVARRKSGNYTVRRPLEIGGALAGCPDATLGLLGRYGA
AVGEAFQLRDDLLGIFGAPTVTGKPAGGDLSEHKATSVVVAAHRLAEPSV
RNQLTELMSRRDLDAGDITRWQHLIAATGAVQWIEQLIDRRLSHALERIH
TSPLDDTVRTALVNMAAVCTRRAA
108802035YP_642232.1 Ferritin and Dps [Mycobacterium sp. MCS]MAYTVPGMTDKEGAQVAELLQKQLSRYNDLHLTLKHVHWNVVGPNFIGVH
EMIDPQVELVRGYADEVAERIATLGGSPKGTPGAIISDRTWDDYSLERDT
VQAHLAALDLVYDGIIEDTRKNIEETEEPDPVTNDMLIGHAAELEKFQWF
VRAHLENAGGDLKHGGKSTEKGAAKAAKS
108802033YP_642230.1 hypothetical protein Mmcs_5070 [Mycobacterium sp. MCS]MTGRLKVLWTGAISAAMAMGVLAAPAVGSADATDDYPIPNRIMRTTCTVE
QYMAAARDTSPVYYERYMIDYNNRPVDIQNMARDRIYWFFSLDYTARRQY
SENTATNVYYEQVATRWGNWAKLFFNNKGVVAHATDVCMTYPPADPSVWH
WGHNAR
108802031YP_642228.1 MIP family channel protein [Mycobacterium sp. MCS]MREPTMMHRVAAEFIGTFWLVFGGCGSAVFAAKYTSADGYAFGIGFLGVS
LAFGLTVLTGVYAFGTISGGHFNPAVTLGAALARRVEWRVLPAYWLTQVI
AGVAAGLVIYVIAKGREGWTATGNMAANGYANHSPAGYSLLAVVIAEVLL
TGIFLLVILGATDTRAPKGFAGLAIGLTLTLIHLISIPISNTSVNPARST
GVAFFNGNEAPAQLWVFWIAPLLGAAIAGAAYPYLFGRHEELADRPVRDE
TLDAQVRAEDVADARLRRGPDPEVR
108802029YP_642226.1 glutamate synthase (NADH) large subunit [Mycobacterium sp. MCS]MGPVPSGLYNPAYEHDSCGVAMVADMHGRRSRDIVDKAITALLNLEHRGA
QGAEPNTGDGAGILLQVPDEFFRAVVDFDLPEPGSYATGIAFLPQSSKDA
ATACEQVQKIAEAEGLTVLGWRDVPTDDSSLGALARDAMPTFRQVFMAGA
SGMDLERRAYVVRKRAEHELGTKGPGQDGPGRETVYFPSLSGQTFVYKGM
LTTPQLRAFYLDLQDERLTSALGIVHSRFSTNTFPSWPLAHPFRRVAHNG
EINTVTGNENWMRAREALIRTDVFGTQADLDKIVPVCTPGASDTARFDEV
LELLHLGGRSLPHAVLMMIPEAWERHESMDPARRDFYRYHASLMEPWDGP
AAVCFTDGTVIGAVLDRNGLRPSRIWVTEDGLVVMASEAGVLDLDPSTVV
QKMRLQPGRMFLVDTAQGRIVSDEEIKAELAAEHPYGEWLEAGLFQLEEL
PPGDYVRMPHHRVVLRQQAFGYTYEELNLLVAPMARTGAEPIGSMGTDTP
VAVLSQRPRMLFDYFQQLFAQVTNPPLDAIREEVVTSLQGVIGPEGDLLN
PTAESCRQIVLPQPILRNAELSKLICVDPDHEIRGHKHGMRAAVIRCLYP
VNRGGQGLKEALNNVRAKVSAAIRDGARIIVLSDRESDEQMAPIPSLLSV
SAVHHHLVRERTRTQVGLVVEAGDAREVHHMAALCGFGAAAINPYMAFES
IEDMVDRGVITGISSDQAKANYVKAAGKGVLKVMSKMGISTLASYTGAQL
FQAIGIDQKVLDEYFTGLNCPVGGIDLDDIAAEVAARHALAYLDRPDERA
HRELEVGGEYQWRREGEYHLFNPDTVFKLQHSTRTGQYSVFKEYTQLVDD
QSERMASLRGLLKFKDGVRQPIPIDEVEPASEIVKRFSTGAMSYGSISAE
AHETLAIAMNRLGGRSNSGEGGEAVTRFDRDDNGDWRRSAIKQVASGRFG
VTSHYLSNCTDIQIKMAQGAKPGEGGQLPGHKVYPWVAEVRHSTPGVGLI
SPPPHHDIYSIEDLAQLIHDLKNANPQARVHVKLVSENGVGTVAAGVSKA
HADVVLISGHDGGTGATPLTSMKHAGAPWELGLAETQQTLLLNGLRDRIV
VQVDGQLKTGRDVVIAALLGAEEFGFATAPLVVSGCIMMRVCHLDTCPVG
VATQNPVLRERFNGKPEFVENFFMFIAEEVRETMAQLGFRTVNEMVGQVG
VLDTTEAAEHWKAHKLDLSPVLHEPESAFMNQDLYCSSRQDHGLDKALDQ
QLIVMCREALDAGTPVKFSTTIANVNRTVGTMLGHEVTKAYGGQGLPDGT
IDITFDGSAGNSFGAFVPQGITLRVYGDANDYVGKGLSGGRVVVRPAENA
PADYVAEDNIIAGNVILFGATSGEMFLRGQVGERFAVRNSGAVAVVEGVG
DHGCEYMTGGKVVILGPTGRNFAAGMSGGMAFVYDPAGELPDNLNAEMVE
LDALDDENVSWLHGMLQAHVNATDSAVGQRILNNWEEELKHFVKVMPRDF
KRVLAAIAEAERTGADKNEAIMAAASG
108802027YP_642224.1 hypothetical protein Mmcs_5064 [Mycobacterium sp. MCS]MYINPISRSRVGRIAWSLFRHPVKSREFPAKHERLITAAELVRYGV
108802025YP_642222.1 hypothetical protein Mmcs_5062 [Mycobacterium sp. MCS]MDAPTPCSEMPLRALVAHIGGLAQAFRAAADKEFGPLTDTPPEPDTPLSP
GWRTEYPRFLAELAESWRDPAAWTGMTRAGGIDLPGEVAGSVALAEVVIH
GWDVALATGQNYDCDAATAHACLQHLSQFDTGGTEGMFGPAVPVPDDAPA
IDRIAGLSGRDPEWSPR
108802023YP_642220.1 catalase [Mycobacterium sp. MCS]MAQDRGAKETIKSVVKDAKDKVVEAAERLQQHSPSYIPGAPGPEKPTFEE
PTAPREPLPPKPDQGGPDLRTATGLSVGGGQTARGQQGEYLTTAQGARLH
DTDHSLKAGERGPTLLQDHHLREKIMHFDHERIPERAVHARGAAAHGVFR
GNGAAEKICKAGFLKSGAETDVFVRFSTVLGSRGSADTVRDTRGFATKFY
TDEGTFDLVGNNIPVFFIQDGIKFPDVVHAAKPHPDREIPQAQSAHDTFW
DFVSLHTEAQAHTMWNMSDRGIPRSYRMMEGFGVHTFRLTGPDGSTSLVK
FHWKPRLGVHSLVWEEAQIAAGMDPDLHRRDLADAIEKGAYPEWDLGVQV
MPDNPDQMFEGIDLLDPTKIVPEELAPVQVIGTMQLNRNPTNFFAETEQV
AFHPGHLVPGIDVTDDPLLQARLFSYLDTQLTRLGGPNFGQIPINRPHAP
VNDMLRDGFHQHGVHPGAAPYRPNSLDGGCPFLAGADTGAFIEAPAVVAE
STKVRAAPASYDDHFSQAALFYRSLSPVEQTHVAEAYTFELGKCYEQTIK
ERQLAVLANIDAELCATVAAGLGLEPPAPTVTPAEPAVLSPAVSQVGKTW
PVEGRNIGILTGPDSDNGVVAAVVEALGAAKLVPLVIAAHGGTLDHEGGS
IPISRTYATARSIEFDGLVLAGSPATVQAKILVDEAFRHFKALGVLPQGT
DLLASSGVNTDSEGVLSASDPAGLTSALLESLGEHRVWGRVVPA
108802021YP_642218.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MLRISTACKVSGVTTASQARAPRGRRSARPSGDDREQAILATAEQLLEAR
PFAEISVDDLAKGAGISRPTFYFYFGSKEAVLLTLWERVIREADAALENA
ASNATSEDVWRPGIKVFFDTFGAHRGVTVAASGSDNAEVRDVFARFMQKW
IDFTAATIEAERRRGAAPQTLPARDIATALNLMNERTLLAAFAAETPGIP
PDRVLDSLVHVWTCAVYGECR
108802019YP_642216.1 ribonuclease activity regulator protein RraA [Mycobacterium sp. MCS]MTIEPRATADLVDDIGPDVRSCDLQLRQFGRRPEFAGRVTTVRCFQDNAL
LKSVLSEPGDGGVLVIDGDGSLHTALVGDVIAALGRDNGWSGLIINGAVR
DASTLRTLDIGIKALGTNPRKSTKTGAGERDVPVDFGGVTFTPGDVAYSD
DDGIVVVTP
108802017YP_642214.1 hypothetical protein Mmcs_5054 [Mycobacterium sp. MCS]MADRPDGSDEQSDTPAEPTPPAAATPPPVKKAPAKKAPAKKAPAKKAAAK
KAPAKAVKKAPAKKNTAPPKKQPPPSPADLVTADGDLTAAAEEAAAQAKA
AVATASNPVAGPAPVPVDGPDQSRLPLAAAVATAVLVLLAVLVARRR
108802015YP_642212.1 copper resistance protein CopC [Mycobacterium sp. MCS]MQTLVRRWAVAVTTVLLVALPLMGAGVASAHAAVIATDPADGTTLTEAPP
RVSATFNEAMQPAFAAMTVVGPDGNLWSTGGPEVQDTVVSVDLRPLGPSG
TYTVNYRATSADGHVVTGSWAFELTVSGTGTPGPSAAAPVPPTAPADDPP
VWPFIVGACVAVGAAALWAARRRT
108802013YP_642210.1 hypothetical protein Mmcs_5050 [Mycobacterium sp. MCS]MGSRVRVAASAAMVAAGMSLAGMGGAMAIAEPEDGGAAPVGAGTAADSPG
DVDRLPLDPERTKPAASQSNPDEGQSGTPGTGQSGSSIPERTTPSTKPTE
TSTPTETTESTTSTSPTTSTPTTSTPTTTSTVVPAPGDTGSDHDGPEGMP
PKLDEPGPIAPSVIDAAPGLPVVVPMAPIAVPVLAVPPVGLPSVLGVGAA
GGGGGSGGGAAAAPRGPAPEVPARVAPPQQPSVRQPEVPVRSGDPAAVPA
SFRAGYGEYLRTAGVMQVAAVAVPGAAGILMLTGLGGLVGYRQARAGLAL
RTESIARFMN
108802011YP_642208.1 hypothetical protein Mmcs_5048 [Mycobacterium sp. MCS]MIVWGIAGLLGLATGLRIGWALVNKQSLVSTAMILALGNLAAVAALNWQP
LTLLVDTVLKWPNIAVALSQVALIMCAAGSCVMITTVASARTPSATRSIA
VAQYVLAGIVAALSLVLFFAAGKQPEMAPQEYLRRTLGASGTSADISWLL
PLIYVLLAMSLVMWSGLRHSSRSRRGRALFVFTVGIALILVVAALFLLRM
FGVVDSIGVGAGATLLGCAMVTVAVGALLPSVEDWFGARRELRIIDPLLI
ELGRRHPDVGIGVRPHGPLVFRVAERMSLISDALFLEATSARTPVDARRT
PGDQGEQEVPDDGLPAPGVTPAEQARAIAEWIYASREGSADSGRRRFPGF
EWLRQPESYSDREWILAIARQYRALDRENPGTAL
108802009YP_642206.1 hypothetical protein Mmcs_5046 [Mycobacterium sp. MCS]MLGAVLVSLAVVFVAELGDKSQIITMTYALRHRWWVVLSGVGIAAVLVHG
LSVAIGHFLGLTLPEKPIAFAAAIAFLLFAAWTWREGRNAGGDDDVRVAE
PRFVVPAIVSSFVLAELGDKTMLATVALASDRDAIGVWIGATVGMVLADG
VAIVVGAILHKRLPEGFLHAMASVLFLLFGLWMLFDAALGWRVVALAATG
GVTAVVLLIAVVRTIRARRLRAASATPHESTSETV
108802007YP_642204.1 superoxide dismutase [Mycobacterium sp. MCS]MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGANDALSKLAEA
RESGDHSAIFLNEKNLAFHLGGHVNHTIWWKNLSPNGGDKPTGELAAALD
DAFGSFDNFRAQFTAAANGLQGSGWAVLGYDTLGQRLLTFQLFDQQANVP
LGIIPLLQVDMWEHAYYLQYKNVKADYVKAFWNVVNWEDVQNRFAKATSS
ASGIIVG
108802005YP_642202.1 rhodanese-like protein [Mycobacterium sp. MCS]MGRMDDVEVTQAEVAELPTAFDGSALLLDVREDDEWQQGHAVGALHIPMG
DVPSRLAEVDPEATVYVMCHAGGRSQRVAQYLVRNGYRAINVSGGILAWS
AAGRPIVTDGGGAGNA
108802003YP_642200.1 glycerophosphodiester phosphodiesterase [Mycobacterium sp. MCS]MNPDDGALGGHPFVVAHRGASADRPEHTLAAYELALKEGADGVECDVRLT
RDGHLVCVHDRRVDRTSSGTGVVSEMTLAELRELDFGSWHASSRPDAGPD
TTDLLTLERLVELVLDWHRPVKLFIETKHPVRYGALVESKVLALLHRFGI
ATPASADLSRAVVMSFSAAAVWRIRRAAPMLPTVLLGDTSRYLGGGAATT
VGATAVGPSIMTLREHPELVDRAAAQGRAMYCWTVDHYEDVRYCRDLGVA
WVATNHPRRTKDWLQNGLTGAAGTDR
108802001YP_642198.1 cell envelope-related transcriptional attenuator [Mycobacterium sp. MCMAVLLVMVVSLVGLTVWVDTSLQRIPALAAYPDRPAAGRGTTWLLVGSDS
RAGLDAEQQAQLATGGDVGNGRTDTIMLVHLPGLTSSAPATMVSIPRDSY
VPIPGYGEDKINAAFALGGAPLLAQTVEQATGMRLDHYAEVGFDGFASVV
DAVGGVTMCPAEPINDPLAGIDLPAGCQELDGRNALGFVRTRATPRADLD
RMTHQREFMSALLHRAASPAVLLNPLRWYPMASAAGGALTVDTGAHVWDL
ARLGWALRGDLTTTTVPIGEFTDGGAGAVVVWDSEAAGRLFDALSTDTPI
PADVLDTTPGG
108801999YP_642196.1 abortive infection protein [Mycobacterium sp. MCS]MSRPSDELPDLLDHGQRRAIRIEIAIVLAVTFGLSAYTALLRLLEAVLLG
LSGQVVALNPRRSTYDLLDLGLNLAGVFQLLAWGALGVYLLWRSGFRLPD
IGLARPRMRPDLLGGLGLAVLIGLPGLAFYQLARVLGINASVEPAELYDT
WWRIPVLLAMSFANGWAEEIIVVGFLLTRLRQLRVNPVVAIVAASLLRGA
YHLYQGFGAGLGNAAMGLVFGYYWHRTGRLWPLIIAHTLIDAVAFVGYAL
LAGHLGWLQ
108801997YP_642194.1 prephenate dehydratase [Mycobacterium sp. MCS]MPRIAYLGPQGTFTESALLQMISGAMVPGGDADDTAVTPVPTDSTPAGLE
AVRSGAADYACVPIENSIEGSVLPTLDSLAVGAPLQIFAELTLAVSFSIV
VRPDHDGDVGTVAAFPVAAAQVRRWLAEHLPAAQLVPAHSNAAAAADVAG
GRADAGISTALAAERYGLRSLAAGVVDEPNARTRFVLVGRPAPPPARTGA
DRTSVALRLPNTPGALVAAMTELSIRDIDLTRIESRPTRTELGTYVFFLD
CVGHLEDDAVAEALKALHRRCEDVRYLGSWPTGTAAGAPPPSSDEATRWL
TRLREGLPTPPEGGR
108801995YP_642192.1 hypothetical protein Mmcs_5032 [Mycobacterium sp. MCS]MNEVMSIQCRECRSGLDHCHGTVIHHVRYRSECTEDDCTTPEVVHTFSVD
CEAVGCQCGQSAAQAVI
108801993YP_642190.1 hypothetical protein Mmcs_5030 [Mycobacterium sp. MCS]MERMLEAPERDRPAGDARDKAPWWHSLQATPTRRALLLTALGGLLIAGFV
TALPRSEGTNGPGLSASAITLGPRGNDTFNHAKAGDCLNWPERNPDGAQI
VDCKDEHRFEVAESVDMRTFPGSEYGPDAEPPSPARIQQISQEQCQAAVR
RYLGPRFDPNSRFTISMMWSGDKAWRQAGERRMLCGLQLPGPNNQQLAFT
GKVAEIDQSKVWPAGTCLGIDPATNQPTDIPVDCAAPHAMEVTGAVNLKE
KFPGALPPEPEQDTFIKDACTRMTDAYLAPIKLRNTTLTLIYSTISLPSW
AAGSHQVSCSIGATLGNGGWSTLLNSAKGPLQINGQPPVPPPDIPEERLN
LPPIPMPDDVDSSSQQSEPDYSQTEQTQQTQTEQTQHGPQPAAAPPSEAP
APPPGDGNTFLNGPPPPPGAPAPPPPAPEAAPPPPPAPAPPPPPPPAPAP
PVEPVPPPPPPPPGP
108801991YP_642188.1 hypothetical protein Mmcs_5028 [Mycobacterium sp. MCS]MDMRLDELRSWFGFGVAGNFAGHLEQAGEAADFVNVEVGTDAGDQAPKGI
FPWYAPGVDGQLGEFPLSHDRIVLPDSAVPLNLQIEPEVGLACRVVWYGD
TVVRLDPFALGAFNDCSIRRPGAAKISDKKNWGASSKGVAPQFFDIGDLT
PDGPTATLRLVCFLRDRDGHEHAYGVDSPLLGYSYYGEVLLDWVVERLAN
QKGSAGTPLEDVGALMAAAGHPEHVLIGIGATRYTELGESTFLQPGDEAV
VRVYDTESDEFSELRQTVVTR
108801989YP_642186.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MQVTSVGHAGFRIDTKAGSILCDPWVNPAYFASWVPFPDNTGLDWDALGD
VDYLYVSHLHKDHFDPKNLRDHVNKDAVVLLPDYPVPDLRRELETLGFHR
FFETTNSVKHRVSGPKGDLDVMIIALRAPADGPIGDSGLVVDDGDTVAFN
MNDARPVDLDVLAADFGRVDVHMLQFSGAIWYPMVYDMPARAKEAFGTQK
RQRQMDRCRQYIAQVGATWVIPSAGPPCFLDPELRHLNDDHGDPSNIFPD
QMVFLDQMRRHGHDGGLLMIPGSTAEFTGSVLDSLTHPLPDDEVEAIFTT
GKADYLEAFAQRMAPVLAAEKATWAPAHGDPLLEPLRAKFEPIMVQSDQI
CDGIGYPVELRLGAETVVLDFPKRVVREPIPDEKFRYGFEIAPELVRTVL
RDGEPDWVNTIFLSTRFRAWRVGGYNEYLYTFFKCLTDERVAYADGWFAE
AHDDSASITMGGYEFQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWNLES
GRCLTTKGHELRTGPL
108801987YP_642184.1 phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS]MEPVFRTLEIAAEAATRVTGTRITYHGLDNIPARGGAVVAINHTGYIDFL
PAALAAKRRRRRMRFMIKAEMEQVKIVGYLIRHTGTIPVDRRAGAGAYAV
AVQALRAGELVGVYPEATISRSFELKEFKTGAGRMAIEADVPILPLIVWG
AHRLWTKDHPRALGRNRIPVTVVVGEPIPPAGPVSELSTTLRASMNALLE
RAQADYPAPAGQYWVPRRLGGGAPTLEEARRLEEVELAERARKRAEGRR
108801985YP_642182.1 LGFP [Mycobacterium sp. MCS]MLSRRPAPSLFFTAIAATLVLLPWAVNGLPGDDDESAAAGAPTLTEQPLA
GLGGGETIREIHQDTPFSMVALTAEDLTGTSARVRAKKDDGSWGPWYEAE
PLEGVGEETAARRGTDPVFVGRTTTVQIAVTRPADAPPSAPAPAEHRGPD
LGYLPATVEQPFAQNINAVLISPPQAPGDTLPLPNAVMAPGVPPRIITRG
QWGADESMRCGGPRYDAAVRAGVVHHTAGSNDYAPEDSAGMVRSIYEYHT
RTLGWCDLGYNALVDKFGQVFEGRAGGMDRPVEASHTGGFNTDTWGVAMM
GNFEVVPPTPIQLRTTGRLLGWRLGLDRVNPMGTTVLTSAGGSFTHFPAG
ATPTLPSIFTHRDVGNTECPGNAAYAAMGELRAIAARFNAPPGPEDLAES
LRGGAIFDRWAKMGGMASALGAPTSPEAAGEGTARYVRFQRGAMYWSPES
GAAPVMGAIYDAWGSLGFERGALGLPTSGEIHEPLWIKQNFQHGTLNFDR
EKATVTRVIDGVPLELPPASSHTPPVQLERFTAPINP
108801983YP_642180.1 UDP-galactopyranose mutase [Mycobacterium sp. MCS]MRPGLAGPLRRPARQHVGKSGRGRIPWLPMRSQYDLFVVGSGFFGLTIAE
RVATQLDKRVLVLERRPHLGGNAYSEPEPQTGIEVHRYGAHLFHTSNQRV
WDYVRQFTEFTGYQHRVFALHNGQAYQFPMGLGLVSQFFGRYFTPDEARA
LIAEQAAEIDTEDAQNLEEKAISLIGRPLYEAFVKHYTAKQWQTDPKELP
ASTINRLPVRYTFDNRYFNDTYEGLPVEGYTKWLENMAADDRIEVRLDTD
WFDVRDELRAANPDAPVVYTGPVDRYFDYDEGRLGWRTLDFELEVLETGD
FQGTPVMNYNDADVPYTRIHEFRHFHPERAYPTDKTVIMREFSRFADEDD
EPYYPINTESDRALLAAYRAKAKAETASAKVLFGGRLGTYQYLDMHMAIA
SALNMYDNTLAPHLRDGAALTQSESTNP
108801981YP_642178.1 PA-phosphatase-like phosphoesterase [Mycobacterium sp. MCS]MADEPRGEDAALVAVQAALAGRPGVLPGARALSHFGEHSAGWLAVAGLGA
VLQPERRRDWLVAGAGAFAAHAAAVLIKRVVRRERPHHPAIAVNVGTPSR
LSFPSAHATSTTAAAVLLGRVTGLPLPAVLVPPMALSRLVLGVHYPSDVM
TGVAVGAVVAEVSARVAERTGARG
108801979YP_642176.1 hypothetical protein Mmcs_5016 [Mycobacterium sp. MCS]MRQSSSADTVRPPHQSGTVRRATGSVVARRLVRGPAFPFDVTVRVSLWVS
VAVVAVLFSWGAWERRWIADDGLIVLRTVRNLLAGNGPVFNAGERVEANT
STLWTYLITAGAWVGGSVQLEYIAFVFAFVLSVAGVVMAMLGTARLYAPS
LQGRRALLLPAGVLVYIAVPPARDFATSGLENGLVLAYLGLLWWMLVCWS
QGLRSPSGPGRDAVSRPFTAALAFLAGLSVLVRPELALIGVGALLMMLVA
ARSWRRRLLIVVAGGLLPVAYQIFRMGYYALVVPGTAVAKDATGAKWPQG
FTYLTNFAEPYLLWVPAVLLILTGVVLVSTRSRPWWIRHQPPRGYGRLAR
MVQSPPTVVLFIVCSGLLQGIYWIRQGGDFMHGRVLLTPLFCLLLPVSVI
PVVLPDGSRFSRETGYLLAGATSVLWLAIAGWSLWAANSPGMGPDATRVT
DTGIVDERRFYAQATGHAHPMTAADYLDYPRMRAVLTALENTPDGALLLP
AGNYDMWDVVPALPPLPDAPDDYIGPHTVFFTNLGMLGMNVGLDVRVIDQ
IGLANPLAAHTERLEDGRIGHDKNLFPDWAIAEGPFLKIPPYLPVYIDRD
WVAQAEVALKCPATESVLNSIRAPLTPRRFLSNVVHAYEFTQYRIDRVPR
YELIRCGMAIPEPHEPPYTGMPAAGP
108801977YP_642174.1 putative esterase [Mycobacterium sp. MCS]MMRGLLRVVAAVVLAAGLWTATETASGTRAGADAVEYLMVPSAAMGRAIP
VAFQGGGPHAVFLLDAFNAAPDVSNWVTAGNAMNTLAGKGISVAAPAGGA
WSLYTNWEQDGSRQWETFLATELPDWLAANKGLAPGGHGIVGAAQGGTGA
MTMAAFHPDRFRYAGSMSGFMTPSATTLNGAITAGLAQYGGVDTRNMWGL
PQLGRWKWHDPDVHIQLLANNNTRLWVYSPTTLTCADPAAMIGYCDQAQG
SNRVFYQHYRAVGGSNGHFDFPSGGEHGWGSWAPQLGAMSGDLVAAIR
108801975YP_642172.1 cutinase [Mycobacterium sp. MCS]MPKTSRRKRHRILALAAAGAMALVVVLVVAIIVVVMRKPDTPDTALPPTA
VPPTSVPSTGKPRPEFQDASCPDVQLLAIPGTWESSPQMDPFNPTQFPIA
LLLNVTNPLRAEFGNDRLEIYTVPYTAQFHNPFSADKQMSYNDSRAEGTQ
AAVKALVDMNNRCPLTSYVIVGFSQGAVIAGDIASDVGNGRGPIDQDLVL
GVTAIADGRRESGVGQTVGPTPPGVGAEITLQEVPTLSALGLSMTGPRPG
GFGQLNDRTFEICAPGDLICAAPESAFSIVNLPRTLETLAGGAGQPVHAM
YATPQFWQVDGQPATGWTLNWARNLIESAPQPKHG
108801973YP_642170.1 mycolic acid condensase [Mycobacterium sp. MCS]MNMSETPNNSPSAENQPIVAQGEGGPLRPAQVDMTVAEMREWLRNWIANA
TGQNADNIDEQTAMVELGLSSRDAVAMASDIEDLTGVTLTATVAFRHPTI
ESLATVIIEGEPEVEHDDDGTDWSRERDVDDIAIVGLATRFPGDMNTPDE
MWEALLEGRDAITDLPEGRWEEFLGEPRIAERVAKAATRGGYLSDIKGFD
AEFFALSKMEADNIDPQQRMALELTWEALEHARIPASSLRGERVGVYIGA
SNNDYSFMSVADPGVAHPYAITGTTSSIIANRVSYFYDFRGPSMAIDTAC
SSSLVAAHQGVAALRAGEADVAVVGGVNALITPLVTIGFDEVGGVLAPDG
RIKSFSQDANGYARSEGAGMLVLKRLSDARRDGDEIYAVIAGSAVNHDGR
SNGLLAPNPDAQAEVLRKAYKDAGINPRDVDYIEAHGTGTILGDPIEADA
LGRVIGRSRPADQPALLGAVKSNVGHLESAAGAASLAKVALSLRNDKLPP
SINYTGPNPYIDFDAVRLKVNDTVSDWPRYSGHAIAGVSGFGFGGANAHM
VLREVLPSDLVEPEPEQVVEVTAEPNQPAVYVGGVRMDEYGEFVDEPLAR
RESGFDEDSDDDGLDRPAAAVEDDYELPGLTDEAKRLLEVAREELEAAEQ
PVPLVPLAVSAFLTSRKKSAAAELADWMDSEEGRASSLESIGRALSRRNH
GRSRAVVMARDHDEAIKGLRALAEGKQSPNVYSADGPVTNGPVWVLAGFG
AQHRKMGKSLYLRNEVFADWINKVDSHVQDERGHSILELILDDAVDYTDE
TTELPIEKVQLVIFAIQVALGELLKHHGAKPGAVIGQSLGEAAAAYFSGG
LSLEDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIKTVFSDYP
DLEVCVYAAPTQTVIGGPPEQVDAIIARAEQEGKFARKFQTKGASHTSQM
DPLLGELAAELVGITPHPLQIGYYSTVHEGKFLRAGSEPIHDVDYWKKGL
RHSVYFTHGIRNAVDNGHTTFLELAPNPVALMQVGLTTMSAGLHDGQLIA
TLARKQDEVDSMTAAMAQLFVHGHDLDMRTLFPRRSRGLAGALDYANIPP
TRFRRKPHWLDVRFSGDNAGVMPGSHVATPDGRHVWEYSPRGAVDAQALA
ALVKSAASQVFPEAAVTAAEQRAVPGDGARLVTTLTRHPGGASVQVHARM
DNGGESSFALVYDAIVTRGGQAVALPAAVATGTVAPQADSLTPAAEPEGG
DAAILSDNLTQGANLGAGLGKWSPDSGETIHDRLGTIVGGAMGYEPEDLP
WEVPLIELGLDSLMAVRIKNRVEYDFDLPPIQLTAVRDANLYAVEQLITY
AIEHRDEVDQLAESQKGKTAEEIAAEQAELMGGASTVAELEEKLAAAGHP
LGEAASEQAAVMSGANLTTVTTPAPDPQAEPSTQQDSAIPAPPTDPSGPN
IPPPPTNPAGPDTTAKSSAAKAAAQVLTQEAVTEALGADVPPRDAAERVT
FATWAIVTGKSPGGIFNELPKVDDATAAKMAERLTERAEGTITADDVKAA
TTIEDLATTVREHLEAGKVDGFVRVLRAPQEGSDRIPVFVFHPAGGSTVV
YEPLMKRLPPDTPIYGIERVEGSVEERAAEYVPKLLEMNGWTEGRSGVPF
ILAGWSLGGVLAYACAIGLKQAGADVRFVGLIDAVRAGEEVPQTKEETRA
RWERYARFAERTFNVQIPEIPYEELENLDDEGQVRFVMEAVAASGVQIPG
GIIEHQRTSYLDNRMIDTAEIKPYDGHVTLYMADRYHDDAIYFEPRYATR
QPDGGWGEYVSELEVIPIGGEHIQAIDEPYIAKVGAHMSEAINRIEAQGK
108801971YP_642168.1 hypothetical protein Mmcs_5008 [Mycobacterium sp. MCS]MWRLRSSSLRGATDGGGLRADDHTRGPRLAVVPHPPAPQPHVPHLLRGEA
RVRVVAAERACQHLRVGHAEPGAGGSADQRPPRVLAAFTTEQRGHLRPGR
DVADGPRRRRRRGVEAPVVHDEPQRNRESHPLRRAGGEDHDVGVLERRAD
RRGGQLGQRAGGRRGTPLRRLCVRVVTQRAVIPRDGPAGRHPVGVVTGGR
RHTPHGQRAQPEPLRAVIGDDDDVAAGQIRGARRNRDDTWRRGGVSALEC
GSHRHQHDVAVDDGGQGGTRRGRRQVGHRARRHVAGDHIREGQIGIKPCL
RWTR
108801969YP_642166.1 hypothetical protein Mmcs_5006 [Mycobacterium sp. MCS]MPSSAPAFVPSVPRAARLEACFEELAELTGQRNAIDGRIVEIVAEIDGDG
RWGATGARSVAALVAWKTGVSPANAKTIATIAHRLTEFPRCTRALREGRL
SLDQVGAIAERAATGSDDHYAELATHASVSQLRTAIKLEPPPQPEPEPEP
DAVSDADVEPKPLPGPADLQPSITTTSDEQYTYWHIKVPHVDAAKVDAVL
RSRLDGLIAQWKRDHGDTDDTSGPGRPPMPRLADAFMDLIDTGWDAEAAR
RPHGDRTTVVMHLDINDRIAALHLGPLLSDADRRFLGCDATCEVWFERDG
QPIGAGRTTRLINRRLRRALEHRDRTCAVPGCAATRGLHAHHIQHWEDGG
PTDLDNLVLVCPYHHRLHHRGIITITGPASKLTVTDATGRRLESGSLARQ
PNQPPPQVPPYRGPSGERADWWWYTPFQPPPPTTN
108801967YP_642164.1 cell wall arabinan synthesis protein [Mycobacterium sp. MCS]MPAHRFVRLIAVIAGLAGVVLCALSPLLPVRQTTATILWPQAPAEDGFVG
DLTAPLVSGAPLALDVTIPCRAIATMPADGGLVFSTIPPGGIAAGRNGLF
VRANADDVVVAFRDTVAAVAPRPAIAAGACSELRVWANVGSVGADFVGIP
GAAGTLSLDKRPQVAGIFTELEVAPQPGAAPAATSEPRLTARIDVDTRFI
TSPTLLKLAVMTLGVLCVIASIIALAVLDRRAGRGVPGAWRRRRVGLSTW
LADIGVVGALLVWHVVGAQSSDDGYNLTIARVSDEAGYTANYFRYFGATE
APFDWYQSVLAHLASISTAGVWMRIPATAAAIATWLIISRCVLPRLGRRL
AANRVAVWTTAAVFLAAWLPFNNGLRPEPLIAFAVIAVWMLVENTIGTRR
LWPAAVAVVIAMFSVTLAPQGLIALAPLLVGARGIARIVSARRAVDGVAV
AVAPLAAAASLLFVIVFRDQTLATVAESVRIKYVVGPTLPWYQEFLRYYF
LTVEESVDGSLTRRFSVLILLLCLFGLIVLLLRRGRLPGTFGGPVWRLAG
TTAIGLLLLTLTPTKWAVQFGAFAGLAGALGGVTAFAFARVGVNSRRNLA
LYVTALLFVLAWATSGINGWFYVANYGVPWFDKQPVIVGYPVTTIFLVLA
IAGGILAGWLHFRIDYAGHTEVADTGRNRALASTPLLVVATIMVVLELGS
MVKATVGRYPVYTIGSANAAALRSGLSDSSCAMADHVLVEADTNAGMLQP
VPGQRFGEYGPLGGEDPVGFTPNGVSDTLEPAEPVAANPGTVNSDGPVDK
PNIGVGYAAGTGGGYGPEGVNGSRVFLPFGLDPDRTPVMGSYNEPGSDQA
GVAAEATSAWYQLPPRTPDRPLVTVAAAGAIWYYEEDGSFNYGQSLKLQW
GVHRPDGSYQALGEVQPIDIVQQKAWRNLRFPLAWAPPEANVARIVADDP
NLSEDQWFGFTPPRVPVLQTASEFLGSQTPVLMDIATAANFPCQRPFAEH
LGVAELPEYRILPNFKQVVTSSNQWQSAEDGGPFLFIQALLRTATIPTYL
SDDWYRDWGSIERFIRVVPRDEAPNAVIEEGSKRVFGWNRGGPIRALP
108801965YP_642162.1 hypothetical protein Mmcs_5002 [Mycobacterium sp. MCS]MVVAALIAAAVAVVSLAAIARVEWPAYNSSNQLHALTTVGQFGCLAGLFA
AGWIHRRGRRLLAHAASMVFLAAFAVVTLAMPLGATRLYLFGISVDQQFR
TEYLTRFADTAALHDMTYYGLPPFYPPGWFWLGGRLAALTGTPAWEMFKP
WSIISIAVAVVLAFVLWAAMIRFSYALIVTTATTAVMLAYSPAEPYAAII
AVLLPPVFVLAWSGLRAEGRGWGAIVGVGLFLGVAALFYTLLLAYAAFTL
VIMAVVAAVAHRSAGPLLRLLVIAVISGAIALIGWAPYLLAALRGTPADT
GTAQHYLPADGAQLSFPMLSFTLLGALCLVGTVWLVVRARNSTRAGALAV
AVLAVYAWSLLSMLTTLAGTTLLSFRLQPTLVVLLSAAGVFGFVEAARGL
ADSFSSRRLLVAAGAIGAIGALTFSQDIPDVLRPDIAVAYTDTDGYGQRA
DRRPPGAERYYREVDAAILEATGRPRNETIVLTADYSFLSYYPYYGFQGL
TSHYANPLAQFDQRAKAIESWQTLGDADRFVAALDELPWDPPTVFLMRRG
SEDSYTLRLASDVYPNHPNVRRYQVKLDAALFDDPRFEVSEIGPFVLAIR
QPVDG
108801963YP_642160.1 FAD linked oxidase-like protein [Mycobacterium sp. MCS]MLQTTTRRLTGWARTAPSVAEVLSTPDPEEIAKAVARVADDPQRGVIARG
LGRSYGDNAQNGGGLVVDMTALNRIHTINTDTALVDVDAGVNLDQLMRAA
LPLGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRSMELLTAD
GTVRTLKPRGKDADLFWATVGGNGLTGIILRATIAMTPTETAYFIADGDV
TADLDETIAIHSDGSEANYTYSSAWFDAISPPPKLGRAAISRGSLATLDQ
LPKKLRRNPLKFDAPQLLTFPDVFPNGLANKWTFGPIGELWYRKSGTYRG
KIQNLTQFYHPLDMFGEWNRAYGSNGFLQYQFVVPTEAVDEFKAILVDIQ
RSGHYSFLNVFKLFGPGNKAPLSFPIPGWNVCVDFPIKPGLGEFVSGLDH
RVLQFGGRLYTAKDSRTTAETFHAMYPRIDEWIAVRRRVDPDGVFASDMA
RRLELL
108801961YP_642158.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MIRPGARGVRELLVNALREAVRSGRLAAGTVLPPSRTLAADLGIARNTVA
ESYAELVAEGWLASRQGAGTWVVNSQAGHQIARPRRVRSTARHNLMPGSP
DVSEFPRSAWLASARRALTNAPSEAFWMGDPRGRPELREALADYLARVRG
VRTSPETIVICAGVRHAVELLTRALGAQRPIAVEAYGLFIFRDAIRALGG
STVPIGLDGHGAVIGDLDGHDVPAVLLTPAHHNPHGMPLHPTRRTAAVEW
AQRRGAYVLEDDYDGEFRYDRQPVGAMQSLDPERVVYLGSASKSLAPALR
LGWMALPDALVEPVLAAAGGNQFFVDALAQLTMADFITAGHYDRHIRRMR
MRYRRRRDRLVDALAPFDVEIRGLAAGLNALLTLPDGAEREVLQRAGNAG
IALVGLSAMRHPAAGPAVADPDGVIVGFGAPADHAFAAAVEALCDVLEAT
LR
108801959YP_642156.1 hypothetical protein Mmcs_4996 [Mycobacterium sp. MCS]MQTGSGAEITFDGDVVAKLHRPGTDPRALRIRLGVAQELRGILLAPLTVV
PGQVGHRWQSRWPRVETVAPQPDQLPWAEAGALLARLHAQPVTARLPHGW
PARLRRVVERHRTAEVAEPVRTALTGLPPAVWRAGSPDRPRTYVHGDFHL
GQLGRRAPGLPWVLMDVDDLGVGDPAWDLARPAGFWAAGHVPDGDWAAFV
GAYRHGGGAALVDAPDDPWPVLDPFARAAVVAAAAHHPDDELLAAACERM
V
108801957YP_642154.1 hypothetical protein Mmcs_4994 [Mycobacterium sp. MCS]MELRLRPYATAGVALVGASAIAMAPLAPPLPDVKIASPSVNLSADIDPFT
PWVNVFENAETNIADLIDDWAEAPFPVLQQVIVNQLGYFSELPDFELIAG
QVIANFEAAAAVLYEQDLSTLNAEHAGIYQLLLNGAPPVLPPFLPPELAP
LIAFTTTSLSGVLLGLVGPVIAPVLALSASIQAIVGNLTSAEPDLGAAFN
TLINIPAGMADAFLNGGQTLDITPLVSLLGSDLLPAGTEVGITFGGLLSP
GGSIFNALDLAVPLDDILGIPLTLQIPGQGPGAIGSLINLSQAIAKALGW
DGTGNPLHEEEDAPAPLSEPNAADDLSLLRASTTTITVPETTDVDAGKTG
DVTPSTDGAAAVDTTVGSGAPTEVEQVKVEDNLPAVLDEETDTTPEKPAT
KRVNPGTKIAGALKSAGDQLNSAVNDLGKKLTKRPSKKAPAADNEKASAP
EKDTSTDKAPAASE
108801955YP_642152.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MTDRIYVVVVTHRRPESLAQSLDALCAQTRRPDGLIVVDNDSESRVRELV
ASQPIPSTYLGSRRNLGGAGGFALGMLHALAEGADWVWLADDDGRPLDPS
VLGVLLDCATRYGLAEVSPMVCNIDDPERLAFPLRRGLVWRRRVSELGEG
ELLRGYASLFNGALFRASTIEAVGVPDLRLFVRGDEVELHRRLVRSGLPF
GTCLRATYLHPCGTDEFKPILGGRMHTQYPDDATKRFFTYRNRGYLLSQP
GLRKLLPQEWVRFGWYFLVSRRDPAGLREWIRLRRLGREERFGRPGT
108801953YP_642150.1 hypothetical protein Mmcs_4990 [Mycobacterium sp. MCS]MTLNNDDDNIEIIGGDAHADDPADGGDGKSLTDLVEQPAKVMRIGTMIKQ
LLEEVRAAPLDDASRNRLREIHHTSIQELEEGLAPELREELERLTLPFTE
DSVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGAL
PPGIAVQGQRGGPAHPGTGQYL
108801951YP_642148.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MQAIVAESPAKLIWTEVPERPLQSGDVRIDVVAAGINRADLLQAAGKYPP
PKGASDIMGLEVSGVISDVADDVSGWAVGQPVCALLAGGGYAENVTVPAG
QVMPVPESVDLAHAAALPEVACTVWSNVVMTAALAAGEVLLIHGGASGIG
THAIQVANALGCRVAVTAGSANKLDLCRELGAEVAINYRDEDFVERLRAE
TDGAGADVILDIMGAAYLDRNVDALATGGRLAIIGMQGGVKAELNIGKLL
AKRASVTATALRSRPVSGPGSKSDIVAEVVANVWPMVADGRVRPIIGAEF
PVQEAQAAQEMLDSGEVSGKVLLRVRD
108801949YP_642146.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MGDTYESVTIETDGHVAQVTLIGPGKGNAMGPAFWAELPDVFTSLDADPD
VRAIVLTGSGRNFSYGLDLAAMGGTLPGLDAGARSRADFHKTLQKMQGAI
SAVADCRTPTVASVHGWCIGGGVDLISAVDIRYASADAKFSVREVKLAIV
ADVGSLARLPLILTDGHLRELALTGKDIDAARAEKIGLVNDVYDDPEASL
AAAHATAKEIAANPPLTVHGVKDVLDQQRIARVSESLRYVAAWNSAFLPS
KDLGEAVTAMFQKRPPNFTGE
108801947YP_642144.1 hypothetical protein Mmcs_4984 [Mycobacterium sp. MCS]MRSDLPQGPDSPPTDELRSAELSLGVLHQVVRSIAEDDLGKQTPCSEFDV
AGLTEHLVRSITILGGAAGAEMPERDPSDSVERQVILAARPALDAWHRRG
IDGAVDVGGTTMPATVLVGILSLEFLVHAWDYATAIGHTVPAPDSLSDYV
LAMAEKIVTPQGRARAGFDDPVEVPDDAPPLQRLLAFTGRRAEV
108801945YP_642142.1 putative aminotransferase [Mycobacterium sp. MCS]MTARLRPELADIPAYTPGKTVPGAIKIASNETVHGPLPSVRAAIEKATDQ
LNRYPDNGYLELREHLASHLDKNLGAGAFTPEQIAVGCGSVSLCQQLIQI
TSSVGDEVIFAWRSFEIYPLQVRTAGATPVQVPLRDHTHDLDAMLAAITD
RTRLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVIDEAYVEYIRGDQ
VPDSFGLVRAHPNVVVLRTFSKAYGLAGLRIGYAVADADIVTALGKVYVP
FSATSISQAAAIASIDAADELLARTDQVVAERDRVTAALREAGFTLPPSQ
SNFVWLPLAERTLDFVRRAAENRLVVRPYGEDGVRVTIAAPHENDAFLEF
ARNWIGQP
108801943YP_642140.1 cutinase [Mycobacterium sp. MCS]MRVRQFGRVLGAVAVTTWASLVGVATPSASAQACPDVEIVFARGTGEAVG
VGGVGQAFVDAVRAQAAPRTVNVYAVNYAASSNFDARDELARTVVEGIRD
AGNRVQTIATTCPDTRIVLGGFSQGAVVAGFVTSSTVPDAVPASYRNAVP
QPLAAEVAEHVAAVTLFGLPSPQWLGTYGSPPVVIGPLYAPKTLQLCAEG
DTICDGTPGGGPSIAHALYGINGMTQQGATYAVDRL
108801941YP_642138.1 hypothetical protein Mmcs_4978 [Mycobacterium sp. MCS]MRLLLISDTHVPKRARDLPAAVWDEVARADVVIHAGDWVEPGLLDALEER
ATRLVACWGNNDGDELRRRLPERADVTLDGVRFTVVHETGASGGRDARMA
KLYPDTDVLVFGHSHIPWDTTAATGLRLLNPGSPTDRRRQPHCTYMTATI
ADGALGDVVLHNLVPTSVDRRG
108801939YP_642136.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium sp. MCS]MTSSPGWPPRPRSPSPTPHPVRIRTGSRRKNSIPTSSCCSGRPAIWRNAN
SCPGWPTWSSPRWRPRSGWSARHWRTSAATSSGRWREAVDAFGSHELSDE
EWEGFACRISYVPQSAGPEALADAVKAAKAELGPDTRRLHYLSVPPKAAK
AVITMLKESGLVDRSRVVMEKPFGTDLASACELNAFVHDTFDESQIFRID
HFLGKEAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPEKLGLDERADFY
ESTGAYKDMVVTHLFQVMAFVVMEPPTALEPRAISEEKNKVFRSMLPVDP
AKVIRGQYVGYRREDGVAPDSETETFIALQVGIDNWRWAGVPIYLRTGKK
MAEGQRIISIAFREAPRSMFPAGSGVGSQGPDHLTFDLADNSKVSLSFYG
KRPGPGMKLDKLSMQFSTQETGRVGDVLEAYERLILDAMRGDHTLFTTAA
GIESLWDRSTPLLEDPPPVKVYQPGTWGPNAIHQLIAPNAWRLPFEREWR
EKTPE
108801937YP_642134.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MGSALTRAAAGAGHRVIAWNRTPHRATALRSAGVSVAGSVAEAVESAEIV
VVCLFDHESVRRVLDPVADRLAGRRLVNVTTTTPDAARELADWSADRGAD
YLDGGIMAVPSMIGTPGSSVYYSGSRAVFDGCGELLETWGAAEYFGDDPG
LASLHDLALLSAMYVMFAGFFHGAAMVATAGTSATEFAGRAAAWLQALLP
ALAEYAEFIDGGDYRRPGQQSLEFSDISEIVEASGAAGISTEVVDTVQRL
IRRQIDTGHGAEGFARVIESIRNPLGAA
108801935YP_642132.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MDSKPPSDAIQAAHRHHLSTLPFTDRADFDDADRGFIAALEPCVVAAADG
RVVWDNDVYAFLDGEAPASVHPSLWRQSQLAAKQGLYEVVEGIYQVRGLD
LSNITFVEGDTGVIVIDPLISTETAAAALALYRQHRGDRAVTAVIYTHSH
VDHFGGVLGVTSQADVDAGKVAVLAPEGFVEHAVQENVYAGTAMARRATY
MYGTLLARGPRGQVGCGLGQQTSTGEVALVVPTLDIRETGEAHTIDGVEI
EFQMAPGTEAPAEMHFYFPRYRALCMAENATHNLHNLLTLRGALVRDPHA
WSGYLTEAIDTFADKADVVFASHHWPTWGRDRITEYLSLQRDMYAYLHDQ
TLRMLNQGHTGIEIAEQFQMPPALERAWHTHGYYGSVSHNVKAVYQRYMG
WFDGNPGRLWAHPPEALAARYAEVLGGVDRVVELARKACDEGDFRWAATL
LDHAVFADQNHTEARQLYADTLEQLAYGAENGVWRNFFLSGAAELRDGNF
GTAVQSTSPTLLSELTPAQMFDSLAISINGPRAWDLDVAVDVTFLDTGDN
YRLTLRNGVLVHRKVSADESSVQATIRLANKVRLLAYAAGDTTSPGVEIT
GDEAALANIVGVLDRPDPAFDIVMP
108801933YP_642130.1 phosphoglycerate mutase [Mycobacterium sp. MCS]MQLLLIRHALPLRSEPGQGSDPDLSEDGIEQAKRLPDALTRFPIARLVSS
PQRRAVQTAQPVAETLGLTVEVDERLAEYDRDLPHYIPIEQIAKENPQEL
ERLMSGRLPSGVDEDAFMARIFAAVDDLVASAEREDTVAVFSHGGVINAL
LHRVLRTERLLSFNVDYASVTRLLWSSRANQLAVASVNGTEHVWDLLPRN
LRW
108801931YP_642128.1 hypothetical protein Mmcs_4968 [Mycobacterium sp. MCS]MTTDPYGPSAGREPEPYDQPNPGPPVPGDYEVADRQPPDLKKVHFTRAAA
VWTSVIVGLLILIVLLIFIAQNTESAAMAFLGWRWNLPLGVAILLAAVCG
GLIASLAGAARLFQLRRAAKKNYKAAMR
108801929YP_642126.1 ABC transporter-like protein [Mycobacterium sp. MCS]MITFEHITKRYPDGTVAVDDLSLEVPEGTLTVFVGPSGCGKTTSMRMINR
MIEPTSGTLTVDGNDVTKVDAVKLRLGIGYVIQSAGLMPHLRVVDNVATV
PVLRGESRRSARKAALAVMERVGLDPKLGDRYPAQLSGGQQQRVGVARAL
AADPPILLMDEPFSAVDPVVREELQTEIVRLQNELRKTIVFVTHDIDEAI
KLGDKVAVFGRGGVLLQYDAPARLLSNPADDAVAGFVGADRGYRGLQFYP
ATGTAGLPLHDLRHVRESEIDALQLAPGDWVLVTRPDGTPYAWINADGVA
LHRNGSSLYDSTIAGGSLFRPDGTLRLALDAALSSPSGLGVAVDEHGQVI
GGVRADDVLAALDRQRQEA
108801927YP_642124.1 binding-protein-dependent transport system inner membrane protein [MycMNFLSEALSFIFTAANWAGPAGLGARIVEHLEYTVIAVVFSALIAVPLGM
IIGHTGKGTFLVVTGVNALRALPTLGVLLLGVLLWGLGLVGPTVALMLLG
IPPLLAGTYSGIANVDPAVVDAARSMGMTERRVLLRVEVPIALPLILGGL
RTATLQIVATATVAAYASLGGLGRYLIDGIKVREFYLALVGALMVTALAL
ILDGLLAFAVWLSVPGTGRWRRAARMPQPLLGDEVALESRSRGGSRSTSV
AGYEPASASPTVEG
108801925YP_642122.1 prephenate dehydrogenase [Mycobacterium sp. MCS]MCVLGLGLIGGSVMRAAAAAGREVFGYNRSVEGVQGARFDGFDASEHLDE
VLGRAAETSALVVLAVPVPALGLMLGHIRDAAPQCPLTDVTSVKGAVLEH
VRSFGLQERFVGGHPMAGTAHSGWAAGDAALFVGAPWVISVDDHVDPDVW
AHVMTLALDCHAVVVPARSDEHDAAAAGISHLPHLLAEALAVTAGEVPLA
FALAAGSFRDGTRVAGTAPDLVRAMCEANSSQLVPALDRSIELLTAAREA
LARHGSVADLVESGHAARMRYDSFSRPEIITTVIGEENWRDELAAAGRAG
GVIRSALPTRDSRR
108801923YP_642120.1 tRNA-adenosine deaminase [Mycobacterium sp. MCS]MTSDESLIRAALDAAALAGPRDVPIGAVVFGPDGTELARAANAREALGDP
TAHAEVLALRAAAAVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARVV
FGAWEPKTGAVGSLWDVVRDRRLNHRPGVRGGVLADECAKPLEAFFARQR
108801921YP_642118.1 hypothetical protein Mmcs_4958 [Mycobacterium sp. MCS]MFKSTSSKLSGVNYAAALLGAFAVFALAPATAAALPPGNTTGNTGCHYTD
KDGYDIPIDDGQSVVVDGKTVTCSGGTITVSQANTGGVRPQRIPNLQVFE
AQKPVLAQAR
108801919YP_642116.1 hypothetical protein Mmcs_4956 [Mycobacterium sp. MCS]MKLVAVLALAGGVLAAPLVTASPAAAVPCNSADCVQYVDRNINPSESCVS
GGSRYLFGLDASGNTYLCNAQRAWVPQPPLVGVRTQGAPCDGSTGVAQSP
DGLPLGCQRGGWLPDFTAFYY
108801917YP_642114.1 glycerol dehydratase [Mycobacterium sp. MCS]MRILDAKPVNLDGFSVTDPALGLVAMHSPHDPQPSLVVRDGRVVELDGRP
AADFDVIDEFIARYGIDLTVAEEAMALDDAVLARMAVDVNVPRAEVVRLI
GGTTPAKLARVMAVMTPVEMQMAMHKMRARRTPSNQAHVTNQLDDPLLIA
ADAASAVAYGFREVETTVPVFGDAPSNAIALLIGSQVGVPGAMAQCSIEE
AMELRLGLRGLTSYAETISIYGTEQVFVDGDDTPFSKAILTAAYASRGLK
MRVTSGGGAEVLMGAAEKCSILYLESRCVSLARALGSQGVQNGGIDGVGV
VASVPEGMKELLAENLMVMMRDLESCAGNDNLISESDIRRSAHTLPVLLA
GADFIFSGFGSIPRYDNAFALSNFNADDMDDFLVLQRDWGADGGLRTVSR
EHLARVRRRAATAVQAVYRDLGLADFDDTRIDAVVVANDSRDLPAGDPKA
VAEAATAIEARQLTVFDVVAALHRTGYAPEAEAIMRLTRERLRGDQLQTS
AIFDDQFQVLSKITDPNDYAGPGSGYTPTEKRRAEIDGIRQARTSAELTA
DQAEHRGHVVFSDVEPAHQGSDPREVCIGLSPALGRSVWLTLCGLTVGEV
LRQLSAGLEEEGCVPRLVRVRSTIDVGLIGLTAARLSGSGIGIGLQGKGT
ALIHRRDLAPLANLELFSVAPLLTAKMYRELGRNAARHAKGMAPLPILAG
GTDESISARYHARAVALVALERQACEPGQAPITVEAKRV
108801915YP_642112.1 hypothetical protein Mmcs_4952 [Mycobacterium sp. MCS]MSRDSVVVAGCDVGNHTTEIVLARVAADGVVEPLTHGQAPTRGRKGSTES
LEGAAALLNRLEVEARVRVDEVVLATIRPVDTATAPLAPAVSPRAPVRSL
RRPDASTPAGAGHGVGTHVPLADLSGPVHPGPVIVSVSAATDFEVAAQAI
GDGVASGWKIAGVLVAQDDAVLIRNRIPIDVPVVDEVELDGLRRGALVAV
EVVAEGRAYRALADPIALSAALQLGHDRLLDVAEFTRELADAPAIAVTAR
TEPPDPPAVDDDYVDCRIGGEIVRYAPAAAHTVLRLEPPGCAVEVRLSAL
PAAENGIAVDDAFFTDLASIDNGAWLRRGVADARGTVVALLAAEPVTDAA
ATLSGLTGRPARTVAGEPAAAARGAQTTPGLPPGSVVCDIGGGTVDLIGQ
GRTVTAAGAGETITTAVSRVLGIPRALAERVKRTPALRVEGPHVAHEEDG
RRVFLDSPASADAIGRLCTRGSAGLVPFSHRLAAEEWRSLRLAIKQQTVA
ANIARCLATFDEPPSALVLAGGGALDDELLRTVGESLRPARVVVGRADID
GVHGPRFAVASGLVHLYAEDRVGSTSPA
108801913YP_642110.1 lipoprotein [Mycobacterium sp. MCS]MSVGGAAIVIAGLAGCSSDSGSSESTTSAESSDTATASASAEATSAPGAA
KVVIDGQDQNIQGTVACTSMGGNLNIAIGQATTGIGAVVTEADPPTVQSV
GLGNVNGVTLGFQQGTGQGNAEVEKDDKTYNIKGNATGVDMANPLQPVTK
PFEIEVTCP
108801911YP_642108.1 queuine tRNA-ribosyltransferase [Mycobacterium sp. MCS]MDQQFFTVEAELPGRRGRAGVIRTPHGEIRTPAFIAVGTQATVKAVLPET
MRELGAQAVLANAYHLYLQPGPDVVAAAGGLGAFMNWPGPTFTDSGGFQV
LSLGAGFRKVLAMDANRVQADDVIAKGKERLAVVDDDGVTFRSHLNGTTH
RFTPEVSIGIQHQLGADIIFAFDELTTLVNTRGYQEDSVRRTHRWAERCL
AEHRKLSLENHEKPPQALFGVVQGAQYEDLRRQAARELTEILDEDGRGFD
GYGIGGALEKQNLATIVGWVTSELPDDKPRHLLGISEPDDLFAAVEAGAD
TFDCVSPSRVARNAAVYSATGRYNITGSRYRRDFTPIDAECDCYTCAHYT
RGYIHHLFKAKEMLASTLCTIHNERFVVRLVDQIRASIVAGNFDELREHV
LGRYYAARGQ
108801909YP_642106.1 saccharopine dehydrogenase [Mycobacterium sp. MCS]MRILLVGAGGVGSAFCAIAARREFFEQIVVCDYDEARARRAAEAVGDARF
VAAQVDATSADAVAALVREHAITHVMNAVDPRFVMPIFNGALAGGADYLD
MAMSLSRRHPEQPYELTGVKLGDEQFAAEADWSAAGRLALVGIGVEPGLS
DVFARYAADHLFSDIDELGTRDGSNLTVDGHDFAPSFSIWTTIEECLNPP
VIWEDGRGWFVTEPFSEPEVFDFPDGIGPVECVNVEHEEVLLMPRWVKCR
RATFKYGLGAEFIDVLKTLHKLGLDRTDTVTVGSGKGPVEVSPRDVVAAC
LPNPATLGPNMRGKTCAGLWVTGTGRDGNPRSTYLYHVVDNEWSMAEYGH
QCVVWQTAINPVVALELLANGTWSGAGVLGPEAFDAVPFLELLTAYGSPW
GVKELTP
108801907YP_642104.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTHTPRRRMSGADRRAQLLDIARDIVAADGFTALSIDRIAHTAGVTRTVV
YQQFTDLAGVMTALLDRESAIAFAGLRSVDWERAEPDADRLGRGILAYLQ
AAPVSWRIFLRPPDGAPPQVRARIELGRAYARGVAARHMSRALGTAVDPD
GPTQRILLAAIEELALLHLEDPAGCPDETVVSYLRSLLWWAERAEITAG
108801905YP_642102.1 amino acid ABC transporter permease [Mycobacterium sp. MCS]MRFLRALLLLLAVLTVASCASADDGSDEPIKSAGVLRVGTEGVYAPFSYH
DASGQLVGYDVDVARAVADKIGVRAEFVETPWDAMFAALEAGRFDVVANE
VTINAERRAKYDLSQPYSVGEGVIVTRADDDSITTLDDLAGKVAAENATS
NWSEVAREAGARVEAVEGFTQAITLLNQGRVDVVVNDSIAVYAYLAETGD
TSVKIAGTVGEKSEQGFAARKDSGLLPELNRALDELRADGTLAEISQRYL
KANASGAPESDQADTAGAPRSTWQLILDNLWPLARAALTMTIPLTVISFA
IGLVIALGVALARLSPNVVLTNVARFYISIIRGTPLLVQLFIVFFALPEF
GIRIDPFPAAVIAFSLNVGGYAAEIIRSAILSIPKGQWEAAETIGMNYPT
SLRRIVLPQAARVAVPPLSNTLISLVKDTSLASTILVTELLRQAQIVAAP
TFEFFALYGTAAVYYWVICLVLSFGQGRIERRLERYVAR
108801903YP_642100.1 fatty acid desaturase- type 2 [Mycobacterium sp. MCS]MAKDLTQVQLLTELEPVVEANLNRHLRMRKDWNPHDFIPWSDGKNYYALG
GQDWEPEQSQLSEVARTAMVQNLLTEDNLPSYHREIAMNFSLDGAWGQWV
NRWTAEENRHGIALRDYLTVTRAVDPVELEELRVEQMTRGFSPGQNGQGE
EALFARSLFDSVIYVSFQELATRVSHRNTGKACNDPIADQLLQRISADEN
LHMIFYRDVSEAGFDIAPDQAMHSLHHVLRNFKMPGYTVPDFRRKAVVIA
VGGVYDPRIHLDDVVMPVLKKWRIFEREDFTGEAARMRDDLGVLVEELEE
TCEKFETAKQRRLEREAKMAENRAAKQAAKQAVSV
108801901YP_642098.1 glucose-methanol-choline oxidoreductase [Mycobacterium sp. MCS]MASYDYIITGAGSAGCVLANRLSEDPRLNVLLLEAGGGDRNLWFHIPKGS
GKLFESEKHMWHYETTPFGPDQHVEQWMRGKALGGSSSINGLLYNRGNRA
DYDGLERLGNKGWGWDEILPIFKGFENNEFGPSATRGTGGPLNISVPRDP
DPLCEEMIDAATRIGMSRVEDINESDAERIGYATSTIRKGRRVSAATAFL
KPAMRRPNLTVRTGALVHRVIIEGGRAAGVEVTTPSGVERLRATREVIVS
MGSLNSPKLLQLSGIGPREVLSAAGVEVRLERDNVGRGLREHRCATLRYG
LNEDLGYNRYLATSMGQALTGMKYLATRKGPLAAPSFDVVGFVKTRPDEE
RPDGQVMMGPYTLPPYNVGEPVSIQREPGVSCLGMVLRPTSEGYIEITSA
DPAAALRINPNYLGTDYDRETTAGLLRRMRAIFEQSPIAGRISHETYPGP
GVQSDDQLVDAALDGGYCGYHAVGTCAMGPSDHDVVDHQLRLRGVDGLRV
VDCSVMPTIVAGNLNGPIMAMAWRAADFILHGC
108801899YP_642096.1 cytochrome P450 [Mycobacterium sp. MCS]MSTRPDQAVSYHFDRHSQDYRERFLDITHEMHRKCPLAWTDTYDGHWVAA
GSAEVFELARCPHVSNDHDVHHERRGYKGISIPTMIEAENFRGGMLEMDD
PEHRHYRTVLNPYLSPAAVKRWEPFVDELVRACLDDHIESGRIDFVDDLA
NVVPAVLTLAMLGVSLEKWSIYNEPAHASVYTPPDSPDAERVRELFMAMG
VDLFANLMEIRANPRPGIIDALATIRIDGEPPPDIELIGMLNLLIGGGFD
TTTALTAHALEWLSEHPDERTRLSRERDTLLNPATEEFLRYFTPAPGDGR
TIAEDMALGDAELREGQRLWLSWAMANRDPAVFTEPDRIVLDRKGNRHFS
FGLGVHRCIGSNVARTVFKSMVTAVLDRMPDYRCDPHGTVHYDSIGVIQG
MRHLHATFTPREPKGPGVAETLARLQRICDEQGLARPITELKGAARIEES
E
108801897YP_642094.1 luciferase-like protein [Mycobacterium sp. MCS]MRIGLTGGGSSVDKIVAHAQRAEADGFSSLWYASAVGGDPLVAMAIAGRA
TGSIELGTAVLQTYPCHPLLQANRVAAAANAMGRPGLTLGLGPSHEPIVR
DVLGLSYDHPARNTREYLRIVSGLLAGVEVDFDGTDWSTHSAGRMAALDH
RVPVLLSALSPRMLRIAAEFADGVVLWMASASAIAGRIAPVLREAANAQG
KPAPRIVAGLPVAVHDDADEARAAISATASSYERMTNYQNIIRAGGGERA
ADVGIVGDEGAVARQLAELIDAGATDVWAQPVAVGADRAQLSASLKRTRG
LLSELARAG
108801895YP_642092.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MSDRFSMEGRVAVITGGGTGIGRASALVLAERGADVVLAGRREEPLKATA
ADVEALGRRAIAVPTDVTKADQCQALVDAALGEFGRLDVLLNNAGGGETK
SLMKWTDEEWHEVLELNLSSAWYLSRAAAKPMIAQGKGAIVNISSGASLL
AMPQAPVYAAAKAGLNNLTGSMAAAWTRKGVRVNCIACGAIRTPGLEADA
KRQGFDIDMIGQTNGSGRIAEADEIGYGVLFFASDASSYCSGQTLYMHGG
PGPAGV
108801893YP_642090.1 luciferase-like protein [Mycobacterium sp. MCS]MPAALLHSQQRMWDPLLSLLVAAQATSTLRLGTAVALPLEHELFTFAKQV
ATLDRFSGGRVLLGVGVGVRAELAMTNSIAWADRYRALSDMVAALRVLWT
EDEACHHGEFYDFDPVWSHPKPQQQPGPPLLAAATGPKAIGECLSWADGW
LPGDAAYRDLSAAVHDFRVRAEDAGRDPATLDLTVMAWGDPSANRLARYR
DLGFTRVVVGGGRRDGDDPSTTLPFLDRYAALVSELR
108801891YP_642088.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MTTHDPRTLKEKDMSVLRDELVPSRYAVQIGDIEVLVISDGVLPITASTL
ATNVDSADLTGWLDDMFLPPDVLDWPLNVVVVRSGDRTILVDAGLGVEFP
DFPRAGQTATRLEAAGIDLESVTDVVLTHLHMDHVGGLLTEGLQARLRPD
LRVHLAAREAEFWTAPDFSRTCMPQPVPGVLRSVAARFLDEYHGRLRTFE
TEYEVAPGVLVTRTGGHTPGHSVVRLASRGEGLTFAGDAVFAPGFDNPQW
HNGFEHDPEEAARVRIRLLRELAATGESLVATHLPFPSVCRVATAGDVFR
CVPAVWDY
108801889YP_642086.1 transposase IS116/IS110/IS902 [Mycobacterium sp. MCS]MTTGQVWAGVDVGKEHHWVCAVDDSGKVVLSRRLVNDEQPIRELVAEIDE
LAERVSWTVDLTTVYAALVLTVLADAGKTVRYLAGRAVWQASATYRGGEA
KTDAKDARVIADQARMRGQDLPVLHPDDDLISELRMLTGHRADLVADRTR
TINRLRQQLVAVCPALERAAQPSQDRGWVILLARYQRPKAIRQSGVSRLT
KVLTDAGVRNAASIAAAAVAAVKTQTMRLPGEEVAAGLIADLAREVIALD
DRIKTTDADIEGRFRRHPLAEVITSMPGIGFRLGAEFLAAVGDPALIGSA
DQLAAWAGLAPVSRDSGKRTGRLHTPKRYSRRLRRVMYMSALTAIRCDPD
SKAYYQRKRDEGKRPIPATICLARRRTNVLYALIRDNRTWQPDSPPVTAA
A
108801887YP_642084.1 nitroreductase [Mycobacterium sp. MCS]MDVYEAVTSRRAVRGFTDEPVPRETLERVLAAASWSPSGSNLQPWRIYVL
TGEPLARLKKHAVDRVSAGVPWDDREFEMYPAALESPYRDRRHDFAEQRY
GALGVVREDWEARRRAAIGNWDCFGAPAALFCYIDRGLGLPQWADLGMYL
QTVMLLLRAEGLHSCPQMAWSTTRHTVAEIVEPDEGLILFCGMSIGFEDR
SVGYARTGRAPLSETVTFIADS
108801885YP_642082.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. MCS]MKVIESEDIDCTADLKARFAADVWPLVDVLLRGARRLTHNDADAEDLLQE
TLVRAYTGFHNFQPGTNLQAWLFRIQYNQWVSAYRWKERRPAEVLSDEMA
DFGVHLSTGLRSAESEVIDSLPDDGVREALGQLSEGFRTVLYYADVEGYT
YAETAALMGIPIGTVMSRVSRARVQLRRLLADSSCARGRFASGSSQAA
108801883YP_642080.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MKLSGRVALVTGGASGIGRATAGRLAAEGMRVCVLDIDGPATEAVAESIG
GIGLRCDVTDPEQVDSAFDTCVAELGGVDVAFLNAGITIDWSGDIGALDL
AQYRKSVGVNVDGVVFGVRAAVRTMRTLDPGVDRAILATASLAGLMPWHP
DPVYSLGKHGVVGFMRSIAPNLAAEGIAVHTICPGITETGVLGDRRSLVE
RIGVPVMEPEMIADAVLLALGAPMSAAGTCWVAQHGKPAWPMAFAPVDSP
DSRLNVPVRAR
108801881YP_642078.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MATSSRRVGAETSKTRDTLLDCVETMMLEEGYASVTYRALAAKAGVTPSL
VQYYFPTLDDVFIAAIRRYSERNLAYLNKVMEKRADDPLRALWEYSWDEA
TGTLMTEFMALGNHRKSIRTEIAAVTESVRRLQLDALVAKFGEDARPWGD
LSLPALQLLISSLPKFLNLEKGVGVETAHAELTEAFERYLDSIEPAPKRK
PATRKRSR
108801879YP_642076.1 ATP-dependent DNA ligase [Mycobacterium sp. MCS]MDTMDLPVMPPLEPMLAKAQAKVPTESGVWSYEPKWDGFRALVFRDGDDV
VLMSRSGKDLARYFPEVLDFVRDELAPRCVLDGEIVVPREIGGRTRLDWE
SLSQRIHPAESRVRKLSEETPAHFIGFDALASGDTSLMKEPFRARRQALI
EAVSHKQWCHVTRTTEDPGLGAQWLEEFEGAGLDGVIAKRLDGSYLPGKR
EMVKVKHARDADCVAIGYRIHKSGEGIGSLLLGLYTDEGDLQMVGGAASF
TAKDRLKLLAELEPLREGDEVREGDPSRWNSAADKRWIPIRPERVAEVAY
DQMEGNSVQGRRFRHAVKFRRWRPDRDPASCTFDQLEVPLTYDLFDVLET
QDG
108801877YP_642074.1 dihydrodipicolinate reductase [Mycobacterium sp. MCS]MPNTPYRVVQWTTGNVGKSSVAAITTNPNLELVGCYAWSADKAGRDVGEL
AGIEPLGVTATNDVDALLALKPDVVVYNPMWIDVDELVRILEAGVNVVAS
ASFITGHNLGDGRARLVEACERGGATLFGSGVSPGFAELLAIVAATACDR
VDKITIAESADTTLYDSPDTERPVGFGTAIDDPNLEPMAATGTAVFAEAV
QLVADSLGVELDEIKCVSEYAQTTEDLAMASWTIPAGHVAGVYASWQGIL
GGKTIIDINVRWKKGTTLEPDWQLDGDGWKITIDGRPTVNMAVGFLPPQD
MIENAKTLEDFFVLGHIMTAMPPIHAIPAVVAAEPGIATYTDLPLPQARG
VVPT
108801875YP_642072.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium sp. MCS]MGMLRTRWLSVLSVVLAALLALVGPFSPATSSAAPADPIAAAATVEPAVA
RIDTEIDYQSAIGTGTGIVLDPGGQVLTNFHVVQGADRVNVAVAGRSYPA
ELVGYDRGRDIAVIQLLGAGGLPVAPIGDSAALAAGEPVVALGNAQGSAA
PLTREVGSVTAFGRTVQAEDSLTGSSDELTGLIEFAAPVRAGDSGGPVVN
SAGQVVGITTAASVNYRMGPGGKGFAIPINEAVGVANQIRSRIPSDTVHI
GPPALLGVGVRTAPSDVPGVLIQEVLRGGPAEAAGLMDRDVLIAINGNRL
TSATQLTYTLDRFYPGDVVDVTWIDGFGQERTAKATLAPGP
108801873YP_642070.1 class I and II aminotransferase [Mycobacterium sp. MCS]MSFHSLSRDDLTAEHERQQRNYAELQGKGLRLDLTRGKPSPAQLDLSNAL
LELPGRDAYRDSDGTDVRNYGGLHGLPELRAIFGELLGIPVPNLIAGNNA
SLELMHDTVVFSLLHGGVDSPRPWIAEPVVKFLCPAPGYDRHFALTENLG
IEMIPVPMLEDGPDVDLIEELVAADPAIKGMWCVPVFGNPTGVTYSWEVV
RRLVQMRTAATDFRLFWDNAYAVHTLTPDFMRQIDVLGLAAAAGNQNRPL
VFASTSKITFAGAGVSFLGGSLGNIAWYLQHAGKKSIGPDKVNQLRHLKF
FGDADGVRLHMQRHRELLAPKFALVGQVLEDRLGESKIASWTDPKGGYFV
SLDVWPGTARRTVALAKDAGIAVTEAGSAFPYRKDPEDKNIRIAPSFPSE
DDLRSAIDGLATCALLAATESLLG
108801871YP_642068.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. MCS]MTKRVPDQKLTLAEILELFVAGQEPLKFSAYDGSTAGPADAELGLHLKTP
RGTTYLATAPGDLGLARAYVSGDLELTGVHPGDPYELLRALTEKMNFKLP
PAKVLRNVVRSIGLEHFKPIAPPPQEALPRWRRIAEGLRHSKARDAEVIH
HHYDVSNTFYEWVLGPSMTYTCACYPQPDATLEEAQENKYRLVFEKLRLQ
PGARLLDLGCGWGGMVRYAARHGVKTVGVTLSKEQALWGQKAIADEGLTE
LAEIRHSDYRDVREIGFDAVSSIGLTEHIGVHNYPSYFRFLQSKLRNGGL
LLNHCITRPDNHSAPTAGGFIDRYVFPDGELTGSGRIITEAQNVGLEVVH
EENLRHHYAMTLRDWCRNLVEHWDEAVAEVGLGTAKVWGLYMAGSRLGFE
TNIVQLHQVLAVKLDERGNDGGLPLRPWWSA
108801869YP_642066.1 hypothetical protein Mmcs_4906 [Mycobacterium sp. MCS]MGQVSASSTVMINAEPAAVLAAVADYQTVRPKILSEHYRDYRVIEGGQGA
GTVATWKLQATKSRVRDVKATVDVAGHTVIEKDANSTLVTNYTVAPAGPG
SSVTVKTSWTGAGGVKGFFEKTFAPLGLKKIQAQVLENLKREVEKGA
108801867YP_642064.1 hypothetical protein Mmcs_4904 [Mycobacterium sp. MCS]MQPGGQPDMSALLAQAQQMQQQLMEAQESLANSEVHGQAGGGLVQVTMKG
SGEVTSVAIDPKVVDPDDVETLQDLVVGAIADAAKQVTILAHDRLGPLAG
GMGGLGIPGL
108801865YP_642062.1 CobB/CobQ-like glutamine amidotransferase [Mycobacterium sp. MCS]MPESTVRIGLVLPDVMGTYGDGGNSVVLRQRLRLRGIDAEVVEITLADPV
PTELDLYTLGGAEDYAQRLATKHLQRYPGLQQAASRGAPVLAICAAIQVL
GHWYETSSGERVDGVGMLDVTTSPQPVRTIGEVVSQPLVAGLSEKLTGFE
NHRGGTVLGPEAAPLARVEKGAGNRDGDGFDGAVQGSVVATYLHGPCLAR
NPELADHLLSKVVGDLPPLDLDEVAQLRRERLAAPRRA
108801863YP_642060.1 DNA polymerase III subunit epsilon [Mycobacterium sp. MCS]MVSHGWGRPAVDTGTGWAVVDVETSGFRPGQARIVSLAALAVGDDGNVEQ
SLATLLNPGVDPGPTHVHGLTAEMLEGAPRFGDVVADLAELLRGRTLVAH
NVGFDYSFLTAEAELVGAELPIDSVMCTVELARRLDLGTENLRLETLAAH
WGVPQLKPHDALDDAQVLAQILKPTLARARERRAWLPTRSVSRRRWPNGR
VTHDDLHPLRMVAARLPCAYLNPGRYIAGRPLVKGMRVAVAAEVTRTYEE
LIERLLTAGLAYTDAVDTETSLVICNQPDVEQGKGYQAQELGVPVLSDAD
FLRALDHVVGGTGIEEFFDATTVGDQFALF
108801861YP_642058.1 2-isopropylmalate synthase [Mycobacterium sp. MCS]MNTPESTDAFSSVRAITTPSGPPHPGQPAWNTQRASAMPVSRYRSFAEEV
EPVTLPDRTWPDKVVDTAPMWCAVDLRDGNQALIDPMSPARKRRMFDLLV
RMGYKEIEVGFPSASQTDFDFVREIIEQGAIPDDVTIQVLTQCRPELITR
TFEACKGAPRAIVHFYNSTSILQRRVVFRADREAVKQIAVDGARMCVEEA
AKHPDTLWRFEYSPESYTGTELEYAVDVCNAVADIVKPTPEVPLIVNLPA
TVEMATPNVYADSIEWMNRHLSPRDSIILSLHPHNDRGTAVAAAELGYQA
GADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEIRRTVE
YCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKVAADEADSDVDD
ILWQVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKADHGLVLPRRL
QIEFSQAIQKITDGEGGEVSPKEMWDVFAEEYLSPVRPLERMRQKVDAAE
VDGGTDTITAVVKVDGVEREIVGAGNGPLAAFCDALGAIGFDISVLDYSE
HALSAGEEAQAAAYVEASVGGKTVWGVGIATSITTASLRAVVSAVNRAAR
S
108801859YP_642056.1 FAD dependent oxidoreductase [Mycobacterium sp. MCS]MIETADVVIVGGGLEGAAAAWALAERGITNVVVVERNTVGSGMTGKSSGI
VRCHYGVSSLAAMANAGLEVFENPQKYLGEQADDIGFRQTGYVVGVGEPN
VGAMRKSLAAQRAVGVQTEEIDAAEVAEMWPFADLEPFAAFGWEPRGGYG
DAYRTAQAFAAAARSAGVRVRQSTAVQNLTTVGDRVTGVKLADGGEISAE
TVVVATGAWTRPFLAQHGIDVPIRVVREQIVLIDPGVELGPVPVFSDLVS
LQYIRPEPDGTVLFGNSDLADNEETDPDDYLNRATDDFVDITVDKVGTRF
PGFPDASITSSYAGCYDVTPDWNPVISRTELDGLVVAAGFSGHGFKIAPA
VGRLVADIVVDGRSGDPRIPETDFRLSRFAEGDLLRTPYPYVGAGEMR
108801857YP_642054.1 glutamate synthase (NADPH) GltB3 subunit [Mycobacterium sp. MCS]MAALSFSSRERSSALAFDLRTTPLRDVNAALHAGDLAGDFVIEHPDGAHN
VAVGLNAPVRVTVEGHVGYYAAGMNQQAEVVIDGNAGTGVAENMMSGTVW
VKGNASQSAGATGHGGLLVIEGNAAARCGISMKGIDIVVGGDIGHMSAFM
AQAGRLVVRGDAGEALGDSIYEARLYVRGSVASLGADCVAKEMREEHHEE
LGRLLKAAGFEDDDTAAYTRYGSARELYHFHVDNTGSY
108801855YP_642052.1 glutamate--ammonia ligase [Mycobacterium sp. MCS]MSTDLAALAEKTGTKFILALFVDLRGKPCAKLVPVEAVEQLATEGVGFAG
YAVGAMGQEPKDPDLMAIPDAASFTPIPFVKDGLAIVHCDPHVEGKPWPY
APRIILRSLIQQAADAGFEPWVGAEVEYFLLTRNADGSLATADAADTAAQ
PCYDARGVTRMYDHLTTISSAMNQLGWANYANDHEDGNGQFEQNFQFADA
LTTADRVITLRYLLSMIAAERGMVATFMPKPFGDRTGSGLHLHLSLTSGG
TPVFPCESDERGLGLSDTAYSFIGGILDHACALQSVIAPTVNSYKRTGAV
STASGASWAPRSATFGGNDRTHYIRVPDAQRIELRGGDGSANPYLAVAAA
LGAGLDGIKRSADPGAVGAVAETRSTLPPTLLHAVEELEADPVVSGVLDA
AGDGVARYFAGLKRHEFFDYHGTVSPWEVEQYLTAF
108801853YP_642050.1 nitroreductase [Mycobacterium sp. MCS]MANPPSDRAAQTQVPIHPDLAARWSPRAFDPAAELTDEQLIALLEAARWA
ASWGGRQPVRFVVGRRGDPTFEALGAVLRRGNSYAKAASALILVCADEGD
DERTARYAVLDAGAAIANLSVEAVSRSLITHPMAGFDVDTARAAFGVPDG
VRPLAVVAVGRLGDYAQADEAIVERDSRPRERLPLVDVAFAGAWGRPSL
108801851YP_642048.1 aspartate-semialdehyde dehydrogenase [Mycobacterium sp. MCS]MVNIGVVGATGQVGQVMRTLLEERDFPATSVRFFASARSQGRKLPFRGQE
IEVEDAGTADPSGLDIALFSAGATMSRVQAPRFAAAGAVVVDNSSAWRKD
PDVPLVVSEVNFERDAGTRPKGIIANPNCTTMAAMPVLKPLHDEAGLVRM
IASTYQAVSGSGLAGVEELFGQASAVVSGSRDLVHDGGAVDFPAPNKYVA
PIAFNVVPLAGSLVDDGSGETDEDQKLRNESRKILGIPELLVSGTCVRVP
VYTGHSLSINAEFAQPLSVDRAKELLAAAPGVKLVDVPTPLAAAGIDESL
VGRIRQDPGAPEGRGLALFISGDNLRKGAALNTIQIAELLAAQL
108801849YP_642046.1 hypothetical protein Mmcs_4886 [Mycobacterium sp. MCS]MIGRMTETPSTPASPTDPKTEPVFTDTPPPAYPAAPAEERRRPGRVTTIA
AWVGIVAGVVFIVAVVFFSGFVLGKNSGDGFQRGGGAGHGQMMFHRDGPP
GMSPMGPRGQFERPGMPFGPGQPGMQTPQQTQPGSPATTAPARP
108801847YP_642044.1 OsmC-like protein [Mycobacterium sp. MCS]MSIEVKYTAESTASGGGRNGHVKSSDDKIDFDTRPPKELGGSGEGVNPEL
LFSAGYAACFLGALRLQAKNNDVEIDEASAITAQVGFGPDSEGGFGITAH
LIGYLPGLEQSVADDLMAKAHAFCPYSKATRGNIDVKLSAKV
108801845YP_642042.1 glutamate--cysteine ligase [Mycobacterium sp. MCS]MTVPTTYDPGCDTAPDEFASAADAAEHITEHCLHDGPVGQVGLEVEAHSF
DLADPRRRPDWGEVTDAIAGVGALPGGSRITVEPGGAVELSGPPADGSVA
AIAAMTSDRAVLRTAFAQRGLGLVLVGADPLRRPRRVNPGGRYSAMEAFF
TASGTGAAGAFMMTSTASIQLNLDAGPRRGWADRVRLAHALGPTMIAATA
NSPLLAGRFSGWQSSRQWVWGELDEARCGPVLGASGDDPASDWARYALRA
PVMLVHNPEPVPVTDWVPFAEWADGQTLLGGRRPTRSDLEYHLTTLFPPV
RPRRWLEIRYLDAVSDALWPAVAFTLTTLLDDPAAADIAAEATESVATAW
DRAARIGLGDRRLHAAALRCVETAAERAPAAVMESMQQLVRSVEEGRSPA
DDFADRAVAYGIGPAVRQLAKGES
108801843YP_642040.1 hypothetical protein Mmcs_4880 [Mycobacterium sp. MCS]MCRHLGWLGAPRSVSALILDPPYGLLVQSYAPRRQKHGLMNADGWGVGFF
SSDLPDDAAPCRWRSAAPLWGDASFASVAPALRSACVVGAVRSASIGMPI
EPTASAPFTDGSWLLSHNGLVDRAVLPLSAHAESTVDSALLAALIFDRGM
DRLGDTVTEVGARDPGARLNILAANGSQMVATTWGDTLSVLRTDDGVALA
SEPYDDDPRWEEIPDRHLVRTDGSSVQLSALRGPA
108801841YP_642038.1 class V aminotransferase [Mycobacterium sp. MCS]MTGTLAERWRAARPKPAGIHLDSGACSRQGFAAIDAAAQHARHEAEVGGY
VAVEAATPVLDAGRAAVAALTGLAATDVVFTTGSNHALDLLLRSWDGDRS
VACLVGEYGPNLAIMAANGFQVSPLPVDTTGRLHVDAAAEALARDRPALV
HLTPLGSHRGLAQPLGPFAEVCRDLGLPLVVDAAQALGHLDCAVAPDAIY
ASSRKWLAGPRGVGVLAVRPEFAERLRPGFPPSEPAAPLTVLQQLEHGES
NAAARVGFSVAIGEHLAAGVQQVRTRLAEVGRLTRAAMADVPGWRVVEPV
DEPTAITTLEPTDGADPHRVRAWLIAERRIVTTACDARRAPRELTVPVLR
LSPHVDVTADELGQAAAALAEAARL
108801839YP_642036.1 hypothetical protein Mmcs_4876 [Mycobacterium sp. MCS]MGEEVKRTDFSHAQRREYRRKVQLCLDVFETMLAQSSFEFERPLTGMEIE
CNLVDADYQPAMTNSEVLASIADPAYQTELGAYNIEFNVPPRPLPGRAAL
ELEAEVRASLNAAEGKADSDGAHIVMIGILPTLMPEHLASNWMSASTRYQ
ALNDSIFTARGEDISIDIAGPERLSLQAASIAPESACTSMQLHLQVSPAE
FARNWNAAQVIAGPQLALGANSPYFFGHQLWAETRIELFTQATDTRPDEL
KAQGVRPRVWFGERWITSIFDLFEENVRYFPSLLPEVSDEDPVAELAAGR
TPRLSELRLHNGTIYRWNRPVYDVVNGKPHLRVENRVLPAGPTVIDMLAN
SAFYYGVLRTMSEEDRPLWTKLSFATAEHNFRDAAQNGMDARLYWPGLGE
VTPDELVLRQLLPMADEGLRRWGVAAEVRDRYLGVIEGRAKTGRNGAAWQ
VTTVRALQEQGLARPAALAEMLRLYCQRMHSNEPVHSWDGPA
108801837YP_642034.1 type 12 methyltransferase [Mycobacterium sp. MCS]MVYMGTKIADIDRMPRGGPRASCLDRLLETNRSEYLDRDDIDDRVKRSVV
RALDRTGELFGTHSRYAEIALAEIADVPDPKILELGAGHGGLSRRLLEAH
PTAEVTVTDLDEASVAKIAASDLGSHPRARVQVMDATAIDAPDRAYALAV
FVLSFHHLPPALAARAIAEGTRVADKLLIVDLPRPPAPLHVVRLLAMLPL
APLVPFAHDGVISSLRCYSPAALRALAAHAGPEIEVELRGGMFSDQVLVA
SRPRH
108801835YP_642032.1 aldo/keto reductase [Mycobacterium sp. MCS]MQTFSLGSHSVGRVGFGAMQLPGPGVFGPPRDHDQSIAVLRRAIDLGIDH
IDTAQIYGPNVANELIREALHPYPADLALVSKVGGTRGDNGEWLPAQDPD
DLRRQIEENLVTLGTDRLAAVNLRLFARDGGDVPARIEDRDLFGRQLDAM
IKARDEGLIDGIGLSHVSVEHLRYALERTEIVCVQNAFNLVDRSAQPLLD
ASTEHGIAFVPFFPLGSAFTADNPILGNPVITRAATELGHTPAQIALAWT
LTVAPNVLLIPGTSSVAHLGENTAVRDIELPAEVVEQLNAVA
108801833YP_642030.1 PadR family transcriptional regulator [Mycobacterium sp. MCS]MVSLRFAALGLLAQHPGSGYDLLKRFEKSMANVWPATQSQLYSELNRLAD
SGLIEVTAVGPRGRKEYRVTTAGRAELRRWITDSSDDPPLRRPDLLRVFL
LGELTPVAARRYAAAFAEHARSELDRLETLRDSLRWDDDDAAFYGRAALE
YGLRLAAMEAEWAAGLTAAIDAR
108801831YP_642028.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MPGRRHSALLTRLSANRSPDSRRAVVDELRRVILEGGAPPGSPIPVNDVA
EVLGVSAIPVRESLKTLVAEGLVAHQPNVGYSVALLTTTELAEMYIVRET
LESAALAAAVAHASEAERTAVAAAHRLLERAVREDDRHSYHRQSRHFHIG
MARPSGMLRLVHMLESAWNITEPVQLMVHVQPSDRAALHTDHGLMLEAFL
DRDVDALLATSRDHHRRLNTVVAALPPDSGLVTRG
108801828YP_642025.1 pyruvate:ferredoxin (flavodoxin) oxidoreductase [Mycobacterium sp. MCSMTRTTVDGNEAVASVAYRLNEVCCIYPITPSSPMAELADEWSGHRRPNVW
GTVPTVVEMQSEGGAAGALHGALQGGALATTFTSSQGLLLMIPNMYKIAG
ELTSAVIHVAARSLAAQGLSIFGDHSDVMAVRQTGFAMLAAASVQEAHDL
ALIAQAVTLRTRVPVLHFFDGFRTSHELNTVELLDDDDLRALVPEGLIRE
HRRRGLSPEHPVIRGTAQNPDIYFQARETVNPFYARVPAVVADLMAELGG
RTGRPLRIADYTGHPEAERVLVLMGSGAQTAAETAGVLTARGERVGVLQL
RMYRPFPVEALAAALPETVRTVGVLDRTKEPGSVGEPLYLDVLGALAEAH
ADGVLRTMPRVCGGRYGLSSKEFTPAMVVGVFDELARQRPRTHFTVGIDD
DVSHTSIGYDPAFDIESPDTVRAVFFGVGSDGTVGANKNTIKILGSDPGV
HAQGYFVYDSKKSGSQTVSHLRFGPHPIRAPYLVTRAGFIGCHHWRFLET
ADVLGRAAHGAALLLNTRHGPDAVWDRLPRAVQQQILDKDIALYVVDAGR
VAREVGLPGRINVVLQTCFFAISGVLPRDQAIAKIKEAVTKTYAGQGADV
VAREVAAVDRAVDDLHRVPIADRAPSGHEPAPIVPADAPEFVRTVTAEMI
AGRGDALPVSALPADGTYPSGTAAYEKRNISDLAAVWDPDTCIQCGNCAF
VCPHSVIRTKLYDADRLDGAPGAFASAPLNAVGLPESRYTLQVYVEDCTG
CGLCVEACPAVAPGIPLTKAINLGPREPLVAEQRENVAFFEALPDADRAR
VDFGTVRGAQFLEPLFEFPGACAGCGETPYLKLLSQLFGDRMMIANATGC
SSIYGGNLPTTPWTTDGDGRGPAWSNSLFEDNAEFGLGFRLAADTHTRQA
RRMLGESREVLGADLVEDILTAPQFRESELHAQRRRVAELHTRLDRLEPA
RADELRSVLDHLVRRSVWIVGGDGWAYDIGAGGLDHVLASGRNVNVLVLD
TEVYSNTGGQMSKSTPLGAVAKFAATGKTTPRKDIALQAIAYGSVYVARV
AMGADPQQTLQAFREAEAYDGPSIVIAYSHCIAHGFDLRHGLDQQYRAVN
SGHWPLMRYDPLLRAAGRAPFLLDSHRPRIPLGDYRYRELRFQSLANADP
DEAERLLGLAQQSVARRWDTYEQMAAASPHEFPSDARKGGD
108801826YP_642023.1 RDD domain-containing protein [Mycobacterium sp. MCS]MVSQPEPVVTGDAVVLDVQIAQLPIRALSAMVDILVIFVGYTLGLVLWAL
TLSDFDTALSAAVLIIFTVLTLVGYPLVFETATRGRTLGKMALGLRVVSD
DGGPERFRQALFRALAGFIELWMLAGGPAAVCSLLSPKGKRIGDIFAGTV
VISERAPRMSPPPVMPPALAWWAGTLELSGLNGEQAERARQFLSRAHQLE
PRLRDEMAYRIAGEVVSRISPPPPPGTPPQYVLAAVLAERHRRALARLVP
TPPAYPGLTPPR
108801824YP_642021.1 hypothetical protein Mmcs_4861 [Mycobacterium sp. MCS]MVLTGRAALIALLCVLPIAVAPAPGVAFVALFGALVLAIVADIALAASPR
RLQVTRSGDTAARLGQSVDSVLDVHNPVRRRIRGSLRDAWPPSAHGAPRT
HELDVPAGQRVTLRTSLRPTRRGDLRSALVTARSIGPLGLAGRQASHRVS
GQIRVLPPFLSRKHLPSRLARLRELDGSTPALIRGQGTEFDSLREYVVGD
DVRSIDWRATARRADVVVRTWRPERDQRIVIVLDTGRTSAGRVGVDPTAA
RSPAPPAAQHPGGWPRLDWSMDAALLLAALAARAGDHVDFLAHDRVTRAG
VFNASRSELLAQLVSAMAPLQPALVESDPAAMASAIQRRVRRRALVVLLT
DLNASALEEGLITVLPRLAARHHVLIAAVTDPRVDLLAAGRDDAAAVYDA
AAAERSRNDRNRIAGTLRQAGVDVVDAPPEELAPALADRYLHMKATGRL
108801822YP_642019.1 hypothetical protein Mmcs_4859 [Mycobacterium sp. MCS]MVLALLVIIAVATVGTLLTASRPGAPMDPQSTSPDGVRALVTLLRDRGVE
VVEADSVADVEGAARGSQPGDTLIVFAETFRLTDDEQLRRLADLPADRLL
LEPVSRVREALAPQLRSDGVSSFAPQPDCDLREANRAGDAQLGLAPSYRA
AEPGLALTRCYDGALVRYTEAGRTNTVVGTSGFMTNAGLLKQGNAALAMN
LAGSAPRVIWFVPQEREGAGGTASLSDLIPDQVGWIVLQLSLAVALLAIW
QGRRLGPLVAEQLPVVIRASETVEGRGRLYRSRRARDRAADALRTATRTR
LLPRLGLPANAQPPAVVQAVAQRTGADPQGVAHALYGPAPTTDADLVTIA
HQLDDIERQVTHS
108801820YP_642017.1 hypothetical protein Mmcs_4857 [Mycobacterium sp. MCS]MVPMSNDAGGPGRGYPPPGYQQGYPPPGYQQGYPPPGYQQGYPPPGYQHG
YPPPGYQHGYPPPGYPPQQGYAPPDVIKPGVIPLRPLGLSDIFNGAVNYI
RRNPKATLGLTAIVVVAAQLISLVLQILGPLIATGDLDPTLSGEAGAGDV
AVLSGSSLAGSITTALASVVLSGMLTVIVGRAVFGADITIGEAWQRVKGR
LLALLGFTALEAVAVLLLIVVVVVAIIAAEAIGGGVAAFLVGAPLVIAAF
LLIVYVATSLVFTPALIVLERLGIVEAAGRSFTLVKRDFWRVLGIWILAA
LAAAVIAGAVGVPFSLGGQLLAGSGSDGGVLVGLILIAVGAAIGQILTAP
FSAGVIVLLYTDRRIRAEAFDLVLHTGAAAGPGVPADSTDHLWLTRRP
108801818YP_642015.1 luciferase-like protein [Mycobacterium sp. MCS]MRRYATGYPDAMTLTRFGYALMTEQSGPKDLVRYAAAAENVGFDFEVSSD
HYSPWLAAQGHAPSAWTTLGAVAHVTERVELFTYVTCPTMRYHPAIVAQQ
AATLQILADGRFTLGLGTGENLNEHVVGKGWPTVARRQDMLREAIQIIRE
LFTGEVVDWRGEYFEIDSARLWDLPETPVDIAAAVSGDRSVEAFAQLADH
LIAVEPNKDLVHAWHDARRATGLPGHVRVIGQIPICWDPDREAAVARAHE
QFRWFAGGWAVNADLPTTAGFAGATQFVRPEDTAGSIPCGPDLDAIVEAV
SEYWKAGFTDIALVQVGDEGQDRFLDEAAGPLLEKLRAAAG
108801816YP_642013.1 hypothetical protein Mmcs_4853 [Mycobacterium sp. MCS]MPCIAVVKPAHPVCARVRAGTRSGVNVSDLLALPVEVGAAVRRRRLFHPA
GVLARGRIERVAPPGQGLPIETGDVIGRVSKAVGLPGSVPDIAGVAWRMT
KDSGPWDILLATTAINRFMLLPTTSWDNTTYSSLMPLRYEGVWWVRAHLT
TKLDGPGLSLDTVTDQLARGDLDFSVDQAAGTGEFGPLARLTLSEVIPPD
KDLSFDPTLNTAPGVSLAPGWLTDFRRAAYRRSREGRDAQ
108801814YP_642011.1 hypothetical protein Mmcs_4851 [Mycobacterium sp. MCS]MTSAPIMVEPTLPDARGPLSLAVVNTLAERAPRNHLSRIEASLADSDPYG
LDLQLALYVCYELHYRGFAGVDPHWEWNAGLLHLRGQMEQTFLAAVRRDV
GEIDPDRTAADEMTALAVEPVDGHPDASGPSYYLRDKGTWEQMREYFVHR
SLYHLKEGDPHAFAIPRLTGQAKASFVAVEFDEFGGGRGPQLHQQLFADL
LAAADLDASYLGYINEVPAEALAAVNLMSMFGLHRALRGAAVGHFASTEI
TSSPGSRRLVEALERMGAPQTCAAFYREHVEADAVHEQVVRTDVVGDLVA
REPHLDADVVFGIRAHALVENRLADHLMACWTAGETSLRRPLS
108801812YP_642009.1 putative transcriptional regulator [Mycobacterium sp. MCS]MMRRLTKVMIDNGRSVHGVELEADPLARVAPAFIVGGTADAVLAFVDGRV
RLTLDEFVTQLATLWLITGNGAAEIARARTPHP
108801810YP_642007.1 cytochrome P450 [Mycobacterium sp. MCS]MTALTAQLTSPANTHRLQVAGAALTSRFPSREEPLATPPPGSNLKPVMGN
YGFPFLGHTLSALAEPLDFARRRYDMYGPVSWAGGVGFRVVALMGPDALE
TAWINRDKVFSSTRGWAPVIGPFFHRGIMLLDFEEHRDHRRIMQQAFART
ALDGYLELMRPGIDRTLGGWPASDAFPFYPSIKHLLLEQAAEVFVGTHLG
PESDQLSADFHDTVRGGQALLRADVPGGVWARGLRARKRLERYFGDQIAD
RQRGDGADLFSMLCRSEDDDGARFTPADIVNHMIFLLMAAHDTTAIALSM
LVYELGRNQKWQKTLRDEAVGRPNDAPAVGDLDAYPLLDAAFKEILRMYA
PAGTLFRQTTRDTDILGHFVPAKTQVAINVHASMRLADWWPDPDTFDPAR
FIDQPGARAAVSRYAFAPFGGGAHKCIGQQFADMTVKTTMHQMLRRFEWS
VADGYRIPLTWGTGPTPADDLPITLRTLTT
108801808YP_642005.1 hypothetical protein Mmcs_4845 [Mycobacterium sp. MCS]MDNRSVRAAGFNVEAGTLLLAVVERSDEGPATPVPVTTPKLTPADLPEAQ
SLRDLAKRVEQELQAARVDAVGLVHTRAFRNLQYNQVYARVTAICAVMFA
AAELNVGYETLTTETIGTAVSCPPKSLGTFNFAVLGFDQRPRFWTTGLAE
AYAAAYTLVGGTT
108801806YP_642003.1 hypothetical protein Mmcs_4843 [Mycobacterium sp. MCS]MLDESMNLGVIQRRPVRRVAAGRRPQPVRPHSGSEAAGPCAQSYYALRVT
RSYCCSYDLTVSLAESNELRQLSRVLFGQAHRLSVMVGIARGGKEFALSE
LADELGFEYLSSIQDPIRDLEASELISRIPKVANKVRFRKNKSYAWKWAE
ELASRYPEQ
108801804YP_642001.1 hypothetical protein Mmcs_4841 [Mycobacterium sp. MCS]MTDRTTGSSTAPAAPTRRRDSPSADPPHSREYSARLAALGRFTVRHKALT
IGVWIGAAIILALLFPQLETVVRQQSVDLIPRDAPSLQTVERMSTAFGEQ
GSKTVLIVAMEDPAGLTPAAQQRYDRLLERLRADSEHVLLVQDLLADPVT
KTQAVSADGKSWYLPVGVTGTLGDPTAAESVKAVRDITAEVFSDSTTTAH
VTGPPATFSDMIASAEHDLLLISIATAGMIALILLIVYRSVFTALLPLLV
IGLSLAVGRGVLSALGEMGMPVSQFTVAFMTAILLGAGTDYTVFLISRYH
EQRRAQVPADQAIIHATASIGRVILASAATVALAFLAMVFARLSVFAALG
PACAIAVLFGFLATVTLLPPVLALAAKRGIGEPKSDRTRRYWNSVAVAVV
RRPVPLLIVSLVTLLALSAVAVTIKISYDDRKGQPATTASNQGYQLLDRH
FRKDVVITEFLVVESPTDMRTGKGLADLDEMASRVSQVPGVTKVSGVTRP
TGERLDQAQLAWQNGQIGDKMAGAVADGNARRDDLTKLTDGADQLAGGLA
QLDTTVRTALAPLAGILTQAQSAGTQVNQFRPLLQQLSATAPAVDQAIQS
GPGLRPLADQAQHAITTLEPLVGALNTSPWCATTPQCAQIRDQVQILITL
RNSGFFNQIADLGDRYDPASNATVAGTLTNVQNAVTSLDKAFGALGNPAD
LAGNLRRLQDGIGQLASGAQALATGVRTLADSNIDMLSGMSQIATQLQNS
ARAAQDSDSSSGFYLPANAFENRQFTDVAKQFLSPDGKTARFMIETSHDP
YSVEAMDLANRITNTANTARPNTSLSDATVSVAGFPAVNSDIQRLLWADF
AQLALATTVIVGIILVLLLRALLAPIYLLGTVLLNYLASIGFGVLVFQWI
FGQEIAWPVPLLAFIILVAVGADYNMLLVSRLREESGSNIRVGVLRTVAN
TGAVITSAGLIFAVSMFGLMVGSVAIMIQAGLIIGFGLLLDTFLVRTLTV
PAIATLLREASWWPTKPNTSTT
108801802YP_641999.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSVASTRVSSNPAQNQGSSAADQVHAAEVPRSRASARRREAIMDAALAVA
ATGGYDAVHMRTVAERVGIAVGTLYRYYPAKTHLLVAALTREFQRLDVSG
DWSSGAGTPQQRLDRLTAHLHDRWQRDPLLTDAMTRAFAVADTRAAAELD
RAAATIEILLARTLGGGEPTPADLCVAGVISDIWLANLVAFISGRVSAAD
TRDRIDRATRRVIDRAAPSTTAP
108801800YP_641997.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSDSSQPSLHDDDDIDPRRIRSRNRLLDAAATLLSTGGVEAVTIDAVTKA
SKVARTTLYRHFQSSSHLLAATFERLLPQVTTPAPTSGSLRDQLIELLSR
QAALFNDAPLHVTTLAWLSLGPTGAKDETDDRHASGALRARVVDQYRQPF
DALLNGDKARAELDDFDLELALCQLVGPLAFARMTGIRTVTHKDCANIVD
DFLAAHRKIVEDGGDRVKPRSTRRSDGARRPSRQIVT
108801798YP_641995.1 hypothetical protein Mmcs_4835 [Mycobacterium sp. MCS]MSGSDKLRARQRAREAQRRANEKRASDARANVDDAASIRVLLQRVGAVDA
WESVRLDQVTENVRRDAACKRMSHFVNLQTVIGRMRDRGQTIASIADLAE
VGARDLQNVLRRARAGDGGAQRVTKSRNAGGLGANGATLRSHSAVDVDHR
SMGADSDSTFDPTRCVRCDAVMLDPEVTSRRGRPRRYCSDTCRRDASAAR
TAAQRHGEPIRVVEVPRAAGGSELRTQHDGATASEIRSVCEAVELALHNA
DAMKILLSSVAERARRKELDRSTFEVARELARAVYPNRN
108801796YP_641993.1 hypothetical protein Mmcs_4833 [Mycobacterium sp. MCS]MRGQAEHSPTPATSATSVVESAEKQGAALEACAGLGNFKSGVGIARGAFI
DRVDRANDWESSQSLGVQGYYFTAVGAELNYLETRLGPEVPREIIDALVD
VRQSIVAVVDADLRREPASISNDMIDRYSSALQAAETVCEAAGAG
108801794YP_641991.1 hypothetical protein Mmcs_4831 [Mycobacterium sp. MCS]MWPKSAMGRLLGRWPIRAAASAHFAARPHSYRSRTVERCPSPCESKHHRA
RIRCTAAGCIQLVLSIRVRQSILVGVQSVS
108801792YP_641989.1 hypothetical protein Mmcs_4829 [Mycobacterium sp. MCS]MELLGAKQVSELIGVPVGTLRYWRHSNIGPASFTLGRRVVYRRDEVLRWI
SQRESATRRGGGDAA
108801790YP_641987.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium spMTGRSSIATHSQPRAWVDNAVRLIEADARRSADTHLLRYPLPSAWGEDCD
VALYLKDESTHITGSLKHRLARSLFLYGLCNGWICEGTTVIEASSGSTAV
SEAYFAALLGLPFIAVMTSSTSASKVALIESQGGRCHFVEESSQVYAEAE
RLAQETGGHYLDQFTNAERATDWRGNNNIAESIYHQMAAEQHPIPEWIVV
GAGTGGTSATIGRYIRYRRYATRLCVVDPENSAFFPAYAQQDPTIVTGAS
SRIEGIGRPRVEPSFLPEVVDRMVAVLDGASVAAARHASRVLGRRVGPST
GTNLWGAFGLLAEMKAQGRSGSVVTLIADSGDRYADTYFCDEWLSSQGID
PSESAEVLADFERSGVWR
108801788YP_641985.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MPERPPTAVTVVKLAWCCLLASVLAAALMFPVVGGIGLMSNRASDVVANG
SAALVEGEIPQVSTMVDAKGNTIAWLYSQRRFEVPSEQIANTMKLAIVSI
EDKRFAEHNGVDWQGTLTGLAGYLRGDTDTRGGSTLEQQYVKNYQLLVVA
QTDSEKRAAIETTPARKLREIRMALTLDKTFTKPEILTRYLNLVSFGNGA
FGIQDAAQTYFGVNASELNWQQSALLAGLVQSTSTLNPYTNPDGALARRN
LVLDTMIENLPNEAEALRAAKNEPLGVLPVPNELPRGCIAAGDRAFFCDY
ALEYLARAGISKEQVAKGGYLIKTTLDPDVQGPVKSAVDNFADPTTPGVA
SVMSVIRPGKESHPVLAMASNRTYGLNLDAYETMQPQPFTLAGNGAGSVF
KIFTTAAAMEMGMGINTQLQVPGSFQAKGLGSSDRPGCPAATWCVSNAGG
YRGSMNVTDALATSPNTAFAKLISQVGVPRAVDMSVRLGLRSYALPGTAR
DYDPESNESLADFVKRQNIGSFTLGPIEVNGLELSNVAATLASGGVWCPP
NPIAQVLDRKGEEVSVTTETCEQAVPEGLANTLANAMSKDDTGAGTAAGA
AGSVGWDLPMSGKTGTTESNRSSAFLGFTNQLAAANYIYDDSPTPGELCS
FPLRQCGSGNLFGGNEPARTWFTAMKPIATNFGPVALPPTDPRYVDGGPG
SQVPSVSGLTVDAARQRIKDAGFQVADGTSSVNSGSRAGTVVGTNPSGQT
IPGSIVTIQVSNGIAPAPPPPTYSVPSLPGLPGGPPPPIGQTVVEIPGLP
PITVPVLGPPPPPPPP
108801786YP_641983.1 anion-transporting ATPase [Mycobacterium sp. MCS]MSTTPPALDMAAILNDTSNRVVVCCGAGGVGKTTTAAAMALRAAEYGRTV
VVLTIDPAKRLAQALGIKDLGNTPQRVPLAPEVTGELHAMMLDMRRTFDE
MVIQYSGPDRADAILDNQFYQTVATSLAGTQEYMAMEKLGQLLAQDKWDL
IVVDTPPSRNALDFLDAPKRLGSFMDSRLWRMLLAPGRGIGKLVTGAVGL
AMKAMSTILGSQMLSDAAGFVQSLDATFGGFREKADRTYDLLKRRGTQFV
VVSAAEPDALREASFFVDRLSSERMPLAGLILNRTHPTLCSLHAEKASEV
ADALAEKDPESLTVAALRIHADRTQTAKREVRLLSRFTGANPHVAIVGVP
SLPFDVSDLDALRAIADQITGTASAA
108801784YP_641981.1 hypothetical protein Mmcs_4821 [Mycobacterium sp. MCS]MLAVGPPPPDKLSAMSQPTQWEYATVPLLTHATKQILDQWGADGWELVAV
LPGPTGEQHVAYLKRPK
108801782YP_641979.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MSAPEHPAYGLLRPVTETASVLLCNNPGLMTLDGTNTWVLRAPGSDELVI
VDPGPDDDEHIAKVAELGRIALVLISHKHEDHTGGIDKIVDRTGAVVRSV
GSGFLRGLGGPLTDGEVIDAAGLRIVVMATPGHTADSLSFVLDDAVLTAD
TVLGRGTTVIDTEDGSLRDYLESLHRLQGLGRRTVLPGHGPDLPDLEAVT
AMYLTHREERLEQVRAALRELGDDATARQVVEHVYTDVDEKLWDAAEKSV
EAQLDYLRT
108801780YP_641977.1 hypothetical protein Mmcs_4817 [Mycobacterium sp. MCS]MSWLFVGFIPWLLMVATFGLERLESGLARNTVSASDVDDFLLRAEAEREH
RQQTRLEPVETLPTRTTGAEVPARVYIPHRPNPQFQPTRHANRV
108801778YP_641975.1 redoxin [Mycobacterium sp. MCS]MSTSTRWTVAVLAVVLALVVALSMQLAEDPAPTRRDGPAPARDHRDADTP
EALAGPRAEADLPPCPPPGVGAGPESLRGITLECAGDGQMVDVARSLAGR
TVVLNLWAYWCGPCADELPAMAEYQRRVGDAVTVVTVHQDENETAGLLRL
AELGVRLPTLQDGRRLIAAAVKAPNVMPATVVLRADGSVAGIVPRSFATA
DEIEEAVDQTMGESG
108801776YP_641973.1 colicin V production protein [Mycobacterium sp. MCS]MTPSQWLDFLVLAVAFVAAVSGWRSGALGSLMSFIGVVLGAVAGVLLAPH
VVTHISGPRTKLFAALFLILALVVIGEIAGVVLGRAVRGAIRNRTLRLFD
SVVGVGLQIGAVLLASWLLATPLTSSDQPSLAAAVKGSRVLAEVDDVAPP
WLKSVPTRLSGLLDTSGLPEVLEPFGRTPIATVDAPDAALATDAVVGATR
GSVVKIRGVAPGCQKVLEGTGFVVSPNRVMSNAHVVAGSESVTVEVDGQT
YDAFVVSYDPNADISILDVPDLPAAPLPFVDELAPPGTDAIVMGYPGGGD
FTATPARIRETIELNGPDIYRKTTVTREVYTIRGTVRQGNSGGPMINRGG
KVLGVVFGAAVDDADTGFVLTSDEVGAQLAKVGNTARVPTGVCVS
108801774YP_641971.1 hypothetical protein Mmcs_4811 [Mycobacterium sp. MCS]MSRGDRKNGVPTTVTSIPLVDPHAPKPDPSIGDLVKDATSQVSTLVRAEV
ELAKAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFAAELLDTWLWRW
ASFLIVFGVMVLVTALLALLGYLKVRRIRGPQKTIESVKETREALTPGHD
KAPKAVAITDGQKTGDPSGW
108801772YP_641969.1 acetyl-CoA synthetase [Mycobacterium sp. MCS]MTTLTPMSDVHTEVPSSYPPPAEFAEQANAKAEMYREAEEDRLAFWAKQA
ERLSWDTPFTEVLDWSDAPFAKWFVGGKINVAYNCVDRHVEAGNGDRVAI
HWEGEPVGDSRSLTYAELKDEVCKAANALTDLGLTAGDRAAIYMPMVPEA
IVAMLACARLGVLHSVVFAGFSASALKARIEDAEAKLVITTDGQYRRGKA
ASLKDAVDEAVDGQPSIEHVLVVRRTGIDVKWTDGRDLWWHETVDGASTE
HTPEAFDSEHPLFLLYTSGTTGKPKGIVHTTGGYLVQSSYTHHNVFDVKP
DTDVYWCTADIGWVTGHTYITYGPLSNGVTQVVYEGTPTSPSEHRHFEVI
EKYGVTIYYTAPTLVRTFMKLGRAVPDAHDLSSLRLLGSVGEPINPEAWR
WYRNVFGDNNIPVVDTWWQTETGAIMISPLPGVTAAKPGSAMTPLPGISA
KIVDDDGNQLPPGSDHGEQANGYLVLDQPWPAMLRGIWGDPQRFKETYWS
RFAEQGWYFAGDGARYDADGNIWVLGRIDDVMNISGHRISTAEVESALVG
HSHVAEAAVVGATDDHTGQAICAFVILESSAADKPHEHMVEELRAEVAKE
ISPIARPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPGVF
EAIRASKAEV
108801770YP_641967.1 HAD family hydrolase [Mycobacterium sp. MCS]MSASEQDAASPSEQSAASPADHPVRTAAFFDLDKTVIAKSSTLAFSKPFF
DQGLLNRRAVLKSTYAQFFFLMSGADHDQMDRMRSYVTNMCTGWDVEQIK
SIVNETLHDIVDPLVFAEAADLIADHKLCGRDVVVVSASGEEIVAPIARG
LGATHAMATRMVVEDGRYTGEIAFYCYGEGKVEAIRALAAREGYALEHCY
AYSDSITDLPMLEAVGHPTVVNPDRALRKEATARGWPVLTFTRPVSLRDR
IPAPSGAAVATTAAVGMSALAAGALTYSLLRRFAL
108801768YP_641965.1 type II secretion system protein E [Mycobacterium sp. MCS]MTSSLIDRVRERLAAESSPLHPAVVAAAIRAESGGVLGDTEVLTNLRALQ
TELTGAGPLEPLLCADGTTDVLVTAPDAVWIDDGKGLRRTTVRFADEGAV
RRLAQRLALAAGRRLDEAQPWVDGQLHGLGAGGFTVRLHAVLPPVAAAGT
CLSLRVLRPATQDLPALVAAGTIVEDASALLRDVIDARLAFLVSGGTGAG
KTTLLAAALGAVAGDERIVCVEDAAELAPQHPHVVKLVARGANVEGVGEV
TVRDLVRQALRMRPDRIVVGEVRGAEVVDLLAALNTGHDGGAGTVHANNP
AEVPARMEALGAVGGLNRGALHSQLAAAVQVLLHVARDRTGARRLTQIAV
LQPHDDGCVRVVPAWQIDRGFDAGAADLRRLVSSRRAR
108801766YP_641963.1 type II secretion system protein [Mycobacterium sp. MCS]MSVAAALLALALLLTGRDGGVRMARLRTAGRRTPGPTERGGADPLAAAST
FDVLAACLTSGMAVSSAASAAAASAPPGLAAILARAADMLALGADAATAW
SDPGTPLDDHARALMRLARRSAESGTALAQGVADLAAESRSDAADAARAT
AERAGVLIAAPLGVCYLPAFLCLGIVPVVVGLAGDVLQSGLW
108801764YP_641961.1 hypothetical protein Mmcs_4801 [Mycobacterium sp. MCS]MAVLIAVTGGLTQVGSAVVARHRAQAAADLAALAAAARVASGARSACAQA
ALVARAMDTTVTDCAADGLEVVVHVEAGVGSGAWRLGPAHAAARGGPVLL
R
108801762YP_641959.1 DEAD/DEAH box helicase [Mycobacterium sp. MCS]MSDFGRELLSCAVAGVVADEHPLRHVADLPARPGQPESWPQWAHPDVVRA
FVDRGVRTPWSHQRAAADLAHDGRHVVLSTGTASGKSLAYQLPILSAMAS
EPRTRALYLSPTKALGHDQLRTAQALTDAVPALHDVAPSSYDGDSPVDVR
RFARERSRWIFSNPDMIHLSLLRNHARWAVFLRHLKFIVVDECHYYRGIF
GSNVALVLRRLLRLCARYSADPGGPTVVFASATTAAPSATAAELIGQTVT
EVTEDGSPQGARTVALWEPALLTDLVGENGAPVRRSAGAEAARVMADLIA
EGARTLTFVRSRRGAELTALGARARLEEVAPELVEQVASYRAGYLAEDRR
ELERALADGRLRGLATTNALELGVDIAGLDAVVLAGFPGTVTSFWQQAGR
SGRRGQGALIVLVARDDPLDTYLVHHPEALLDRPIERVVIDPANPYVLAP
QLLCAATELPLTDSEVRMWDAETVAESLVDDGLLRRRAHGYFPVPGLDPH
PAVDIRGSTGGQIAILEADTGRMLGSANAGQAAASVHPGAVYLHQGESYV
VDSLSFEDGVAFVHAEDPGYTTFAREVTEIAVTGAGERESYGAVTVGLVP
VSVSNTVVGYLRRRLDGEVIDFVELDMPTRTLDTMAAMCTITPEALLDNG
IDPLRFPGSLHAAEHAAIGLLPLVASCDRGDIGGVSTAVGPEDGLPTIFV
YDGYPGGAGFAARGFGQIRTWWTATADAIEACECPGGCPSCVQSPKCGNG
NDPLDKVGAVRVLRLVLRALDDRRR
108801760YP_641957.1 hypothetical protein Mmcs_4797 [Mycobacterium sp. MCS]MFSFSVPAVAPAAGHSTTGAPLAYCRFVSQLSFFSAEAVPPAVADLTGLL
AAPGQVVLVGSGREQGARLSVVVEDLWRAEALAEMITDAGLGAEISRTDE
NTPLVRTAVEPRLVAIAAEWTRGAVKTVPPQWLPGPRELRAWTLASGTRE
PNGYLLGLDPHAPDTHSPLASAMMRIGIAPTLIGTRGSRPALRISGRRRL
TRLVETVGEPPQDVAALSHWPSTP
108801758YP_641955.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MASEAIPIGRISAFVRWVARTPWPVFTLGMLQADIIGALFVLGFLRFGLP
PEDRVQLQDLPAFNLAIFLGYLFVSFTVGAYLSLRLLIPVIRWQRRDTLL
ADGDTSTTDLARARALRMPFYRTVISVANWCLGSIVFIVASWPVASKSAP
VVAVATALGATATAIIGYLQSERVLRPVAVAALRGGVPENFRAPGVVLRQ
VLTWVLSTGVPVLAIVLALVASQFDILEAPADRLTMPILLLAIAALVIGL
AGTVLVAMSIADPLRQLRWALGEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLSERQRLRDLFGRYVGEDVARRALERGTELGGQERDVAVLFVDLVG
STQLASTIPAADVVNLLNDFFRVVVDTVNRHGGFVNKFQGDAALAIFGAP
IEHPDACGAALAASRELHDELIKVLGQTEFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEPGHVLASAIAVSGALDAEALCWNVGETV
ELRGRIAPTQLARPVNLMSPREISDLSR
108801756YP_641953.1 carboxymuconolactone decarboxylase [Mycobacterium sp. MCS]MTDTREQGLQVLRELLGGSIPEGTDFTQDSRFGAELIEIGVDSIFGRLWT
RECLSRRDRSLVTMGILIALRATDEFKAHVKIGLNNGLTEDEIAEVIYHA
SGYAGFPNANSALTAARDVLEGP
108801754YP_641951.1 hypothetical protein Mmcs_4791 [Mycobacterium sp. MCS]MPVSALDGFYTTWDNARQTFGQGTPQPGADFDKSPQLTDLGSGVTAAAPG
SKWSGAAATNYDKANTDHQAVFTRLAELDRRIAQQVDQSAQVVATGRQNL
DQVRQWVTDAANSVPPGKQRDMFLMQIANRGLGQLSEVVQKTNAESNTVA
QNLAKLGPEFDAIKNEQKFGNGEKDEKKDDAEALGNEEMHAVPEKERAEQ
DVQAALAGDQGAAARVDEVLGKIQPGQQLTSEQASYLSQMQAQQHGMSID
DLHKAEQRLGDHKDIIGDSWQLMSNDDVWMPHTELEQGALDDPSWRVRGG
FEQLPTSVQDALRDADKSAPLGEGIAGLTHDRDLQKISEIVTDGNDKFQT
GTALDREMMTAADKIMDTNLGTLQPMGDPEIVQGLFEAAGSDHQVVHDHL
LGDGGDDFLHDVNAVEWTDDGKSAASLFSWTHDAAAGHEAGIAGNTAEKY
ASYIGSHKDELMNIDGQTLGELNPELVKGYAHGLTPYMSDLSGLASADPN
NTFDFIDKENAVEKPVAKGIFAVMSTEESAFKEFHSVADAHILKNSYEWA
NDVKNGVQVPANDERLLDCASLQALEKVGITEAANALGLNREQVEAQRAE
AYDMGLKMLSGTGSVVPGIGTAVGPAIDNFGGAMKDSIFGDPRDFQEMTV
RNMDAGESARFALNALIAQDVPLNYGRYSLDDSWYEYASVDPARPELGEA
RFIKNIEGLQNASISDSSMEQNLTTILKQTLGESSPTDAVKDQYDDVVAN
PDPREAIRPGQ
108801752YP_641949.1 UDP-galactose 4-epimerase [Mycobacterium sp. MCS]MTWLVTGGAGYIGSHVVRALTEADLPVVVIDDLSTGLEQFVPESVPFVRG
TLLDGALVEQTLREHAVAGVIHIAGFKYAGVSVQRPLHTYEQNVSAMVTL
LQAMETVGVDKIVFSSSAATFGTPDVDQVDESTPTAPESPYGETKLIGEW
LLRDMGRASGLRHTSLRYFNVVGSGSTALFDTSPHNLFPLVFDMLYRGDT
PRINGDDYPTPDGTCVRDYVDVGDVALAHVAAARRLTRGEPVEPVYNLGS
GAGTSVREIMTAIRTVTGVDFEPQIMPRRPGDPARIVANGDLAARDLDWK
MRHSLEDMVASAWAARQAAGAAYPGAGQS
108801750YP_641947.1 peptidase M1- membrane alanine aminopeptidase [Mycobacterium sp. MCS]MTRSKKGKNTPAVIDPYLPETGNFGYRVSRYELDLEYKVAINRLSGSASI
TAVTLAALRTFTLDLADTLRVTKVAVNGRRPARFSCANDKLRVELSSALP
AGAALVVEVRYGGTPEPIETLWGDVGFEELTNGALVAGQPNGASSWFPCD
DHPSAKASYRIQISTDSPYRAIANGELVSRRARAGHTVWTYEQAEPTSTY
LITLQIGMYDVHKLAKSPVPIQAALPARLRSNFDHSFGRQPQMMKLFEKL
FGPYPLASGYTVVVTDDALEIPLEAQGISIFGANHCDGTRRAERLIAHEL
AHQWFGNSVTVRRWRDIWLHEGFACYAEWLWSENSGGRSADEWAHHYHGR
LTDLPQDLLLADPGPKDMFDDRVYKRGALTLHVLRTRIGDEKFFALLRDW
TARHRHSTAFTDDFTGLAANYADESLRPLWDAWLYAEDLPKL
108801748YP_641945.1 integral membrane protein TerC [Mycobacterium sp. MCS]MNVSALEWGITIAVTVAVLLFDVVAIARRPHEPSMKECSIALSVYVSLAI
AFGVWVWVFHGGDYGLEFFAGWLTEYSLSVDNLFIFIIIMASFNVPRKYQ
QEALMVGIILALIFRGIFIALGAVAINQFSWVFYIFGLFLVYTAWNLARD
TDHEDDGDNAVVKFARNHLTLTDKWDGLKLWIKQDGKRLMTPMFLVIVAL
GTTDLIFALDSIPAIFGLTQEPYLVFTANVFALMGLRQLFFLLGGLLKRL
VYLSQGLAFILLFIGVKLFLHALHENELPFINGGEHVKVPEIPTLLSLGV
IVVTLVITTVLSLMKTRRQSTDEITEVDPKAEDKIEDDGEKSFDSR
108801746YP_641943.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MTPASQTELTGQMLIAGAAVRGVGPEIRGFDPTAGTELGPGYRYGDASHV
DAACAAAAAAFGPYRSTPAEARARLLEAIADGLVAITDDLVARAHAESGL
PRARLTGELGRTAGQLRLFAAVLREGSWNGVRIDTAQPDRTPLPRPDLRQ
RAVPLGPVAVFGASNFPLAFSVAGGDTASALAAGCPVVVKAHDAHPGTSE
LVGRVITDAVAAAGLPPGTFSLLNLAQEGGITLVTDPRVKAVGFTGSRAG
GLALVDAAARRREPIPVYAEMSAVNPVFLLDGALAAGGADLGRAFVDSLT
LGSGQFCTNPGLIVAVDGPGLDTFVDAARDALAGSAPTAMLTPGIAENYR
AGVEALAGRATLIARGSADGTAAVSCRAALFGTDAVSLLGSVSLQAEVFG
ASSLIVRCADFEEMTTVAANVEGQLTATLHADESDHDRAAALLPILELKA
GRILFNGWPTGVEVTHAMVHGGPFPATSDSRTTSVGSRAIERFLRPVCYQ
NAPGVLLPAAVADGNPECLWRRVDGELTRD
108801744YP_641941.1 allantoicase [Mycobacterium sp. MCS]MSTAHSHFLALPDLASRAAGAAVVWANDELFAEKENLIIPAAAQHRPATF
GHKGQVYDGWETRRSRGADRESCDSAIIRLGAPGVVRGVVVDTAWFTGNY
PPEVSVEAAYVPGHPSIEELLGRHWTTIVERSPVDGDTRNPFEVASGRRW
SHVRLSMYPDGGVARLRVHGEGLLDPQFAELPLDLAALEHGGRITGCSNM
FYSSPNNLLLPGTARTMGDGWETSRRRDAGNDWVQVRLAARGVLSFAELD
TSYFIGNAPGSARLRGRDGDGEWFDLLDEVALQPDTRHRFLIASERPVTE
ARLDVFPDGGMARLRLFGRLTDDGLRAVAERWSLTG
108801742YP_641939.1 inorganic diphosphatase [Mycobacterium sp. MCS]MEFEVVIEIPKGSRNKYEVDHETGRLKLDRYLYTSMAYPTDYGFIENSLG
EDGDPLDALVLLPESVFPGCIVDARPVAMFQMTDEAGGDDKVLCVPAGDK
RWDHIQDLADVPEQVLEEVKHFFVHYKDLEPNKYVKAADWTGREAAEAEV
QRSFERFEAEGH
108801740YP_641937.1 hypothetical protein Mmcs_4777 [Mycobacterium sp. MCS]MSASSADLTVGRTVDWRFAATVGAKLVRPGPPATDYTRRQAVEQLATASR
EAELPVREVTGLTEGNAVTEARIIDRPGWIQAAAQSMRTMTGGTDRPSNF
LTGRVTGAQTGAVLAFVSSGILGQYDPFATAGGQERSDPGNGPSGELLLV
WPNVIAVERQLRVSPTDFRLWVCLHEVTHRVQFGANPWLADHMSSALAVL
TKDAGEDVTEVAGRLADYVRNRRAHTDAHSTGVLGLMRAMQAEPQRRALD
QLLVLGTLLEGHADHVMDAVGPAVVPSVATIRARFNQRRERKQPPVQRIL
RALLGVDAKISQYTRGKAFVDHVVAKVGMERFNTVWSGPETLPLPTEVDE
PQRWIDRVL
108801738YP_641935.1 hypoxanthine phosphoribosyltransferase [Mycobacterium sp. MCS]MRAAALVPVPTAWHAVGVPAHTPDLYEGDIKSVLLSEEQIQSRTAELAAQ
IADTYRAAIGDSGQDLLLVTVLKGAVMFVTDLARSIPLPTQLEFMAVSSY
GSSTSSSGVVRILKDLDRDINDRDVLIVEDIVDSGLTLSWLLRNLATRQP
RSLRVCTLLRKPDAVRADVDIEYVGFDIPNEFVVGYGLDYAERYRDLPYI
GTLEPKVYTHD
108801736YP_641933.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MRASVLRGGRMVLRDDVPEPVPGPGQVLVAVKACGICGSDLHFAAHGDDA
LAAGAQMEGMPQLGDTVDLSADVFMGHEIAAEVLEAGPDTDAPPPGTVVT
SIPALISQTGVAPIVYSNSVIGGYAERMLLSAPLLLPVPNGLDPRHAALT
EPMAVGLHAVNRSAITPAESALVIGCGPIGMAIIAALRLRGVEHVVAADF
SQTRRRLAQTMGAHETVDPAQRSPFEVAAPAVVFEAVGAPGILNDVMRRA
PAHTRVVVAGVCMEPDTVMPFYGAPKELSIQFVFAYDVGEFAETLRAIAE
GAIDVAPLITGEVGLDGVGDAFATLSRPAEQCKILVTP
108801734YP_641931.1 alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]MCLGETVITPTERLVGTNGVRLRVVEAGERGAPVVVLAHGFPELAYSWRH
QIPVLAEAGYHVIAPDQRGYGGSTRPDAVEDYDIVALTGDLAGLLDDVGA
QRAVVVGHDWGSPVVTNFALLYPDRVAGMVNLSVPPVPRASDPPTQIWRK
TFGDHFFYILYFQEPGVADADLGRDPRQSLQRMLALEGFSAPAPDLADNP
LPPLPEWMSQEEFDHYADVFTRTGFTGGLNWYRNFDRNWELTATTPAATI
TVPTLFIAGSADPVLSFTPRHRVTDLVTGEYREVLLDGAGHWLQQERPDE
VNALLLEHLAGLELT
108801732YP_641929.1 GTP cyclohydrolase I [Mycobacterium sp. MCS]MTRSYDSATVKIADFDQPRAEAAVRELLIAIGEDPDRHGLVDTPARVARA
YREMFAGLYTDPDDVLNTTFDEQHDEMVLVKDIPMYSTCEHHLVAFHGVA
HVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERLTAQVADALMRKLDPR
GVIVVMEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKASRAEALDLILR
K
108801730YP_641927.1 dihydroneopterin aldolase [Mycobacterium sp. MCS]MSDRIELRGLTVRGNHGVFDHERRDGQDFVIDLTVWLDLAPAAASDDLAD
TVDYGGLAQRAAGIVAGPPRDLIETVAAEIADDVMKDQRIEAVEVVVHKP
EAPIPLTFADVAVVARRTRAREERK
108801728YP_641925.1 hypothetical protein Mmcs_4765 [Mycobacterium sp. MCS]MGPTRKRDLAAAVLIAGIVGYLAALLAYPRYFPPISLWTGLSLLGVAVAI
AAWGVNVRNKIRDGEIGDGPGRLHPLAVARSVVIAKASAWVGAPVLGWWA
GVLVQILPQRGALRAAGEDVPGVVIAAASALALTIAGLWLQNCCKSPPEP
PEDPDPSSD
108801726YP_641923.1 NAD-dependent glycerol-3-phosphate dehydrogenase-like protein [MycobacMEQPPAPSWGPPGDLRPARLSVGIISAGRVGTALGVALERAGHVVVACSA
ISQASRRRAQRRLPDSAVMPIHDVADRAELLVLAVPDAELSAVVSGLAAT
GTVRPGAIVAHTSGANGVGILAPLSERGCIPLAIHPAMTFTGADEDIARL
SDACFGITAADDVGYAIAQSLVLEIGGEPFRVREDARPLYHAALAHAGNH
VTTVILDAVEALRSALWGQELLGQELVGDAPGGIAERVIAPLARASLENA
LQRGQAALTGPVARGDAPAISAHLRALAEVNPELAEAYRTTSLRTAQRAH
ASEDVFAALAAQS
108801724YP_641921.1 aspartate alpha-decarboxylase [Mycobacterium sp. MCS]MLRTMLKSKIHRATVTQSDLHYVGSVTIDADLMDAADLIEGEQVTIVDID
NGNRLVTYAITGARGSGVIGINGAAAHLVHPGDLVILIAYGTMEDAEARA
YQPRVVFVDADNRQVHLGADPAMVPDTAVDLMSPR
108801722YP_641919.1 hypothetical protein Mmcs_4759 [Mycobacterium sp. MCS]MRSPIDHGAVAALADQPLDWRYKGLPAEWWGATPAQICGDSPELFSAGVL
GPVCVLRASALTHNLVTMARWCRRRGVELAPHAKTHLAPQLLARQFDAGA
VAVTAATVSQVRILRAFGVRDVLLANEVVDRAGLVWLAREMAADPEFRMV
CWVDSLRGVELMSAALADAGRPLDVCVEVGMAGGRTGCRTTADVDAVARA
VTASPRLRLVGVAGYEAACGQDVNAEALAVVTGYLTDVRTAVERLATAFE
TDDVLVTAGGSTYFDLVTDVLTGGWPAGLTVRTVLRSGCYLTHDDGLYAR
TSPLQRAGAGGLTAAMSVWAQVISRPEEELALVGMGRRDVSFDQGLPVPR
LLPGSEVTRLNDQHAYLRLGADDTGVRVGDWLEFGVSHPCTTFDKWPMIP
VLDDGNRVVDLIRTYF
108801720YP_641917.1 DNA-bridging protein Lsr2 [Mycobacterium sp. MCS]MAKKVTVTLVDDFDGEGTADETVEFGLDGVSYEIDLSSKNAKKLREDLKQ
WVEAGRRVGGRRRGRATGPTRGRGAIDREQSAAIREWARRNGHNVSTRGR
IPADVIDAFHAAT
108801718YP_641915.1 hypothetical protein Mmcs_4755 [Mycobacterium sp. MCS]MTSQQARKTRVPAIDLSATRAAVWLSATAFLALLVLYFLGFDQGATSVFG
ADNTAIHEFVHDARHLLGFPCH
108801716YP_641913.1 phosphoglycerate mutase [Mycobacterium sp. MCS]MSEVVRLTLVSHAMTDAVSAGRFPTDEPLNAQGHRQADACVELGPTDAAY
CGPEKRTRQTAELLGLHAVVDPLLADLDHGRWRGDVLGGVEPAELAIWLT
EPAQAPHGGETVVQVIERVRRWMDSMAGRRGRFVAVTHPAVVRAAILVAL
DAPARSFWRIDVAPVSRTVLHFRGHAWTLRSSP
108801714YP_641911.1 antibiotic biosynthesis monooxygenase [Mycobacterium sp. MCS]MPSQNPVVKINAIEVPPDAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVK
GENRYFVVTQWETEEAFQAWATGPAIEAHKGQAANPVATGASLLEFEVVL
DVAGSGDKA
108801712YP_641909.1 hypothetical protein Mmcs_4749 [Mycobacterium sp. MCS]MSTALISLAVLSPFALTAVLIWTARRAGVLRWDLDQFRVWAPMAGRFDSR
YDEDRDSYRVQHDLDAIRTRFEEHPVWPTSGALGERR
108801710YP_641907.1 GAF sensor-containing diguanylate cyclase/phosphodiesterase [MycobacteMTRTLDQVVTAAAAELMAATATNVVESCTRVLADVVAHLGVDFSFLRHND
HTIKATKLVAEWPIRDYIPDPDPIGTIYFAEADPVFRQAEYLKTPLIVRP
EPDNDDYQRRIEEGRGVPSVSMACVPLLSGEMTSGILGFIKIGDREWTTE
EQNALQAIATLFAQLQARIAAEEQLQYLAEHDDLSGLLNRRALMAHLGLR
LAEGQPGPVSVLFLDLDRLKTVNDYLGHSAGDQFIKMFAERLRAGTEKPA
VIARVGGDEFVVVPDEPMDVVAVESFARRLQTWLQRRVVIDGEMLARTVS
IGVAVGTPGDDTTSDLLRRADQAALSAKSTGGSKTAVFTTEMASQHAIRN
DIELHLEGVIDEASSALVLHYLPEIDMRTGKVLGTEALVRWRHPTRGLLL
PESFIGVAESINLAGKLGRLVMRSACADFARWRSRRTAGDAILRINVSPV
QLVSDGFAATVAGTLDEFGVDGSAVCLEITESVVVQDIEATRHTLAALKE
VGVRIAIDDFGTGYSVLTHLKSLPVDTVKIDRSFVRDLGASPGDLAIVRA
ILALADAFELEVVAEGVETVAAAKTLLELGCPRAQGFMLSRPVDAAAMEA
LFREGRIAVDAWRDDAATVNGRQ
108801708YP_641905.1 carbonic anhydrase [Mycobacterium sp. MCS]MTAWKALKEGNERFVAGRPEHPSQSIDYRASLAEGQRPTTVVFGCGDSRV
AAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEFAVTVLEVPLIVVLGHDS
CGAVKATLAALDEGVVPGGYVRDIVERVTPSILLGRRDGLSRVDEFEERH
VNETAVQLRDRSSAIASRIEAGKVAIAGVTYHLADGRAQLRAHLGDIGEA
108801706YP_641903.1 DNA integrity scanning protein DisA [Mycobacterium sp. MCS]MAVKNARTSSNVVQLARPTLRETLGRLAPGTPLRDGLERILRGRTGALIV
LGYDDSVETICDGGFELDVRYAPTRLRELSKMDGAVVLSSDGTRILRANV
QLVPDPSIPTDESGTRHRSAERTAIQTGYPVISVSHSMSIVTVYVAGERH
VVPDTPTILSRANQTIATLERYKSRLDEVSRQLSTAEIEDFVTLRDVMTV
VQRLEMVRRISLEIDADVVELGTDGRQLKLQLEELVGDNDTARELIVRDY
HANPDPPTPAQVSATLEELDSLSDNELLDFTTLARVFGYPSTLEAQDSAM
SSRGYRAMAGIPRLQFAHVDLLVRSFGSLQGLLAASADDLQSVEGIGSMW
ARHIREGLSLLAESTIADRLA
108801704YP_641901.1 hypothetical protein Mmcs_4741 [Mycobacterium sp. MCS]MNRIHPRASAVTAGLAACGLAFALTACGSGQISQTATQAPAVNGVNAGTG
DVSLRNVHLRAPQTSDYVRPGSDVELLFVATNDSPDQPDKLVSIRSDIGS
VPVRGKADIAPGGVLVAGEPDGQTAALESVEPAEPLTVDVKLTKPITNGL
TYPFTFAFERSGEVTVQVPISAGEAPRRDDSGGGGSEHSGGH
108801702YP_641899.1 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [MycobacteriuMTTVAVVPAAGSGQRLAAGAPKAFVNLAGRPMLERAIAGLRNSGVVDSIV
VAVPPSRTDEAKLVFGGEALIVAGGADRTESVRAALAAVGDADYVLVHDA
ARALTPPSLVARVVRALEAGHSAVVPGLPVADTIKAVDANGAVLGTPERA
GLRAIQTPQGFHIDVLRRAYARAGDGGFTDDASMVEQAGGQVQVVEGDPL
AFKITTPLDLVLAEAILAGAR
108801700YP_641897.1 cysteinyl-tRNA synthetase [Mycobacterium sp. MCS]MTDRADADRPATSPTGLRLYDTMTGAVRDFVPLRDGHVSIYLCGATVQGL
PHIGHVRSGVAFDVLRRWLTAKGLDVAFIRNVTDIDDKILNKAADAGRPW
WEWAATYERAFSAAYDALGVLPPSAEPRATGHITQMVELIERLIDRGHAY
TGDGDVYFNVATLPDYGKLSGHRIDDVHQGEGVATGKRDQRDFTLWKGAK
PGEPSWPTPWGRGRPGWHTECVAMCEAYLGAEFDIHAGGMDLVFPHHENE
IAQAEAAGDGFARFWLHNGWVTMGGEKMSKSLGNVLSIPAVLQRVRAAEL
RYYLGSAHYRSMLEFSETALQDAVKAYAGVEDFLHRVRTRVGTVVPGDWT
PKFAAALDDDLSVPIALAEVHAARAVGNRALDSGDHETAMTQARSIRAMM
GILGCDPLDERWESRDETSAALAAIDVLVRWALDSRADARNRKDWATADQ
IRDRLKEAGIEVTDTADGPQWSLLDGDSKDV
108801698YP_641895.1 arsenical pump membrane protein [Mycobacterium sp. MCS]MLLALLLLVVVLAFALARPRGWPEAVAAVPAAGLLVATGALSVDEAVAEI
TRLAPVVGFLAAVLVLAQLCDDEGLFHAAGVLMARRGAGDPRRLLTVVFV
VASATTAILSLDATVVLLTPVVLATARTLSIPAAPHVYATAHLANSASLL
LPVSNLTNLLAFTAAGLSFTHFAALMTLPWLAAIVGEYILLRALFRNDLA
AVPAPDKTVPAPELPLFVLVVLGLTLGGFAVTSLLGLSPAWAALAGAVVL
GVRSLAQRRSTVAGIVRSANVPFLAFVLCLGVVVEAVMVHGLDDAMRQAL
PAGDGLVALLGIAAVAAVLSNVVNNVPAVLLLLPLVAGAGPAAVLAVLIG
VNIGPNLTYVGSLANLLWRSIVRGENIPAGVLQFSRVGLCTVPLTLVASV
FGLWAGLALFT
108801696YP_641893.1 hypothetical protein Mmcs_4733 [Mycobacterium sp. MCS]MQRFDVPAAGPDSALTVTWAGVTTLLVDDGSSALMTDGFFSRPGLASVGL
RRIGPSAARVDGCLARLRVDRLDAVLPVHTHFDHALDSALVADRAGAVLI
GGASAALLGRGHGLPESRISTVTSGATITAGAYDLTLVESGHCPPDRFPG
AITTPVTPPARASAYRCGEAWSVLVRHRPTAHTVLIVGSAGFVPGALHGT
RADVVYLGVGQLGRQPEAYLRDYWEQTVRAVGARRVVLIHWDDFFRPLHR
PLRALPYVADDLDATMRGLSRLAEIDGVPLHLPQLWQRADPWR
108801694YP_641891.1 50S ribosomal protein L28 [Mycobacterium sp. MCS]MSAHCQVTGRSPGFGNRVSHSHRRTRRRWRPNIQTKTYYVPSEGRRVTLR
VSAKGIKVIDRDGIDAVLARIRRQGGKI
108801692YP_641889.1 major facilitator transporter [Mycobacterium sp. MCS]MVAFDRSTGDDTQRWAYPLLLVLSGVALGVSGLPAPLYGMYEANWHLSPL
ATTIIFAVYAIAALGAVLVSGRISDVVGRKPVLIAALAALVIGLGVFLVA
DNMALLLLARAIHGAAVGSIVVAGAAALLDLRPHHGVRSGQLSGVSFNIG
MTVAILGSALLAQYAPHPLRTPYAVVAVLCLIVGAGLLALREPHIARTRG
RIRVAKPAVPQEIRGDFWFSALGAMASWSVLGVLLSLYPSLAARQTHIDN
LVFGGAVVGTTAFAAALAQLASTRVPARRAAIVGDIGMALSLLLTIPVLL
SHQWPLVFVAAALLGATFGLGFGGSLRHLSDVVPAGRRGETMSAFYLAAY
TAMAVPTLLAGWAATTWELVVVFPWFAVAVATACVGAAVAGMRSARAAAA
EAY
108801690YP_641887.1 LamB/YcsF family protein [Mycobacterium sp. MCS]MSASSVDLNADLGEGYGVWTLGDDDAMLDIVTSANVACGFHAGDPARLVR
VCRAAAARGVRIGAQVSYRDLEGFGRRFIDAAAEELAADVMYQIGALSAL
ATAAGTTVSYVKPHGALYNAIVTHRDQARAVATAVHAVDPGLLVLGLPGS
AFLDEARELGLQTVTEAFADRAYQPDGQLVSRREPGAVIHDLDEVADRVI
SMVTAGRVTAIDGSTVEIAVKSICVHGDSPGAVHIAAAVRDRLTAEGVTL
APFS
108801688YP_641885.1 hypothetical protein Mmcs_4725 [Mycobacterium sp. MCS]MRGNVFLGDAMTHGMLPGVALSALLGFDVLVGGFVAAVAMAVGVAAIGRS
SKLSSDTSIGLLLVGMLALGVVIVSRSQSFAVDLTGFLFGDVLAVQTADL
VTLGVALIVTLSAVVVGHRAFVAVTFDARKAATLGLRPDIAVPTLTVLVA
IAMVASFHVVGTLLVLGLLIAPPATALLWVRSIPRVMTVSAVLGSLAVYV
GLLISWHADTAGGATIAGVAVLMFFASTVARRIVAKWKPAVRSMGSVAAS
VCLVTACSGGAAPPAAPSAEGPGDEVVVEGARELDGPLTRLVLVDPGSGA
TAVYDAVDETETPIGEFGPVAVSAVTAASHIWRRATARRSWTPVHGPSTT
ATTTTTSPPIPRSSGPSTGRWLR
108801686YP_641883.1 periplasmic solute binding protein [Mycobacterium sp. MCS]MQTAADAGVPTLTLGDHLDPIRYAQGDTAGAPDPHFWMDPQRMITAVDVI
EQAVSRAVDGVDVAVVARNAERYRAELRALDGSMSLKFNAITEGRRKLVT
NHHVLGYLADRFGFQVIGAIVPSGTTLAAPSPSDLQSLAGAIRSARVPAV
FVDSSQPERLAHVLAEQAGVHVRIVALYTESLGPPGTSGATYLDMIRANA
DAIVNGLS
108801684YP_641881.1 Cob(II)yrinic acid a-c-diamide reductase [Mycobacterium sp. MCS]MSRLDRRIPTLSVVTDHAFTDAERHAVYRAITERRDMRRFVPGEKVPDEV
LARLLAAAHAAPSVGLMQPWRFIRITDPALRRDIHALVDEERHHTAEALG
PRGEEFLALKVEGVLDCAELLVVALRDGRERHVFGRRTLPHMDLASVSCA
IQNMWLAARAEGLGMGWVSIFDPRRLAGLLGMPDGAEPVAVLCLGPVPDF
PDRPVLELDRWALGRPLAEFVTENRWD
108801682YP_641879.1 periplasmic solute binding protein [Mycobacterium sp. MCS]MTACSGGGDSAAPSAQPGGECPTEPVSVVVSVDQWGGIVSQLGGQCATVS
TVVASSSVDPHDFEPAPKDAALFEGAQLIVVNGGHYDEWASKLAEGSAPD
APVIDAAEVSAEAADVGADMHAANPHIWYSPAAVTAVADAVTAELGRLAP
DAADYFTERQAEFGDALAPYHQVIGSIKATAAGKTYAATENVFDDMAAAV
GLTNRTPPGYQATAANESDPSPADLDAFLRLLGDRGVDVLIYNVQTEGSV
PQQIRAAAERAGVPVVEVTESVPPGAASFQAWQVDQLSALAEALGVGG
108801680YP_641877.1 hypothetical protein Mmcs_4717 [Mycobacterium sp. MCS]MTTSLMALSYQDNWWQILTSAFMRNALLGGTIVALAAGLIGYFVVVRNTA
FAAHALAHIGLPGATGAALLGLPVALGLGVFCIGGALVIGALGRRAADRE
VATGTVLAMATGLGLLFNSLATRNSSTMTNVLFGNLLAITGEQIVSFAVL
LGVLAAGIGVIYRPLLFTSVNAQVADAKGVPVRGLSVVFMVLLGLTVTMA
VQAVGTLLLFALVVTPAAAAIMLTARPAAAIALSTAVNLVAVWFGLALSA
MFNAPPSFIIVTIACGVWAVVWAVERGLRSSADRVLVT
108801678YP_641875.1 hypothetical protein Mmcs_4715 [Mycobacterium sp. MCS]MLTPDELTARTARAVAAAASAGRDLGLHVDEPRVLYDVFSVIVHLAPAPV
AVRVPTVLPPSLRARPDRQTAQQHAELAVAGWLADRGFPVVPPSPLVPRE
PVVHDGFSMTFWRYLDAVSDAEPDWPQRCASTARLHAALRDHPGEGLGFW
TQFDTYIPAALAELEHHPDLLDRADLHRAQRDWDRIAPILTSRAAFESAF
PGVDVQPIHGDAPFHNMIVTPTGEYWSDFESVTLGAVESDLAMVGPEGRA
AYDAAATELGLRTLDDRVVALTESAGLLAAVACLAMAPQLPMLVDALAPT
VDLWRARSG
108801676YP_641873.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSSPASSSGSRPREVMNVAVLAESELGSEAQRERRKRILDATLAIASKGG
YEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALGREFERIDAKTDRAA
LAGGTPYQRLNFMVGKLNRAMQRNPLLTEAMTRAFVFADASAAGEVDHVG
KLMDSMFARAMSDGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSK
RLDLAVRLLIGDGDRPKI
108801674YP_641871.1 hypothetical protein Mmcs_4711 [Mycobacterium sp. MCS]MNRLAAAGAAALLTALLTHPATAAAAANSAMTSIAVDPATKIEMHVNANC
VGNRCMFDTTANLMTPGGPTGFPGDAWSRQTITLRSNDRNVWQEAEYSAP
AGTPREVKGANHNNVLSKMYKSLRDVEISVTSFGGGPIERYRIDGASMPT
EWATGQLATRAAFIVCSHIQVVYGGVNLTTPDACAQTTFG
108801672YP_641869.1 acyl-CoA dehydrogenase- type 2-like protein [Mycobacterium sp. MCS]MTSIEQRDAQAVLSGIDDLLPTLRQRAQEAEDLRRLPDETVKDLDEIGFF
KLLQPQQWGGMQCDPSLFYEAVRRLGSACGSTGWVASIIGVHNWHLALFD
QKAQDEVWGDDPSVRVSSSYAPMGAGTVVDGGYRVSGAWQWSSGCDHATW
AFLGGPVIKDGKPVDFGSFLIPRSEYRIDDVWNVVGLKGTGSNTVVVEDV
FVPRHRFLSYKAMNDGTAGGFENNTAPVYKMPWGTMHPTTISAPIMGMAY
GAYEAHVEHQGKRVRAAFAGEKSKDDPFAKIRIAEAASDIDAGWRQLIGN
VGEEYALLAAGKEIPFELRARARRDQVRATARAIASIDLLFEASGATALG
IDQPVQRFWRDAHAGRVHAANEPERAYLIFGNDAFGLPPQDTMV
108801670YP_641867.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSIRSLGYLRIESTDVAAWREYGLNVLGMVEGKGTVDGALYLRMDEFPAR
LVIVPGERDRLLQSGWETANAEGLQEIRNRLDVEGTPYKEATAAELADRR
VDGMITFDDPSGNTLEIFHGVALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDAESTHFYRDVLGFKLRDSMRLPPQLVGRPADGAPAWLRFFGVNPRHH
SLAFMPGETPSGIVHLMIEVENSDDVGLCLDRALRRKVPMSATLGRHVND
KMLSFYMKTPGGFDVEFGCEGLEVEDENWIARESTAVSLWGHDFSVGFK
108801668YP_641865.1 hypothetical protein Mmcs_4705 [Mycobacterium sp. MCS]MEPSPAAESSGEMTVVYEDAATPEAVNGRRVLTENRLLESLAADVNDSFV
LPEDVRLVGAQCDEANAFWSSDDRTVTICYEDADLSLTTFEQAGDPDPVA
ATIGAERATFYHELGHATLDLYDLPFTGREEDVADQLAAVMLLEPDDTGA
IDPTDVRAAAAYARMFEANSEQDGGAAQDFPFWDVHEYDLARMYNFQCWI
YGADPAGNAFIVDEGLVPEDRADSCEGEFDRMSRAWWDMLDPHLRSE
108801666YP_641863.1 LysR family transcriptional regulator [Mycobacterium sp. MCS]MANRAPSICKTADMPISSPRRPSADDLLVLLAVGRTGRYTTAAEELGLNH
TTISRRIAALEQSIGGRLVARVAGGWELTDLGREALAAAEAVESAVRSLS
VDPAGRRALEGVVRISATDGFSAYIVAPAAALVQRDHPGVAVEIVATTRR
ASQQRSGLDVEVVVGEPQVHRAEAIRLGDYCLGLYGSRDYLAEHGTPSDV
DDLARYPLVYFIDSMLQVDDLDSATGFAPAMRESVTSTNVFVHVEATRAA
AGLGLLPCFMADRHDDLVRVLPNAVSVRLTYWLVTRAETLRRPEVDAVVE
AIRARVHEQRDVLLGAP
108801664YP_641861.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MRDLAGRTALVTGGASGIGEACARELAARGATVTVADRDETAATALADEI
GGSAWVVDLLDVSALEGLALDTDILVNNAGVQRIDPIVDFAPENFRMLMT
LMVEAPFLLIRAALPYMYAQKFGRVINISSVHGLRASEYKVGYVTAKHAL
EGLSKVTALEGGPHQVTSNCVNPGYVRTPLVTKQIADQAKVHGIGEDDVV
TQILLKESAIKRLVEPSEVGSLVGWLASPQSGMVTGAAYTMDGGWSAR
108801662YP_641859.1 hypothetical protein Mmcs_4699 [Mycobacterium sp. MCS]MGAATVGAMFESVFDVDPDAGEAELRAQVEQLERLKSSAAAAQARATALW
AAKRRATEAASGMPKRKRGRGLATEVALARKDAPVCGNTHLGMARALVHE
MPHTLAALECGALSEWRATLIVKQSACLSVEHRRHLDAELCADVSKLDGW
GNRRIEAEAKKITTRLDAAAVVARSAKAAGDRCVTIRPAPGTMAYVTALL
PVAQGVAVYAALKREADTTFDDRSRGQVMADTLVERVTGRPAEKPVPVSL
NLALADTTLVGDDDEPGWCEGYGPVPAGVVRALVSDAVADEAAKATLRRL
YRHPASGQLVAMESKARTFPKGLAAFIDIRDQTCRTPYCNAPIRHHDHAE
PHRQGGPTSARNGLGECEGCNYAKEAPGWTVTTSDDGGEHRAEFRTPTGA
TYRSTAPPLPGPPVYARSIIEGGLSIDIVRFAAA
108801660YP_641857.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MSEERELLRETVAALVDKHASPAAVREAMTSERGYDESLWTLLCEQVGAA
ALVVPEELGGAGGELGDAAVVLEELGRNLVPTPLLGTTLAELALLSSDEP
DADALAGLAAGEQVGAVVFDPGYVVNGDIADVVIGVSDGQLSRWTSFEAH
PLDAMDLTRRLARVEPGDTVAIGADPGLADTAALLTAAEQIGAATRCLEL
TVAYTKDRVQFGRPIGSFQALKHRMADLYVKVQSAKAVVDEALAEPSPVS
AALARFSASEAFTAVAAEAVQMHGGIAITWESDIQLYFKRAHASAQLLGP
PREQLRRLETQVF
108801658YP_641855.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MDLTFDDATEDFRAEVREFLAAHRDDFPTKSYDCAEGFEQHRRWDKVLFD
AGLSVISWPERYGGRDATLLQWIAFEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQLDRVLPKMASGEEIWAQAWSEPESGSDLASLRSTATRTDGGW
LLNGQKIWSSRAVFGDRAFGLFRSDPEAQRHKGLTYVMFDLKAEGVTVRP
IAQLGGDTGFGEIFLDDVFVPDADVIGEVNDGWRAAMSTSSNERGMSLRS
PARFLAPAERLVAEWKKDRDPAYAERVADAWIKAQAYRLHTFGTVTRVAA
GGELGAESSVTKVFWSDLDVALHQTALDLRGADGELADLPAREEDPYNWT
DGLLFALGGPIYAGTNEIQRNIIAERLLGLPREPKGQAK
108801656YP_641853.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MIEVQEFRAEVRQWLADNLVGEYAALKGLGGPGREHEAFEERLAWNRHLA
AAGLTCLGWPVEHGGRGLSVAHRVAFYEEYAIANAPAKVNHFGEELLGPT
LIAYGTPEQQQRFLPKIVEVTELWCQGYSEPGAGSDLANVATTAVLDEEG
EHWLINGQKVWTSLAHWAQWCFVVARTEKGSKRHAGLSYLLVPLDQPGVE
VRPIIQLTGDSEFNEVFFDDARTDASLVVGEPGDGWRVAMGTLTFERGVS
TLGQQIEYARELSGIAELAKRTGAADDPLIRERLTRSWVGLRTMRSYALA
TMDVEQPGQDNISKLLWANWHRELGEIAMDIEGMAGLTLKDGDFDEWQRL
YLFSRADTIYGGSNEVQRNIIAERVLGLPRESKG
108801654YP_641851.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSTSAAGQPPTRRDELLELAATMFAERGLRATTVRDIADSAGILSGSLYH
HFSSKEEMIDELLRGFLDWLFERYHQIVATEPNPLERLKGLFMASFEAIA
TRHAQVVIYQDEAKRLSSQPRFSYVEERNREQRKMWVEVLNQGIAEGYFR
PDIDVDLIYRFIRDTTWVSVRWYQPGGPLTAEEVGRQYLSIVLGGITAGD
ERLLE
108801652YP_641849.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MKTNAAILWEYGGDWTVEEIDLDPPGDGEVLVSWEATGLCHSDEHIRTGD
LPAPLPLIGGHEGAGIVREVGPGVVGLAPGDHVVASFLPACGRCRFCSTG
HQNLCDLGAMIMAGTQLDGTYRRHVRGQDVGVMALVGTFSQYGTVPEASI
VKIDDDLPLARACLLGCGVTTGWGSAVNTADVSPGDTVVIIGLGGIGSGA
VQGARLAGAEKIVVIEPVESKRELAFRFGATHFVTTMEEANALVADLTRG
VMADSAILTVGLLEGSMLEDAANIIRKGGAVVMTALSTMADNQPTLGMMM
FTLFQKRLLGSLYGEANPRADIPRLLSLYREGKLLLDETVTHEYKLAEVN
EGYEDMRAGRNIRGVILHDH
108801650YP_641847.1 hypothetical protein Mmcs_4687 [Mycobacterium sp. MCS]MAEVKPEPSITAAVIGDVVASRSAPDRRALHRDLSGALRDAGFAFTVGDE
FQGTHPSVGAAIDAALTVRLAVAPDIDIRFGIGWGQVTVLDTETGIQDGP
GWWAAREAIEWTASAQRQPGLAAVRTSYRRAADVTGPNVDAVNAALLCRD
HLLGSLDDRSLRILKGLLSNHTKKDIAAAEHVSASAVSQRAGRDGLDLLV
LTSTYLRGVR
108801648YP_641845.1 putative CoA transferase subunit beta [Mycobacterium sp. MCS]MTEPTRAEVCAVACAELFRDAGEIMVSPMANMVSIGARLARLTFSPDILL
TDGEARLLADTPALGATGAIEGWMPFGRVFETLTWGRRHVVMGANQIDRY
GNQNLSAFGAIQHPKRQMFGVRGAPGNTINHATSYWVGGHSTRVFGESVD
IVSGVGWDKVDPDNPAYRFLDVYRVVSNLGVFDFNGPDHQMRALSLHPGV
EAEQVAENTSFEVHGLDTAEVTRLPSDEELRLIREVIDPKSLRDREIRS
108801646YP_641843.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MPITTKTVEPGIVSVTVDYPPVNAIPSRGWFELGDTITAAGRDRSTHVVI
LRAEGRGFNAGVDIKEMQNTEGFTALIDANRGCFHAFRAVYECEVPVIAA
VNGFCVGGGIGLVGNADVIVASDDAKFGLPEVERGALGAATHLSRLVPQH
MMRRMFFTAATVSAETLHHFGSVHEVVPREDLDESALRVARDIASKDTRV
IRAAKEALNFIDVQPVNARYRMEQGFTFELNLAGVSDEHRDAFAGTSKGE
TK
108801644YP_641841.1 short chain dehydrogenase [Mycobacterium sp. MCS]MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPAGGG
SAAQSVVDEITAAGGEAVTSGANVADWAQAEGLIQTAVDSFGGLDVLVNN
AGIVRDRMFANTSEEEFDAVIAVHLKGHFATMKHAAAYWRAQSKAGKTVD
ARIVNTSSGAGLQGSVGQANYSAAKAGIAAMTLVAAAEMGRYGVTVNAIA
PSARTRMTETVFAEMMSTQGNDFDAMAPENVSPLVVWLGSTESRDITGQV
FEVEGGKIRVAEGWAHGPQVDKGARWDPAELGPVVADLLAKARPPVPVYG
A
108801642YP_641839.1 hypothetical protein Mmcs_4679 [Mycobacterium sp. MCS]MDTVSDSDRIAAAEAYVDALATHRADAVPFAPGCVRIEVGLKTGFSGKHL
RRSLTGGPQYRIIVATTDRTFRVVGDEVHATFTVVTKARAAGRRVVAHVD
ETFLIPASDGLIHHIRARIRPAIVPA
108801640YP_641837.1 cytochrome P450 [Mycobacterium sp. MCS]MPGPNSCPIAPDFDFLDANLNLERLPVAELAELRKSEPVHWVDVPGGTGG
FGDKGYWLVTKHADVKDVSKRNDVFGSSPDGAIPVWPQDMTRDAIDLQKA
VLLNMDAPQHTRLRKIISRGFTPRAVGRLEDELRARAQKIAETAAAEGAG
DFVEQVSCELPLQAIAELLGVPQDDRDKLFRWSNEMTAGEDPEYADVDPA
MSSFELITYAMKMAEERAKNPTEDIVTKLIEADIDGEKLSDDEFGFFVVM
LAVAGNETTRNSITHGMIAFSQNPDQWELYKKERPETAADEIVRWATPVS
AFQRTALEDTELGGVQIKKGQRVVMSYRSANFDEEVFENPYQFDILRNPN
PHVGFGGTGAHYCIGANLAKMTINLIFNAIADKMPDLKPIGQPERLKSGW
LNGIKHWQVDYTGAGGPAIEQKCPVAH
108801638YP_641835.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MFIDLTPEQRRLQAELREYFSTLISPGERDAMETDRHNEAYRAVIKRMGA
DGKLGVGWPKEFGGLGFGPVEQSIFVNEAARADVPLPAVTLQTVGPTLQV
YGTEAQKKKFLPAILAGEVHFAIGYSEPEAGTDLASLRTSAVRHGDEYIV
NGQKMWTTGAHDADYIWLAARTDPEAAKHKGISILIVDTKDPGYSWTPII
LSDGAHHTNASYYNDVHVPADMLVGEENAGWKLITTQLNHERVMLGPAGK
VAGIYDRVHAWASKPGSNGVTPLENDNVRRALGEIRAVWRINELLNWQVA
AAGETIAVADAAATKVFSTERIQRIGRLAEEIVGAYGNPAEPDTAELLRW
LDSQTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR
108801636YP_641833.1 MaoC-like dehydratase [Mycobacterium sp. MCS]MSAPSVEVGTKLPELQIYGDPTFIVSTAIATRDYQDVHHDRDKAQAKGSK
DIFVNILTDTGLVQRYLTDWAGPSARIRSIGLRLGVPWYAYDTITFTGEV
TAVDDGVTTVKVVGANSLGNHVIATATIVLGDH
108801634YP_641831.1 PPE family protein [Mycobacterium sp. MCS]MGIMPDTSPYGSQTVTGPGWPNVDEETLAAAAASYEALAAKLSGSVVPQQ
QGQLMKLSDAWEGGGAVAAAGEASTIIGGHEANAAHAAAIAAKLREMEVA
VVRTKTMVNTMAQETQHECEAIQALPFSNTQQLVQARVKMGLSQNIAQVT
ASSTELANSFGVPPSIPTPGVPPTVPGQQAAQGAAKEAGQAGGQGSQQGM
QQMMQMASMAGQLPQQIGQMVSQVPQQMMQPLQQLSQPLQQLTSMFGQGG
KADSLGAAGLPFSSFSNHPLAGGSGAGGGGGMMRAASLPGSGGVSAQTPL
MAGLVGTNAVSVAPAEPVVAGSATVGGVAPVAAGAMGGMGGMGAPMGMMG
GRGSGGGGGTRAGLAAPEPLEYDVGEDVDDEW
108801632YP_641829.1 ATPase [Mycobacterium sp. MCS]MSKHRKQDDNTNGINKRLAAALAASGLYVAGNFMSPIGAVESARAATNGD
SDSGVVLAGRTSSGVPPALQSNNSAQQNDSWSYLWFLQSRDGGAREVTDT
RGGGLDGAALRGQHDANLRGALVRLSLAPSSGGFHLGSRAGVDFAESEHS
AVGFFHSVFNHFHSVIRDFVEFIHRLFAIHHGDDDDDDDDDDDDDDDDDD
DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DDDLEEAPAGGPPVGTPGDDDDDDVDGDDDVDGDDDDGNGNSPGENGNGP
GGNNPGGSGPGGSNPGGGNPGGSGNGPGGSGNGPR
108801630YP_641827.1 hypothetical protein Mmcs_4667 [Mycobacterium sp. MCS]MENSADRSHDCEDRPDIGRFLARANPGESVATAQPCDIRLTRADVDAAIA
LGGRYLVSAQREDGSFVYEVDWMTGEESADDNVVRQAGATWGVALLHRET
REPDHRAAVDRSLRKWDTAVREIDGRRWLADGEFRSGKLGAVALIGLSLL
ERLAVPEGLDDPARMRASLDALCRFVEDARSPSGGFQKAFDTRTGNHSGA
ADPYSSGEALLLLARSGIELGEPDRLERALAWAEEDYHEFVVRPLADEPD
PDVTKGYYQWGSMTWFAFATAGHAPETWGRRLIEQALWMVDVHRTLSRKR
NTGYAYEGIVPAWEWARRTGNEDTARKLACVVHQGLRKLCAWQLGHPLAS
SALRSAPEQFHGAVQNHARQSALRIDVTQHQLHALMYARRFSVDAAEHLC
ATDISAAPAVSVQTGRVQSVVATPGCWSECSCWAKTSAGVFQPRTFRGRL
LSVSATASRS
108801628YP_641825.1 Mur ligase- middle region [Mycobacterium sp. MCS]MKAVAFVKKRLEPQALVLPHCRTYRYGVDRDTVRGLNGNGYALLADATPL
AFPHGVPRLKVASVRNALTNLALATRASYPGRIVAVTGSAGKTSTCNMIE
DLLQVFGVPKRPTKNFNTFDGVNGEVANLTNEAIAVIEVAASFLSQRGGP
RPNVLRPEVAMITSIGEAHLEYFGSPQGVAEVKSNVFDLMSRGTAVIPRD
ADTYDYMVQRARAAGATTVSFGAHPSADAHLLSYSAADGVVEAEIFGERI
TYELGALGRHFARNSVGALGVVAALGLDWRRAAGALASSREVTGRGMTFD
VGSASGRFTLIDDAYNANPSSVRAAIEMLSERATPPRGRRIAVLADMLEL
GPRSEEFHRALAEPLLGAAIDRVYLVGDQMRALWDDLPSEIRGQYYPTVD
GLQAALDREFADGDVVLFKGSNGTELHKVVAHFKRATKRRSDAPKDLARS
EDTGFVQPAGRRRLEVRARHPKSSQSGSRRTSLVFVGDLSMGDCYLKRPH
LSVARHRLEENPWSFVELLAPLVQDKSLLVANLETVLAERPADPFRGMKK
YQGWDDPVRTLAVMQRLGVDAVSLANNHTMDFGVAPLRRTIAHLESTNIV
PFGAGENEVQAARPLSVSAPFGNVHIFAGYEFRTGYARKWNFYASGDAAG
VNPLTGRATGSLIADIARTRTDDPASVIVVYPHWSGARNYQWATDEMIGM
NSEFLDAGADFVIGHGAHRMQEIVSGREGTTVFSLGNFVFNSPGRYAKFG
SPTFSLVARLEIEDGDPVTGIGADLHIYPIMSDNRETGFRPRPVRKSEAV
QVYNILAGQSGARFREDFDLEHGDRGWYIGRTIPLSMAGGQRRRDAVTSP
A
108801626YP_641823.1 MaoC-like dehydratase [Mycobacterium sp. MCS]MPINLDEALGAELPPAEFSWTSSDVQLYHLGLGAGVDPMDKRELRYLVDN
TPQVLPTFGNVAQSFHMTEPPSVKFPGIDIELSKVLHASEAVTVPGPIPP
SGTGIAVTRFTDIWDKGKAAVIWSETTVTDPDGTLLWTQKRSIFARGEGG
FGGERGPSTSVEPPERAPDAEIDLPILPQQALLYRLCGDRNPLHSDPDFA
AAAGFPRPILHGLCTYGIACKAIVDEFLDGDVSRVSSYGARFAGVVFPGE
TLRANVWKDGDTLIATITAPSRDNAVALSGVELKPV
108801623YP_641820.1 acetaldehyde dehydrogenase [Mycobacterium sp. MCS]MPEKLQVAIVGSGNISTDLLYKLQRSEYLEPRWMIGIDPESEGLARARKL
GLETSHEGVDWLLAQDDKPDLVFEATSAYVHRAAAPRYEEAGIRAIDLTP
AAVGPAVIPPANLREHLDAPNVNMITCGGQATIPIVYAVTRAVTEQGGTV
PYAEIVASVSSSSAGPGTRANIDEFTKTTSKGVQTIGGAARGKAIIILNP
ADPPMIMRDTIFCAIPEDVDRDAIAQSIRDVVAEVQTYVPGYRLLNDPQF
DDPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIAKE
SLSLAGGAQA
108801621YP_641818.1 hemolysin III family channel protein [Mycobacterium sp. MCS]MQRVAPRATARRIPVRQHPRYRRSPERPSACNGPSVITGPPGPEAIEALQ
PDPVDELIVRPRARGLIHLVSAVVAVVAGAALVEVAWTGSASSRAGWAAL
IYVAAIIAMFGVSAAYHRVRWTSPSAEKWMMRLDHSVIFVFIAATYTPFA
VLALPPDTGTKALTIVWTGAAAGVALKMLWPSAPRWVGVPLYLMLGYVAL
LFAEALLIGAGFTVVALLAAGAVLYNIGAIFYGVRWPNPWPNTFAHHEFF
HAFTVAAAVCHFAAIWLVIR
108801619YP_641816.1 hypothetical protein Mmcs_4656 [Mycobacterium sp. MCS]MKIKTLAATSAMAGALGFAAMGIGSGFAHADPKPNPPVPGHDGWRPGDPP
GHNPFGPPGQVKKDPALGILPNPLYGVPPGHWDDPGYFGIPTTWLPPNYW
GPPLRVVFNPNVTAWGVWINDGLFVPLPR
108801617YP_641814.1 two component LuxR family transcriptional regulator [Mycobacterium sp.MIVDDHELFAEGLELLLARDWSEQFVIGGRTTFVEEAAELATSCDADLAI
VDLSMPPLGGVAAIRHIRARHPRTRILALSGTGDMQLAEDALRAGADGFL
SKTVRPEALVGPLTTIAAGLRVVDPALLDALLSGTRKPSPEVLTALTPAD
LKLWVLVSTGMETADIATRMMVSDRTAKRMVASLLNKLGVGNRIAAAALA
GRSGILDDLAEG
108801615YP_641812.1 cytochrome P450 [Mycobacterium sp. MCS]MTTVFPETTHGDIDLSAREFWAKPPVERDAAFAVLRRENPVAWSRPADSD
LLPPEQNLKGFWSLTKHEDIRYASRHPEIFSSAQGITMEDFPHEILMMSQ
SFIAMDAPRHTQLRGITLDAFKPRNMRRLQGWVQEHARDLISEMSHLGEG
DFVELVSVKLPGRIFGSFFGLPPGEIHEKTIDAAQRTLGWTDPDVRGDRT
ALELFAGAVMDLHETVTTLLPERRANPGDDLLSWMVQAEFDGVKMTDDEL
KAFFTLLAVAANDTTRHASAQAIYAFSQFPDQRDLLVADVEGRVDSAVEE
ALRWASPLIHMRRTATQDVTVRGAEIKAGDKVVLWYSSANRDEDVFDDPF
TFDIERNPNPHLAFGGGGPHFCLGAALARTMLRSLLTEVYTRIPDIHAPE
PKFQVANFINGINSLPATWTPERR
108801613YP_641810.1 betaine-aldehyde dehydrogenase [Mycobacterium sp. MCS]MTGLPHYRMYVDGEWRDAAESIEVRSPATGAPVATVAYGDLTAVDDAVAA
ARAAHEAGVWRSMPPQQRADLLDAIADKLAARSDELTALQVRENGATVRG
AGAFLIGYAIANLRYFASLARSYAFQTSGPLIEAPTLASGLILREPVGVC
AGIIPWNFPLLLAVWKLGPALAAGNTVVLKPDDQTPLTLLELARAADEVG
LPAGVLNVVTGPGPVAGARLAEHPDVRKIAFTGSTEVGKGVMRAAADNVK
KVTLELGGKGANIVLEDADLDLAVDGSLFAFLMMSGQACESGTRLLVHES
VHDEFVRRLVARAETLVMGDPMSPATDLGPLVSAKQKARVEKYIALGQEE
GCRMAFQGTVPSDPALAEGHWVPPVILTGATNQMRIAREEIFGPVLVVIP
FRDDDDAVAIANDSEYGLSAGVWSADNGRALGIARRLESGTVWVNDWHMV
NAMYPFGGVKQSGLGRELGPDALDEYTEPKFVHIDLTNDRRKRAFAVVVS
AAAAESD
108801611YP_641808.1 IclR family transcriptional regulator [Mycobacterium sp. MCS]MAPTKADPSLPGRASPPTDRVVRILDFLADRPQERFGVSELARRVGLTKP
TCLGIVTALSEAGYLVRDPADKTYRLGPSLITLGHRAQESMRVSPAAREQ
LRLLSARFGATAALSAVVDDRITLLDLVAPAGVRPGVEVGQSYPFAPPVG
LMFVLWDEEAERDWLRRQPTIPLRTDTDRLRRVVAACRADGYLVERQTAG
GRRLYSLLAGMPTELPDELRALLGELVSDIGERVYLREESTGRGRHDVSV
ISAPVYDHYRRQVMVVSMHIGKPLTDNEISERARAVVATADAVTAQLGGV
VHPAGV
108801609YP_641806.1 short chain dehydrogenase [Mycobacterium sp. MCS]MALGLLKDKVVVVSGVGPALGTTLARRCAEEGADLVLAARTVERLEDVAK
QITDLGRRAVSVGTDITDEAQVANLVDQSLEAYGRVDVLINNAFRVPSMK
PFANTTFEHMRDAIELTVFGALRMVQAFTPALAEAKGSVVNVNSMVVRHS
QAKYGAYKMAKSALLAMSQTLATELGEQGIRVNSVAPGYIWGETLKSYFN
HQAGKYGTTVEEIYQATAAASDLKRLPTEDEVASAILFMASDLSSGITGQ
TLDVNCGEYKA
108801607YP_641804.1 UDP-glucose/GDP-mannose dehydrogenase [Mycobacterium sp. MCS]MTTFCEPTVSDHLRSDVAQPLHGVGIVGLGYVGLPTALAIAESGVAVLGC
DISESRIAAIKAQRVDLLAGDLMSLNRLLDTDLLTLTTEVAGLAAVDTVL
ICVPTPVDTHLVPDLTALRAACATVVDAARPGQTIVLTSTTYVGCTRELL
VEPLARRGLVAGRDVFVAFSPERIDPGSPAHVPERTPRVVGGVTDACAVQ
ATRTLVRSAASVHQVSSPEAAELTKLLENTFRAVNIALANEFSDVAKNFG
VDVMEVISAAATKPYGFMPFRPGPGVGGHCIPCDPHYLLWQLKATRLPSP
VTEAAMASIASRPQAVVNRAQELLAEEGRPLAGSRILVVGVAYKPAVADV
RESPALHILEELHRRGAEVAFTDAMVESVWTESGHLARETDPAQGDWDLV
IAHTLHPAADHTWLSTVPLLLDAAYGLPDLPQRRVL
108801605YP_641802.1 polysaccharide deacetylase [Mycobacterium sp. MCS]MTATEDQPDPAADPRHHLVVTPEAFDAQLTALRAAGYTSITSDQYVDYLA
GGEVPERSVLLTFDDGTHGLWTYADKILERHGMHAVSFLITGNVGAKRPY
YLSWQEIERMADSGRWDFQSHTRKMHARLPIDAAGTLASEMTHRRWLFEK
NRPETLDEFEGKIRTDLLASVQDIVDHGLPRPTLFAFPFSDGYDDDRASS
DPQAAATALTVVREIFAGAFNNAPPQPLPAGARAAAVGMTGRIELTVDST
VEGLLESVRAKTPVAPGHAAPSRRPDLWTRLSDDTEAPLRIQGRGVRFDG
PGRWSGAAYGREATADWASYTATVTVGGLAARGVENGALIARVGTGEEVS
VQVSAKYARVSVGLGPAWKVLRDLPLRPGDRHTVTMEVSPTAIGVVVDGS
ARMSVPAGGGPAEYGGIGLSSSRTTEAAPWPVFTDLSVAPGRDVPNVKAG
VGVPTRS
108801603YP_641800.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MSTDTAHSGIREIDTGTLPDRYARGWHCLGPVNDYLDGEPHSVEAFGTKL
VVFADSKGDVKILDGYCRHMGGDLSQGTIKGDEVACPFHDWRWGGDGKCK
LVPYAKRTPRLARTRAWTTDVRSGLLFVWHDHEGNPPPPEVRIPEIPEFA
SDEWTDWRWNSILIEGANCREIIDNVTDMAHFFYIHFGLPTYFKNVFEGH
IASQYLHNVGRPDVNDMGTTYGEAHLDSEASYFGPSFMINWLHNNYGGYK
AESILINCHYPVTQDSFVLQWGVIVEKPKGMDEKMTDKLARTFTDGVSKG
FLQDVEIWKHKTRIDNPLLVEEDGAVYQLRRWYQQFYVDVADVTPEMTDR
FEIEVDTTAANEYWNTEVQENLARREGEKAEQPTP
108801601YP_641798.1 hypothetical protein Mmcs_4638 [Mycobacterium sp. MCS]MFPAHRQTTVKSVAAAVLLAGAATVGCDTPEGEVAGDPAVPAVEPVPTVT
TTSPAAGNDAAHRDYSQLLLQASDISDDEDTFTVRSTSGSPGGLPGASAL
FVNAEDTRAISDTVVVYPDAATATATLRNALPAVEKTVVGGTPRPAPVGT
DGTIVVGMSAEGPKAATLLIYTHGPALVRLHFESAPGDATTDEFVFTVGK
MQLIALRTGLTDEE
108801599YP_641796.1 acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]MAKNMAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADAGATMDDIDAV
VVGKAPDFFEGVMMPELFLADAVGATNKPMIRVHTAGSVGGSTAVVAASL
VQSGKYRRVLAMAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRA
YIRRSGAPTHIGAMVAVKDRLNGAKNPLAHLHQPDITLEKVLSSQMLWDP
IRFDETCPSSDGACALVIGDEEAADSRVAEGHPVAWIHATALRTEPLAYA
GRDQVNPQAGRDAAKALWAAAGINSPIDEIDVAEIYVPFSWFEPMWLENL
GFAAEGEGWKLTEAGETAIGGRLPVNPSGGVLSSNPIGASGMIRFAEAAI
QVMGKAGEHQVEGARKALGHAYGGGSQYYSMWVVSSDKRTQP
108801597YP_641794.1 hypothetical protein Mmcs_4634 [Mycobacterium sp. MCS]MTASQSSPALIETHEPPLSAPLKLSFDYTRSVGPLLGQFFTALREKRIVG
VRGSDGRVHVPPAEYDPVTYERLTEIVPVAGVGTVVSWTWQPAPLEGQPL
DRPFAWALIKLDGADTPMLHTVDAGDADKISAGTRVHAHWVDEPVGAITD
IAYFALGEDAEPEGEPSDPRTRGAQTDKDPVTMLVTPSSIEIQHTASAPE
STFLRALEEGKLLGARTGKDGKLYFPPREADPATGRPTTEFVELPDRGTV
TTFAIINIPFAGQRIKPPYVAAYVLLDGADIPFLHLVTEIEADQVRMGMR
VEAVWKPREEWGLGIDNISHFRPTGEPDAEYDTYKHHL
108801595YP_641792.1 hypothetical protein Mmcs_4632 [Mycobacterium sp. MCS]MTDTVSQHTIAGTVLTMPVRIRKANTHVAMFSVAAPAAQRMIDYTGLRVC
EYLPGRAVVMLMLVRYVDGDLGKYHEFGTAVMVNPPGSTAKGPGALASAA
AFIHRLPVDQSFTLEAGRRIWGFPKIMADFTVRETPRFDFEVSENGTFIA
GIEFARGVPIPSAVTARPQVLKTYSHTDGVLREIPWEMRNSGMSVRLGGA
RLRLGDHPYARELAALGLPKRAFASQASANVEMTFGDAQEIR
108801593YP_641790.1 hypothetical protein Mmcs_4630 [Mycobacterium sp. MCS]MTISKMRRMVGGATLCAGVLAATIGFGNGVAQAAVPPGATVPAAPIVATD
TGFAGHRGGYGYHPGHAFFVPRPYYDTWFAPWPYGFRGYYR
108801591YP_641788.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MSDAQVTEKQPDALVEQRGHTLVVTLNRPESRNALSTEMLSIMVDAWDRV
DNDPEIRSCILTGAGGYFCAGMDLKAATAKPPGDSFKDGSYDPSRIDGLL
KGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYP
MGGSAVRLVRQIPYTIACDLLLTGRHITAAEAKEYGLIGYVVPDGTALDK
ALEIAEVINNNGPLAVQAILRSIRETEGLHENEAFKIDTKIGIEVFLSED
AKEGPRAFKEKRAPNFKMK
108801589YP_641786.1 2-nitropropane dioxygenase [Mycobacterium sp. MCS]MRTELCDRFGIEYPIFVFTPSEKVAAAVTRAGGMGVLGCVRFNDSDDLEN
VLQWMDENTLGKPYGVDVVMPAKIPTEGTAVDINKLIPQTHREFVDKTLA
DLGVPPLPEDEARNEGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKD
VIDQVHEAGVPVAALAGSAKHAQRHVDNGVDIVVAQGHEAGGHTGEIGSM
VLWPEIVDALNGQAPVLAAGGIGTGRQVAAALALGASGVWMGSAFLTSAE
YDLGHRKPSGVSTIQEAMLRATSSDTVRRRIYTGKPARLLKTKWTEAWDA
PEAPEPLPMPLQNILVSEAHQRMNESDNPDTVSMPVGQIVGRMNEIRPVA
DIIAELVSGFDEASKRLDGIREG
108801587YP_641784.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MGADPTVANLLRPLADVDDRGIHADGEFASWREHIRSAAAVGAALRGRLD
PATPPHVGVLLGNTPFFSRVLVAAALAGLVPVGLNPTRRGEALVRDIEHA
DCQVVLTDDPTGVPDGVEFIDVESAHWRAELAAYADTPVRFADPDPDDLF
MLIFTSGTSGEPKAVRVTHEKVAVPGRMLAARFGLGPSDTCYLSMPLFHS
NAVMAGWSVGVAAGASLALRRKFSASQFIPDVRRYHATYANYVGKPLSYI
LATPPRDDDADNPLKIMYGNEGAPRDLDRFARRFGVTVVDGFGSTEGGVA
IARTPDTPEGSLGPLGPDIAIVDVETGERCAPGQVGELINPNGRGQFRGY
YNDTAAEAERMAGGMYHSGDLAYRDENGFIYFAGRLGDWMRVDGENLGTA
PIERVLLRHNDVVEVAVYPVPDPAVGDRVMAALVLRPGAEFAVEKFQAFL
AEQSDLGPKQWPSFVRVSSSLPRTETFKVLKRHLSAEGTDCADPVYPITR
108801585YP_641782.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MRIGYTPEQEELRRELRSYFTKLMTPERAEALASNDGEMGRGNVYRETVA
QMGKDGWLTLSWPKEFGGQARPPMDGLIFNDEAAIANVPVPFLTINSVAP
TIMAFGTEEQKKFFLPKIASGDLHFSIGYSEPGAGTDLASLRTTAVRDGD
EYVINGQKMWTSLIAYADYVWLAVRTNPEAKKHRGISMLIVPTTAEGFSW
TPVHTMSGVDTSATYYQDVRVPVSNLVGEENAGWKLVTNQLNHERVALVS
AQPIFVALDGVREWAQNTHISPDGRGRRLIDSEWVQLNLARVHAKAEVLK
LINWELASTEAAPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRTNS
PGALLRGRVERMHRSCLILTFGGGTNEIQRDIIGMVALGLPRVNR
108801583YP_641780.1 3-ketoacyl-ACP reductase [Mycobacterium sp. MCS]MTTPRNDLTDLSGRVAVVTGAAAGLGRAEAIGLAAAGATVVVNDMSASLD
ASDVLDEIAAAGSKGVAVAGDISQRSTADELVETADGLGGLNIVVNNAGI
TRDRILFNMSDEEWDAVIAVHLRGHFLLTRNAATYWRAKAKAGDGKVYGR
IVNTSSEAGLSGPVGQPNYGAAKAGITALTLSAARALDRFGVRANAIAPR
ARTAMTAGVFGEAPDPSTDGIDPLSTDHVVTLVRFLASPASEAVNGQLFI
VYGPKVTLVAAPVAEAHFAAESDAWDLDDLSETLRGYFADRDPERGFSAT
ALMESRD
108801581YP_641778.1 hypothetical protein Mmcs_4618 [Mycobacterium sp. MCS]MSFDATVRLRRAFGWVPGAVDTMGEQALFYGETIRYIPNAVTRYRKETIR
LIAEMTMGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGNIGIEALT
GFLSAFLNVRIVAPVIAGIALAATIGAGTTAQLGAMRVAEEIDAVETMAV
HSVSYLVSTRLMAGLIAIVPLYSLSVLAAFFAARFTTVYINGQSAGLYDH
YFNTFLVPSDLLWSFLQAIVMSIAVMLVHTYYGYNASGGPVGVGIAVGQA
VRTSLIVVVTITLFISLAVYGASGNFNLSG
108801579YP_641776.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MKREGNLLNVGIFTVAMLLVAAMLVVVFGEFRFASGNSYHANFTEASRLK
AGQDVRIAGVPVGTVTDIKLNDDNTVDVAFDVHNKYQLYTSTRAVVRYEN
LVGDRYLEIISGPGELRKLPPGSTIPKQNTQPALDLDALLGGLRPVLKGL
DGAKVNELSSAVIELLQGQGGALANLLATTGSFSQNLAARDQLIGDVITN
LNTVLGTVDEKGAQFDASVDRLQQLITGLAQGRDPIAGAIEPLAAAENDL
TEMLKASRRPLQGVIENARPLAQRLDERKADVNKVIEPLAENYLRLNALG
AYGSFFNIFYCSVRIKVNGPAGSDILIPFGGPPDPSKGRCSENG
108801577YP_641774.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MKSHGRWMRVGLAALLVVTLAVGIYLVWPSRTGNKITAYFTSAVGLYPGD
EVRIVGVPVGKIDTIDPRAEDVKVTMTLDHGVQVPADAKALMIAPNLVAA
RFIQLTPAYTGGPVMQDGAAIGLDRTAVPVEWDEVKEQLTALSAQLGPQQ
GSMQGPLSAFVNQAADTFDGNGDSFRQALRELSQTAGRLGDSRTDLFGTV
RNLQVLVNALSNSNEQIVQFSNHVASVSQVLAESTADLDNTLGTLNQALL
DVRDLLDENNDALIGQISRLADFTQILTDHSEDIEQILHVTPNGLANFYN
IYNPAQGTVGGLLTLPNFANPVQFICGGTFDAAVTTDNYKRREICRQRMG
PVFKRITMNFPPLLAHPINSITAYKGQILYDTPATEAKAETPVPYLQWQN
APGVTPPDPAKAQEDLNALFLPPAPAAPAAPPPPGNSLNGVPLAPLPAEE
GHR
108801575YP_641772.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MLTRLTKLQLSIFAVVTVLTVGAISLFYLHLPAAVGIGAYDVTAKFTAGG
GLYENANVTYRGVTVGRVEKVGLADDGVVAQMRLNSGTPVPENVTATVKS
VSAIGEQYIDLVPPERASKSMLRDGADIGLNRTAIGQDISGLLEEADRLV
SSVGDSRIQDVLREAFKAFNGSGPELSRLIQSSRLLVDEANANYDEVAQL
IDQAGPFLDAQIRSGDDIRSLADGLADVTGNVAGADAQLRATLETVPGTT
EAANTTFEGIRPTFPVLAANLANFGRIGVIYHKSLEQALVIFPALLAALN
TVAGGVPADEGGKLDFKIHLNDPPTCSVGFLPPTSIRSPADTTLRDLPRD
LYCKAPHNDPTVVRGARNYPCMEFPGKRAATIQQCRDPEGFVPIGSNPWR
GPPVPIGEPIQDPRMILPQNKFPFIPPQVDPDPGPPVVQLPPGVQPGPGP
APHAPFPLPVPPNDPGVPPPLPYYAPPDQLVPPYGRPAPAPPPPPPSLAP
PPPADAPPVPAPEPAPGPGPLPGRLPGPLPAEAPMASGPTTATYDSRTGV
FADPAGGVGVYAPGADKLAPAENWADLMMAPRQM
108801573YP_641770.1 hypothetical protein Mmcs_4610 [Mycobacterium sp. MCS]MGKWPTRLAGVVSVLCAVVFVALAAVGGLLFWERVETRGAQEARAELAPL
AAEQIPKVFGYDYQTVERSLTEAYTMLAPEFRQEFRDRATKDIIPQARER
QVVSQANVVGVGVLDAQRDSAQVMVYLNRTVTEKNGKPIYDGSRLRVDYA
KVDGRWMIDYITPI
108801571YP_641768.1 hypothetical protein Mmcs_4608 [Mycobacterium sp. MCS]MPAKSDPADIGDVEPLADSTARQARKVVAAYAVDADECRVFLSMLGIGPS
KLEA
108801569YP_641766.1 short chain dehydrogenase [Mycobacterium sp. MCS]MLLSQLSLADRTYLVTGGGSGIGKGVAAAIVAAGGDVMLAGRNADRLAAA
ADELSAAAGDGAGQVRYEPTDVTNEDEAARLVEAATAWRGRLHGVVHSAG
GSETIGPITQIDSDAWRRTVDLNVNGTMYVLKHAARELVRGGGGSFVGIS
SIASSNVHRWFGAYGPSKAALDHIMKLAADELGPSWVRVNGIRPGLIQTD
LVGPILESPEVSADYRACTPLPRFGEVTDIANLSVFLLSDASSWITGQII
NVDGGHNLRRGPDMSGMLEPLFGADGLRGVV
108801567YP_641764.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MSNMHIGFIGLGNMGSAMAANLLAAGHDVTAYNRSPDKVDALSAEGARPA
RTVAEACQGDVVVTMLANDDAVEAVSFGDDGIVASLRPDAIHVSSSTISL
ALAERLTAAHAEGGSRFVSAPVFGRPEAAAAAKLFVVAAGAPDTVEALAP
VFEAIGQRTFVVGTEPKAANLVKVSGNFLIASVIESLGEAMALVAKGGVD
VDQYLDLLTSTLFDAPAYRTYGGLLARREFEPAGFSATGGLKDVRLALEA
GDGLQVPLPIASLLRDRFLTLLATGGGHLDWSAIGALSAWESGGPGPNA
108801565YP_641762.1 carbon-monoxide dehydrogenase [Mycobacterium sp. MCS]MKAAPFAYHRPDSVTEAVQMLSEFGDDAKILAGGQSLVPMLAMRLTHFEH
LIDISRIGELTGIDLVDGQIVVRAATPHALVGLDDEVADSVPLLTLATPH
IGHFQIRTRGTLGGAIAHADPAAEYAAVALALDAQIEAVSSRGRRDIAAA
DLFTGLWETSLAADEILTAVRFPVWSGRCGFAVEEFARRHGDFAIAGATV
ALELDGDDRVTRCAIGLLGLGSTPLRGVDGEQAVVGTRVSDISTDEIGRL
TLAAVTDVPADLQGSASYRRRVGAAMVSRALASAVAQVTSEEMIHA
108801563YP_641760.1 xanthine dehydrogenase- molybdenum binding subunit apoprotein [MycobacMTDTVATRYSGTRVARVEDNRLLTGRGTFVDDIQRPGMLHACFVRSPFAR
AKVNGIDASAALAMPGVYAVFTAEDLNGDAVESWHAVAGKDVPDTPRPPL
AEGEVKFVGDPVALVVAESRYLAEDAADAVQVDYEPLPAVADFRTAVNAE
TVVHEQYPDNVAGGMGGAPPDEETFSSAPCVVSENIYQQMYVPVPIETRG
MVVEWEPTTGELTLWASTQTPHELRAFTARLLGIPAQKVRVIMRDTGGGF
GQKVVPMREDMVIMLAARKVPGALKWIEDRRENLMSAGQSRHVDGTARMA
FDEDGTILAVDIDFNQDVGAYPTPYPVLTTAAIGMFFPGPYRVPKASFNY
KTVFSNTAGLHAYRGPWQYETLAREIMFDIAARKLGIDPVELRRKNILRG
DEMPYFNPNGMPYDHVAPADTFEQAVKILDHEGFRKEQAEALAQGRYIGL
GFSAYIEPTGAATGHLGTEGCTIRMEPTGKINVYVNGGSTGNSLETTVIQ
LTADALGADIDDVATIQGDTAITPYGAGTQGSRSAPMTAGAVNEAGGILR
AQLIRMAAHHLGVEVDDIELGGSKAYVREDPTKSVSFADIAYRAHYQPEH
LPPGGTATLEATARFTSMAMIHWANATHACTCEVDVETGQVTLTRYIVSE
DVGPMINPNVVEGQVAGGTVQGIGGALLESLVYDADGNPLSSTFVDYLLP
TATEVPPIEFGHVEIPGPGVGGYKGAGEGGAIGSTPAVINAINDALAPLG
VTVTRLPATPATIVELLEQANREDH
108801561YP_641758.1 alpha amylase [Mycobacterium sp. MCS]MRKIETGDLWWKNAVFYCADIETFYDWNGDGTVDIRGMTERIEYLFDLGV
TCLWLMPFYPTARKDDGYDIIDFFGVDQRLGNLGDFVELVRTARSKGIRV
IVDFVMNHTSDAHPWFKSARRSKDDPYRDYYVWSETEPKSSPADVVFPDQ
EDSIWEQEPKTGEWYLHHFYKHQPDLNIANPKVQEEISRTLGFWLQLGVS
GFRVDAVPFLFARDGVPGDPGVFDPYEYLGDVRNFVNRRVGDAVLLGEVN
VPYDDQKSFFGGPDGDGLNMQFDFIGMQNMYLSLARGDAGPIAAALRERP
PLDETSQWANFVRNHDELTLDKLGDAERQEIFDAFGPERDMQLYGRGLRR
RLPAMLGGDERRMRMVYSLAFSLPGTPVLYYGEEIGMAENLDIPGRFAVR
VPMQWTSDDNGGFSRAAARRLPRPITDGLYGPDRVNVADQRHDHQSFWWF
IRDLIYTYRQQPEIGWSTAEVLDQPNPAVLAHCCREKSGWTMVGLHNFGA
DRCMVPIQIEDAPEGSTLVDLLDGLSVHELDAKGRLEIGLDGYGYRWLRL
VRPGDDPII
108801559YP_641756.1 hypothetical protein Mmcs_4596 [Mycobacterium sp. MCS]MNLASWVLGLSFILLTIAIHTTAVVLMAFRLESRARARIDNHRRDPRREL
PAAIGRIGAVALILTALHGLEGVLWASAYTWLGAFESFTDASTFSLASMT
TFDLPGNTLPSRFHLFSVLEAVNGVLLFGISTAFLFAVMQVHWQVLFHHH
EPANQN
108801557YP_641754.1 hypothetical protein Mmcs_4594 [Mycobacterium sp. MCS]MKPWLQRSAVSAVVLGIVPLLELASPAVGHAQPPPPPCPPGMYWNFTTVV
CEFPPPPALYIDPWLPVYVPDVVDVDLDVDIPVPGPPGIGAPGRPNIGAP
GPGPRPPGIGGGRGGGRGGRR
108801555YP_641752.1 hypothetical protein Mmcs_4592 [Mycobacterium sp. MCS]MRCCLGCGATLSKRSQKIYCGNACQAAARRTASAKLWLESGQAWVDSRPD
HYIRVHLAAEQSGCCAICGGSSTWHGLPLTLILDHIDGNSTNNRRQNLRL
VCPNCDSQLPTYKSRNRGSGRAFRRQRYADGKSY
108801553YP_641750.1 two component transcriptional regulator [Mycobacterium sp. MCS]MAMAALSETTPEARVLVVDDEANIVELLSVSLKFQGFEVHTASDGASALD
KARDVRPDAVILDVMMPGMDGFGLLRRLRADGIDAPALFLTARDSLQDKI
AGLTLGGDDYVTKPFSLEEVVARLRVILRRTGRGAEEPKTSRLSFADIEL
DEDTHEVWKAGEPVSLSPTEFTLLRYFIINAGTVLSKPKILDHVWRYDFG
GDVNVVESYVSYLRRKIDTGERRLLHTLRGVGYVLREPR
108801551YP_641748.1 histidine triad (HIT) protein [Mycobacterium sp. MCS]MLGAMATVFTKIINGELPGRFVYEDDEIVAFLTIAPMTQGHTLVVPRAEI
DQWQDIEPAVFARVMEVSQLIGKAVVKAFGAERAGVIIAGLEVPHLHVHV
FPAYNLTDFGFANVDNNPSPESLDEAQSKIKAALAELG
108801549YP_641746.1 nuclear transport factor 2 [Mycobacterium sp. MCS]MTQEAVEQSPVVAASRASWRCVQSADKEGWLALMADDVVIEDPIGEAVTN
PDGNGVRGKDAVAAFYDANIGPNTLTVTCEATFPSSSPTEIAYILVLRTE
FPNGFVATVRGVFTYQVDAAGLITNLRGYWNMESMTFEEAKGD
108801547YP_641744.1 hypothetical protein Mmcs_4584 [Mycobacterium sp. MCS]MKGGTMTSSSKREELEQWVERWLQANRDAEKAGDWKPLADFYTDDATYGW
NIGPKEDVMCIGKEEIRDVALGLEMEGLENWVYEYQKVLIDEKQNEIVGF
WKQIVNKSDGTQDEIYGIGGSWFRLAAVGEDESLLIEWQRDFFDFGHVAK
GYAKLIESGDLTPTMQKRIERSLSGEKLPGYYPLGEAPAPIW
108801545YP_641742.1 cytochrome P450 [Mycobacterium sp. MCS]MTTAVVPRVSGGEEEHGHLEEFRTDPIGLMKRVRDECGDVGWFQLVDKHV
ILLSGAEANEFFFRSADEDLDQAEAYPFMTPIFGKGVVFDASPERRKEML
HNSALRGEHMKSHAATIEGEVKKMIAGWGEEGEIELLDFFAELTIYTSTA
CLIGLKFREQLDHRFAEYYHELERGTDPLCYVDPYLPIESFQRRDEARVK
LVALVQEIMNQRVADPPKDKADRDMLDVLVSIKDEEGNPRFSADEVTGMF
ISLMFAGHHTSSGTSSWTLIELIRHPEVYAAVQQELDELYADGQEVSFHA
LRQIPLLDNVVKETLRLHPPLIILMRVAQGEFEVAGFPIHKGDFVAASPA
ISNRIPEDFPDPDAFKPDRYDKPEQADVVNRWTWIPFGAGRHRCVGAAFA
TMQIKAIFSVLLREYEFEMAQPPETYRNDHSKMVVQLERPAKVRYRRRVK
A
108801543YP_641740.1 cytochrome P450 [Mycobacterium sp. MCS]MTLTSDVVLDPYDYDFHEDPYPYYKRLRDEAPLYRNEELGFWALSRHADV
LQGFRNSTTLSNKFGVSLDPVSRGPHASKTMSFLAMDDPAHLRLRTLVSK
GFTPRRIRELEPRVTELTLKHLDTMLERAGDGTVDYVAEFAGKLPMDVIS
ELMGVPEADRDRIRALADGVMHREDGVNDVPAEAIEASLNLIVYYQDMVA
ERRKKLTDDLTSALLEAEIDGDRLTDEEVLGFMFLMVIAGNETTTKLLAN
AAFWGHKNPDQLTQVYDDIDRVPLWVEETLRYDTSSQILARTVVGDLTLY
DTPIPDGDVVLLLPGSAHRDERVFDDPDSYVIGRDIGSKLMSFGSGAHFC
LGAHLARMEARVALTELVKRIRGYEVDEANAVRVHSSNVRGFAHLPITVQ
TR
108801541YP_641738.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MAILANGESRLLIDGKLVAGTAGTFPTVNPATEEVLGVAADADSDDMGRA
IAAARSAFDDTDWSTNTELRVRCLRQLKDALREHVEEMRDITIAEVGAPR
MLTSGAQLEGPIDDLSFAADTAETYEWRTDLGHATPQGIPTRRTLAREAV
GVVGAITPWNFPHQINLAKVGPALAAGNTLILKPAPDTPWCAAAVGEIIA
EHTDFPPGVINVVTSSDHAVGALLSQDPRVDMVSFTGSTATGRAVMTDAA
ATIKKVFLELGGKSAFLVLDDADLAGACSMAAFTAAMHAGQGCAITTRLV
VPRAKYDDAVEAAAATMGSIKPGDPTSKRTVCGPVISARQRDRIQGYLDL
ALQEGGRFACGGGRPADRDTGFFIEPTVIAGLDNNARVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVFSGDDARAQAVAARMRVGTVNVNGGI
WYSADAPFGGYKQSGIGREMGVAGFEEYTEIKLIATAAN
108801539YP_641736.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MSDLKYGYIGLGNMGAPMAKRLTGWPGGLIVFDVRPDAMAPLVEAGAAQA
DNVADVADADIISITVLNDEQVRHVVAELVPRAKPGTVIAIHSTISPDTA
VELAKELRSQDIHVVDAPVSGGAGAAEKGELAVMVGAERSVYERVKPAFK
QWASVVVHAGEPGAGTRMKLARNMLTFTGFAAACEAMTLAEKAGLDLQAL
GRVVRHSDAQSGGPGAIIVRENMRPLDHDNFLYDMFLHTRGLAEKDLGLA
LTLGEELDVDLPLAQVALQNLAAGLGVPHVESSTEE
108801537YP_641734.1 hypothetical protein Mmcs_4574 [Mycobacterium sp. MCS]MMSRYAALSREELATLVPELLLIGQLIDRSGMAWCISNFGREEMLQIAIE
EWAGASPLYTKRMQKALKYEGVDVITIFKGLQLDIGAPPQFMDFRYTVHD
RWHGEFHLDHCGALLDVEPMGEDYVRGMCHDIEDPTFDATALATNRRCQV
RPIHRPPRTPADRHPHCRWTVIIDESYPEVDFIPQLDIVSASRAYNTDLE
PIDPDDEGMSDYSGPLLSDVDFGAFSHSALVRIADEVCLQMHLLVLSFNL
AVAARAKDDPALARTIRTKQLIGIAGVAAERIRKALNLSKDVKGALRVLE
LHPLLNPAAYVWADVDPGFLHVRSSPAHEDGSWISLVSPAADLPLQAIVQ
AVDPHLRAEVSGLESDWTVRVIETDTAAKELPEVEVCKFSGGASWEFEDR
KSLPLTVV
108801535YP_641732.1 cytochrome P450 [Mycobacterium sp. MCS]MTTMESRCPFGPGFDFTDPDVLVQGIPVNEFAQLRKTAPVWWNEQQESIF
DDGGYWVISRHEDIKSISRNGDLWSTNAKGAVMRLPEGVTAEQLDLTKAL
LINHDAPEHTRLRKIVSRLFTPRSVAALEEKLAISARQIVAAAREKGSGD
FVTDIAMSLPLQAIADLIGVPEADREKLFHWTNCIMNTDDPDFDSDPTVA
NAELMGYAYNMAEERRRCPADDIVTRLIQADIDGESLGDVEFAFFVILLA
VAGNETTRNAMTHGMNAFFEHPDQWELFVRERPETAVDEIVRWATPVHCF
QRTALADVELGGVTIREGQRAGLFYSSANYDEDVFQSPFEFDILRDPNPH
LGFGGNGAHYCIGANLARMEIKLIFNELADQIPDIAKLGEPQRLRSGWIN
GVKELPVSYRG
108801533YP_641730.1 putative esterase [Mycobacterium sp. MCS]MAAMSAHLSRRAALRLAAGAAAGAAGVHALGAAAPAASVPPAAAPTYLTG
SFVSAARGGVQTNWAIARPPGQSAALHPVIALHGKGADAAQVMAGGVEQG
LAEAAAAGLPPFAVVAVDGGGSYWHRRASGEDSGAMVLDELIPMLDTMGL
DTSRVGFLGWSMGGYGALLLGARLGPERTAAICAVSPALWTSAGASAPGA
FDGADDFAANSVWGRPELAAIPIRIDCGTSDPFYSATEQFIAQLPNPPAG
GFSPGGHDGGFWSSQLPAEITWMAPLVAA
108801531YP_641728.1 amino acid permease-associated protein [Mycobacterium sp. MCS]MTHPDTVREQPELRRVMGPGLLLLFVVGDILGTGVYALTGDVAAEVGGAA
WLPFLVAFLIATITAFSYLELVTKYPQAAGAALYAHKAFGLQFVTFLVAF
VVMCSGITSASTASRFFGANLIEGFGLEWGTAGVAAVALGFMALLAAVNF
RGVGESIKLNVVLTIIEATGLMLVLFVGLWAFTRGGDVDFSRVVAFDTAG
DKNAFMAVTAATSLAFFAMVGFEDSVNMAEETKDPVKTFPKVLLSGLTIA
GIVYMLVAVVAVALVPVGRLEESDTPLVEVVKAGAPNLPIDTLFPFISMF
AVSNTALINMLMASRLIYGMARQHVLPPVFGTVHPRRLTPWVAIVFTTLI
AFGLIFYVSVFASSSAISVLGGTTSLLLLAVFAVVNVAVLRLRRDVQAGG
AHFKTPTVMPVVGFIASLYLVLPFSGRPAQQYYVALILVAIGIVLFFINR
LINRRLGVRDTEITDPTHLA
108801529YP_641726.1 adenylosuccinate lyase [Mycobacterium sp. MCS]MSVTIPNVLANRYASEDMVAIWSPEAKIVAERRLWLAVLRAQIELGMGNT
VVPDGVVADYERVLDQVDLASIAARERVTRHDVKARIEEFNALAGHEHVH
KGMTSRDLTENVEQLQIRRSLELVHAHGVAVVARLAEKAVSYRDLVMAGR
SHNVAAQATTLGKRFASAAEETLLALQRVEELIARYPLRGIKGPMGTAQD
MLDLFGGDTAKLADLERRVAEFLGFRDVFTSVGQVYPRSLDHDVVSALVQ
LGAGPSSLAHTIRLMAGHELVTEGFAPGQVGSSAMPHKMNTRSCERVNGL
QVVLRGYGSMAAELAGAQWNEGDVFCSVVRRVALPDAFFAIDGQTETFLT
VLDEFGAYPAVIQRELDRYLPFLATTRILIAAVRAGVGRETAHEVIKEHA
VAVALAMREKGQEPDLLDRLAADPRLPLDRVALEDALADKQAFSGAAGDQ
VDRVAQAVDELVSRYPEAAKYTSGAIL
108801527YP_641724.1 UDP-sulfoquinovose synthase [Mycobacterium sp. MCS]MDTELGVQSLTPIASLAERLTGWREVSGRRIESVNLDIAEDYGELLDLLR
SARPDAVVHFAEQRAAPYSMKDAAHKRYTVANNVNATHNVLAALVESRLD
CHLVHLGTMGVYGYETSAVNLPEGYLTISYPDRHGAVVTREALYPTKPGS
IYHLTKSLDQLLFQFYAQNDRLRITDLHQGIVWGTQTEETRRDPRLINRF
DYDGDFGTVLNRFLLQAAIGYPLTVHGTGGQTRAFINIQDTVRCVRYAVE
SGTQVGSRVRIMNQVAETLRVRDLAQILERLVGAQVAYLPNPRAEADENE
LAVCTDNLRQLGLDPILLEAGLLAESLEIAAAYADRCDLGKIPCVSYWND
ERRCAAEKVDR
108801525YP_641722.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MNEPVARQHRDSQTPSAPPPQIPQKPKAVVRHYRSIDSAPPAYAVKRPPS
AVNGALLIFVALSSLTLLLGTVQARAWGDHARDLVFATADGQAAAIPVRA
FLLVMVTSVAWSLDTNFWRRLAVHLELTGVLILVCAVVDFSAYLGYHVGL
FYPQIVGQQLASSLAAMVLLPFTVMRHARLPRPARLRPAGRMRWHAWVRL
AVPLAVAFVAAAWIEDRMPVPVAWMREWALMGGVGPGIFLVQQLFGILAA
GIGLVMIRRSRRARFAPPLAVIIPAHNEAHDITATIEAVDRAAARYAETV
HIYVIDNASTDDTADVAQTAIAACAHSTGEVHECAVPGKAVALNYGLSVI
REEFVVRIDADTVIGENCLDVTLRHFTDAKVAAVGGMPRPERIRTFFDRV
RLVEVLVKHGFFQVAMMGYDGIIGEPGMFVVYRRRVVEEVGGIVQGMNGE
DTDICMRMSSQGYLSLVDPTAVYFSETPQSWAHLREQRTRWFRSIYHIAA
HNRHAILSRSSMAGAVMLPFQLANSARRAMMLPLLLFGLLIFGLFRESFP
GLHPERLLAVFLGLPLLVALGVCLVRQPRAVLYLPEYLLFRIVRSYFTLA
AVLSLVFPPLHPRQALRERRRTRRRPRHRRNRATPADRSSSAASPDIAAT
S
108801523YP_641720.1 phosphoribosylaminoimidazole-succinocarboxamide synthase [MycobacteriuMRPALSDYRHLASGKVRELYRIDDEHLLFVATDRISAYDHILSSEIPDKG
RILTAMSVFFFDLIDAPNHLAGPPDDPRIPEEVLGRALVVRQLEMLPVEC
VARGYLTGSGLIDYRKTGTLCGLTLPPGLTEASKFAEPLYTPASKAELGL
HDENIDFAATVDLVGEKRAAQLRERTLQIYTQGADHALTKGIIIADTKFE
FGVDPSGELVLADEVFTPDSSRYWYADAYREGQVQPSYDKQFVRNWLTGP
ESGWDRAADQPPPPLPAEIVDATRSRYIEAYERISGLSFAEWIGASA
108801521YP_641718.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAKSSYHHGDLKSAILAQAAELVAERGADGISLRELARAAGVSHAAPAHH
FTDRRGLFTALAAQGWRMLAEALADARPDFLNAASAYVRFALDHPGHYEV
MFDKSLIDETNSELAEAKAAAGQELNRGIATLTDARSQSDPEGAALAAWS
LVHGFIMLWLNDLIATEGDPLAQIERAARMLFAG
108801519YP_641716.1 hypothetical protein Mmcs_4556 [Mycobacterium sp. MCS]MAGQLILSISHVSARTLADVAGFRAELDARGVPASFLVAPRLKGGYRLDR
DAPTVEWLRDRRASGDAIVLHGFDEAATKKRRSEFASLAAHEANLRLMGA
DRVLEHLGLRTRLFAAPGWTVSQGTVMALPRNGFRVLAGLGGVTDLVRGT
TMRARVVGVGAGFLTEPWWCRTVVLTAERTARRAGVVRLNVSAKQLGRIG
PRRAVLDAIDLALMHRCAPQVYRWGPGAALSEAA
108801517YP_641714.1 hypothetical protein Mmcs_4554 [Mycobacterium sp. MCS]MRLLVAAVLASCGWAFVTPAAATANPMDCPPNCDRIPRSAWIAPTSIPLY
DVYRWPELSTLSVTAVTPRFRFEETCATPPMAIDDPRTWAVAARASVTSP
DGQWHLQAQVMHWRGETWQGGQLATAVFDDAVAALRACQRTAPSASPSIT
TFEPTRLAAVVSAPDRSVLHQYLVAELRNSTVTELALWSTAQPSVLWRPV
PDAFVLDAMGAPLCTAYIGSCR
108801515YP_641712.1 phosphoribosylformylglycinamidine synthase I [Mycobacterium sp. MCS]MSARVGVITFPGTLDDVDAARAVRLAGGEPVSLWHADADLKKVDAVIVPG
GFSYGDYLRAGAIAKFAPVMGEVVRAAEGGMPVLGICNGFQVLCEAGLLP
GALTRNIGLHFICRDTWLQVASNTSAWTTRYENGADLLIPLKSGEGRYVA
SEKVLDELEGEGRVVFRYRENLNGSMRDIAGISSANGRVVGLMPHPEHAT
EALTGPSDDGLGLFYSALDAVLTV
108801513YP_641710.1 putative aminopeptidase 2 [Mycobacterium sp. MCS]MPASPQSLCAFIDASPSPFHVCGTVADRLRDAGFTELAEGDAWPSAAGDY
FTVRAGSLVAWRAGENPHAPFRIVGGHTDSPNLRVKQHPDRFVSGWRIVA
LQPYGGAWLNSWLDRDLGISGRLSIRAGDSLEHRLIRIDEPILRVPQLAI
HLSEDRKGVSLDPQRHVNAVWGVGGSARSFLGYIADRAGVAEDAVLAADL
MTHDLAPSTLVGADRELVSAPRLDNQATCYAGLEALLAAQPRDVVPVLAL
FDHEEVGSTSDHGAQSELLPTVLERITLAAGGHREDLLRRMSGSVVASGD
MAHATHPNYPERHEPGHLIEVNAGPVLKVQPNLRYATDGRTAATFALACA
QAGVPMQRYEHRADLPCGSTIGPMTSARTGIPTVDVGAAQLAMHSAREVM
GADDVAAYSAALQAFLSPA
108801511YP_641708.1 hypothetical protein Mmcs_4548 [Mycobacterium sp. MCS]MAKHRNKGVRRRIKKAALMGGVAATSAAMTMGLTAPSAGALALPGIGEVP
GTEALDLNLALPGAGEFDPAAVPNLGFLLDALGVDLSGLIPGLLGDLPIT
GAGLNIITTGPPFGALALLGANPFWVPAYPPLIANEINETPYGIVATIPN
IFVPGGPPLSIPLGNVRLPIVIAFGLGSLATGMAYPDVVADLPNQPGGSE
STLPGPSLTVLPLILLRNPGRADGGIAARFAPVLDPILGLFGFNSVVTPD
VDVETDGSAILVPIKVDATVEYDPLSDFAAWPNPFTLANNAAAFAFPTYI
LRGADLAGFLPQLTEPVLGTAESAILNFLLGPILTELPPQVLLPNVLTED
ALNTFLTLESDALPLLEPFRYPTDFANLFTGGAFGFTNPFADAVEPALKI
LVNLGYTNVTQDMSNPLDPYPRDFTGDFGSDYAPFFTFPENVDWGQVPGD
LATAFAAGVQNAFFTGIPGVKGPLAGPNPLAIIAGLLGLPTGPAELPELL
TAFPDLADIIGGNLGLPGLNSTSTLAAAAAPAVGGSDDPLTRLGETLART
LNIAFEREAPVDYTPPSGPVDSAFDVTEGLSASALRLLAATVLGPTRLAA
LAEGGPEALADLIENTVDAPLWIADPALYGLRDALPEDAADTVTEFRDSL
WTLTERINEALLGALEDLPNAPADVTITSEQAKGGVDDEDIEATLKVAGT
EQPGQPAGEVKSDLPPAEADVDPGAVLEGEESATPKGDKKVTGGGQIKGG
QLSKTIERSIDRVGDRLNDAADDLRDGVKKALTPPSRSTTVSDNDTETDK
EPAA
108801509YP_641706.1 phosphoribosylformylglycinamidine synthase II [Mycobacterium sp. MCS]MTQELAPTLDTVERAAATPDQPQPFRELGLKDDEYQRIREILGRRPTDAE
LAMYSVMWSEHCSYKSSKVHLRYFGETTTEKMRSTMLAGIGENAGVVDIG
DGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLR
FGAADAPDTKRVLDGVVRGVGGYGNSLGLPNIGGETVFDPSYAGNPLVNA
LCVGAMRKEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFSGDE
SGAGRKKLPSVQVGDPFMEKVLIECCLELYAADLVVGIQDLGGAGLSCAT
SELASAGDGGMRVELDQVPLRAANMTPAEILSSESQERMCAVVTPDNVEA
FLAVCRKWEVLATVIGEVTDGDRLVITWHGDTVVDVPPRTVAHEGPVYQR
PVTRPDTQDALNADTSADLPRPATGDELRATLLAMIGSPHLCSRGYITEQ
YDRYVRGNTVLAEHADGGVLRIDEATGRGIAVSTDASGRYTALDPYTGAQ
LALAEAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGCA
ALGIPVTGGNVSFYNQTGSTAILPTPVVGVLGVLDDVKRRIPTGLGTEPG
ETLMLLGDTRDEFDGSIWAQVTAGHLGGLPPKVDLEREKLLADVLTAASR
DGLISAAHDLSEGGLIQAVVEAALAGETGCRVLIPENFENGTGPFTFLFS
ESAGRVLVAVPRTEESRFRAMCEARGLPITRIGVVDPGSDAVEVQGHFTV
PLAELRTTSEGVLPGLFG
108801507YP_641704.1 abortive infection protein [Mycobacterium sp. MCS]MRRNEVAALTLATALVALSGLVSPRLPERWAAVVHAVFGASLAAATRAPL
GLRPPALRGGLGAGATAAAVVTTGVAAASAVPGVRSAMKARDLPAAPTRW
LILRIPLGTVWAEELAYRGALGYLGASAFGPTRGRLLQSVAFGLSHIADA
RAAGEPVVGTVVTTGIAGWVFAWLAERSGSLVAPMLAHLAVNEAGALAAL
AVQRPLRSAVRD
108801505YP_641702.1 hypothetical protein Mmcs_4542 [Mycobacterium sp. MCS]MAARRTADPAQTRAAVSAVVDWLRDDTAAPPGRTEIAEAVRLTARTVAAL
APGASVEVRVPPFVAVQCIAGPTHTRGNPPNVVETDPRTWLLIATGLLSF
DEAAASGGLHLSGSRAGELANWLPVVTPGM
108801503YP_641700.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MVDNIRCLVTGATGYIGGRLVPALLDRGLQVRAMARTPGKLDDAPWRAQV
EVAKGDLMDRESLAAAFEGMDVVYYLVHSMGTSKNFVAEEAESAHNVVAA
AKQAGVRRVVYLSGLHPEGVELSRHLASRTEVGEILIDSGIETMVLQAGI
VVGSGSASFEMIRHLTDRLPIMTAPKWVHNKIQPISIDDALYYLVEAATA
VVPSSRTWDIGGPDVLEYGDAMQVYADLAGLRPRRFVVLPWLTPTLASHW
VGLVTPISSGLARPLVESLECDAVTHENDIDAVIPHPPGGLTGYRKSVAA
ALRENGTAATGGRRHLLRINPAVAQ
108801501YP_641698.1 phosphoribosylaminoimidazole synthetase [Mycobacterium sp. MCS]MTERAEQHGISYASAGVDIEAGDRAVELFKPLAAKATRPEVRGGLGGFAG
LFALRGGYREPVLASSTDGVGTKLAVAQAMDKHDTVGLDLVAMVVDDLVV
CGAEPLFLQDYIAVGRTVPERVSQLVAGIAEGCVIAGCALLGGETAEHPG
LMAPDHYDISATGIGIVEADDVLGPDRVRPGDVIIAMGSSGLHSNGYSLA
RKVLLEIDRMNLAGHVEEFGRTLGEELLEPTRIYAKDCLALAAETQVRTF
CHVTGGGLAGNLERVVPNGLMAELDRGTWTPAPVFQMIAQRGRIERTEME
KTFNMGIGMVAVVAPEDTDRALAILTARHIDCWTLGTVKKGGKDEPRALL
VGQHPRF
108801499YP_641696.1 glycine cleavage T protein (aminomethyl transferase) [Mycobacterium spMSAVPVPEGPDVGAVWHYGDPLGEQRAAADGAVVVDRSHRATLALSGAER
RSWLHTISSQHISDQADGTVTQNLSLDGQGRVEDHWWQTELDGVLYLDTE
PWRGEPLLNYLRRMVFWADVTIEPADLAVLSLLGPALADTPVLDALGLGS
LPAESTAVALPGGGFIRRLPADGLELDLLVPRAQVADWRDRLTAAGVRPA
GVWAYEAHRVAALQPRLGVDTDERTIPHEVGWIGSAVHLDKGCYRGQETV
ARVHNLGKPPRMLVRLHLDGTTDRPSTGDPVLAGGRTVGRVGTVVEHIDD
GPVALALVKRGLPADTPLTTGGDVEATAIIDADSLPDNDHVGAGRLAVER
LRGGGR
108801497YP_641694.1 hypothetical protein Mmcs_4534 [Mycobacterium sp. MCS]MGWRKITAALAAAGLVVACASPESPSESGPSSSSPSGHGSYAECLNEHGV
PAAPGPNTGPPAGVDRAAWDQALKSCASLAPGPG
108801495YP_641692.1 hypothetical protein Mmcs_4532 [Mycobacterium sp. MCS]MVLFYEILLVVCTLVITWFALYALYRLITDES
108801493YP_641690.1 hypothetical protein Mmcs_4530 [Mycobacterium sp. MCS]MCAPPKQGLTLPASVDLEKETVITGRVVDGSGQAVGGAFVRLLDASDEFT
AEVVASATGDFRFFAAPGTWTLRALSKVGNGDATVAPSGAGIHEVDVKVA
108801491YP_641688.1 hypothetical protein Mmcs_4528 [Mycobacterium sp. MCS]MSTSTDTASDPRVDVRGPRFAAWVTTGVLVATLVLSAVSPLAAAVLLGAQ
TVVFAIGARRGPRRHPYGIVFGRVIAPRLGPVTDREPAGPLKFAQLVGFV
FAAVGTIGFAAEWSAVGLIATAFALFAAFLNAAFGICLGCKLYPLAARLR
RVPTPA
108801489YP_641686.1 hypothetical protein Mmcs_4526 [Mycobacterium sp. MCS]MRKVLIGLVATVTAVVVGAVGADFGTAIYAEYRWSRTLRDVANLDSDPWV
GIIGFPFVTQAMDHEFGEMEIRASGVDHPVVGKASLEATLHDVDLSETSW
LVRPDAPMAVGKVESRIIINSTHVGRFIGIPDLLVEAPTGETNDATGGTT
ESGISSNKGVVFTGTPEAAGFDERVSVAVDLSVSGPDQTTLVMTATDVLT
GAGTAEQAVPEDKTAAVLDAFSASMPGQKLPFAIAPTAQGARGSDVIIEG
IADDMTITLDGFRQS
108801487YP_641684.1 N-acetyltransferase GCN5 [Mycobacterium sp. MCS]MTSIDWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQVLRELPADRTRHL
VAVDPDAGAVVGYLNLAPASDTAPPMAELVVHPDFRRRGTGAAMARAGLA
EGGTHARIWAHGNLEAARATARTLGLQVVRELLQMRRPLTDLPPVTVADG
VRLATYSGPGDDPELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAG
LFMAFDDASGKLLGFHWTKVHGPDLGEVYVVGVDPAAQGRGLGATLTLTG
LHHLAERLSNSPQPTVMLYVEADNGAAVKTYRRLGFDVSSVDAAYAAVAD
108801485YP_641682.1 arsenical-resistance protein [Mycobacterium sp. MCS]MTRPVASTETPQVVAKLSTLDRLLPLWIGIAMAAGLLLGRWVPGLNTVVE
SIAVDGVSLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLVSSLLLNWV
LGPALMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAA
AVLVALNSIFQVVMFAVLGWFYLSVLPGWIGLAQTTIATSPWDIAKSVLI
FLGIPLLAGYLSRRFGEKARGREWYESRFLPTVGPWALYGLLFTIVILFA
LQGDQITNRPLDVVRIALPLLAYFAIMWGGGYLLGALLGLGYERTTTLAF
TAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVALVYVSLALR
RRFSRPVGVVRPPE
108801483YP_641680.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MVIEQDAVRRRAAVHAALADPGRLTIVDRLRLGDASPSELQVALDMPSNL
LAHHLKALEGAGLIRRVKSEADRRRTYLKLDHDALAVMVPATTRTADRVV
FVCTRNSARSQMAAAIWNGRSRIPAASAGTHPADSIHPGALAAARRHRVP
IEPQTPRRLDDVLADGDLLIAVCDNAHEELPPELDRIHWSVADPARSPQR
DAFDTALRELTDRVQHFLAALTPT
108801481YP_641678.1 phosphate ABC transporter permease [Mycobacterium sp. MCS]MAVTPDSTAVGSSAQSTSPQGVGNTPGRDTKSGKGSALKQGDGRWGDKVF
KSIAVAAGATIIGAIALMALFLIVKAIPSLQANQANFLFSTEFLTSDSDN
LRFGIRDLFMVTVLSSVFALVIAVPIAIGIAAFLTNYAPKRLARPFGMLV
DLLAAVPSIVFGLWGIFVLAPWLTPVATFLNDKLGWFFLFSEGNVSLAGG
GTIFTAGIVLAVMILPIITSVTREVFALTPRGHVEAAQALGATKWEVVRM
TVFPYGRSGMIAASMLGLGRALGETIAILIILRTAAQAGHWSLFDGGYTF
ASKIASAAAEFSAPLPTGAYIAAGFVLFALTFVVNALARAAAGGRVSGG
108801479YP_641676.1 phosphate transporter ATP-binding protein [Mycobacterium sp. MCS]MAKRLDLKDLNIYYGSFHAVADVGLAVLPRSVTAFIGPSGCGKSTVLRTL
NRMHEVIPGARVEGSVLLDGEDIYGPGIDPVSVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRNRKTLDEVAEQSLKGANLWKEVKDRLDQPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIDELKQDYTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLVEVDDTEKIFSNPTQKATE
DYISGRFG
108801477YP_641674.1 phosphate uptake regulator PhoU [Mycobacterium sp. MCS]MRTAYHEQLGALTDQLGEMCGLAGGAMERATQALLQADLVLAEQVISDHD
QIATMSARAEEAAFVLLALQAPVAGDLRAVVSSIQIVADVDRMGALALHV
AKIARRRHPQHVLPEEVNGYFAEMGRVAVELGNAAQEVLETRDPEKAARI
QEEDDAMDDLHRHLFTVLMDREWKHGVTAAVDVTLLSRFYERFADHAVEV
ARRVIFQVTGAYPTEEVIPTPR
108801475YP_641672.1 dihydrouridine synthase TIM-barrel protein nifR3 [Mycobacterium sp. MCMPSPVVLAPMAGVTNVAFRTLCRELEVARAGTVSGLYVCEMVTARALVER
HPVTMHMTAFASDESPRSLQLYTVDPATTYAAAKMIADENMADHIDMNFG
CPVPKVTKRGGGAALPYKRKLFGQIVRAAVTATEGTDIPVTVKFRIGIDD
AHHTHLDAGRIAAEEGAAAVALHARTAAQRYSGTADWDQIAALKAHVTAV
PVLGNGDIFDADDALAMMAATGCDGVVIGRGCLGRPWLFAELSAKFTGRP
LPVPPTLGEVADIIRRHGELLTDHFGEDKAMRDIRKHIAWYLHGFPAGSD
LRRALALVKTRAELSELLARLDPDVPFPPAATGPRGRQGSAASVSLPEGW
LTDPDDCTVPAGADVMHSGG
108801473YP_641670.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSSGQRRGRWSGVPLQDRQALRRDELVTAGVKLLGGEGGPALTVRAVCRE
AGLTERYFYESFVDRDEFVRAAYDDVCSRAMSALMTAETPRDAVERFVKL
MVDDPTRGRVLLLAPASEPVLTQSGAAWMPNFIELVQHKLTRITDPAIQA
MVATGLIGALTALFTAYLDGRLSATREQFIDYCVDMLLSRVASH
108801471YP_641668.1 globin [Mycobacterium sp. MCS]MTTIYEQIGGAEALEGVVEDFYGRVLADEQLSGFFTGTNMARLKGRQVEF
FAAALGGPEPYTGAPMRQVHQGRGITMHHFNLVAGHLTDALHAAGVPEAL
VGQIIGAVAPLADEIATARTA
108801469YP_641666.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVRPAQTARSERTREALRQAALVRFLAQGVEDTSAEQIAADAGVSLRTFY
RHFTSKHDLLFADYDAGLQWFRAALAGRSPDESIIESVHSAILEFPYDAD
AVTKIAALRAEELDQGRIVRHIRQVEADFAEAVEEHLTRDRAPAAGSDER
LRATVMARCIAAAVFGAMEMWMEDDPRSLPELSRLCRTALESLEFRQY
108801467YP_641664.1 diacylglycerol O-acyltransferase [Mycobacterium sp. MCS]MKLISPTDSMFLLVESREHPMHVGGLQLFEPPDGISGADFLREIHQAMVE
QTDFQETFRKHPGTVLGGVANLAWAVDEDVDLDYHLRRSALPSPGRVREL
LELTSRLHGTLLDRHRPLWEAHLVEGLSDGRFAVYVKFHHALIDGVSALK
LTQRTLSTDPDDPEVRVPWNLPPKRRTREPESKSLLRSVTDRVGSVAALA
PSTFGLARAALLEQQLQLPFGAPKTMFNVPIGGARRVAAQSWPLERIRSV
KRATGATVNDVILAMCAGALRFYLTEQNALPDAPLIAMVPVSLRTEAEAD
SGGNMTGVVLCNLATDDDDPARRLDTISLSMRRNKQVFSQLPRVQQLALS
ASMIAPLGLGAVPGFVSTAPPPFNIVISNVPGNQEPMYWRGARLDGNYPF
SIALDGQALNITMANNGDNLDFGLVGARGSVPHLQRLLGHLEDSLKELEV
AVGV
108801465YP_641662.1 hypothetical protein Mmcs_4502 [Mycobacterium sp. MCS]MTDAIDPAAPPSGSGCVECEANDGWWVHLRRCAACGHIGCCDDSLARHAS
AHWSQTGHPIIRSFEPGEDWFWNYETGTYYDGPVLADPQSHPADQPAPGP
RDRVPPDWVAQLRAR
108801463YP_641660.1 cyclase/dehydrase [Mycobacterium sp. MCS]MAVSDSREVVIEATPAQILDVIADVEATPSWSPQYQSAEILDTYADGRPR
QVKMKVKSAGITDEQVIEYTWTDSKVSWTLVSAGQLKAQDASYTLTPDGE
KTKVRFDIKVDLSVPLPGFVLKRAMKGAMETATDGLRKQVLKVAKGGN
108801461YP_641658.1 cyclase/dehydrase [Mycobacterium sp. MCS]MAVRASREVVFDASPEAILDVLADIEALPAWSSVYKKVTVLDRHPDGRPR
RVKATLRLMGITDNEILEYHWGRHWVVWDAEDTFQQRGQHVEYNLTPEGD
RTRVRFDIIVDPSAPIPQFLVKRAKKIVLHSATEGLRARVMAKTHAE
108801459YP_641656.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTTARPLRADAARNRELLLAAAEEEFAERGLDASVADIARRAGIAKGTVF
RHFATKEDLIASIVSAHIAALAAAARGLADAADPGAALLEFLTVAADQRQ
QRDLTFLQSASDDDPRVIEVRDELHAALETLVGRARDAGAIRSDITETDV
FLLMCAPIHVVENLAAPTPLLWQRYLAIIFDGLRPEGAHPLPQPAPNLP
108801457YP_641654.1 NADH:flavin oxidoreductase [Mycobacterium sp. MCS]MAFTFDDDATLLTPLQMGETFAPNRVFMAPLTRSRAQADGTPSYLAAQYY
AQRASAGIVITEATAVSQSANGAYLNTPGIYTDRHQEKWARIASAVHAEG
GRIFMQLWHVGRMGHPDISGVHPVAPSAVAADLTAHTPGGKKPLVVPRAL
EVEDIPRIVADFRAAARRAVDAGMDGVEIHGANGYLLHQFASDVVNRRAD
AYGGSAENRARLTAEVVEAVADEIGAGRVGLRISPGNGAGDVREDEPIAV
YEALLDRIAPLGIAYLHVLIDPTHTTFGVIRALWPGVLVLNTGRETDTDF
CQLESFAQWGAVSAVAVGRAFLANPDLIERLVVGAELNDPDVATFYSPGP
VGYIDYPTLAELETRESA
108801455YP_641652.1 short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase [MycMAENTITWEQDSDGIVTLTLDDPTGSANVMNDHYKESMHNAVERLVAEKD
SITGVVITSAKKTFFAGGDLKSMINTGPDDAEAVFENVESIKADLRKLET
LGKPVVAAINGAALGGGLEIALACHHRIAADVKGSVIGLPEVTLGLLPGG
GGVTRTVRMFGIQKAFMEVLSQGTRFKPGKAVEIGLVDRLVQSVDELIPA
AKAWIKANPEAHTQPWDVKGYKMPGGTPSSPGLASILPSFPALLKKQLKG
APMPAPRAILDAAVEGAQVDFDSASRIESRYFVSLVTGQVAKNMIQAFFL
DLQTINGGGSRPDGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKD
VSLENAQKGKAYSEKIEAKALERGRTTKEKSDALLARITPAADPADLKGV
DFVIEAVFENQELKHKVFQEIEDIVEPNALLGSNTSTLPITGLATGVKRQ
EDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTPIVVND
SRGFFTSRVIGTFVNEALAMLGEGVEPASIERAGSMAGYPAPPLQLSDEL
NLELMQKIATETRKATEAAGGTHDPHPAEAVVNKMIEIGRPSRLKGAGFY
EYVDGKRTGLWPGLRETFGVGSADIPLQDMIDRMLFAEAIETQKCLDEGV
LTSTADANIGSIMGIGYPPYTGGSAQYIVGYEGALGTGKEAFVARARELA
ERYGDRFTPPDSLTK
108801453YP_641650.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. MCS]MRQASVVVITLANMALSKNDREQFLAEPHVAALSVSAGPDRGPLTVPVWY
QYSPGGQPWVLTGAGSRKHRLIEAAGHFSLMVERIEPSVRYVAVDGPVSR
IEPGTDEHLVEVATRYLPPAAVEPYLEMARREHGESVVIHLDPRHWLSSD
LGSF
108801451YP_641648.1 hypothetical protein Mmcs_4488 [Mycobacterium sp. MCS]MEKISLTALAREQLELARSHNSGRSARTVYGGHEHSLRQTLIALTGGNGL
DEHDAPEEATLYVVTGRVRLGDGTSHWEGSAGDLIVIPKTRHDLAALEDS
VVLLTVLQSVGPYA
108801449YP_641646.1 ethanolamine permease [Mycobacterium sp. MCS]MDTTHSESSDYLAKRTLKQGTAGWLLLAGLGVGYVISGDYSGWNFGLAEG
GFGGLLIAGVIIAGMYLAMVLGMAEMSSALPAAGGGYTFARRALGPWGGF
ATGTAILIEYAIAPAAIATFIGAYVESLGLFGITDGWWVYLAVYLLFIGI
HLSGVGEALKVMFVITAIALAGLIVFAIGAVGRFDAANLTDIAPTDAAGA
SSFLPFGYLGIWAAVPFAIWFFLAIEGVPLAAEEAKDPSRNVPRGILAAM
GVLLVTGSTVLVLAAGSGGAELISASGNPLVEALGDTTTSKVVNYIGLAG
LVASFFSIIYAYSRQLFALSRAGYLPRRLSVVNSRKAPTLALVVPGIIGF
ILSLTGQGAMLLNMAVFGAALSYVLMMVSHIALRVREPDMPRPYRTPGGV
VTTGFALVIAALAVVATFLVDSTAATWCLVVFAAFMAYFGLYSRHHLVAN
SPDEEFAALADAEKDIL
108801447YP_641644.1 hypothetical protein Mmcs_4484 [Mycobacterium sp. MCS]MAQLPDERLIRLLELRPDLTQPPPGTIAALAARATSRQSVKAATDGLDFL
RLAVLDALLVLHADTTAVPLTKLFELIGGRADEGAIVVAVDDLRARALVW
GDDDQVRVAAEAASGLPWYPGQAVVETAEHGADDIAEKLAGLDTAQRELL
ERLLEGSPVGRTRDAAPGTPADRPVQRLLAAGLLRQVDDDTVILPRLVGQ
VLRGEAPGPTELNPPDPVTTSTKPSDVDAVAAGAAIDVLREVDVVLEALS
AAPVPELRSGGLGVRDLKRLVKATGIDERRLGLILEVALGAGLIAAGMPE
PDPGDGTSTFWAPTVAADRFIESPTAVRWHLLASTWLDLPARPGLTGSRG
PDGKPYASLSDALYSTAAPLDRRLLLAVLADLPAGSGVDAASASRAMIWR
RPRWAVRLQPEPVGGLLTEAHALGMVGRGAIATPTRRLLAGEPPEDVVAA
KAKVLPAPIDHFLVQADLTVVVPGPLERDLAEQLAAVAAVESAGAAMVYR
VSEASIRRALDTGKTASELHSFFGRHSKTPVPQGLTYLIDDVARRHGQLR
VGMAASFVRCEDPALLAQAVAAPATGAVELRLLAPTVAVSQAPIADVLAA
LRNAGLAPAAEDSSGAIVDIRSRGARVPAPGRRRVFRPAPTPTGQTLGAI
VAVLRKVAAAPSGNMRLDPGVAITQLQEAALQQTSVVIGYVDPAGVATQR
VVAPVNVRGGQLTAYDPASGRVREFAIHRVTSVVSAENE
108801445YP_641642.1 molybdenum cofactor biosynthesis protein MoaC [Mycobacterium sp. MCS]MAASSQHGLSHVDESGAAHMVDVSGKDVTKRTAVAAGTLHTRPDVVALIA
SGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFEIGESHV
RVTATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDPAARIDDIAVLRK
EGGKTGTWTRP
108801443YP_641640.1 molybdopterin synthase subunit MoaE [Mycobacterium sp. MCS]MTAVVHRAAVTEDPIDLTEHEDLVSHESAGAVVSFAGVVRDHDGGRGVAR
LEYSAHPSAAQVLAEVAAEIAAESDGVRAIAVSHRVGPLEIGDAALVAAV
AADHRRAAFDTCSRLVDAVKDRIPVWKHQFFGDGSDEWVNSA
108801441YP_641638.1 sulfur transfer protein ThiS [Mycobacterium sp. MCS]MSTTTTVRVAVRYFAAARAAAGTESEDLTVPAGTTVQALVDELSSRSAEL
GRVLARCSYLCDGVAVRDTTMALANAQTLDVLPPFAGG
108801439YP_641636.1 hypothetical protein Mmcs_4476 [Mycobacterium sp. MCS]MRVLLNIIWLIFGGLWLALGYAVAGILCFVLIITIPFGFAAFRIASYALW
PFGRTIVEKPGPRPGALIGNVIWVLLFGIWLAIGHLVSAAAMAITIIGIP
LALANLKLIPVSLVPLGKEIVPVDPPVPAMRAAA
108801437YP_641634.1 putative glutathione S-transferase [Mycobacterium sp. MCS]MSYVASGGEFNRDTDYITDRITADGRDGYPVEPGRYRLIVARACPWANRT
IIVRRLLGLEDALSIGFCGPTHDERSWTFDLDPDGVDPVLKIPRLQDAYF
KRFTDYPKGITVPAVVEVSTGQVVTNDFPQITLDFSTEWTAHHRDGAPDL
YPEKHRDEIDEVAQRIYTEVNNGVYRCGFAGSQRAYEKAYDRLFTALDWL
EDRLAGQRYLVGDTITEADVRLFTTLARFDPVYHGHFKCNRAKLSEMPAL
WGYARDLFQTPGFGDTVDFVQIKQHYYIVHSDINPTQVVPKGPDLANWLT
SHGREALGGRPFGDGTPPGPAREGERVAAGHTPL
108801435YP_641632.1 major facilitator transporter [Mycobacterium sp. MCS]MVDNRGVAGGRDESDGDPEDFRRDARYYPPRPPAGHDHPGMANYPSDGGT
YRRPRRQPTPSANRWLPPLDEPTPSGYQYDPPPGVGAGAGRVTVTRAAAQ
RSREMGSKMYGLVHRAATADGADKSGLTALTWPVVANFAVDAAMAVALAN
TLFFAAASGESKSKVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALAA
SFLARTALVVLLIANYDGETGSYQSWVLYPCALGMMVLSKSFSVLRSAVT
PRVLPPSIDLVRVNSRLTTFGLLGGTVVGGAFAAGAEYLLNLFHLPGALY
VIVAATIAGAALSMHIPKWVEVTAGEVPATLSYHGGSGGLRRERPSERSG
KARQPLGRNTITALWGNCTIKVMVGFLFLYPAFVAKSHDATGWEQLRILG
LIGAAAAVGNFAGNMTAARLELGHPARLVVRAATAVTAVALLTAVTGNLL
VAAVATLITSGASAIAKASLDASLQDDLPEESRASAFGRSESLLQLAWVA
GGATGVLIYTDLWIGFTTITAVLILGLAQTVVSYRGESLIPGLGGNRPVL
AEQEGRRSDAAGVGYE
108801433YP_641630.1 hypothetical protein Mmcs_4470 [Mycobacterium sp. MCS]MAAPLLHAEIEIDAPVATVWSLVSDLSRMPQWSPQCRVMKPLGPVRPGTK
TINLNRRNRLVWPTTCTITEVVPEKKVAFRVDANKTVWSYELEPTATGTR
LVETRNAENGVTAVSNMAVNKLMGGVPSFEEELVAGMNESLAKIKAAAES
108801431YP_641628.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MIDLESRLASDLSLAVVRLARQLRFRRAESPISLSQLSALSTLAKEGAMT
PGALAVRERVRPPSMTRVIASLAEMGLVSRNAHPVDGRQVLVSVSPAGAD
LVEAEKRASQEWLQRRLASLEPEQRKTLLMAADLMSAMVEASA
108801429YP_641626.1 hypothetical protein Mmcs_4466 [Mycobacterium sp. MCS]MAAGVAAVIATAVIVLSLGLLRVHPLLAVGLNMVAVGGLAPTVWGWRNRP
VWRWFAFGAAVGVAAGWTALLAMTLSGTTPS
108801427YP_641624.1 phosphoserine aminotransferase [Mycobacterium sp. MCS]MAELTIPADLKPRDGRFGSGPSKVRPEQLQALAAAGDLFGTSHRQAPVKN
LVGRVRDGIKQLFSVPEGYDVILGNGGSTAFWDAAAFGLIDKRSLHLTYG
EFSAKFASAVAKNPFVGDPIVVKADPGSAPEPQSDPSVDVIAWAHNETST
GVAVPVQRPADSGDALIVIDATSGAGGLPVDIAQADAYYFAPQKNFAGDG
GLWLAVVSPAALARIEAIGQSGRWVPDFLSLPIAVENSLKNQTYNTPAIG
TLVLLADQLDWLNGNGGLDWAVKRTADSSQRLYSWAEASSYATPFVTDPA
LRSQVVGTIDFADDVDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFAA
VDPEDVSALTRCVDWVVERL
108801425YP_641622.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MPHVITQSCCSDGSCVFACPVNCIHPTPDEPGFATAEMLYIDPAACVDCG
ACVSACPVGAIAPEATLTDSQLPFVELNAAFYPPRPPDEKVPPTSKLAPV
PDAPVVRSRPDGPLRVAIVGSGPAAMYAADELLTQRGVRVTMFERLPTPY
GLVRAGVAPDHQSTKRVTRLFDRVAARRELRLYLNVEVGTHLTHEDLLAH
HHAVLYAVGAPNDRRLDVDGMGLPGTATATEVVAWYNGHPDYAALPVALD
HRRAVVIGNGNVALDVARILTTDPDRLAATDIADHALAALRASRIDEVVV
AARRGPAQSAFTLPELIGLTAACDVVLDAADHELVRRDLCDETDPLTRNK
LEILAKLPDASAPATRPRIRLAYRLTPRRVTGATRADGVEFTVTGTDEVR
RLDAGLVLSSIGYRGRPVAGLPFDEADGVVPNESGRVVDPASGRSVPGSY
VAGWIKRGPTGFIGTNKSCAAQTVHTLVADYNAGALAVPSAGYGDLDRFV
RERRPDVVDSQGWRAIDAAEIARGGDRRPRVKFTSVADMLQAAAAAPEPP
LARRLLAGLLR
108801423YP_641620.1 hypothetical protein Mmcs_4460 [Mycobacterium sp. MCS]MTTDPAVVFASAARSFADLVGRLPATGWDGPGLGEWDLRALVGHTSRSLI
TVSTYLQSTAAREDVTSAAEYYVKVTPAALGIDPAAVAERGRQAGRDLGE
DQAAAVASLAAKALADVDAADDPLIEVIGGLGIRLSNYLPTRTFELAVHG
LDIARAAQIDYAPPSDVLADAVRLAGDVAVVSGRGVEVLLALTGRAGLPP
AFSIV
108801421YP_641618.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium sp. MCS]MKKADNEHLARMRVEYGSVEKDGSADLDVDWLADGWVALLRRWLADAEAA
GIAEPNAIVLGTVDAGGRPVTRTVLCKSVDDTGITFFTNYGSAKGEDLAS
TPYASATFPWFALGRQVHVRGPVTKVSAEETADYWSKRPRGSQLGAWASQ
QSRPIASRAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQGR
ESRVHNRIRVHDGRIERLQP
108801419YP_641616.1 type II citrate synthase [Mycobacterium sp. MCS]MADNPSSATEHAKLSYPGGELELDIVPATDGADGIALGSLLAKTGYTTFD
GGFVNTASTKSAITYIDGDAGILRYRGYPIEQLAEKSTFIEVSYLLIYGE
LPTADQLEDFTTKIQRHTLLHEDLKRFFDGFPRNAHPMPVLSSAVNALSA
YYQDSLDPMDKNQVELSTIRLLAKLPTIAAYAYKKSEGQPFLYPDNSLTL
VENFLRMTFGFPAEPYEVDPEIVRALDMLLILHADHEQNCSTSTVRLVGS
SQANLFTSISGGINALWGPLHGGANQAVLEMLTKIQKSDGDVREFVRKVK
DREDGVKLMGFGHRVYKNYDPRARIVKEQADKILGKMGVEDELLDIAKSL
EEVALTDDFFVERKLYPNVDFYTGVIYRAMGFPTRMFTVLFALGRLPGWI
AHWREMHSEPGKIGRPRQIYTGYTERDYIDTDKR
108801417YP_641614.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MPRNPLADEVWGALTALVFDNRDSWRRAVVEETGLPFSRVRVLRRLGRQP
MTVKQVAQAATLDAPAATVAVNDLEDRGLVVREVDPANRRCKTVSLTDDG
RAVLATIEAIDDPAPEGLAALDDGELEALRATLRKLTGR
108801415YP_641612.1 hypothetical protein Mmcs_4452 [Mycobacterium sp. MCS]MVAAAYLARAGRRVQMLERLDHVGGAAVSAHAFDGVDARLSRYSYLVSLL
PRRIVDDLGARIRLVKRRYSSYTPDPATGGHTGLLIGPTSTFDAVGAAAD
EAGFTDFYHRFRTVTERLWPTLTAPLMTREQIRRHVLSGADDQAWRAVTE
TPIGAAITAAAHSDLVRGVMATDALIGTFARTDDPSLVQNICFLYHLLGG
GTGDWDVPVGGMGAVSGALAAAAAGFGAEITTGAEVTAITPDGEVTYSAG
GREHRVGARFVLANVTPTVLAALLDEPAPPSAPGSQVKVNLMLRRLPKLR
DPTVTAEQAFGGTFHINETLSQLDAAHDRAAAGEVPQPLPCEIYCHSLND
PTILSDELRAAGAQTLTVFGLHTPHSLLAHGDDDRMRNTLTSAVLTSLNS
VLAEPIHDVVMEDAAGRLCIETKTTTDLEHSLNMTGGNIFHGGLQWPFAE
ADDPLDTAAQRWGVATRHPRILLCGSGSRRGGGVSGIGGHNAAMAVLDS
108801413YP_641610.1 FKBP-type peptidylprolyl isomerase [Mycobacterium sp. MCS]MNPGQKPEIDFPDGPAPTELVIEDLVVGEGPEAVPGANVEVHYVGVEYDT
GEEFDSSWNRGQSIEFPLQGLIQGWQDGIPGMRVGGRRKLTIPPAQAYGP
AGGGHRLSGKTLIFVIDLLATR
108801411YP_641608.1 two component transcriptional regulator [Mycobacterium sp. MCS]MDSGVGSPRVLVVDDDPDVLASLERGLRLSGFDVSTAVDGAEALRSATET
RPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEA
GADDYLVKPFVLAELVARVKALLRRRGSSATFSSETIQVGPLEVDIPGRR
ARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVV
DVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ
108801409YP_641606.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSIETVARQTLYRQAHARGGDLHSLADRALLRRIWRFAGRHHRRLAAFVA
VSVVSATLAVATPVLAGRVVDEITRGGAASVVIGLAAVIATVALAEAGVS
LLTRWLSSNIGEGLIFDLRTAVFEHVQKMPVAFFMRTRTGALVSRLGNDV
LGAQRAFSDTLSGVVSNLVTLTLTLGVMLAISWQITVVALVLVPVFVLPA
RRIGARMAHLSRESAIHNATMNTQMTERFSAPGATLVKLFGRPESESHEF
AVRAGRVRDIGVRSAMLQSTFMNSLTLMSALALALVYGLGGVIALGGHLQ
AGAIVSLALLLTRLYAPLTALANARVEIASALVSFERVFEVLDLEPIIRE
EPDAVAVPDGPVRVEFDHVRFSYPTADKVSLASLEEVAVLDDRDDGEVLH
DISFTAEPGQMVALVGSSGAGKSTIAALLARLYDVDSGAVRLAGMDVRDV
TFESLRDTVGMVTQDGHLFHESIRANLLLAAPETESDDRLWEVLRRARLA
DVVAAMPDGLDTVVGERGYRLSGGQRQRLTIARLLLGRSRVVVLDEATAS
LDSASEAAVQQALGEALAGRTSLVIAHRLSTVRAADLILVVEDGRIVERG
THRQLIGRGGRYAELYETQFAEPEAVA
108801407YP_641604.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSVTDWRGRVKENRDGDDGNLPIDGSVPRRREARALLGNLLKPYRMTVFL
LALVVVVENLARLSVPLLVQRGIDHGIPPLLEGGPARELMLIVGALCAVV
LVQAASRMFFLRRSGRIGQKVLLELRRRVFRHFQRLDLAFHDRYTSGRVV
SRSTNDVEAIQDMLETGFDSLITAVLTLVGTSILLVTLDVKLGLMCLAAF
PILVALVWWFRNESAKTYRKVRESAALVIVQFVETMTGIKAVQAYRREPR
NQEIFEDIADEYREINERTFRLLAIFMPGVKLVGNITTGVVLLYGGYRTL
NGEMTIGTLTAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAER
PGIKDPTDPVRLESVRGEISFDDVTFGYSPDRPVLPGLTVTVPAGQTVAL
VGTTGAGKTTIAKLIARFYDPTSGAVTLDGTDLRRLSQSELRRHVVMLTQ
ENFMFEGTVADNIRFGKPEATDDEVRAAAQAVGADRFIDLLPEGYDTDVA
KRGGRLSAGQRQLVAFARAFLADPAVLILDEATSSLDIPSERMVQRALET
VLSDRTALVIAHRLSTVAIADRVLVVEGGRIVEDGAPSELIGRDGGRYAA
LHQAWEQSLA
108801405YP_641602.1 diguanylate cyclase [Mycobacterium sp. MCS]MAAALSRGWWSHAHHYEWMSDYLVARGMTAAVRVMMAGIAASLSVCLLVL
LRFDGPQDTVPVAMTWTAVAGGVFGVALWARRWPTHTESVAFAVVSNAAI
ALSCLAYPNPTGALTGCISFATIAAYIAFFHSTALVVYNFAVTTAVAVIA
ALRIALSGHPAMAVVDLFIVVQINIAMPVAIHVLVRALGVDLARADRDPL
TGLLNRRAFYAHSAKLLTGGPSHGGTHLVMVVVDLDDFKRINDTYGHQVG
DEALISVGQALSRAVVGFPAEIGRSGGEEFVVAAVLETDDPAPLAEQICG
EIAALPEPVTASVGTACIALDASRGNHESTLDRMVRAADAAMYEAKRAGG
NKCHHLGEPYW
108801403YP_641600.1 epoxide hydrolase-like protein [Mycobacterium sp. MCS]MSAITPFRIDVPDAVLTDLKDRLANTRWPEAECVDDWSQGIPLAYTRELA
DYWANGYDWRAREAALNRFDQFTTDIDGLDIHFIHQRSSRPDAFPLIITH
GWPGSVVEFDKVIEPLTAAGFDVVCPSLPGYGFSGKPTSAGWGIERIAKA
WDELMVRLGYDRYGAQGGDWGAVITTQIGRNERGCVAIHTNMPIGRPPKD
LANPTDEEQQTLAAMAERKRWGTGYFQQQATRPQTLGYGLVDSPVGQLAW
IVEKFREWSDCDGHPENVFTRDELLDNVTLYWVTASAASSARLYWESGVG
GRGSGPVRVPTGVASFPKEIVRMPRHWCEDSYHLTHWTDMPRGGHFAAFE
QPELFADDVTAFFDSVR
108801401YP_641598.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSTNTDLYRSARDQLVAVIGDYDKALQSFEWPRLEGAFNWATDWFDVIAR
DPITADRRALWIVEEDGREEQITFAQMADRSDRVATWLERRGIGKGDRVI
LMLGNQVELWEAMLAVAKLGAVIMPTTGALGPADLADRITRGGATAVIAN
AADTAKFTEVPGDYLRIAVGAPVAGWHTYGEAYDTVSAGPFTARTTVDDT
MLIYFTSGTTSKPKLVEHSQVSYPVGHLSTMGWIGVRPGDVHLAISSPGW
AKHAWSCFFAPWIAEATIFVYNYRRFDAAALLRQLNRAQVNTFCAPPTVW
RMLIQSDLGTKPAGLREILGAGEPLNPDVIAQVEKAWGLTIRDGFGQTET
TLQIGNTPGQPVKPGSMGRPMPGVPVVLVDPLTGRPAEEGEICLDLSRQP
VNLMTGYLDDPARNAAVTEGGYYHTGDVAQRDSDGYITYIGRTDDVFKSS
DYKVSPFELESVLIEHPAVVEAAVVPQPDDTRLSVPKAYVALAEGWQADA
DTAKSIMEYARDHLAPYLKVRRVEFYELPKTISGKIRRVELRRREEDSAG
RAIPTEYRYEDLVAG
108801399YP_641596.1 hypothetical protein Mmcs_4436 [Mycobacterium sp. MCS]MSAAHRSAVLARRGCALLAVASAGLHVTSLGHAANPVAGGLLLVMIGGCL
YCAHDLWVAGSVRAWLVVALMNIAMIALHLPAPAHHHGGSAPPMPTAMSV
ATVLAMVEVTVAAAVLYIRTRHHGVALTARRDFPG
108801397YP_641594.1 hypothetical protein Mmcs_4434 [Mycobacterium sp. MCS]MSENAGVAPQENPQKDQSQWVTGDEPMTGPQRSYLNTLAQEAGEQIPEDL
TKAQASETIDRLQQQTGRGTS
108801395YP_641592.1 carboxyl transferase [Mycobacterium sp. MCS]MSRIGALQLRDTVLDEGSFRSWDSAPLAVATTDSYRAELAAASEKTGLDE
AVLTGEGRVFGRRVAVVACEFDFLAGSIGVAAAERITAAVQRATAERLPL
VASPSSGGTRMQEGTVAFLQMVKIAAAVQLHKQAHLPYLVYLRHPTTGGV
FASWGSLGHVTAAEPGALIGFLGPRVYEHLYGEPFPAGIQTAENLHRHGV
IDGVVPLELLRATLDRALTVLADPPGAPPSAPPAEPPADVPAWTSVEASR
RPDRPGVGYLLRHGATDRVLLSGTGRGEAATTLLALARFGGQPAVVLGQQ
RVLGGPDPIPGRSAPALRVGPAALREARRGMALAAGLHLPLVLVIDTAGP
ALTVEAEQGGLAGEIARCLADLVTLDTPTVSVLLGQGSGGPALAMVPADR
VLAALHGWLAPLPPEGASAIVYRDLDHAAELAAAQGVRSADLLRNGIVDT
VVGEHPDAADEPLEFTHRLSATIAAELHALRDVPSQTRLQRRMDRYRRIG
LP
108801393YP_641590.1 hypothetical protein Mmcs_4430 [Mycobacterium sp. MCS]MLGAALRYGFGTASVLAGGWVLRALQGTPASLGATPAEIHPVARRSGNYR
EGVFVNLEPADTISMDAEARRMLVRELFLGREKGRPGAPIPVVAPAPVTA
EAAGLAAYWHGHSTTVVEVDGYRVLTDPIWSDRCSPSRTVGPQRMHEPPT
PLEQLPAVDAVLISHDHYDHLDIDTILGLARTQRAPFVVPLGVGAHLRKW
GISDARIVELDWNESHRIGELTLVCTPARHFSGRLFSRNTTLWASWVIAG
PEHRVFFGGDTGYTASFSEIGSQHGPFDLTLLPVGAYHPAWPDIHMNPEE
AVRAHQDMTDAGGGVLLPIHWGTFRLAPHPWAEPVQRLLAAADPAGVSVV
VPKPGQRVERGASPAIEPWWQL
108801391YP_641588.1 K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter ATPase [Mycobacterium sp. MCS]MTAGPAVVTAGLTEDEVARRVAAGQSNDVPTRAARTTGEIVRANVFTRIN
AILGVLFAIVLSTGSLINGAFGLLIVANSAIGIIQELRAKRTLDKLAIVG
QAKPLVRRRSGTRALAPSEVVLDDIIELGPGDQIVVDGEVVEDNNLEVDE
SLLTGEADPIAKDAGDPVMSGSFVVAGSGAYRATKVGREAYAAKLAEEAS
KFTLVKSELRSGINQILRFITYLLVPAGLLTIYTQLFTTDTGWRRAVLAM
VGALVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVNELPAIEGLARVDVVC
ADKTGTLTENGMRLSELQTLTADHVEDVLASMAADDSRPNASMQAIAEAY
PHAPGWTATAVAPFKSATKWSGVSYGAHGNWLIGAPDVLLDPSSPVAEQA
EDIGSHGLRVLLVGSSDVPVDDPAAPGTVTPVALVVLEQRVRPDARDTLD
YFATQQVSIKVISGDNALSVGAVAGSLGLHGECMDARNLPDTTEELAEEI
ESHTTFGRVRPDQKRAMVHALQSRGHTVAMTGDGVNDVLALKDADIGVAM
GSGSPATRAVAQIVLLDNKFATLPYVVGEGRRVIGNIERVSNLFLTKTVY
SVLLAVLVGLAGLASEIFGTDPLLFPFQPIHVTIAAWFTIGIPAFVLSLA
PNNERAHTGFVRRVMSSALPSGLVVGTATFTSYLLAYQGRAASETEQTQA
STAALITLLVTAIWVLAVVARPYEWWRVALVAVSALAYVVIFSIPWAQEL
FILDPTNPAITSMALGVGLVGVAAIEALWWGQGRLLGERRRLWHER
108801389YP_641586.1 hypothetical protein Mmcs_4426 [Mycobacterium sp. MCS]MAKLSVSVDVPLPPEKAWECASDLSRYKEWLSIHRVWRSKLPETLDKGAR
IDSIVEVMGMPNRVNWTIVHYKPPQAMTLNGDGKGGVKVKLIGKVKPSGD
GSTVTFDIHLGGPALFGPIGMVVAGALKSDIRESLDRFKTVFA
108801387YP_641584.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MRVVIAGGHGKIAMQVEQLLAQRGDTAVGLIRNPDHAGDLEAIGAEPLVL
DLEKATVGEVIDALRGADAVVFAAGAGPGSGAARKETVDRDAAILLADAA
EAAGVKRYVVISSMGANTEAPDDAGDPVFVTYLRAKGAADDAVRSRRALD
TTIVRPGRLTDDPGTGRVHIADSTGYGAIPREDVAAVLLAVLDTPGTVGR
TFELVGGDTPIDEAVAAGG
108801385YP_641582.1 cytochrome P450 [Mycobacterium sp. MCS]MTPTHDGLGLPHVQYGDLPMAQDRGAGWAALRGLGPVAYGDGWFYLTERE
DVLAALRNPEEFSSRIAYDDMISPVPLVPLGFDPPEHTRYRRILHQFFSP
QTLGELLPSLQAQAIEIIEAIAVHDECEVMADLATPYPSQVFLTLFGLPL
ADRERLIAWKDAIIAFSLTTDPGSVDLTPAVELYSYLTEAVAEQRNRPRD
GILSQLLHGDDPLTDNEATGLSLVFVLAGLDTVTASIGTALLELTRRPEL
RKALRDNLDNVPAFVEEMIRLEPAAPVVGRVTTRPVTVAGVDLPAGAEVR
LCLGAINRDGSDALSGDDVVLDGRLHKHWGFGGGPHRCLGAHLARMELRL
VVTEWLTRISDFELAPGFVPEITWPSATCSLPRLPLRIRAREIS
108801383YP_641580.1 hypothetical protein Mmcs_4420 [Mycobacterium sp. MCS]MTTTDEKTEDLPPGTTPYYARMHKWIKRAVLVCLVALVIEGAFTLPFMAV
YYGYPTLSLTEICSELLKVRYSDDALECQVPYPAFGPPEGAEGKDTAQDE
WGIQPVPKYNRIGFRELVRIHEEREARQAAEQQQGP
108801381YP_641578.1 ATPase [Mycobacterium sp. MCS]MTTDTYYANGTEVQLFEQAFHQRLPVMLTGPTGCGKTRLVEHMGSLLGRP
VVTISCHDDLTSSDLVGRFMVTGGDVVWTDGPLTRAVKAGAICYLDEVVE
ARHDSLAILHSLTDHRRALYLDRAGEVVEAPDGFMLVCSYNPAYRSSLKE
LKPSFRQRFVTLPMRYLPPEQESAVIVAETGVDRQTAHRLVRCATAIRTA
DDVFHFEPPSTRVLVTAAALIAAGATALEAAEACILAPLSSDGAITEGLR
EVAVASLADADDSSTTL
108801379YP_641576.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTPPVKRSARQLRSRQTRERILGAAIAEFTSSGMAGADVGAIVAAAGVAH
GTFFFHFPSKEHVLLELERREEARMAADFTRFLGGAHDLATALTHLVGLV
SALEQRFGPRLFKELLALHFSPTRPTRDEWTDHPVIVSLVREIERASGDG
EVHPEVDAFYSATFFLLGLYGALTTTEHGEARDTMLAKLVTTALRGLTNK
EN
108801377YP_641574.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MALEQFDLTGQVAIVTGAGKGVGQGIAQVLAEAGAAVVGTARTESDIAAT
ISGIERAGGKGVAVVADAMSRPDGERVVAAAMENFGRVDILVNNVGGSTY
ARFLDITDEDFRHTFDWCVTSAFIMSQLTARHMIEAGRGSIINISSGSAR
FGIRALAAYCTAKGGLEALTRAMAQELAPKIRVNAIALGSFATEGLQGSL
DMMPGSLEKMNAATPLRRLGDVADLGRLCVYLSTRDCYATNAIFHVDGGI
ESNNSPLPIPDY
108801375YP_641572.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MNLFALLDQTAARHADRGAVYHGERQVHTWSSLRERALRLAGSFTGFGPG
ARIAVASENAPEIVELMFGIWAAEAVIVPVNYKLHPREMEQIVADAGVSR
IFASPKIGAELAQLVDVPVEVIGGAEYENRCAASPVDPPRTTDPASLAWL
FYTSGTTGRSKGAMLSHRNLMAMTVSHLADFDSPDENCSLVHGAPMSHGS
GLYVPPYVARGARQVVPASGAFEPAEFLDLCEHHPGCSAFLAPTMVARLV
ATGRAKPANLNTIVYGGGPMYVDSLKKALAAFGPIFVQLYGQGEAPMTIT
GLRRSDHLAGGVPASDAVLGSVGYARSGVDVAVLGEDDRPAGIGEIGEIV
CRGDVVMSGYWNNPAATAATLQDGWLRTGDMGSFDADGYLTLRDRSKDVV
ISGGSNIYPREVEEILLEHPAVVEAGVVGAPDEEWGEIVVAFIVGRVSPT
DLDAHLLERIARFKRPKRYEFIDELPKNSYGKVLKRELRERLTT
108801373YP_641570.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MGTTLADALRDAARDTPDRVLVRDGDDELTCGALQERAMALASALMRRMP
VGSVVSFMLPNWHEAAVVYLGATLAGMVVNPILPSLRDHELTFILADADS
RAIFIPHTFNGHDYAAMLKRVAAGLPSPPEVVVVRAEPAGHSSFADLLAE
AGGGDLPELSSDSTRMIMYTSGTTGRPKGVLHSHDSLHALLAQLGRYWNI
DPGDTFLVPSPIAHIGGSIYAFEAPLLLGSRAVLMERWDPDGAVALMLEH
GCTHMAGATPFLDGLLAAAQRADTRLPDLEVFICGGASVPPSLIRRAAAY
FERALVTRVYGSTEVPVTTVGSLDDVDHAAETDGRPGIADVTLVDGEIRA
RGPQMFTGYLHPQDNTGAFDTAGYFRTGDLGRWTDDGYLMVTGRAKDIII
RNGENISPKEVEDLLVTHPQIAEIAIVGIPDARTGERACAAVVAAGDPGP
DVAALREFLLGRGVAKFKVPEQVVLVEALPKNDAGKVLKHKIRASLTEGG
108801371YP_641568.1 NHL repeat-containing protein [Mycobacterium sp. MCS]MTSPTESLQATRYPGAQPTVTDGWRLERLTAPSRLFGANGLRTGPDGRVY
VAQVTGSQISALDLGSGTLETVSPKGGDIIAPDDVAFGPDGALFATEVMD
GRVSVREADGRTRVLRDDLPCANGITVHQGRLFIGECREGGRLLELDRNG
GIVRTLAENLPSPNAMEVGPDGLLYYPLMTANEIWRVDPNGGEPQRVAGD
LGVPDAVKFDADGFLVSTQVASGQVLRIDPRSGAQTLLAQLSPGLDNLTF
VGDRLFVSNFTGEITEILSGGETRTTLAGGLNWPLDLAVGDDGRLYVADG
TYFYVVEADGSLQTVGMLFTPGYPGFLRGLTPVGGGEFVVTTSGGQVTRY
RPAAGESEVLADGFDQLYGIAATPGGAAVFAELGTGRVHSVHDGEVQLLA
GDLREPVGVAIAPDGNPLVAESGAGRVVRLAGSQAVTVVDGLQRPQGLVV
ADGVLYIVDAGAKEVVAVDMNSGARQTIATGLPVGPPPGVEPKPLRGMPP
FSGPQGPFAGIAAAPDGTLFVSADGDGSVLALRRTART
108801369YP_641566.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MTHTESDLDAAIEVEADADDSTGEIAEDLSDAMTIPVEAYISPEYARAER
DKLWRRVWQQVGRVEEIPEVGSYLTYDILDDSIIVVRTGPNEFRAHHNVC
MHRGRKLVDTPDGAKNAVGRARKSFVCGFHGWTYGLDGTCTHIREQDDWK
GVLTPRNTHLAPVQVDTWGGWLFVNMDPDCEPLMDYLFPASKILDPFGLE
NMRYKWRKWLYFDCNWKVAMEAFNETYHVFTTHPEFNKFGEFKGWAKAQG
KHSNIGYDAPKGMDETKSKIRLGTGDDPRVSTAEMQMYTWEQTNATTTET
LVNAAKRLVDELPEGTPADKVLQHWLASARRDDEARGVIWPTIPPDILGQ
SGTAWQIFPNFQIGQGLTSALCYSARPDPSYDPNKCIFEVAVFELYPKGE
EPETEWAYTPKDSPNWLSVLPQDFSNMAAVQQGMKSAGFPGTMPNPYRER
STVNLHHQLSKYMGTGEPREL
108801367YP_641564.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MTDLRYDGRVAVVTGGGRGLGRAYALLLASRGAKVVVNDLGGDLTGDGVD
AGPAHEVVREIVAAGGEAVASTDSVATPEGGRAIVDTAMDTYGRLDILIH
NAGNVRRASLSEISDEDFDAVVDVHLRGAFHVVRPAFPVMCDAGYGRIVL
TSSIGGLYGNHDVVNYAVAKAGVIGLSNVAAIEGAEYGVRSNVIVPAAVT
RMAEGIDTSAYPPMDPELVAPTVGWLSHETCSVTGEMFIALAGRVATAVL
VETPGVYRSSWTVEDVAADLDAIRDRSHPVVFPVVPDGHNAHIRYSFAMA
AQKAGT
108801365YP_641562.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MSMDFDMGPRAAELRSRLRELVSEHVPEHFLGAFTDDPADLETAQRFCRL
LAEQDLLCLAWPQEFGGGGASVWEQTVVREEMWAHHEPRGAQYMGVNWVG
PIIMRHGTEEQQRRHLPPIARGEVIWCQGFSEPEAGSDLASLRTTARRDG
DGWLISGQKIWTSYATMAQWCFLLARTSRGERKQQGQTIFLVPMDDPAIQ
VRPIRAMLGPHHLNEVFFDDLRVTEADVLGTVDAGWSIVQDVMAFERVGI
ARYARCERLLAAAPTVLGDRWGDLSEELRGRWVRMLTHCRRARLMAYRVV
SLQSSGRIQPGDAAAYRIAVTKLDQDSAEVLMDISAEVSRDDPRAAWFLG
EVEDHWRYSQAATVSSGSIEMQRILLSRALLAAAK
108801363YP_641560.1 oxidoreductase-like protein [Mycobacterium sp. MCS]MKVLVIGTGFGKHAAAPAYESAGFDVEVVSPRDESAVARGLGSGADLVSV
HSPPFMHVDHVSAALDRGLAVMCDKPFGRTADEATAMRDRAHAVGVPTFL
NFEFRCRESWAKVKELADSGAIGTPNHLSWNWFGNRLRGRRYGWINDAEL
GGGWIGAFGSHLIDFTRWLFGSEIVDCGGVTRIDDPMHADADGTPRQATA
EDAYAAWFRLADGATAAQDTGFAAATSTLPRAVLLGTDGSIELTADTTLV
LRTKGSEPETFEFDRPGRPDPALVTLFGQVADALRTGSRTTPSFDDGLAV
ARVMDRLRANAVRMGTR
108801361YP_641558.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MSIDDFRATVRAWCAEHVPSDWREKQTGVGDEEFVRFQKAWFAELHSAGY
AVPHWPAEWGGGLSVAEQIVLYQELAAHDAPRLVLAFVGIHHAASTLLVA
GTDEQRRRHLPAILDGEIWVQGFSEPEAGSDLASLRTTAHRTGDTFVVNG
QKLWASGGMHADWCLLLARTDPDAPKRKGISYFLLDMTTPGVDVRPIRNA
VGDSHFCEIFLNDVEIPAANLVGAENAGWQVAQETLGAERGMTMLELAER
LANAGFRRLVRTSPVDDPVVADRLAQFECEITALRGLCRKVVEGHDSGAI
GPADASIVKLYYSELLQRLTDFGAEIGGPAGHTEIAKPMSSGWESGSWVL
DFIGSWEWTIPGGSSEIQRTIIGERGLGLPREPSAV
108801359YP_641556.1 thiamine pyrophosphate enzyme-like TPP-binding protein [Mycobacterium MGVPVYKRILDLFEAEGVNTLFGIPDPNFVHMFTEAEARGWSVVAPHHEL
SAGFMAEAASRMTGKPGLCIGTLGPGVANIAGAMMCALVENSPVIFLGGQ
RARITERRVRRGRIQFVQQEGLFTPSVKFSSSIEYADQTDEIIREAIRRS
MSGTPGPSYIEYPSHVILEELDVPEPLPPNRYRLVNQGAGEREIAEAATL
IREAKSPILLVGHGVHTSRTQEQVRELAELMACPVIQTSGGTSFIPGLED
RTFPYLFSPAANEAVEQSDLCVALGTELGEPMHYGRTQHWAGNDANRKWV
YVEQDPTAIGVNRQFDVPLVGDLRGVVPQLVDALRDAPRTPSATLESLVE
ADAAEIARVAEEAPSGRTPVHPARFVVEATKAFNEYAEDGIMVRDGGATV
IFQWTYSQAKPRDVIWNQNFGHLGTGLPYAVGASVAEGRKRPVMLLTSDS
AFLFHIAELETAAREGLPLVCVVGVDHQWGLEVGVYKRTFEQPSPQPGVH
WSKDVRMDKIAEGFGCHGEFVEKDDEIGPAIQRAYASGKTAVVHVCIDPK
ANSEEMPKYDRFRTWYAEGTQ
108801357YP_641554.1 amidohydrolase 2 [Mycobacterium sp. MCS]MVAGRYEYGIDFARVGAVDFHTHVEVDGHGHRAYDDALVEATAAYFKLGA
GALSSVDALADQYRRHNTAAVVFTIDARTAMRHAPNSIEDLVAGAVRNND
VLIPFGSVDPWHERRAVHRVHELVRDYGVRGFKFHPSMQAFEPNDRRFYP
IYEAIAEAGVPALFHTGQTGMGAGLPGGHGIKLRYSDPMLLDDVAADFPE
LTIVMAHPAVPWVDAQISIASHKANVFVDLSGWSPKYFPPQLVSAIGRQL
RTKVLFGTDYPYIQLDRWQRDFDDLGIDPAVRRLVYKDNALRVLGLAG
108801355YP_641552.1 major facilitator transporter [Mycobacterium sp. MCS]MKVGARSTTGWKATISVAMSNYIEAGSIIAIATSLGFWQAEFGISNFGVG
LLAALSANAFGAAIGAILGGPLCDRFGRKAIYTYDLLVYMAGVLVAACAV
NFTMLLIGFIVTGIAVGAGVPASWTYIAEQAPSVQRAKHVGTAQLAWSTG
PLVGFALAAALAPLGLLGSRLIFAHLFVVAAIVWWVRQGLQESQIWQDEG
RDEPTQVASAVGVRGLRGLFSRRVNITALLFLGGIYLFWNTVAGQAGIFM
PRVYDTAGLHSAVQQNLLQVLVWGCTVLATYFGFMGLADRMSQRLLYVIG
AALGIVGWIVLVAFTDSGVPTMLIFAVLWGVSSGIGAQAFYSLWTSELFA
TPYRASAQGVMFFVVRTATGLLSYFFPTMLAVTGLTGVGLLLVGLLTIAL
VIGAVWAPQTRGKTLKQIEAERYGAPVSPANVEKAAVTP
108801353YP_641550.1 short chain dehydrogenase [Mycobacterium sp. MCS]MTDTVRELIDRSNRLGADPKNTNYAGGNTSAKGTETDPVTGAPVELLWVK
GSGGDLGTLTEKGLAVLRLDRMRALVDVYPGVEREDEMVAAFDYCLHGRG
GAAPSIDTAMHGLVDAAHVDHLHPDSGIAIATAADGEALTKQIFGDRVVW
VPWRRPGFQLGLDIAEIKRANPQAIGTILGGHGITAWGDTSAEAEAHSLE
IIETAERYIAEHGRRYPFGAPLAGYGALPEGQRRDKAAALAPFLRGLVST
DKPQVGHFTDDPRVLEFLSCGEHPRLAALGTSCPDHFLRTKVKPLVLDLP
ADTSVEDCKARLAELHEAYRADYRAYYERHAGPDSPAMRGADPAIVLIPG
VGMFSYGKDKQTARVTGEFYLNAINVMRGAEAISTYAPIDEAEKFRIEYW
ALEEAKLQRMPKPKPLATRIALVTGAASGIGKAIATRLAAEGACVVIADL
DAGKAAAAAEELGNTDMAVGIAADVTDEAAVQAAVDATVLAFGGIDIVVN
NAGLSLSKSLLETTAADWDLQHDVMSRGSFLVSKAAARALIDQGLGGDII
YISSKNSVFAGPNNIAYSATKADQAHQVRLLAAELGEHGVKVNGINPDGV
VRGSGIFAGGWGAKRAAVYGVPEEELGAYYAQRTLLKREVLPENVANAAF
ALCTSDFSHTTGLHVPVDAGVAAAFLR
108801351YP_641548.1 LacI family transcriptional regulator [Mycobacterium sp. MCS]MREVAAAAAVSVGTVSNVLNSPDKVAPATVARVHAAIEELGFVRNDAARQ
LKAGRSRSVGLVVLDVGNPFFTDIARAAEHRAGEHNLTVLLGTSDDDPRR
ERAYLDAFDEQRVFGLLVSPIGDDLSRLRASQQRGTPVVLVDRDGSGTPF
DSVAVDDVAGARLAVDHLCATGRRRIAFVSGPTELRQVRDRLRGAREAVA
EVAGATLEVIETPALTVLEGRAAGERLRERPPGRRPDAVFCANDLLAIGV
LQALALIGDIRVPDDIALVGYDDIDFARSAVVPLTSVRQPTRAIGTTAID
LLMAAADAGGAHRPDHIVFQPELVTRDST
108801349YP_641546.1 Iron-sulfur cluster binding protein [Mycobacterium sp. MCS]MSTFLGTPGTGNLRGDEAFPRAARKALQDSQMRRNVGHATRTIRTKRLHA
VGECADWEELRAAGSALKQDVLARLPELLDELERNVTARGGVVHWARDAD
EANRIVGELTRAAGADEVVKVKSMATQEIGLNEYLESIGIAAVETDLAEL
IVQLGHDKPSHILVPAIHRNRAEIREIFRREMPGTADLTDEPRALAMAAR
AHLRRKFLSAKVAVSGANFGVAETGTLAVVESEGNGRMCLTLPQTLITVM
GIEKIVPRFTDLEVFMQLLPRSSTAERMNPYTSMWTGVHPGDGPQEFHLV
LLDNGRTSVLADEVGRAALHCIRCSACLNVCPVYERTGGHAYGSVYPGPI
GAILSPQLTGTAGHDDPNSSLPYASSLCGACFDACPVRIDIPSILVHLRA
KQVDAQRGGIPGGQDLAMRAAAWAMASPRRFALAEKALAAGRFAANADHR
ITTLPWPGSKWTASRDMPEPPTEAFRQWWSRTHG
108801347YP_641544.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MWSDHTRVDGYPHRMRAHELVLERIERDLADGALAIGDRLPGERALAEEL
SVSRSSVREAIRVLEAMGVVRTAVGSGPDAGATVVADPSSSIGSALRLHT
ATRHLPIADLVDTRILLESWALREAAHRRPRPDLTAVEAILDAMDEVALS
PEEFLRLDAAFHVAMSELAGNVVVGAMMAALRDSIHGYVLAGVPLLDDWP
VVATTLCAEHRAILNAVRRGHGARAGKLVDAHIHGYVDLIRR
108801345YP_641542.1 hypothetical protein Mmcs_4382 [Mycobacterium sp. MCS]MSDLPAWAQRLDLAPHPEGGWYRETWRSDLTVTQSALPPDYTGPRSAGTA
ILFLLMPGQQSAWHTVRSAELWMYHRGSPLLLEMGPEHDSATTHLLGSDI
DGGASPQLIVPARHWQRARPRDDEPSLVSCVVVPGFDFADFELGAVSD
108801343YP_641540.1 heat shock protein Hsp20 [Mycobacterium sp. MCS]MLRFDPFSDLDTWTRGLLSSQTGSDRTPRFMPMDLCKIDDHYVLTADLPG
VDPGSVDVNVDNGTLTISARRTARSEESAQWLANERFFGSYRRQLSLGEG
VDSAAISATYENGVLTVTIPMAERAKPRKIEVAHGGGQKSIQPTTVDAE
108801341YP_641538.1 hypothetical protein Mmcs_4378 [Mycobacterium sp. MCS]MIRAKLLKTMAMGIGAAALPVGVALAGAAPASAGPDVCVSGPYGFAYACV
DTPRWVEWYDDGPRGRGNGHWKHGHHD
108801339YP_641536.1 cytochrome c oxidase subunit III [Mycobacterium sp. MCS]MTATASPARARRIPGEAGTWVFLLGDMLVFGVFFGTFLVARAGDPELFDR
ARATLHIGIGLADTLVLLTSSLCVVVALGAVRAGAGALARRAVIAAIGLG
VVFVGLKVSEYLSLGAAGHGPGANDFYLYYFILTGLHLFHVAIGLTVLAV
VADQVRRPPLTPGRTALVEGGACFWHLVDLLWIVLFALLYLVS
108801337YP_641534.1 luciferase-like protein [Mycobacterium sp. MCS]MSRDFRFGIGLHSAASMAKVQDAARRAEDRGFDVLHVPDHLGAPAPFPVL
TAAAAATSTLHLGTFVLNAGFYRPALLARDAAALRDLSGDRLELGLGAGY
VRKEFEAAELPFPTARERVDHLEHTTTYLAEHVPGMRMLIAGNGDRLLRV
AARHADIIGLTGGDRAAEGDDDPLAERIAFVRAAAGERFDELELNIAITA
MPLDDSGRPDLTIPRRFLPGLSDDQLLRHPGVLSGTPQDMADRLREYRDR
YGVSYVIVQAPHEDAFAKVIAQLR
108801335YP_641532.1 RNA polymerase sigma factor SigK [Mycobacterium sp. MCS]MTALTQPVRLPFVTTDLDVLLRQVAERDVDAFAALYDRTRSRVYGMVTRV
LRDPGYSEETTQDIYLQVWRSAGSYDPKAGSPMAWLLTLAHRRAVDRVRS
EEAASQRESRYGAASVDPPVDHVADSVILLDERRRVVDCMGSLSDLQREA
IQLAYYEGLTYVQVSERLSANLATIKSRMRGGIRGLKNCLGMS
108801333YP_641530.1 amidohydrolase 3 [Mycobacterium sp. MCS]MAATLFRNGTIWTGTSESVAEALLVVDGAVAAVGADATARTADEEVDLDG
GFLMPSFGDGHAHPLLGGLEEVGPPVRGCGSVDEIVEAVRGYAERHPEAE
WIVGASYDGSLAEGGLFDARWLDAAVPDRPVVLRAWDYHTVWCNSVALQR
AGITADTPDPVLGEIPHREDGSVLGTLREWGAVDLVTAVMPERDEDIRVA
ALGTAADYYLARGVTWVQDAWVEPGDVETYLAAARRDALRIRFNLALYAD
PRHFDAQLPQFAEARRRVDELAAPLLTAQTVKFFADGVVENETGALIEPY
CSGLHNHSRGQERSDPGDKRGMQVWEGDSLAESVRRVDELGFQIHIHAIG
DAAVRQALDAIEHAITVNGPRDRRPVIAHAQLVDDADIDRFARLGVIANM
QPLWAQLDPLMTVLTVPRLGPERADRQYRMRTLDEAGVLAFGSDWPVSSG
APLDGIAVAASRRTVDGTPEGGWTPQEIVPVERAMRAYTAGVARQAFAEE
RWGRLTPGASADLVWLSADPRSTPALEIPAIEVRGTCLAGKLVGPSAR
108801331YP_641528.1 hypothetical protein Mmcs_4367 [Mycobacterium sp. MCS]MLRPGRHAYFAYGSNLCVQQMAQRCPDAADPRPATLADHDWLINERGVAT
VEPVDGAQVHGVLWQVSDHDLATLDSAEGVPVRYRRDRLTVQTDDGPAPA
WVYIDHRIEPGPPRPGYLERIIDGALHHGLPHRWVEFLRRWDPMHWPHRP
HHADTKGPKSLSELLTDPAVTEHSVLRSRFGFLAIHGGGLEQMTDVIAER
AAEAADASVYVVRHPEQYPHHLPSARYLAAESARLAEFLDHVEVAVSLHG
YGRIGRSTELLAGGGNRALAAHLAAHVEIPGYRIVTDLDDIPPELRGLHA
DNPVNRVRGGGAQLELTSRVRGLSPRSPLPGDDGLSPATSALVQGLVAAA
RSW
108801329YP_641526.1 hypothetical protein Mmcs_4365 [Mycobacterium sp. MCS]MNKFIGFAPLAVAAGIGAAVLMAPAAAAQPNCVTTGQGAYGGSTTQCSSP
GNTQIVTSPGQTNYLYPWNDYYYGPALVFGW
108801327YP_641524.1 dihydrodipicolinate reductase [Mycobacterium sp. MCS]MAIRVAQIGTGNVGSHALTQLIIDPQFELTGVWVSSAAKAGKDAAELAGL
DEPTGVTATNDLDEVLAAKPECVVYTAMADNRLPEALEDYRRILSAGVNM
VGSGPVFLQYPWQVLPEELIAPIEEATRTGGSSVFVGGIDPGFANDLLPL
ALAGTCQRIEQIRCMEIIDYATYDSPTVMIDVMGFGKPLDDLPMLLQPGV
LSLAWGSVVRQLAAGLGIELDEVTETYVREPAPEDFDIASGPIAKGTAAA
LRFEVRGIRDGKVAVVLEHVTRLREDLCPDWPQPAQPGGSYRIEITGEPT
YTLDLCQSSPHGDHNRAGLVATAARIVNAIPAVVAAEPGIRTTLDLPLLT
GKGLYAS
108801325YP_641522.1 DNA end-binding protein Ku [Mycobacterium sp. MCS]MRSIWKGSIAFGLVNVPVKVYSATEDHDIKFHQVHAKDNGRIRYKRTCEV
CGEVVEYRDIAKAFESDDGQMVVITDEDIATLPEERSREIEVLEFVPASD
LDPLMYDRSYFLEPDGKSSKSYVLLAKTLSETDRVAIVHFALRNKTRLAA
LRVKDFSKRDVMMIHTLLWPDEIRDPDFPVLDKEVEIKPAELKMAGQVVE
SMTDDFNPDRYHDDYQDQLRELVEAKLEGGEAFAVEEQPTELDETEDVSD
LLAKLEASVKARRSGSSSGSDSDDGDEPAKKAPAKKSAAEKAPAKKAAKK
TAAKKAPAKKASAKK
108801323YP_641520.1 mannitol dehydrogenase-like protein [Mycobacterium sp. MCS]MKLDESTLPDIPIAKPTYARGDVTVGIVHFGVGGFHRAHQAMYVDALLEK
GLAAEWGICGVGVLPGDRKMADALGAQDGLYTLLLENPDGSRDARVIGSI
VDYRYAPDDPEGVVELLAAPSTRIISLTITEGGYEVDKVDADSVNVFGLI
TDALALRRDRGVDPPTIVSCDNIEGNGDVARAAFMSYADRTHPGLSEWIG
SNARFPNSMVDRITPVTTPEVIATVRDEFGVDDAWPVVAEPFTSWVLEDT
FTDGRPPFEDVGVLLVDDVTPYELMKLRLLNASHQALCYFGYLAGYRLVH
DAAADPLFAELLRRYMDSEATPTLRPVPGIDLPDYKRTLIERFANPGVRD
TIARLCYGSSDRIPKWLLPVVRENLRTGAPIRLSAAVVASWSRYAEGVDE
QGEPIDVQDQLADELVPLARAQRDNPTSFIENRLVFGDLVDEKRFVDEYV
AALESLHRVGARATLEALVGKP
108801321YP_641518.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MKVQTIARRLAGGLAAAGLVFTSGCSGAGSLGSSDNEVTIALVSNSQMTD
AQQLSSEFEKENPGTKLKFITLSENQARAKITMSAAMGGSEFDVVMISNF
ETPQWAKDGWLVNLSEYAKNTPGYDEDDFISSLRESLSYEGNMYAVPFYG
ESSFLMYRKDLFEQAGITVDQNPDYQPTWPEVAQWAETLKTDDRAGICLR
GKPGWGEVLAPLDTVINTFGGRWFDEQWNAQLDSPEVKKAVNFYVDTVKN
FGELGAASTGFQECANLFGQGQTAMWYDATSAVSVLEDPKEYPDLVGKIG
YLPAPIVEKPNSGWLYTWALGIPKGAKNPDGAWEFISWMTSKDYMKLVGE
KLGWARVPPGSRTSTYTDLPEYEAISKSYGPLTLKSIESATPNQPTVQPV
PYTGIQFVGIPEFQDLGTRVSQQISAAIAGQKSVDDALAQSQEYAEVVGR
TYQEK
108801319YP_641516.1 binding-protein-dependent transport system inner membrane protein [MycMTTTVEETTPTTGSDITAKKKSRKFSVWGVLAWLVGLGFFFPVFWMILTS
FKQEGDAATDPPKLFFTPTLDQYGAVFDQGIGPAMLNSLFATGLSTILVL
LLGTPAAFALSLRPVRKTQDALFFFMSTKMLPIVAVILPLYVIVSNIGLL
DNIWALVILYTAMNLPIAVWMMRSFFLEVPAELLEAASLDGASLWRSVRE
VILPLVSPGIAATALICVIFAWNEFFFAVNLTAVNAQTMPVYLVGFIAGE
GQYWAVLSAAATMAALPVIICGWLAQNKLVRGLSFGAIK
108801317YP_641514.1 hypothetical protein Mmcs_4353 [Mycobacterium sp. MCS]MSEPFIGREAITRGKLTRGQLRARYVAVHPGVYFPKGARPTLAARASAAW
LWTGRHGVISGRAAAALHGAKWVDATTPIEIIAEHGRRRDGVIVREERVG
DDEVVVIGDLPVTSSARTAFDLARHLPRDAAVVHLDALAAATGVSAADTA
PLARRYRGARGVRSADVALDLMDAGAASPQETRLRLTLIDGGLPRPRTQI
RVTDGYSEAFIDMGYDEPKVGLDYEGAHHATSRGQYVHDIGRAELLDREG
WIDLRVVAEHSRRFILHRVREAFARRGWIPPSST
108801315YP_641512.1 hypothetical protein Mmcs_4351 [Mycobacterium sp. MCS]MYVRGMSGHDLQAAVTALRAAFDEVASCDVALLDRAELVAALDELEALGC
RLPTMSHRLLARLRSEATPQQMGAKSWREVLTVRWRISGSEANRRLTEAG
LLAPRQALTGPSLPPVLPATAAAQAHGLINSEHVEVIRRAVDKLPGFVDT
VTREQFEVTLVRTAVGVGPKELKDAADLTLFLLDQDGPEPDDTERARKRG
VSRSKQRPDGMVELSGHLTPEAWAVWEVIFAKYAAPGMCNPDDPEPCTSG
APSQEQIDNDHRTLAQRQHDAMVAIGRIALMSGELGQLNGLPVSIIIRTT
LEDLESRAGVGTTGGGTVVPIADVIRMAGHANHYLAVFDGATGSALDLFR
AKRTASAAQRIMLIARDGGCTKPCCTVGAYGCQVHHVDADWSDGGNTNVD
ELGLACGPDNRSVDKDGGWSTRMNDQCEVEWIPPPRLDTGQARLNHYHRP
ERLLRPSDDPVPTSQDRSGAIEPADGGKVGDAESGPPRSADDTGEPGGPA
PPGNRAA
108801313YP_641510.1 hypothetical protein Mmcs_4349 [Mycobacterium sp. MCS]MTVTVDEIRVADPADAWIRAGFDVDPDDVCRIGGVRIRLVGRDRGTGIVG
WSLRGLPGPSADLDGIATNASEAAGAVPARHANGVTAIDHVVLMSPDLKR
TVAALAAVGLAPRRERDADPGGRPVRQIFFRLGEVILEVVGSPETAREGP
SRLWGITYVVADIDATASFFGDRTAPVKAAVQSGRRITTLRHRDLGMSVP
TAMISPLILES
108801311YP_641508.1 FHA domain-containing protein [Mycobacterium sp. MCS]MPCHLEVWKPSGRQLIALDGQRVTLGKASTNAVPLEHDETVSRLHAVFEN
LGSAWSIRDLGSRNGTYLNGEKITAERVLRSGDEVRVGRSRMIFWQGHGT
GEGPGDEQTVSAQPSDLPPRLTPREIDVLMALCRPLVSDDLFPEPASVRR
MAGELFVTEAAVKQHLQNLYDKFAVPAEGDRRVRLANEALRRGAVTIAQL
RDAT
108801309YP_641506.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MPVLDRFRLDDKVVIVTGASSGLGVAFAKACAEAGADVVLAARRVEKLEG
TAELVRAAGRRALSVATDVVDPAQCQAMVDAAMAEFGHVDVLVNNAGVGT
AVPATRETPDEFRAVVDVNLNGAYWAAQACGRVMGPGSSIVNISSILGIT
TAGLPQAAYSASKAAIAGLTRDLAQQWGIRKGIRVNAIAPGFFESEMTDQ
YKPGYLESVIERAVLGRTGDPEELAATLVWLASDAGGYVTGQTIVVDGGV
TIT
108801307YP_641504.1 hypothetical protein Mmcs_4343 [Mycobacterium sp. MCS]MRFTYAEAMTDPTYYIPLAKAAEAAGYDAMTIPDSVAYPFESESKYPYTP
NGSREFLDGKAFIESFVLASALCAVTTTLRFNFFVLKLPIRPPALVAKQA
GSLAALFDNRLGLGVGTSPWPEDYELMNVPFAKRGKRMDECIEIIRGLTT
GEYFEFHGEFYDIPKTKMTPAPTKPVPILVGGHADVALKRAARCDGWMHG
GGDPEELDGLIAKLNRFREEQGQSGPFEIHVISVDAFTLDGIKRLEDKGV
TDVIVGFRIPYITGADTEPLADKIRNLEWFAENVIGKL
108801305YP_641502.1 major facilitator transporter [Mycobacterium sp. MCS]MTRVPTRQPWLTRNVRLLSAVSFLQDAASELLYPLLPIYLTSVLGAPAAV
VGAVEGAAEGAASLTKLASGPLADRFARRPLIATGYGMAALGKVIVAAAG
TWPGVLAGRVTDRLGKGLRGAPRDALLVDGIDPDARGRVFGFHRAMDTFG
AVVGPLLGLAGYELLDHQIPPLLWVAVIPAVLSVALVFCVRERTRAVPAV
ARPPLLSRVRDLPRRYWRVTALLVGFGVVNFPDALLLLRLNEIGFSVVEV
ILAYVGYNVVYAVASYPAGALADRVGTPAVFAVGLGFFAVGYTGLGLTTD
TLTAWMLIGVYGLFTACTDGVGKAWISSLVGADVQASAQGVFQGASGFAI
LAAGLWAGLLWGADGTVPLLISGLAGGVFAVIVAVFAVRHR
108801303YP_641500.1 ribonuclease BN [Mycobacterium sp. MCS]MAEAASTKHRAPDPDDPRKPESPTDLTKPSAFYVLRKTAREFGHDQCTDL
AAALTYYAVLSLFPAVLVMVSLLGVFGQGRRTTDALLDIVSDVAPASTVD
TLRPTIEQLVESPSAGFALVIGILTALWSASGYVGAFGRAMNRIYEVAEG
RPVWKLRPLQLVLTFAALLGAALVAFMLAVSGPVAEALGNAIGLGEAAVT
AWSIGRWPVILLLVVVAVAVLYYATPNVQQPKFRWISLGAGLAILTWIVA
SVGFGFYVANFSSYNKTYGTLAGVIIFLLWLWITNLALLFGAELDAELER
GRQLQAGLPAERELQLPPRDTRVIEKKEAAIEEDVERAKALRRSRGRDDG
108801301YP_641498.1 membrane protein [Mycobacterium sp. MCS]MGFLLRAAVTGVALWLVTQFVSGMEFVGGENTLQRVGIIFVVAVVFGLVN
AIVKPIVQILSIPLYVVTLGLFHVVVNALMLWLTAWITEHTTHWGLYIDD
FWWTAVWAGIVLSIVSWVLSVLSGNLIKR
108801299YP_641496.1 short chain dehydrogenase [Mycobacterium sp. MCS]MTRQRILITGASSGLGAGMARAFAAKGRDLALCARRVDRLDELKAELKQR
YPEITVAVAELDVNDHDQVPKVFAALSDELGGLDRVIVNAGLGKGAPLGS
GKLWANKATIETNLVAALVQIETALEMFKRTGAGHLVLISSVLGNKGVPG
VKAAYAASKAGVSSLGESLRAEYAKGPIRVTVLEPGYIESEMTSKSASTM
LMTDTDTGVAAMVRVIEKEAGRAAVPWWPWAPLVQLMRVLPPRLTRLFA
108801297YP_641494.1 succinate-semialdehyde dehydrogenase (NAD(P)+) [Mycobacterium sp. MCS]MKSVPTGLWIGGEEREAKSTFNVLDPSSDEVLVAVGDATAEDAVAALDAA
CAVQAEWAATPARKRGEILRSVFETLTDRADDIAALMTLEMGKVLAESKG
EVTYGAEFFRWFAEEAVRIGGRYTPSPAGTGRIIVTKQPVGPCYAITPWN
FPLAMGTRKMGPAFAAGCTMIVKPAQETPLTMLYLAKLMAEAGLPKGVLS
VLPTSSPGPVTEALVDDGRLRKLTFTGSTGVGKSLVKQSADKLLRTSMEL
GGNAPFIVFDDADVDAAVDGAMLAKMRNGGEACTAANRFHVANSVREEFT
EKLVKRMSEVTLGNGLDESATLGPLINNKQLQKVTELVSDAVSRGATVAV
GGVAPGGPGNFYPATVLADVPADARILKEEVFGPVAPITGFDSEEEGVAA
ANDTEYGLAAYVYTRSLDRALRVAEAIESGMVGINRGVISDAAAPFGGIK
ESGFGREGGTEGIEEYLDTKYIALTK
108801295YP_641492.1 hypothetical protein Mmcs_4331 [Mycobacterium sp. MCS]MRPEPPHEESEMSIETDQSLDIDALRQEIDELDAAILAAVQRRTEVSKII
GRARMASGGTRLVHSREMKVIERYSVLGPEGKDLAMLLLRLGRGRLGH
108801293YP_641490.1 hypothetical protein Mmcs_4329 [Mycobacterium sp. MCS]MSSADSTGRPDDSPPQHDPETRIIRRHPTGAQPVVPSAQQTGIIRRHPTG
ELPAVAHEPQTSYIEPPAVEDGAQTSYIPRPRPVEIPATTFVAHPRTAIA
AAVLTIVSGWATAVIATDLIAGWWRTDQLFCVAIGFLTTISAAASIGGLV
MLLLRRRMSRLLVVVGCVIGLLIFGSLFVAGAKFPWIVYAIPVLPVAAIA
LTLLPSTGRWAQSG
108801291YP_641488.1 succinyl-CoA synthetase subunit beta [Mycobacterium sp. MCS]MDLFEYQAKELFAKHNVPTTPGRVTDTAEDAKAIAEEIGKPVMVKAQVKV
GGRGKAGGVKYAATADDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEY
YISFLLDRANRTYLAMCSVEGGVEIEEVAATKPDRLARIPVDATKGVDEA
FAREIAEKGHLPAEVLDAAAVTIAKLWEVFVGEDATLVEVNPLVRTPDDQ
ILALDGKVTLDANADFRHPEHAEFEDRDATDPLELKAKENDLNYVKLDGQ
VGIIGNGAGLVMSTLDVVAYAGEKHNGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGEEANKPLVVRLDG
NRVEEGRKILADANHPLVVLAQTMDEGADKAAELANK
108801289YP_641486.1 acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]MVDPRTPVIVGVGQFTERIDDDGYRGLSAVDLATEATRAALSDTGADTAA
VAQAIEVFAGLRQFEICTPFADPPLGASDNYLRSVAKRVGADPARAVLEP
IGGNGPQKLMTEFAGAIAAGDIEVALVVGSEPGSTAKYFAKRDRKPDFTE
HVGGQLEDRGYGFEQYMSDYTVAHGLTGAPVQYGLLDNARRAAKGLGVAE
YRREMAELFAPFSAVAAKNPYSSSPVERSVDEIVTVTDENRMICDPYPRL
LVARDTVNQGAAAIVMSVAAARRLGVPEGKWVYLRGHADQTEQDLLDRER
LGVSVSAKQAVAEALRVAGIGIDDVATFDLYSCFPFPVFAVCDEFGLDAD
DPRGLTLTGGLPYFGGPGNSYSLHGIAETVAAMRDNPGSYGLVGANGGVM
SKYSVGVYSTEPADWAADRSKELQADIAGLPKVPVTRHADGRGTVETYSV
RYDWPVRTGIIIGRLDADGSRFLAISEDDDLVALMSDGDPLGAAIEVRPD
GDKNRATSA
108801287YP_641484.1 alkanesulfonate monooxygenase [Mycobacterium sp. MCS]MGDGGRGGCCHGSMSTERIADHVKFAYWVPNVSGGLVTSTIEQRTDWNYE
YNKKLAQTAENNGFEYALSQVRYEASYGAEYQHESTSFSLALLLATERLK
VIAAVHPGLWQPAVLAKLGATADQLSGGRFAVNVVSGWFKDEFTHLGEPW
LEHDERYRRSAEFLQVLRKIWTEDDVDFRGDFYRIHDFTLKPKPVNTPER
PNPELFQGGNSTAARRNGGRYADWYFSNGKDFDGITEQIVEVRDHAREVG
REVKVGLNGFIIARDTEKEARDTLREIIEKADKPAVEGFRSAVQQAGNST
ADKKGMWADSSFEDLVQYNDGFRTQLIGTPEQIAERIAAYRKRGVDLILG
GFLHFQEEIEYFGARVLPLVREIEASDASSADAPALATV
108801285YP_641482.1 hypothetical protein Mmcs_4321 [Mycobacterium sp. MCS]MDNRPVGTRQARELLRVAFGPSVVALVVIAAVTLLQLLIANSDMTGAFGA
IASMWLGVHLVPVSIGGSELGAMPLMPALMMVWGTARTTAAATPPHGSWF
VTRWVVASALGGPLLIAAIALAVIHDAASVLTELQTPSALRAFGGVLVVH
LIGAAIGVASRVGRRTVLTSPLPNWLPDAFRAAAAGVLALAGLCGVVIAG
SLVVHWSTMHELFAITDSVFGQFSLTVLSLLYLPNVVVGAAAVAVGSSAH
IGLATFSSFTVLGGDVPALPVLAAVPEPPLGPVWVALLIVGAAAAVAVGQ
QVARRPAPIHIAAAKLVVASAVAALTMALLGEAGGGRLGNFGQVGVDQTT
FGPGVFLWFTVIGGLTVVMSGGIVRRPRRVRVTEPEPEPEPEAAPEQDLD
DAETGPIVDPVAAAPEPVTAEPVAEPVPGEPDPALDPEEHFIVDDAGSPP
NDSAPNDSPPNDSAPTDGEPRR
108801283YP_641480.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferaseMSGDQGQAGAKRPIRRALISVYDKTGLIDLARGLHEAGVDIVSTGSTAKT
IADKGIPVTPVEFVTGFPEVLDGRVKTLHPHIHAGLLADTRKPEHVEALA
KLGIAPFDLVVVNLYPFSETVESGASVDECVEQIDIGGPSMVRAAAKNHP
SVAVVVEPNGYDGVLAAVRTGGFTLAERKILASLAFRHTAEYDVAVASWM
GSTLAPEEPAQKLPAWVGGTWRRAAVLRYGENPHQQAALYRDATAWPGLA
QAEQLHGKEMSYNNYTDADAAWRAAFDHEEICVAIIKHANPCGIAISSVS
VADAHRKAHECDPLSAFGGVIATNSSVSVEMAETVADIFTEVIVAPAYEP
GAVEILSRKKNIRILVAAQPPTTGTELRPISGGLLLQQRDALDADGDDPV
NWTLATGEPADPATLANLKFAWRSCRAVKSNAIVVVADGATVGVGMGQVN
RVDAARLAVQRAGDRVRGAVAASDAFFPFPDGLETLTEAGVKAIVHPGGS
MRDDVVTEAAAKAGISLYLTGARHFAH
108801281YP_641478.1 serine/threonine protein kinase [Mycobacterium sp. MCS]MPLETGQVFAGYTIVRLVGTGGMGEVYLAQHPRLPRQDALKVLPASFSAD
DEYRHRFSREADLAAALWHPHIVGVHDRGEYDGRLWISMDFVDGHDAARL
LVDRYPNGLPAADVIEIVTAVADALDYAHQRQLLHRDVKPANILITGPDR
ARRRILLADFGIARHAEDNTGLTSSNIAVGSMSYSAPEQLMGHPIDGRAD
QYSLAATAYRLFTGSPPFPHSNPAVIISHHLNTPPPRLGDTRPELRAFDA
AMARALAKDPAARFGSCHDFAVALAQATGSPAAPPSLATAPPGPVGPPPG
VSYPGPPISAPPAQPQMGAAGPPVMVSPWMPSGAPYPGTQYGPAQGQPPP
RRRGLIVAGAILAVILLVAAVVSVVAVSGSDDDSTPNPATTTTTTRSRTA
PTTTRPTATSARPNRSAYTIADYIRDNRIVEVPIRRETPDAPVVTLPIPP
GWSDAGPRAPSWAYSAMVFDGLPANVDPPTVISLMSKLSGDVDPARIFEY
APNELKTLPAARTGIAGPIKLSGYDAVQVEGTYERDGRPRATWQKTAVVD
TADGLFILQVNGDAPAAESRLITDVGAVIDQQTTIAP
108801279YP_641476.1 sulfate transporter [Mycobacterium sp. MCS]MNPARLLPRRSDYADLPTSWRRDVLAGVTVGVVALPLALAFGISSGVGAA
AGLITAVVAGVVAAVFGGSHVQVSGPTGAMAVVLAPIVAAHGLGSVALVT
VVAGLLVAGCGIAGLGRTVTFIPWPVIEGFTLGIAVIIFAQQLPAALGVS
APAGGRTLTTALHVLTHADWAAAAKTLVVVGFVAVVMVALPRLHPGAPAS
LLAVVGATIGVIALHVPVAAIGELPSHLPAPVLPTVDVDSLRTLLSAAVT
VAALAAIESLLSARVAATMSPTGPYDPDRELLGQGLASVASGVFGGMPAT
GAIARTAVNVRSGARTRVAAIVHSIVLLGVVYLLSGPVSQIPLAALAGVL
MVTSFRMISAATVRSILRSGRSDALTFVVTAVITVSFDLIEAVMIGVLAA
AFFALRNVAGRSSVTREQLPGPNRDGDEHIALLRLDGAMFFGAAERISTE
IAEAFGTPGGPAAAGIRVVIIRMSQLGMLDATGARTLAEITAELEARGIT
VIIKGVRPEHLNMITSVGVLDSLRHENHLMDSLDDAIAHARTHVAEHPS
108801277YP_641474.1 von Willebrand factor- type A [Mycobacterium sp. MCS]MADARAHKGHGRSSRYSRYTGGPDPLAPPVDLREALEQIGEDVMEGSSPR
RALSELLRRGTKNMRGADRLAAEANRRRRELLKRNNLDGTLQEIKKLLDE
AVLAERKELARALDDDARFSEMQIEALSPSPAKAVQELSDYQWRSPEARE
KYDQIKDLLGREMLDQRFAGMKEALENATDEDRQRVNDMLDDLNELLDKH
ANGQDSQQDYDDFMAKHGEFFPENPRNVDELLDSLAKRAAAAQRFRNSLS
PDQRAELDALAQQAFGSPSLMNALNKLDSHLQAARPGEDWSGSSEFSGDN
PLGMGEGAQALADIGELEQLAEQLSQSYAGATMDDVDLDALARQLGDQAA
VDARTLAELERALMNQGFLDRGSDGKWRLSPKAMRQLGQAALRDVAQQLS
GRHGERDTRRAGAAGELTGATRPWQFGDTEPWNVTRTLTNAVLRQAGSSV
REIPVSITVDDVEISETETRTQAAVALLVDTSFSMVMENRWLPMKRTALA
LNHLVSTRFRSDALQIVAFGRYARTVTAAELTGLEGVYEQGTNLHHALAL
ATRHLRRHPNAQPVILVVTDGEPTAHLEDFGGRDGAQVFFDYPPHPRTIA
HTVRGFDEVARLGAQVTIFRLGTDPGLARFIDQVARRVGGRVVVPDLDGL
GAAVVGDYLTSRRRR
108801275YP_641472.1 PE-PPE-like protein [Mycobacterium sp. MCS]MAKHRTVRKSSGRRSSMARLMAPGGLAAAAVGATGLSSALMTGATTAIAP
SVDLVALITPANSTSQIFAGTTYYGTDYANPPLYGEQQVVPFFLGPQGIA
DAIRAADDDSRGTVVLSSGWGAGQTGTALGMLSPGDRDNVDLVILDNNTN
RAGGGFWTTYSPFAPLLLTSADPTPTDLGVPVLDVAYEYNINSSAPVDPL
NPFALGNSLVAYLYGYGAQQTAEVPPEVMAEAKNPAGPHYHYVLDSNGEI
VGEPTLLPDSTTTYVTFESDGLPLVRPLRLLPGGDIVADAIEPTLTELVN
AGYNDGLGMEDNPAIPLDPTVERPMKPGSSLTALDGVPESASTGVDAGVK
TAQEDLAEPTKLVTKPVDEVGKLPVLSTLADDASETLLPNLKRNTTGAAS
DDDESDAPAKERPGQRFAERINDVVKKVTGGASIGANTDKTDDAAGGDET
D
108801273YP_641470.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MSTLVRYAVDGPVARLTLDSPQNRNALSTVLVEQLHDGLRRAAADAGVRT
VVLGHTGGTFCAGADLREAAGRDPGDVAVDRARELTGTLRAILESPVPVI
AAIDGHVRAGGLGLVGACDIVVAGTGSTFALTEARIGVAPSIISLTLLPK
MTPRAAGRYFVTGETFGAQEAERIGLATVATDDVESTVAELAAQIGRGSP
QGLAASKALTTAALLQAFDRDAAALTEQSAALFVSEEAREGMLAFLEKRP
PRWIG
108801271YP_641468.1 pyruvate carboxylase [Mycobacterium sp. MCS]MITRVLVANRGEIARRVFSTCRRLGIGTVAVYTEPDAQSPHVAEADARVR
LQGNNGYLDSAQLIAAARAAGADAIHPGYGFLSENAEFAAAVCDAGLTWI
GPPAAAVAAMGSKIEAKKMMAAAGVPVLDELDPATVTADRLPVLVKASAG
GGGRGMRVVRDLDALAGEVQAAQREAQSAFGDPTVFCERYLAAGHHIEVQ
VMADVHGTVWAVGERECSIQRRHQKIIEEAPSPLVERTPGMRAKLFDAAR
LAAEAIGYTGAGTVEFMADDTGEFFFLEMNTRLQVEHPVTEATTGLDLVE
LQLLVADGGRLDAEPPPSRGSSVEARLYAEDPAKNWQPQAGTVHRFHVPP
TVRVDSGVEDGSVVSIFYDPMLAKVISYAPTRRQAAAILADALVRTRLHG
VRTNRDLLVNVLRHPAFLDGATDTAFFDTHGLAELAAPIGDARAGELSVL
AAALADAARNRSDATVFAAAPSGWRNLASGYQTKRYRDAAGDEHEVRYRF
TRAGVQFGDHDDVRLMSATPQRVVLASGGVEFPFDVARHGDAVFVDSPLG
AVEFVALPRFPDPESAVAQGSLIAPMPGAVVRVGAAVGDTVSAGQPLVWL
EAMKMEHILTAPGDGVLAELTVAPGQQVEVGTVLARVESPEGDDT
108801269YP_641466.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MSIWDTPERDQLRKTVRAFADREVLPHVDEWERAGELPRELHRKAGAAGL
LGAGMPESVGGGGGDGADAVIICEEMHYAGAPGGVFASLFTSGIATPHMT
ASGDERLIDTYVRPTLHGELIGSLAITEPGGGSDVGHLTTRAERDGDSYV
VNGAKTYITSGVRADYVVTAVRTGGPGAGGVSLLVVDKGTPGFEVTRKLD
KMGWRSSDTAELSYTDVRVPAANLIGAENTGFLQIAGAFVSERVGLAAQA
YSSAQRCLDLTVQWCRDRETFGRPLISRQSVQNTLAEMARRVDVARVYTR
HVVERQLSGETNLIAEVCFAKNTAVEAGEWVANQAVQLFGGMGYMAESEV
ERQYRDMRILGIGGGTTEILTALAAKTLGYQG
108801267YP_641464.1 hypothetical protein Mmcs_4303 [Mycobacterium sp. MCS]MSWVTQALFGAVWAVGGVVIGLSPPLSETGRGASTPVAGWFFAAFGVYLL
ISGFRRTADPPRDPTRRPRHASGREPDRRTAVVVPLSIVITALAGFGSIW
WGFTSGNVALLWLGVLGASIIVFGAPIIVDMVRDRRSRR
108801265YP_641462.1 two component transcriptional regulator [Mycobacterium sp. MCS]MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAV
VLDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTSPDEGPDSPALTFLDLTLDPVTREVTRGS
RQISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIG
YLRRKTEASGEPRLIHTVRGVGYVLRETPP
108801263YP_641460.1 peptidase S1 and S6- chymotrypsin/Hap [Mycobacterium sp. MCS]MTNHPRYSTPPQQQPGHRPVGPDTGYQGADPYSQQQPYDWRYAAQPQQQF
RAPYDPYRGAAQPTAVMPQPRPTQKRSRAGALTVGALAVAVVSAGIGGGV
ATMVQQDRPSFGSSITGAAPSVPAAALPAGSVEQVAAKVVPSVVKLETNL
GRASEEGSGIILTSDGLILTNNHVVAAAADGPGAPGGAQTKVILSDGRTT
SFTVVGTDPSSDIAVVRAEKVSGLTPITLGSSSDLRVGQDVVAIGSPLGL
EGTVTTGIISALNRPVAAGGDTRNQNTVLDAIQTDAAINPGNSGGALVNM
NGELVGVNSAIATMGGDSAQAQSGSIGLGFAIPVDQAKRIADELIQNGSA
SHASLGVQVSNDAATDGAKIVEVNQGGAAAAAGLPSGVVVTKVDDRVINS
ADALVAAVRSKAPGDKVTLTYLDPSGKPQSVQVTLGKMQQ
108801261YP_641458.1 hypothetical protein Mmcs_4297 [Mycobacterium sp. MCS]MKAISRVLIALAAAIAALFTSTGTSNAGLDNELSLVDGQGRTLTIQQWDT
FLNGVFPLDRNRLTREWFHSGRAKYIVAGEGAEDFEGSLELGYQIGFPWS
LGVGINFSYTTPNIAFDGEVLDVTGGVGGIVPLDAIVTPPLFPGVSISAD
LGNGPGIQEVATFAVDVEGAEGAVAVSNAHGTVTGAAGGVLLRPYARLIA
STGDSVTTYGEPWNMN
108801259YP_641456.1 integrase catalytic subunit [Mycobacterium sp. MCS]MKEAAVATGVSRDRCYAILRAIGRPVGQARGRGERADQRGVADLGVVVAV
FKDTGSILQAATACGVSHSTARKLLVAEGLVTSGKIPWGKPEAKRRCLEL
FEQGWSTGAAAREVGVNVRTARDWRKGIRHTNNTRVHPDGRVVDYTDQTV
YKQSVSNLICDDTGRPAIDDRYLSVQDRVAIADGLLGKESLRTIAGRIGK
NVSTVSREIRARSIDGRYLPYHADRAAASARARPKQSKLVVNVVLRGAVE
EGLSRKLSPEQISNRLRRDHPDDESMQVSHETIYQALYFQARGGLKKEVQ
QALRTGRTRRKPHRKEGERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDL
ITGEKNQTAIGTLVERSTRYTMLVHLPGGHDAESVRDALIATISTLPAHL
RGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPWQRGSNENTNGLLRQY
FPKGTDLSIYGPEDLEHVAQELNGRPRKTLGWDTPAERLRDLLLTN
108801257YP_641454.1 hypothetical protein Mmcs_4293 [Mycobacterium sp. MCS]MGESLDPTPIARLTGLRPDWSRTVTARRIVAAVLVMLAAVAAVRSDPDGD
QVDVVVAATDLTPGTELAESDVRVERRPLTTVPDGAAVDPTAVIGATVAG
PTRRGEVLTDVRLLGPRIAEAAAGPDARIVSLQLADGALVDLVRTGDVVD
VLAAPASNTGEEARPRVIATRAVVVLVSEKRQGPGAAGERAVLVALPAQA
ANDVAGASLTQAVTLTFH
108801255YP_641452.1 5-formyltetrahydrofolate cyclo-ligase [Mycobacterium sp. MCS]MTSPTKSEMRAQVLQARRKVTPETQEREAAALAAHLAEIAAPGRTVCAYV
PIGSEPGSLAMLDELLARGARVLLPVARHDEAGVPAPLRWGEYRPGRLAD
AQFGLREPAPPWLTADAVAEADVVLVPALAVDRCGVRLGRGAGFYDRSLG
RADSAALLVAVVRDEEVVDRVPGEAHDVRMTHALTPGCGLVALRESQ
108801253YP_641450.1 MoeA-like domain-containing protein [Mycobacterium sp. MCS]MRSVEEQQARIAAAAVAPRPVRVAIAESQGLMCAEEVVTERPMPGFDQAA
IDGYAVRSVDVLGVGGGPGADDHDGRDVSLPVMAMIEAGARTPSRLQPRQ
AARVQTGAPMPTLADAVLPLRWTDGGANRVRVLRGVRSGAYVRRAGDDVQ
PGDVAVRAGTIIGPAQVGLLAAVGRERVLVHPRPRLSVMSVGGELVDISR
TPGNGQVYDVNSYALAAAGRDAGAEVNRVGIVDTDPARLREIVEGQLNRA
EIVVIAGAVGGAAAESVRTVLAELGEMEVSRIAMHPGSVQGFGQLGRDRV
PVFLLPANPVSALVVFEVMVRPLIRLSLGKRAPMRRIVEARALSPITSVA
GRKGYLRGQLMRDQDTGEYLVQALGGAPGASSHLLATLAEANCLVIVPTD
VDEVRTGETVDVAFLAQRG
108801251YP_641448.1 hypothetical protein Mmcs_4287 [Mycobacterium sp. MCS]MPSIPQSLLWISLVVLWLFVLVPMLVSKREAVRRTSDVALATRVLNSGQS
ARLLRRSGPAAGHHSDPDWRPSADELDDEPLDDRDTRDAEPEGAVVLAAA
PQRDTEPDYLDVDIVEEDSGALPIGSAADQPFEDILPTAAGAPEFDAEPE
DDVDDETDDVAADSDDAESVDDGTEDEYEYVPDSSGIETPADDERAEPAD
DALGAARRRRYESKTAEAVSARKYLFRKRMVTSMAVALLASAVAAYLVAP
WAWWLCGAVGAVTVLYLGYLRRQTRIEEQVRRRRAQRIRRSRLGVENTED
PELDVVPARLRRPGAAVLEIDDEDPIFEHLDEVAFARHFDLPKAAGQ
108801249YP_641446.1 hypothetical protein Mmcs_4285 [Mycobacterium sp. MCS]MAEHAEALVRKTKKLGIMGFGAVAVTGAFLAFGAGTAGADVEDVEGDPAA
PSAFPVAEDGIRVADPGVVNAGPSEVRAADINAPLPPAGGESKDSLRAVP
SITGGIGQYIDFGPFGGAGAPIWDW
108801247YP_641444.1 shikimate 5-dehydrogenase [Mycobacterium sp. MCS]MGRPPLNKDTRLCISLAGRPSNIGTRFHNHLYEVLGLDFLYKAFTTTDIG
AAIGGVRALGIRGCSVSMPFKQDVLDLVDEVEPSARIINAVNTIVNDDGH
LTASNTDYLAVQRLIDQYGLDSGCSVMVQGSGGMASAVGAAFRDRGFATG
TVVARNETTGRALAERLGYDYAAQVASRSAEVIVNVTPIGMAGGPEERQQ
AFDADTIAQAHTVFDVVATPAETPLITAARQAGVAVITGAEVVALQAAEQ
FERYTGVRPTPEQVAEASAISRRD
108801245YP_641442.1 PE-PPE-like protein [Mycobacterium sp. MCS]MRGPVGSLLAVFTAIAGVVLLAFSGMLTGIVQLLATTALIMGGTDHPLST
PPDTISFVDGYMDDAVDNYIDPGLDTGPSVNKVAVITPEQFFPAFGSMTF
DDSVQEGRDNLNECVAGTPSCEYNESEALGSDAPKPDDSFIVFGYSQSAV
IASLVKRDLMQTPPADATGVSFVLLSNAMRPNGGILARGFEGMTIPLLGV
TFYGPTPTDSCEADGPCYPTVDVAQQYDFMGGDAPVAPLNVVAMANSLAA
YYYLHGSVPAKSLDDPNVIDQGEWGDTHYYLIPAERLPLLMPFEQAGVPA
PILAVLDAPLRVIVEAGYDRESSPGEHVQFRLLPIGDPFRFLVNLAKSVP
VGIDDGLQEAGLGRALGTEDVFRPYGVGGEDLPQPGDSATEDNLRTAAVP
TETTASEPAAEPLTDGPVVSGQPSERKGDEPSQLSNDSPVPPAPEQVKER
RLSPLLRGLSDREEADAPKLPSIRPPGERLVRRVVESVTGQRAERPDDSG
DDASGGTPAAESDPDAA
108801243YP_641440.1 hypothetical protein Mmcs_4279 [Mycobacterium sp. MCS]MSTPKKIAAAAGVGLLAACGSPEDADIARVSEVKATFGEQYQYRDIAPTG
IDPKLLQPQKMPAGMRFQPPECAKFAEGRLPEADLKGNMAAATAEGEGNR
FIALAVETNAPVPVTEPGDSCKKVEFSGPGLRGAVEVVEAPHIDGVQTSA
THRVLQTVVAGAPRTGELYNYTARFGTYMVIVTANPLVIPDKPVAPVNTE
LARRLLVDAVAAVQG
108801241YP_641438.1 MerR family transcriptional regulator [Mycobacterium sp. MCS]MDGHELTPSEMSARSGVAVSALHFYEREGLITSRRTAGNQRRYARETLRR
VAFIRMSQRLGIPLARIRAALATLPTDRVPTSKDWAKLSASWREDLDERI
LHLQRLRDNLAGCIGCGCLSLKTCALANPGDVLAGSGPGPVRL
108801239YP_641436.1 hypothetical protein Mmcs_4275 [Mycobacterium sp. MCS]MGTIILGSEAIDRGEVSRQGLRSAYRTIFPDVYIPAVAEPSLYANTVGAW
LWSKRRAVITGKAAAALHGAEWVDENSPVELIWRNNRPPHGIVTRNDRFT
CDEVVEIYGLAVASIQRTAFDLGRFLPRGEAVAHLDALARATGLAVDHVL
PLAEQYRGARGVRRCREALGLMDGGAQSPRETWLRLLLIDAGFPRPTTQI
PVLDDYGDPFAHLDMGWERLMIAVEYDGKQHQIDRSRYVWDHKRLTMLRR
RGWLHIRVISEDRPYDILRRVREAWTQRETAQRVVNRSA
108801237YP_641434.1 hypothetical protein Mmcs_4273 [Mycobacterium sp. MCS]MGMTAGRLLLGATPLGQPGDASERLVNALARADIVAAEDTRRVRQLAQAL
GVRPVGRVQSFFDQNEASRVPALVEAIKSGATVLVVSDAGMPLINDPGYR
LVSACVEAGLTVSCLPGPSAVTTALAVSGLPSDRFCFEGFPPRKHAARLS
WFQALATEQRTCVFFESPRRLPDTLRDAADALGGDRRVVVCRELTKTHEE
VKRGTLAELADWAADGVLGEITVVLAGAVPSADLDTLVADVNDRVAAGAR
VKDACAEVIAAHPGAPSRRELYDAVVRSRG
108801235YP_641432.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. MCS]MSTTTEHAERFTLLRPLLFTIAYEILGSATESDDVLQESYLRWAEVDLDT
VHDTKAYLAQLVTRQALNALRAQSRRREDYIGPWLPEPLLVQSKDAEADV
VLAESVSMAMLVVLETLTPDERAVFVLREVFGFSHDEIAAAVGKSTTAVR
QMAHRAREHVQSRRKRFEPVDPKTSTEITMRFFAAASTGDLDGLMELLAP
DVVWTADSAGKRSAARRPVTGAERVGRLVLGLLRAAGEAGRIEPAVYNNA
PALKLFLGDSFEGIVTVEIVDGRISHFYAMRNPDKLVGVDVPREITRTV
108801233YP_641430.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. MCS]MTTEHAERFTSLRPLLFTIAYEILGSATESDDVLQDSFLRWADVDLATVH
DTRSYLAQLVTRQALNAVRTNARRREDYVGPWLPEPLLVDDGDAASDVVL
AESVSMARLVVLETLTPDERAVFVLREVFGFDHAEIAEAVGKSVGAVRQM
AYRAREHVHARRKRFGPADAADAAKVTEQFMTAAATGDVEGLLALLAPDA
VWITDSGGRAKAIRRPVLGAKKVAALIAGFFRAAPKQVPDLRLETATYNN
TPAVLVRSGDRVEGMILIDVVDGRIANFYAMANPDKLTGIGVARTIRRQ
108801231YP_641428.1 glutamate dehydrogenase [Mycobacterium sp. MCS]MNGLHENLQGIFEEVARRNPGETEFHQAVYEVLQSLGPVVAKHPEYADSA
IIRRLCEPERQILFRVPWVDDSGAVQMNRGFRVEFNSALGPFKGGLRFHP
SVYLGIIKFLGFEQIFKNSLTGMPIGGAKGGSDFDPKGRSNGEIMRFCQS
FMTELYRHIGEYTDVPAGDIGVGMREIGYLFGQYKRITNRYESGVLTGKG
ITWGGSLVRTEATGYGTVYFIADILKSRGESFEGTRAVVSGSGNVAIYAI
EKIQHLGGTVIACSDSDGYVVDPDGIDLALLKEVKEVQRGRVADYAEMRC
GRARFVHGNVWDVECDIAVPSATQNEINGADAAALVKGGCRIVAEGANMP
CTPEAVKLFAEAGTVFAPGKAVNAGGVATSALEMQQNASRDSWTFDETED
KLAEIMGRIHDRCLQTAEEYGQPGNYVAGANIAGFTRVADAMLALGII
108801229YP_641426.1 TatD-related deoxyribonuclease [Mycobacterium sp. MCS]MTPLIDAHTHLDACGARDGDDVRAVLDRAGAVGVGAVVTIADDLASAHWA
TRAADWDDRVYAAVALHPTRADALTDEAKVEIERLVAHPRVVAVGETGLD
LYWPGKLDGCAEPEVQREAFAWHIDLAKCTGKPLMIHNRDADAAVLDVLA
AEGAPETVIFHCFSSDAQMARTCVDAGWLLSLSGTVSFRNAHALREAAQL
IPGEQLLVETDAPFLTPHPYRGAPNEPYCLPYTVRALAEVRGEPAEELAQ
QTADNAIRAYALRTG
108801227YP_641424.1 dimethyladenosine transferase [Mycobacterium sp. MCS]MTIRLLGRTEIRRLAKDIDFRPRKSFGQNFVHDANTVRRIVSASGVHRHD
HVLKVGPGLGSLTLALLDRGAHVTAVEIDPLLAQQLPTTIADHSHSEINR
LTVLNQDILTLMPSDLENQPTALVANLPYNVAVPALLHLLAEFPTIRSVM
VMVQAEVAERLAADPGGKDYGVPSAKVRFYGNVRRYGMVSPTVFWPIPRV
YSGLVRIDRYETSPWPTDADFRAQVFDLIDIAFAQRRKTSRNAFAEWAGS
GNESARRLLAASIDPSRRGETLAIADFVRLLQRSGEAEEQVRVQ
108801225YP_641422.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. MCS]MSRFTEKMYRNARTVSTGMVTGEPHEPIRHTWGEVHERARRIASGLAAAG
VGHGDAVGVLAGFPVEIAPTAQGLWMRGASLTMLHQPTPRTDLAMWAEDT
MNVIGMIEAKAVIVSEPFVVAIPVLEEKGIKVLTVSDLLAAEPIDPIEVG
EDDLALMQLTSGSTGSPKAVQVTHRNIHSNAEAMFIGAEYDVENDVMVSW
LPCFHDMGMVGFLTIPMYFGAELVKVTPMDFLRDTLLWAKLIDKYKGTMT
AAPNFAYALLAKRLRRQAKPGDFDLSTLRFALSGAEPVEPADVEDLIDAG
KPFGLKPEAILPAYGMAETTLAVSFSPCGAGLVVDEVDADLLAALRRAVP
ATKGNTKRLADLGPLLTDLEARVIDENGNVMPPRGVGVIELRGECVTPGY
MTMGGFIPAQDDHGWYDTGDLGYITEEGHVVVCGRVKDVIIMAGRNIYPT
DIERAAGRVEGVRPGCAVAVRLDAGHSRETFAVAVESNNWQDPAEVRRIE
HQVAHEVVAEVEMRPRNVVVLGPGSIPKTSSGKLRRANSVSLVT
108801223YP_641420.1 ABC-2 type transporter [Mycobacterium sp. MCS]MTAVESRQSDQARRPLTHRTNLVQQSWIMVKRNMIHTKRMPEMLSDVTAQ
PIMFVLLFAFVFGASITNTGGASYREFLLPGIQAQTIVFSAFVVASGITA
DVEKGIIDRFRSLPISRSSVLIGRSIASVIHSSLGVFVMALTGLAIGWRI
RGSVGEAVLAFALLLLFGFGMIWFGILIGSLMRTVEAVNGVMFTALFPMT
FLANTFVPTEPMPHWLRVIAEWNPVSSLAQAMRELWGNGGPAAPDAQLPL
HHPVLATVLWSLVLTAVFAPFALRAYARRTGG
108801221YP_641418.1 hypothetical protein Mmcs_4257 [Mycobacterium sp. MCS]MAAPEHHDTDNTQPPPPVRPTPPGGGLGSVLGPLERTGRFYAESWRDYLD
RSDRTVPVARPTLSLASHALRDEIVLLGLRARRPLSDPGTFSRITREVEA
AVDFYGERGWLDDPTRFFAPPPPLTDISIQRVKSARHTHQRLVFDSGYAP
HPGEPGAERWQTYTANRRCYGLMLRHREPRPWLVCIHGAEMGRAALDLTL
FRTRWLHHDLGLNVVLPVLPMHGPRARGLPKGAVFPGEDVLDDVHAAAQA
VWDVRRLLSWIRSQDPDAPIGLNSISLGGYVASLVASLEDGLTCAVLGVP
VADLVELLGRHAGLGRDDPRRATIKLAEPLGRMTSPLSLNPRVPMQGRFI
YAGLADQLVHPREQVVRLWEHWGRPEIVWYRGGHTGFFQARPVQRFVEAA
LVQSGLVDGAARSRER
108801219YP_641416.1 hypothetical protein Mmcs_4255 [Mycobacterium sp. MCS]MLLTAGHGRLSGAELTDLLRGAGVTSLIDIRRFPGSRTNPDMSRDAMASW
LPAAGIGYRWEARLGGRRRLTADEPRDDPWWQVEQFAAYAAHTRTAEFDA
ALTEVLDESGCRTVLVMCSESVWWRCHRRLVADVAVLRFSAAVSHLMHDG
RLTPHPVAAGARLRDDGFVVWDGAVQDG
108801217YP_641414.1 50S ribosomal protein L25/general stress protein Ctc [Mycobacterium spMAKNAPNKLTAAVRTETGKGASRRARREGKVPAVLYGHGTDPQHLEVNAR
DFAAVLRHAGTNAVLTLDIDGTEQLALTKSLEIHPIRRNIQHADLLVVRR
GEKVTVEVNVVVEGDATPGALVTQEANAIEIEADVQSIPEQLTVSVEGAE
EGTQITAAQVELPSGVTLISDPETLVVNIVSAPSAEELESEGGGASLEEQ
AAEVAEAEASEEAAEAGEESAE
108801215YP_641412.1 hypothetical protein Mmcs_4251 [Mycobacterium sp. MCS]MTARRVTAAAAALLVLAIGGCGAETPDYQSVWSTSSSAAPSPETPTETPV
PVAQYLEEAGVTGRTVAPEKLPDLTVSIPTPPGWQPYPGTQFEPGTRVIA
KGDTYPIAMLLVFELTGQFDPAEAIKHGDDDARLSENFKELNASQENWRG
LPSAMVEGTYDLNGQRMQTYNRIVIATGSPPANQRYLVQLTVTSFANEAE
KYGKDIEAILTGFTVAPKK
108801213YP_641410.1 ribose-phosphate pyrophosphokinase [Mycobacterium sp. MCS]MGTEWTDNRKNLMLFSGRAHPELAEQVAKELDTPVTAQTARDFANGEIFV
RFDESVRGCDAFVLQSHPAPLNQWLMEQLIMIDALKRGSAKRITAILPFY
PYARQDKKHRGREPISARLVADLLKTAGANRILTVDLHTDQIQGFFDGPV
DHMRAQKLLTGYIAEHYPSEDMVVVSPDSGRVRVAEKWADSLGGTPLAFI
HKTRDPLVPNQVVSNRVVGDVRGKTCVLTDDMIDTGGTIAGAVKLLKQEG
AGDVIIAATHGVLSHPARERLAECGAREVIVTNTLPIGEDKQFPQLTVLS
IAPLLANTIRAVFDNGSVTSLFDGSA
108801211YP_641408.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAAPDKEVRAPRARMTGSERRQQLVEIAKSLFAQRGYEGTSIEEIAQRAN
VSKPVVYEHFGGKEGLYAVVVDREMSALLDGITSSLTNNRSRVRVERVAL
ALLTYVEERTDGFRILIRDSPAAITSGTYSTLLNDAVNQVSSILAGDFSR
RGLDPELAPLYAQALVGSVSMTAQWWLDTREPKKEVVAAHLVNLMWNGLT
HLEADPRLQDEE
108801209YP_641406.1 transcription-repair coupling factor [Mycobacterium sp. MCS]MTVSGLHHVQTPIAGLIELALRDPCLADLSARAADKPDDLAMVGPASARL
LVTAALAQAGPLLVVTATGREADDLTAELRGVIGDSAALFPSWETLPHER
LSPGVDTVGARMMLLRRLAHPDDARLGPPLRVVVTTARSLVQPMAPGLAE
VEPVTLTVGAEMDFDGVIKRLVDLAYTRCDMVAKRGEFAVRGGILDVFPP
TAEHPVRVEFWGDEISEMRMFAVADQRSIPEIEVDTVIAVPCRELLMSDE
VRSRAAVLAAEHPTHENSVPGSVPDMLAKLAEGIPVDGMEALLPLLRPTD
LAMLSDHLPDGAPILVCDPEKVRTRAGDLIKTGREFLEASWSTAAVGGAA
PIDLEAMGASGFLGFEEVRTGARAGGHPWWTLSQLSDEKAIELDIRSAPS
ARGQQSSVEEIFAMLRAHVATGGYGAVVTPGAGTAHRVVEQLGENDTPAT
MLEPGEEPKAGVVGVLKGPLHDGVVLPGANLVIVTEADLTGSRVTATEGK
RLAAKRRNVVDPLALTAGDLVVHDQHGIGRFVEMTERVVGGARREYLVLE
YASSKRGGGSDRLYVPMDSLDQLSRYVGGEAPSLSKLGGSDWANTKTKAR
RAVREIASELVALYAKRQAAPGHAFSPDTPWQNEMEDAFGFTETVDQLTA
IEEVKADMEKPVPMDRVICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPT
TLLADQHLQTFTARMAGFPVTVKGLSRFTDPAESRAALEGMKDGSVDIVI
GTHRLLQTGVVWKDLGLIIVDEEQRFGVEHKEHIKSMRTHVDVLTMSATP
IPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPQDDKQVAAALRRELLR
DGQAFYIHNRVRTIDQAASKIAALVPEARVVVAHGQMPEELLERTVEGFW
NREYDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQLRGRVGRSRE
RGYAYFLYPPEQPLTETAYDRLATIAQNNELGAGMAVAMKDLEIRGAGNV
LGAEQSGHVAGVGFDLYVRLVGEAVEAYRAAADGKTVATPQETKDVRIDL
PVDANLPPDYIGSDRLRLEAYRRLAAAQDDAGVDAVIDELVDRYGPLPEP
AQRLVGVARLRLVCREYGITDVSSVSASTVKLSPMELPDSALLRLKRMYP
GATYRATTGTVSVPIPRATDSVGAPRIRDAELVAMVAGLVLALNGKPQAQ
IDTAKFGGSRA
108801207YP_641404.1 Tat-translocated enzyme [Mycobacterium sp. MCS]MTGGSRRTGLSRRTFFAGALGTGAAVGVGAALSGCSDARPAAPVSGARFV
PFDGPHQTGITSVPIPEQGLIASFNVLSKDRAGLAATLAELTDEIRGLMA
GRPPEVRDPAYPPVDSGILGEKPPPDNLSVVVGVGASLFDDRFGLADRKP
RELETMPFLANDRLDPKLSHGDVSIILEAGHTDTVQFALRQLMRRTRSHL
VLRWMVDGYARGIGAGPASEAATPRNLLGFKDGTSNLDPEDDALMDRHVW
VGPDDGEPDWAVGGSYQAVRIIRMFVEFWDRTRLAEQEAIFGRRKVSGAP
IGMTDEFADPDYAEDPDGKRIKLDAHIRLANPRTAETEQNLILRRGFSYS
RGFDGAGRLDQGLAFVSYQRSLEKGFLTVQRRLKGEPLEEYILPVGGGFF
FMLPGVTGEDRFLGDRLVD
108801205YP_641402.1 putative lipoprotein LpqU [Mycobacterium sp. MCS]MSDEGSLSTRTKARWMTVAAVVVATILVLASSCSWQMGIPIPEGVPPPPG
DPVPAVDTYADGRPADALREWAAERAPQLGIPVTALEAYAYAARVAEVEN
PDCHLTWTTLAGIGMVESHHGNYRGAMVAANGEVTPPIRGMRLDGSSGNL
EIVDTDSGLLDGDDELDRAMGPMQFIPETWRLYGVDANGDGKSDPDNIDD
AALSAAGYLCYTGKDLSTPRGWMNGLRAYNYSEQYARTVRDWATAYADGR
RL
108801203YP_641400.1 septum formation initiator [Mycobacterium sp. MCS]MPESKRPDPKRRSPASRPGKPGGANRGRPKGTSTPRREPRAIEAKPASEQ
PYAESVGHAIVRRAEQLAVEQSEQRFGSAARRAAILAAVVCVLTLTIAGP
VRTYFSQRTEMKQLKATEEQLREQIAELEQQKVKLADPVFIAAQARERLG
FVMPGDIPFQVQLPPGAVAPGSRPADEQPNAPSGQPWYTSLWKTIADEPH
GAPAPPPVPPGPPPLPAPPPPPGG
108801201YP_641398.1 Ppx/GppA phosphatase [Mycobacterium sp. MCS]MAAVDCGTNSIRLLIADAADGRLTDVHREMRIVRLGQGVDATGEFAPDAL
ARTQGALAAYAELMRAYEVAKVRMVATSAARDVANRDAFFQMTADVLGEV
VDGAVAEVITGTEEAELSFRGAVAELDPADGPFVVVDLGGGSTEVVVGRD
RVDASFSADIGCVRLTERCLHSDPPTAEEVSAAREFIRGALDEALQQVPV
QGARTWVGVAGTMTTLAALAHRMTTYDSEAIHLSRVGFRSLLEVCDELIA
MTRQQRAALGPMHEGRVDVIGGGAIIVEELARELGERAGINELVVSEHDI
LDGIALSIA
108801199YP_641396.1 prolipoprotein diacylglyceryl transferase [Mycobacterium sp. MCS]MTPEWHLGPVAVPVHGVFVGLGVLAALVVFVAEARRRGAVNEQSVVAASG
ALVGGAIGMRLSGWARHLDLTANPSLAEAWQFGSRSILGGLLGAYLGVLV
AKRIGGYRGKTGDLFAPAVALGITVGRIGCHLTEAPGRPTTLPWGIHAPA
TTPDCPGCLTGQAMHPSFLYEIAFQLAAFVILLWLRDRISHPGELFVLYI
AGYATFRFLVEFTRANETVWLDLTRPQWFLLPSLLLIGIRLWYGHRRGYY
RSAAHQQEVRA
108801197YP_641394.1 hypothetical protein Mmcs_4233 [Mycobacterium sp. MCS]MARRPTLMAVQGAALIVGTGYLLLGALGFLPGVTTNHERLEWIGHQSDAL
LFGVFATSGLHNVLHLLLGAAGMFCARTYAASRAYLLAGGVALLGVWFYR
AGSGHSGIAEVFPLNRADNWLHFALGVVMLVLALTLAAQHDPTKPRSRPR
AKSRA
108801195YP_641392.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSGYRDLFRASIDDPEKFWAEAARAVTWTREPTRVLDDSNPPFYRWFPDG
ELNTCANALDRHVEDGRGEQAALIYDSPVTGVKGTYTYRELLDQTARFAG
ALRGLGVEKGDRVVIYLPMVPEALIAMLACARLGAVHSVVFGGFAAHELA
ARIDDARPTVVVSASCGVEPTRTIEYKPMLDAALEMAEHKPVGCVILQRE
HHRCELTDGRDHDWTELVAGADAVDPVPVAATDPLYVLYTSGTTGKPKGI
VRDNGGHAVALLWSMRNIYDTQPGDVYWAASDVGWVVGHSYIVYAPLLLG
ATTVLYEGKPVHTPDAGAFWRVAAEYGVKALFTAPTAIRAIKKEDPQGRE
IGRYDLSKLEYLFQAGERLDPDTYQWAADKLGIPIVDHWWQTETGWAIAA
DPMGVEPMPVKPGSATVPMPGYDVRILHPDGSECGPNEEGAICVKLPLPP
GTLPTLWGDDDRYIASYLRAFPGYYLTGDGGYVDDDGYLFVMGRTDDVIN
VAGHRLSTGSIEAVLAAHPAVAECAVIGVADEIKGQVPRGFVVLKSGADA
QGLEAELVAAVRDNIGAVACLKQVDVVHALPKTRSGKILRKTMRGLAEGR
DEPLPSTIEDPAVLDKLHPVLREKR
108801193YP_641390.1 osmosensitive K+ channel signal transduction histidine kinase [MycobacMTVANGPKRGELRIYLGAAPGVGKTYAMLGEAHRRLARGTDVVAAVVETH
GRAKTAELLDGIEVLPPRHVTYRGGRFPELDVDAVLARRPEVVLVDELAH
TNTPGSRNAKRWQDVEALLAAGITVISTVNVQHLESLNDVVTQITGIEQR
ETVPDEVVRSADQVELVDITPEALRRRLSHGNVYAPERIDAALSNYFRRG
NLTALRELALLWLADQVDAALAKYRADNRITDTWEARERVVVAVTGGPES
ETLVRRASRIASKSSAELMVVHVVRGDGLTGVSAPEMGRVRELAASLGAT
LHTVTGDDVPTALLDFARERNATQLVLGTSRRSRWARILDEGIGAAVVQR
SGKIDVHMVTHDEAHRSPTASPRTRRAASWLAALAVPAAICALTVLLLDP
LLGVAGESAVFFVGVLLVALLGGVAPAALSAVLSGLLLNYFLINPRHTFT
IAEPDSALTIVVMLAVAVAVAALVDGAASRRREARHAAREAELLALFAGA
VLRGADLTVLLERVRETYGQRAVSLLREKAGVVACVGADPCVDVNTADTA
IEVGDDEFWLLLAGRKLAARDRRVLSAVAGQAAGLVRQRELTEEAGRAEA
IARADELRRSLLSAVSHDLRTPLAAAKAAVSSLRSDEVDFSADDRAELLA
TVEESVDQLTALVANLLDSSRLAAGVVRPQLSAVYLEEAVQRALLGISRG
ATGSGDIGIDRVEVDVDGCVVAADSGLLERVLANLIDNALRYAPDGPVRV
TAGRVGERVLIAVTDTGPGIPPGGQDRVFGAFQRLGDQDTTSGVGLGLSV
ARGFVEAMGGTVTANDTPGGGLTVEIDLAAPQEAHA
108801191YP_641388.1 potassium-transporting ATPase subunit B [Mycobacterium sp. MCS]MTLTTIDARTAHPDDPAPQKIRSGLLDPAMLWRSTPAALRKLDPRTLWRN
PVMLIVEIGALWSTALALIDPTWFGGLTVAWLWLTVVFANLAEAVAEGRG
KAQAETLRKTKADTMARRLIGWAPGHPGTEEEVAAPLLRQGDVVVVEAGE
VIPGDGEVVEGIASVDESAITGESAPVIRESGGDRSAVTGGTTVLSDRIV
VRITQKPGDSFIDRMIALVEGANRQKTPNEIALNILLTSLTIVFVIAVAT
LQPLAIYAKAGNPGVPDSLALDGDGITGIVLVSLLVCLIPTTIGALLSAI
GIAGMDRLVQRNVLAMSGRAVEAAGDVNTLLLDKTGTITLGNRQAAEFVP
LTGVTTAELADAAQLSSLADETPEGRSIVVFAKQQYGLRARTPGELADAH
WVEFSATTRMSGVDTGGHRLRKGAASSVAEWIRSEGGSVPAELDAIVTRI
SVAGGTALVVGRVSDGRADILGVIHLKDVVKQGMRERFDEMRRMGIRTVM
ITGDNPLTARAIADEAGVDDFLAEATPEDKMALIKKEQAGGKLVAMTGDG
TNDAPALAQADVGVAMNSGTPAAKEAGNMIDLDSDPTKLIEIVAIGKQLL
ITRGALTTFSIANDIAKYFAIIPALFVGLFPGLDLLNVMRLHSPQSAILS
AVVFNALVIVALIPLALRGVRYTPGGASKLLSRNLSVYGVGGIVAPFIGI
KLIDLVVQLLPGM
108801189YP_641386.1 Orn/DAP/Arg decarboxylase 2 [Mycobacterium sp. MCS]MIRIRRSRTLPRHTVCHRALRGTPLQVPAELLTTAPVAEWVRRRGLGVDV
GSAEELRVALQAGLPASRVAAQCRDVEAVEAAVSAAVGRFVIGGWAEVLL
LAGRRDGAHRVVVDVSEGSGERLAASVMSMGRLDVVGLRCRVGAGEAEAR
DAVRRMIEQMARLRSKHGVILTRACLSGYGRGDAGPEELRRGVHHLQLAA
EEACARLRYPRPALVLSLHAAALVES
108801187YP_641384.1 major facilitator transporter [Mycobacterium sp. MCS]MSIDSVLASADELHKRATRKAVLRLLPVMCAVYFMAYIDRTNVALAKTHL
EADVGISAAAFGFGAGIFFISYAFLEVPSNLIMYRVGPRRWIARIAVTWG
TLSALMMFVQGDLSFYIMRFLLGAAEAGLYPALMYMVTVWFAQSYRATVV
GFIYLAPTIALVVGGPMGGALMELDSAFGLHGWQWMFLIEGLVTVLVGVL
VWFKLPQVPSEARWLSADEAQILTERAAGAHHDTATRIRGNVKEAFGRPF
VIVVALIYFFNQITNVGIVFNIPAIVEDLDISGSFLIGLLSGSAGIGATI
GVLVIPRLFARYPREASAVGILAAATLVTSIAFMLSSSALARILLIAISM
IFVFGTLPLFWSIAMARMSGLMAAASLAFINTIGLIGGFVGPYLFGLAET
ATNNPSAGFYVVILASIIGVALAPVLGHAIKREDAST
108801185YP_641382.1 major facilitator transporter [Mycobacterium sp. MCS]MKRGGHGVGAQADWRMSTNRTQAPARSHRLRRVLLALCVTEITSWGVLYY
AFTVLSDQIAAETGWSAPAVTAAFSAGLVTSAFVGIPVGRWLDRVGPRWI
MTAGSALGCVSVVAVVAAPSYAWFVAAWVLAGVAMSAVFYAPAFAALTRF
FGADAVRALTVLTLVAGFASTVFAPLTAALSAQLSWRSTYLVLAVVMAVI
TIPAHFFGLRRPWPAVVTAHAVESPTRTARSGAFIALVAAFALGGVASYA
VIVNLVPLMAERGISTGAAAVALGLGGAGQVMGRLGYQTLVRRVGVVTRT
VVIMAGIAATTALLGVFTGYAALLAVAIGAGVMRGIMTLLQATAVTERWG
ATHYGHLSGILNAPVMIATAIGPFVGAALASILGGYAAMFLALGAVAAVA
AVTALATSTHSRRRRD
108801183YP_641380.1 hypothetical protein Mmcs_4219 [Mycobacterium sp. MCS]MRMPRRVARFNRRVTNPAARAITPWLPNLGTLEHVGRKSGKRYRTPLLVF
PTEEGYAILIGYGLQTDWVKNVLAGGSTVLHKRGRAVTLTNPRVVDKAEA
AALVAPRSRLFYRAFPYNEAALLLTRVDSAR
108801181YP_641378.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MDEIVLGDVTVTRVLEYYGSVRLSPQTFFPESDPTAWRHNEHWLAPDFLD
PAADVCVSAIQTWVLRSAGATILVDTGVGNGKERPNTPVWHRLQTDYLDN
LAAAGVRPVDVDYVINTHVHVDHVGWNTRLVDGHWAPTFPNATYLIPRAD
FDYWNPANRQSSNPDHKTLFLDSVAPVHAAGQTVLWEDTFVVDANVRLQT
APGHTPGSSVVTLESGTDRAVFVGDMLHTPLQFVEPDVNSCFCEDPAQAR
ATRRRVFGWAADTNTLVVPAHLGGHGAAELARDGDRFTITKWAPFDRVTA
RV
108801179YP_641376.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPTVTWARLDGERRAAVVAAAEAEFAAHGFSHGSLNVIARRAGVAKGSLF
QYFADKRDLYAFITDVASQRVRSYMETQIRELDASRPFFPFLVDLLDAWV
AYFAEHPRERSLHAAASFEVETDARVSVRAVVHRHYLEVLRPLVHDARAR
GDLRDDADTETLVSLLLMILPHLALAPYVRGLDPILGLDELSPEQPALAV
RRYVAVLSAAFQTVPVQPTRDSIAQEVTP
108801177YP_641374.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MNRFDGKGVLVTGAASGIGQATVQRLLEEGAYVVGLDLPEADRVADRYAY
RRADILDAEAVADALAAVVAGAGRLDGVVHSAGVAGGGPIHLLPDEEWDR
VVDVNLKGTFVVNRAALTQMLQQDRVDGERGAIVNLSSIEGLEGTAGGSS
YNASKGGVVLLTKNAAIDYGPSGIRVNAICPGFIETPLFDAVVGMPGMER
PREGLRHEHKLRRFGRATEVAGVAAFLLSADASFVSGQTLVVDGGYLAGR
DHHVTELMGLSEQ
108801175YP_641372.1 type 11 methyltransferase [Mycobacterium sp. MCS]MTDDMWGTGDYRAVAEKVTSIADVLVRRAGIEAGMAVLDVACGTGNASIP
AAKLGARVCGLDFSPGLIAIARQCGADANVEIDWRVGDAQSLPFEDDSFD
RVISAIGHMFAPDHKRTADELLRVCRPEGRIAVACWTPQGAIGEMFKRLG
AISPAPPEGFQPPVLWGTEEHVRELLGESVEFERHNVDFDEPSPESYVDF
MLASFPPLIAMRAQLGDELVRETYLGWATDVNEADDGSLRFRGEYLVSVT
108801173YP_641370.1 hypothetical protein Mmcs_4209 [Mycobacterium sp. MCS]MDSEQIIRIALTIVTPIVTAGIGILALVVGDWRERRTQTGRRKLAVEDAC
RQVGFAADWFNASKLINDSPEVQQQAAAQAQAWLDEAAELLSESTPPPSA
EVTKSVTARRLLLAYPMHRRGARVLRGLYYFFLGVVVLQFSGALGAAFGR
TDTLGVPNYFSGGLIYTDLLVIFLYTLVAMGFRFWSLRVEESRVTAAPRL
TIRRALLLYRLKGLRAMLARFLFHCWVALTVLIAVLTVVSAIDDPRVLPS
NLVAIAALVGWAIALRYWAVSKDSQLPPSGSVPPL
108801171YP_641368.1 hypothetical protein Mmcs_4207 [Mycobacterium sp. MCS]MRRTSILAPVLLSVGAVLVAPAIPAQAETALETIAALEAAGYTVNIDRVG
SAPLEECVVTSVRNPQTVTELARVEHHDGPFGFGGDDDDHGRLVPVVVSR
SISVSLNCAG
108801169YP_641366.1 hypothetical protein Mmcs_4205 [Mycobacterium sp. MCS]MMSKKMTITTLLGGAAVGATLLIGAPIASADPDGPSWGSEVKGCVKNSSC
YGGGTRGEYVRAQARDNETPGYGNEIHRLANPGASDPSGAVTGTNPSGDR
PSGN
108801167YP_641364.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAFMSAPAPARDRRVRRSRAALIQAAIDVVTGRDTASVALSDIAEAAGVT
RKVAYQQFGDRDALLMEAALDLMRREVVPQVINLPPGKPRALAALRHFAD
HRRFYRAVLTGPNAVSLGAGLADLVLPRTRDRIRDLHGDDLDPQLVADLA
VQINGGILAMITAWLIEGDDPLDPDDFAERMLRVQYFLIPEGRRDADEGR
R
108801165YP_641362.1 cytochrome P450 [Mycobacterium sp. MCS]MTVHDLSPVRSGGDADLPHYPQPREQGCPFAPPEQIRTLAAEKPLHRVRW
WDGSTPWLVTGPAELRSLLTDSRVSADDVHYAVPQWSPTEARESKRRPTT
FLNTDGNEHRRYRRMLTRSFSVKRANALRPMIQRHTDECIDAMLAGPRPV
DLMTALALPVPTIAICALLGVPYEDHETFQRHISTGVDRSVPAEEGQRAM
AELFDYLRTFVTREVEHPTGADTICAELGEQVRAGNVTMDTAIFMATSVL
GGGFETTANMIGLGTLAFLLNPDQAAIVRASEDPTVTVGAIEELLRYLAV
AGNSKCRVALADIEIAGETIRAGEGIVSGFPAANWDSGAFAEPERLDVTR
QGNHHLAFGFGPHGCIGQQLARVELQVVFDTLLRRIPDLRLATSLDEIEF
KNNTRAYGVYALPVTWGPVKR
108801163YP_641360.1 rhodanese-like protein [Mycobacterium sp. MCS]MLDRRRRPPRRVLGAVAGACAVLALSACGTDTPTEVSAARLVDPAEFAAA
VAEPDRLTINVHVPFEGDIAGTDLSIPFDRIADQADRLPSDRSTALAIYC
RSGPMSTTAAESLRDLGYTHVVELRGGMRAWQADGRPLTGI
108801161YP_641358.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium spMKPALSLRSPHPSPSRHHRLGRYERPGTMVGNTPVLRIAAPFTSDERGFW
AKLEGFNPGGMKDRPAMHMVERGRACGALRPGATIVESTSGTLGLGLALA
GTAYAHPVTLVTDPGMEPLIARMLSAYGARIEMVTEPHPDGGWQRARQDR
VQQILSADPHAWYPDQYNNPDNVEAYRPLALELQAQLGHIDVLVCSVGTG
GHSAGVARVLRESNPALRLIGVDTIGSTIFGQPASTRLMRGLGSSIYPGN
VDYEAFSEVHWVAPEDAVWACRTLAATHYTSGGWSVGAVALVAGWAARTL
PDSSTIAAIFPDGPQRYFDTVYNDDYCRAHGLLDHTPPAGPAVIGHPRER
VVSSWTRCTDVVDPMAVLR
108801159YP_641356.1 copper/zinc binding superoxide dismutase protein [Mycobacterium sp. MCMTTQLKTVDGKAVADATIDFTGGYATVTVETVGDGTLSPGFHGLHIHEFG
RCEPNSPAPNGGPTGDFASSGEHFQAEGNTGMPASGDLPPLLVRSDGAGK
LVVTTDAFTEDQLKGPDGSSILLHQGADMPGATEGVDTRIACGVISPASA
ETSVSTSTSTSTVTTTVAPVPPATVTETTTPPTTSPSPTTTATTTVSETT
PPTTTTVPTSPESPTPPAG
108801157YP_641354.1 ectoine hydroxylase [Mycobacterium sp. MCS]MAVDTTHRVRDHYPTRLDQPAEPITRAEPTVWGREPDGPLTGADLRTMAG
AGYLVRPDTLDPIWLAPLQDELARISTVADAGDPRIIRERTGGIRSVFQP
HLFSEVIAEVISLDTVLPVARQILGSDVYIHQARINVMPGFTGGGFYWHS
DFETWHAEDGMPAMRAVSCSIALTENFPHNGSLMVMPGSHEVFYPCVGAT
PANNHESSLIRQEAGVPDRNTLTAAAERFGIDQVTGPAGTALWFDSNLMH
GSGSNITPFPRSNIFLVFNSVENRLSEPFAASRPRPEYLAARDMRRVGN
108801155YP_641352.1 diaminobutyrate--2-oxoglutarate aminotransferase [Mycobacterium sp. MCMSTLADTTAVAVSDLPEVYSAVESEVRSYCRGWPTVMANASGSWVTDTSG
RRYLDFFAGAGALNYGHNNPALKKPLVEYLTGDMIVHSLDMATTAKSDFL
QAFQELILEPRGLDYKVQFPGPTGANSVEAALKLARKVTGREAIINFTNA
FHGMTLGALSVTGNSMKRAGAGIPLVHTTPMPYDNYFGGVTEDFHWFERV
LDDSGSGFNRPAAVIVETVQGEGGLNVARAEWLRALAELCRRREILLIVD
DVQMGCGRTGAFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFRRDLDVW
APGEHNGTFRGHNPAFVTATAALKTYWRDGEFAEQTSAKGAMVRDRLEAI
ASEYEGVSARGRGMAQGLKFTDAPVAATVCRKAFERGVLMETSGPSDEVV
KLLPPLTTSTADLEAGISVLAESVAAALS
108801153YP_641350.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MYCRTVLTLTHTDALARFGHALSDITRARILLRLSRASGYPSDLAEQLGV
SRQILSNHLACLRGCGLVVAVPEGRRSRYELADPRIGAALDDLMGLVLAV
DPNCCCTGDDGDGCRCC
108801151YP_641348.1 LigA protein [Mycobacterium sp. MCS]MPRSVSATAARRGFDDGTHSDVARDRCGGRRCFGGRTRRRRGGRRRDRIR
RLRPVSGGLQLRTGGSWTRGGRPRRRHDSSGRRTGTRARSRGRGREPRRR
SRGGTRRRGRGGRGGRGGTRRRPCRERSHRGAGRRGRRGTARGRHGAHPG
RRRRHRGRAHRRHRRRSHRRQERRGRHRRGGSGDGHRTCARGRRRPRSGL
HHHRRDDEPAGRRKRHHDKRFRGSGTVGPRAPDAAAVTVRVRAAASPGGQ
GVRVGRVRHPRRRHEVHHRPTATPARQHRHRPHVDSGDRRRPPRERRLVL
PRHGRTAHADHLPAARFPRQRHDVQPHRRLPGRAHQQCGRRADSDLEPVS
GRRLLARGRPDVPRRRRTVHRRPRGAQRERGRRGLRHPLRRHRHPAQRLR
PGRPLPRRRPGRRCLRPLRPIRHRQWRIQPPRRCHLARRCPAAQRHRGEL
TGGARRDRHLHSVPRAARADQPFQLHQQHHPGAERGPRRQVPRCRTRRRR
AHGLDAGRQPRHPAVRLCGRRVPEAPESARRTTTDGGLDQRHVRRPDRRR
HRGLRRCRVHRHLRGTRVAGRDPDRQGPRHRQGPRQRGRDLAADAHPGLA
VAVDPRGAPTGGLNPSARMGRRGSRSRCPDTSRV
108801149YP_641346.1 cytosine/purines uracil thiamine allantoin permease [Mycobacterium sp.MSAVATGEPAPEVTERLESDLTVIPESGRTTDVRGQFWIWAGANIAPINW
VLGALGVTMGLGLWETIAVLAVGNLIGMSLFGIFVVIGQRTGVTGMVLSR
AIFGRRGAYVPAAVQAVVCMGWCAVNTWIVLDLVMALLGRIGIADPDSTA
HGPRIVVGAVIMVIQVVIAWFGYRVIAAFERWTVPPTVAILVAMTAVAWF
GLDVEWGYAGDAALTTGEHIAALSAVMTAIGIGWGITWFGYAGDYSRFVS
TTVPARKLFVASALGQFIPVLWLGALGATLATLSSSADPGEIIVDAYGAL
AIPVLLLVVHGPLATNILNIYTCTVSTQALDIHINRRILNLVIGAVAMVG
VVLFVLNGDFALMIDSWLVGIVGWVAPWAAVVLVHWFVIARREVDPEALL
APPGAGLLPTVRPTALVALGVGILFTWMFMYGMTPLLQGPVASALGGVDL
SWLAGGIAAAGTYLALEAIRGRQLQK
108801147YP_641344.1 hypothetical protein Mmcs_4183 [Mycobacterium sp. MCS]MIRVTWVDNTLAYIDQASFLGLRALGRGPLIQFTWIYDRAVDIDGLRRFH
CNLGHGLLGRLVERSPLPFGRHRWVASTGPVDLDIAAADLPRRDVWTWAD
ERAAMPIDPEFGPQWHLGVQPLIGGGAAVSLVVSHTTGDGLAICEAVTDA
VNGVRRDLGYPPPSSRARRQAMAEDARQAVRAIPDMGRAVAATVRVARSQ
RDELASSMSSARAQPVTGEARTVVAPCVVTLVDTAQWDARAKELGGNSNS
LLAGFAARLGLLLGRTDDAGLVTLSYPVSERVPDDTRGNALTEARMKADP
MRVTTDLTELRATMKREFAALREKPNELLAPLPLTPLTPRLLVRRLESMI
VERGAPIGCSNLGDIDPAVNRPDGTDAAFMAPRIVEPKITTTILDRSGGL
LFLGSSRLGGLVTVTVAAWRPGGENTKDALRDVVTQALGDLGLTGTVEPE
PHGLRKV
108801145YP_641342.1 cupin 2 barrel domain-containing protein [Mycobacterium sp. MCS]MDVHRGWGVVPAAVIGLAVLPGSAAATPAEGDVVRTDLAKGETDQPVSIT
TAPGERSSLLVQDLQMRPGSSSGWHTHPGPEHSVITGGTVELQTAADCAV
VPYGAGQAVFIPAGLAHRVANTAPHDAHVVATYTVPTGAPARGDSPDVCR
K
108801143YP_641340.1 hypothetical protein Mmcs_4179 [Mycobacterium sp. MCS]MANIFTRRKPPVAAPKVTAMTAQDPQVAVLDVAALPRGPVGDLAVDSASG
FVVTTNPADRSITVFDADTLGSARVVAVGGTPGLVAVAEDRAYVTTSSLH
DDAVTVVDTRVGTVIARYPLAFTATAMTISPDGKRVYIGRTGDQDVDVAV
LDTAAERFGTIGIGYRPGTTVDAVRVDAAGRRLYVATTGLAGSALLTVDI
ETARVVRRLRLPSPIRDLALGRDGLAYVLRSDRRYGGSIDVIDLGANVVI
DSVAIGGAPTQLTVSPDGSRAYVVDYDRVAVFDAMTSEVVDEITGEGSPA
CVAVREDGRRIYVADHAGAMTSLATPRKHFAATDPIVRPDMRELSPAV
108801141YP_641338.1 signal transduction histidine kinase regulating citrate/malate metabolMPVPRPWSEWIGRSRPRSLAGQAIALQIVVIAVIVVAGSTLALIDARRDG
DEAARQQVVGIATALADSPSTAAAIESGRATELLQPVTEAVRTQTGIAFI
TIMAPDGVRFTHTDPGQIGGRYLGTTEPALRGETFSEVYTGTLGPSIRAV
APVRDGDRIVGLVSAGITQQTLAQRWRSQVPTIAAVTLAAVVVSSIGMWL
IRRRLMRQTHGLRPDELRVMYEHHDAILHSVSEGLVVLDHDGVALVNDEA
RRLLGLPPGPIDRAALPPFLRTSDPGVRDEVHVTDERVLVVNRSRVADSE
SEVVTIRDRTELQGALGELSSLQVLTDSLRAQAHEAANKLHTVITMVEMG
RPEDAVRFATHELELSQRLVDRLSEAVAEPALVALLLGKTAQADERGIAL
TVTEDTHLPSHSEALSGQEMVTVLGNLVDNAMDACDRDDPWVEVTVNQDE
TRLLMRVADSGAGMDPETFARAMQRGYSTKPGDGKAHHGLGLALVAQVAA
RHGGTVTADVTYGSVVTVTVPLGVS
108801139YP_641336.1 hypothetical protein Mmcs_4175 [Mycobacterium sp. MCS]MRTKWALAASAAVCGVIAAPAGLASADDSAQDTINRLQREGYTVNIDRVG
SAPLSECVVTNVRNPRTVTSFSPIDRIGIDDDYNINAFNPIVVGRSVSVT
LNCTA
108801137YP_641334.1 dihydrodipicolinate reductase [Mycobacterium sp. MCS]MALRVVQWATGGVGVAAINGVLEHPELELAGCWVHSKAKAGRDVGELIGT
DHLGVTATDSVDDILAMDADAVIYSPLLPDPNEVAALLRSGKNVVTPVGW
FYPGEKEAAPLRAAALEGGVTLHGTGIAPGGISEKFPLVMSIMSTGVTFV
RAEEFSDLRTYDAPDVVRYVMGFGDTPEKALSGPMQKLLDGGFIQSVKMV
VDKMGFRADPVIRSSQEIAVATAPIESPIGAIEPGQVAARRFHWEATVDG
EVVVRVTVNWLMGEQNLDPAWEFGEAGERYEMEVHGNPDFTVTVKGFQPD
SVEAGLESNNGIVATAAHCVNSVPAVCAAAPGIATYLDLPLISGRAAQRL
R
108801135YP_641332.1 patatin [Mycobacterium sp. MCS]MRGGRLHSHLAHCLPVTKRALVLAGGGIAGIAWETGVLRGIADEAPDTAG
ALLTADVLVGTSAGSTVAAQIGSGLGIDALYDRQLAAASAEIDPGVSIDT
ITGVFLAALTDPDATTTQKLQRIGEIALSTPTVAEHVRRAVIEQRLPSHD
WPDRDLRVTAIDTATGELVTFDRTAGVSLVDAVAASCAVPGVWPPVTIGP
RRFMDGGVGSTVNLAVAADCEAAVVLVPSGRSSPSPFGSGAVAEVDGFPV
PTLGVFADDEALAAFGANPLDPACRIPSAQAGRAQGRRVAAGVTDFLAGQ
V
108801133YP_641330.1 protein LpqV [Mycobacterium sp. MCS]MRRCLPRLFAAATLAGALALAACSSGGDDASTPSSSQASSQVEASPTTTE
ARSAAPGAVEVSPGGVTTAVGAPAESTEDEYFQACNTARQWMAGRGGDLK
AQLEPYLAELQGTDSAGPGTFGTPWSKLPPGRQSAVIVAAEAAADELCG
108801131YP_641328.1 rhodanese-like protein [Mycobacterium sp. MCS]MTSRIDRILEDARARLRRMPAAEVPAALARGAVLVDIRPQAQRAREGEVP
AALVIERNVLEWRCDPTSDARIPQAVDDDVEWVVLCSEGYTSSLAAASLL
DLGLHRATDVVGGYHALEAEGVLV
108801129YP_641326.1 hypothetical protein Mmcs_4165 [Mycobacterium sp. MCS]MKLLPEGVIPIQCDDPSHRSPVTIANVYPMRGFESRWQLWLSTAPTDAPE
IIETVVDDTPPTPGAGVTAFQGGGVVRRRWHLPACRKCGRTPPAMREEKL
FAALTALTDNGIDTVSLRLLAATMGRMSA
108801127YP_641324.1 hypothetical protein Mmcs_4163 [Mycobacterium sp. MCS]MSAATAFDYLLDALRDHGSTVRETGDGRAMATCPSHEDRNPSLSIGPRSD
GKGVVLRCHAGCDYRDVLAALDMHPRDLFDEEGIRAIFAPSRTYGYSDGR
RVHRKPDKTFPQSGNTRGSALFGADRIGDAPVIFWPEGEKDVEAIEAAGG
FAVCSAMGAGKAHLADPEPVRGRHVVVVADRDEPGYRHAAQVAQIVRPIA
ASVSIVEAATGKDAADHIAAGRSLDEFVPVPEAEPVDGANCSMRSSSSRV
RSWRSGARTTWLCSCCGRCTRGLSTRST
108801125YP_641322.1 hypothetical protein Mmcs_4161 [Mycobacterium sp. MCS]MTTPDDGDGDDGAFIELFVGFGPVRDGRNYALKWLEPQGLLRLAEDLFDA
DEQGDDIEPVLRAWTTAQALDDGGDDDGS
108801123YP_641320.1 hypothetical protein Mmcs_4159 [Mycobacterium sp. MCS]MPKLDLDAAVLLSDDELHTRSAAATERCETRIDRAQTENRDMTERERDLT
AADRDELVVIRDALEIRSARRAEGEAIEQRRRDIGRAIESMPRPESRAAI
GAFVEGLSHGVPVRVNVECRSITSATAGARTEVANNSGGRPEWLWTAAGI
PFNRATSLKVQGPKWAALVARSATAEGGTKPNATDPTLEEETLQAFAVVE
EVSDQVVRYGIGAQAVADRLAAESVFSVNAAFAGALEAAAGTPVTYATSA
SHMADLAIARVWAKTGAKPTALLVNSADYPLLSAKASVGPGDGIGAEVVR
FNGTVLVVNDAVTAGVGVVFNGAGFSAHASDVLLASAPNLNTNMVTLRAE
TYAALLQHDAGAIVAVDLAAA
108801121YP_641318.1 hypothetical protein Mmcs_4157 [Mycobacterium sp. MCS]MTDTAQTVEETPPQETPPPKRAWWLRHYTFFGTATGLVFVWFSLTPSLLP
RGPLFQGLVSGGAGAAGYAIGVFAVWLTRYMLSRDTSPPAPKWAWVALVV
VGVVGQVLMIVYFHVWQDQIRDLMGVPRMGFWDHPLTAVLAIVVLFALVE
VGQLIRRLVVFLVRQLNRVAPPRVSAVVVVALLLALSIALLNGVVVRGLM
SAINNTFETVNDETDPDTPAPESPLRSGGPQSLVSWESLGHQGRVFVSGG
PTVAELSAFNGAPAIEPIRAYAGLNSADGIRATARLAAEELLRTGGLNRA
VVAVATTTGTGWINEAEASALEYMFNGDTAIVSMQYSFLPSWLSFLVDKE
NARQAGQALFEAVDALVREMPEAQRPRLVVFGESLGSFGGEAPFLALNNL
IARTDGALFSGPTFNNTIWNELTRQRDPGSPQWLPIYDSGENVRFVARPD
DLDRPDRPWGTPRVVYLQHASDPIAWWNPDLLFARPDWLKEPPGYDRTAR
MKWIPVVTFLQVSADMAVAVDVPDGHGHVYVRDVVNGWAAVLQPPGWTPE
KTERLRPVLTATH
108801119YP_641316.1 3-hydroxyisobutyryl-CoA hydrolase [Mycobacterium sp. MCS]MAENEDVLVSVENGVGLVTLNRPKAINSLTHGMVTTLADALHAWEKDDGV
RTVLLTGAGERGLCAGGDVIALYHSAKAGGADARRFWFEEYQLNSYIGGY
PKPYVAVMDGIVMGGGVGVSAHGDVRVVTDTTKMGMPEVGIGFIPDVGGT
YLLSRAPGLLGLHAALTGAPFSGADAIAMGFADHFVPHDQLDAFKAAVVA
DGVDAALAAHTTEPPPSQLLTQRDWIDECYAGDTVADIIAALRGHAAGPA
NDAADLIASRSPVALAVTLESVRRAGRLDTLEDVLRDEYRVSCASLRSHD
FVEGIRAQLVDKDRNPKWSHQSVDEVTAADVDAYFAPADPELTFP
108801117YP_641314.1 hypothetical protein Mmcs_4153 [Mycobacterium sp. MCS]MDDLPFIGSEALADGRLTRYELRRYHRAIMPDVYVDRRAEPSLRQRTVSA
WLWTRREGVVAGLPAAALHGAKWIDDDVPVELIWRNARTPPGVVTRADAL
LDGEVATLDGLPVTTADRTAFDLGRRGPLTAAVARLDALIRATDLGVGDI
EALAAGHPHTRGLRQLEKALDLVDVGAESPKETWLRLLLIRHDFPRPRTQ
IPVPAPDGHTTYYLDMGWEDLELAVEYDGDHHRTTKDRFAYEIQRAEDIA
AAGWHVVRVAARSREADVIRRVTRAWRLRTS
108801115YP_641312.1 G-D-S-L family lipolytic protein [Mycobacterium sp. MCS]MRASRGALAAAVAATLASTGSAYIGVRNLLTGQADQARQVIPKSWDVPPR
ADGVYSPGGGPVEKWHRGDPFDLHLMIFGDSTATGYGCRTADEVPGVLIA
RGLAEQSGKRIRLSTKAIVGATSKGLSGQIDAMFVAGPPPDAAVIMIGAN
DVTALNGVSQSASRLGKAVARLRASGAVVVVGTCPDFGVITAIPQPLRTV
ARAKGLRLARAQAAAVRAQGGVPVPFSDLLAPEFYKQPDVLFSDDMFHPS
AAGYALAASQLLPALCVALGEHSPTGASEQALPTRAADVSTLLAKLGGIT
RLWRRTTGVPAPVIASPG
108801113YP_641310.1 cystathionine beta-synthase [Mycobacterium sp. MCS]MRIAQHVSELIGNTPLVQLNSVVPEGAGTVAAKIEYLNPGGSSKDRIAVK
MIDAAEASGELKPGGTLVEPTSGNTGVGLALVAQQRGYKCIFVCPDKVSE
DKRNVLRAYGADVVVCPTAVAPDDPDSYYSVSNRLVTEIEGAWKPDQYSN
PMGPESHYETTGPEIWRDTDGKVTHFVAGVGTGGTITGAGRYLKEVSGGK
VRVIGADPEGSVYSGGTGRPYLVEGVGEDFWPSAYDPAVPDEIIAVSDAD
SFDMTRRLAREEGLLVGGSCGMAVVAAIEVAQKAGPDALVVVLLPDGGRG
YLSKIFNDSWMSSYGFLRNRLDGSIEQPTVGDVLRGKSGELPDLVHTHPS
ETVRDAIGILREYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRA
KLADAVAEHMSPPMPLIGAGELVSTAAKTLRECDALMVVEEGKPVGVVTR
HDLLGFLSDGSTRR
108801111YP_641308.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MLAPEERELRQTVRRFGEQRLRPHVGEWFEAGEVPVRELASEFGKLGLLG
MHLEGYGCGGSTATAYGLVCQELEAVDSGLRSMVSVQGSLAMFAIHKHGS
EEQRKQWLPAMATGDVIGCFGLTEPDFGSNPAGMRTTARRDGSDWILNGS
KMWITNGSVADVAVVWARAEEGILGFVVPAGTEGFSGREMKHKLSLRASN
TSELHLDDVRLPAEAQLPDARGLSGPLACLSEARFGIVFGSVGAARDCLE
TTLDYVGSREVFDKPLAAYQLTQAKIADMAVELGKAQLLALHLGRLKDEG
RIRPDQVSFGKLNNVREALAIARQCRTLLGANGITLEYPVLRHANNLESV
LTYEGTSEVHQMVIGEALTGVSAFRG
108801109YP_641306.1 hypothetical protein Mmcs_4145 [Mycobacterium sp. MCS]MARIAEDLLLLLLDNASAQPCLDKPRRERVLAAAVLLDLAHACLIRPAVD
GDPAPAGRLVALTPRGPLDPVAEPAFRLLQRRALRPPVAIDRLRRHTEDA
LLAHLEATGQIGRVELPGKRSKRIGHQYGWPVANRDRAAHSRSQVLSALF
DRTPPTPSTAAVITLLHAVDGLGALLSLNDRGWRWVHGRAGEISLGSWVD
ESPTGLAEVNLAVTAAALRAALG
108801107YP_641304.1 hypothetical protein Mmcs_4143 [Mycobacterium sp. MCS]MIERPAARYGRQRVSRRTRRLVAAVLAAGVVVAGVILAIVASQRLGTQEV
EGELGAYRIIDDRTVEVTVSVTREDPSRPAVCIVRARSKDGSETGRREIL
VPPSEQATVQVTTVVEASKPPVIGDVYGCGLDVPPYLVAP
108801105YP_641302.1 hypothetical protein Mmcs_4141 [Mycobacterium sp. MCS]MIETVLLATEWLAQEQPRETGPDFGKASPFGLLIVAALLVAVFLLVWSMN
RHLKRLPESFDPEHPEPDQAVDDGTVDLGGDPGAGPRSVAENGNPPRESG
G
108801103YP_641300.1 nuclear transport factor 2 [Mycobacterium sp. MCS]MAVDPKALVQRYLDTVASGTADDVAALYAEDATLEDPVGGGEVHIGRHAI
AGFYKNTDGVEISTELLTIRVGGNEAAFLFAITVGGAMRIEPIEIMTFNH
DGQIASMKAYWGPDDITQL
108801101YP_641298.1 undecaprenyl pyrophosphate synthetase [Mycobacterium sp. MCS]MRLRQELMRSKSQLPRHIAVLCDGNRRWARDAGHDDVSYGYRVGAAKIAE
MLRWCQAAGIEMATVYLLSTENLQRDADELAELIEIITGVVEEICAPANR
WSVRTVGDLSLLGDEPARRLRDAVESTTGNGTAFHVNVAVAYGGRQEIVD
AVRALLSKKLADGVTGEQLVEAVTAEAISENLYTSGQPDPDLVIRTSGEQ
RLSGFLLWQSAYSEMWFTEAYWPAFRRVDFLRALRDYTRRDRRYGT
108801099YP_641296.1 hypothetical protein Mmcs_4135 [Mycobacterium sp. MCS]MTAVHNSVLTRPLSDSTDSLLRFALRADATLCAALGLFVAMAADPLSRLS
GLSATAEWIGGALLVGYGALLYVLAAVPDVRRVGVGALAGNVGFAIAVAA
VLIGGWLPLTPAGVAMTATFAALTLALAYLQYLGVRRLV
108801097YP_641294.1 pantothenate kinase [Mycobacterium sp. MCS]MARLSEPSPYVEFDRTQWRALRMSTPLKLTEDELKKLRGLGEKLDLLEVE
EVYLPLARLIHLQVAARQRLFAATSEFLGEPQQNPDRPVPFIIGVAGSVA
VGKSTTARVLQALLARWGNHARVDLVTTDGFLYPNAELGRRNIMHRKGFP
ESYDRRALMRFVTAVKSGADYACAPVYSHLLYDIVPGEKQVIRHPDILIL
EGLNVLQTGPALMVSDLFDFSVYVDARLEDIEGWYISRFLTMRSTAFADP
ASHFHHYATLTDEQAVFAARDIWHSINRPNLIENILPTRPRATLVLRKDA
DHAINRLRLRKL
108801095YP_641292.1 serine hydroxymethyltransferase [Mycobacterium sp. MCS]MTADSVTSSAAAPGAEYAATASTAYQAALQVIESVEPRIAAATRKELADQ
RDSLKLIASENYASPAVLLTMGTWLSDKYAEGTIGHRFYAGCQNVDVVES
VAAEHARELFGAPYAYAQPHSGIDANLVAFWAILATRVEAPGLAELGAKH
VNDLSEADWESLRNKLGNQRLLGMSLDAGGHLTHGFRPNISGKMFHQRSY
GTDPETGLLDYDKLAAAAREFKPLILVGGYSAYPRRVNFAKLREIADEVG
ATLMVDMAHFAGLVAGKVFTGDEDPVPHAHVVTTTTHKSLRGPRGGLVLA
QPEYSDAVDKGCPMVLGGPLSHVMAAKAVALAEARQPSFQAYAQRVADNA
KSLAEGFLKRGARLVTGGTDNHIVLLDVTSFGLTGRQAESALLDAGVVTN
RNSIPADPNGAWYTSGIRFGTPALTTRGFGAAEFDRVAELVVDVLNNTQP
NSTGPTGFSKAKYTLADGTAERVHAASAEMLDANPLYPGLTL
108801093YP_641290.1 PhoH-like protein [Mycobacterium sp. MCS]MPQCPPTGSRGTRGYQERYVTDSPLRTYVLDTSVLLSDPWATTRFAEHEV
VVPLVVISELEAKRHHHELGWFARQALRLFDDLRLEHGRLDQPIPVGSEG
GTLHVELNHSDPSVLPAGFRNDSNDARILTVAANLAAEGKCVTLVSKDIP
LRVKAGAVGLTADEYHAQDVVVSGWTGMDEIDVTTDEVDALFADGEIDLA
AARDLPCHTGVRLLGGSSHALGRVNAAKRVQLVRGDREVFGLRGRSAEQR
VALDLLQDESVGIVSLGGKAGTGKSALALCAGLEAVLERRTQRKVVVFRP
LYAVGGQDLGYLPGSESDKMGPWAQAVFDTLEGLASPAVLEEVLARGMLE
VLPLTHIRGRSLHDSFVIVDEAQSLERNVLLTVLSRLGAGSRVVLTHDVA
QRDNLRVGRHDGVAAVIEKLKGHPLFAHITLQRSERSPIAALVTEMLEEI
SPGALP
108801091YP_641288.1 hypothetical protein Mmcs_4127 [Mycobacterium sp. MCS]MTERHPVVVGIDGSRAALDAALWAVDAAVGRDTPLRLLYAIEPADHDVAA
AARELAIADLAVRDVFTAIQATERPVRIEVEIVQDSAVRALASASRSAAL
VCVGAVGLQDAIPGRIGSTAATLARSAHCPVALVRHNTDGYVLAEVEDWS
DSGAVLRHAVDEALLRRVPLRVLTPGSESARAPAARTLDGWRRRHPDLEI
DLLTSDDGVVDFLAGEPGRVQLVVVGAERARGPGEFTDPRGRSVLREAGC
TLLTCHRQHRL
108801089YP_641286.1 putative signal transduction histidine kinase [Mycobacterium sp. MCS]MTEPIGPDEPRGPGPLRDTLSGLRLRELLTEVQDRIEMIVEGRDRLDGLV
DAMLVVTAGLELDVTLRTIVHTAIQLVDARYGALGVRGHGHDLVQFIYEG
IDDGTRDLIGHLPEGRGVLGVLIDDPRPIRLDDIRHHSASVGFPANHPPM
RTFLGVPVRIRDEVYGNLYLTDKVGGQPFTEEDEVLVQALAAAAGIAIDN
ARLYEQARARQAWIAATRDIATEMLSGASPATVFRRVVDQALTLTGADGT
LVAVPGDTEAPPDQVHDLVVVESAGMFTGAAVTVALDESPIGLAFRKRTP
VRVDRLTLGSAECGAALVLPLRAADTVAGVLVAARVPGAQEFTAEQLDVT
AAFADQMALAWQLASSQRRMQELEILTDRDRIARDLHDHVIQRLFAVGLS
LQGTLARVRDADVQQRLAGNVDDLQAVIQEIRTTIFDLHGGSSGATRLRQ
RLDEAIGQFAGAGLHTTAQFVGPLSVVDATLADHAEAVVREAVSNAVRHA
RATELTVRVTVADDLCIEVADNGCGIDGSITESGLGNLRARAEDAGGTLT
LGESAGGGTLLRWCAPLA
108801087YP_641284.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MSTRLVITGASGNVGTALLQRLADAGGYTVTGVTRRKPPESGIYRSAQWR
QLDLAEHDATTRLQAVMGDADAVVHLAWGFQPTRNVQYLDAVGVGGTRAV
LRAADVAGVGQLVHMSSVGTYAAGRYGQYVDETWSTAGIDTSPYSRAKSA
AEALLDDYERSHRDGLTIARMRPGFIVQRSAAGGLRRYTLPAFIEPRWLR
FLPVLPLDRGLVVPIIHADDVADAIARTVERRAAGPFNLMAEPPVRRDDL
AEALGAYPVHVPSSLLRPAVALSWRARLQPMDEGWLDMAFSVPLLDTGRA
QSELGWKPVRTSIEALVDMGEGFKNCADTESPVLSYRGPLTSVLRDLRAG
PITDRKVP
108801085YP_641282.1 fructose 1-6-bisphosphatase II [Mycobacterium sp. MCS]MPADPDALRASGSSRRREAPDRNLALELVRVTEAGAMAAGRWVGRGDKEG
GDGAAVDAMRELVNSVSMRGVVVIGEGEKDNAPMLYNGEEVGNGDGPDCD
FAVDPIDGTTLMSKGMPNAISVLAVAERGAMFDPSAVFYMNKIAVGPDAV
DAIDITAPIGENVRAVAKVKGLSVRDVTVCILDRPRHEQLIADVRDSGAR
IRLISDGDVAGAISACRPNSGTDMLAGIGGTPEGIITAAAIRCMGGAIHA
QLAPKDDEERQKAIDAGHDIDRVLKTEDLVSGENVFFCATGVTDGDLLQG
VRYTGGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAVDFTGDSNAAY
PLP
108801083YP_641280.1 hypothetical protein Mmcs_4119 [Mycobacterium sp. MCS]MTARNPNVAAGAAPAADLSGWTAEPFTAAGYTHDVYRKGDGPGVVLIPEM
PGLHPHVLALGNHLVDNGFTVAAPSLFGTPMKPPLGPGALPVLLKGCVSK
EFAAFATNADRPVAHYLRALARDLNARTPGKGVGVIGQCFTGGFALAAAV
DDSVLAPVLSQPSLPLPVTPKHKRDPGLSEGELRIIERRAAEDGLCALAL
RFSKDWMSPAERFETLKARLGDAFEVIEIDSARGNPHGISPTAHSVLTDQ
IREVDGHPAYEARKRVVEFLTQRLVEA
108801081YP_641278.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MDFAGRQAIVTGAGSGIGAALCRALVAAGAEVLCTDIDADAAEATARGLG
ARWSPLDVTDAAAVQRAVDEVVARAGRLDLMFNNAGISWGGDTELLTLDQ
WNAIIDINIRGVVHGVAAAYPQMIRQGHGHIVNTASMAGLTAAGLITSYV
MTKHAVVGLSLALRSEAVAHGVGVLAVCPAAVETPILDKGAVGGFVGRDY
YLQGQRVKAPYDADRLARDTLRAVQRNKAVLVKPRQAHAAWVFARLAPGL
MQRMAARFVAEQRAGQRAQTVGTG
108801079YP_641276.1 hypothetical protein Mmcs_4115 [Mycobacterium sp. MCS]MTEDLVRIPAQSATIGSDRHYPEEAPARDVTVDGFWIQAHAVTNAEFAAF
VDATGYRTVAERPLDPANYPDAPAQNLQPGSMVFRRTAGPVDLRHLNQWW
YWTPGASWRHPIGPGSSIVNRADHPVVHVAYDDAEAYAAWAGLELPTEAE
WEVAARGGLPHAGYTWGDEPEGPGHKLANYWHGEFPWRPDRGYGRTAPVG
SYPPNGYGLYDMAGNVWEWTTDWYTDTGGSACCAEDSYDPAQPQFPVPRR
VVKGGSFLCADSYCARYRPAARRPQPVDTGMSHIGFRCVRH
108801077YP_641274.1 sulfatase [Mycobacterium sp. MCS]MPNSTPNILVIWGDDIGISNLSCYSRGMMGYRTPNIDRIADEGMLFTDSY
GEQSCTAGRSSFITGQSVYRTGMSKVGMPGVDIGLQKEDPTIAELLKPLG
YATGQFGKNHLGDLNKYLPTAHGFDEFFGNLYHLNAEEEPENADYPTEEE
APVMRRALLPRGVIHSWATEEDSGEVDDRYGPAGKQRIEDTGPLTKKRME
TIDDETTDACVDFITRAHGTGTPFFVWMNMTHMHFRTHTKPESLGQAGRW
QSPYHDTMIDHDRNVGQLLDLLDELGIADDTIVIYSTDNGPHANSWPDGA
TTPFRSEKATNWEGAFRIPELIRWPGKIEPRSVSNEIVQHHDWLPTFLAA
AGDPDIVDKLKAGHTIGDITYKVHIDGYNLVPYLTGEVAKSPRRGMIYFS
DDCDVLGIRAENWKVVFQEQRCQGTLQIWFEPFTPLRAPKLFNLRTDPYE
RADITSNTYWDWVIDRIYLVLYGSAIATQFLETFKEFPPRQEPASFTIDH
AVDELNKFLSTRGG
108801075YP_641272.1 MgtC/SapB transporter [Mycobacterium sp. MCS]MLAVDLLTRVGLATVLGVAIGLERQWRSRMAGLQTMALVSTGSALYLILG
AYSFPDADPTRVAAQIVSGIGFLGAGVIMKQGLSVTGLNTAATLWSTAAV
GALAGAWLWREALASAVIVVAVNLALHPLAEAMDRRKNWGGREHPPVHYL
LTVVCREDHDTDIRALLVQAVIDSHLQLTSLRSVAADGGKLQIAAGVSAL
ARDDAVLEKIVGVLAVDARVTSVRWNIPEEEASGLARP
108801073YP_641270.1 3-beta hydroxysteroid dehydrogenase/isomerase [Mycobacterium sp. MCS]MADATLTTELGRVLVTGGSGFVGANLVTELLERGHHVRSFDRAPSPLPPH
PLLETLEGDICDPETVAAAVAGVDTVFHTAAIIDLMGGASVTDEYRRRSF
AVNVGGTENLVRAGRAAGVKRFVYTASNSVVMGGQPIVAGDETLPYTDRF
NDLYTETKVAAEKYVLAQNGIDGMLTCSIRPSGIWGRGDQTMFRKVFESV
LAGHVKVLVGSKNVKLDNSYVHNLIHGFILAAEHLVPGGTAPGQAYFIND
GEPVNMFEFSRPVVEACGERYPRLRVPGRLVHFVMTVWQKLHFRFGLPKP
LLEPLSVERIYLDNHFSIAKAERDLGYRPLFTTEQAMQACLPYYVELYEK
MKADGAKTPAVQAVRTTPPAG
108801071YP_641268.1 exodeoxyribonuclease VII large subunit [Mycobacterium sp. MCS]MTTPADDQGKSPENPWPVRAVATRVAKYIDRLGMVWIEGQLTELKIRQTT
AWMVLRDPAADMSLSVSCPRDLVANAPVPLSEGTQVIVLGKPQFYTRNGS
FSLRISEIRAVGIGELLARIDRLRRLLDAEGLFDPRLKRPIPFLPGTIGL
ITGRASHAERDVMTVAANRWPAVRFAVRNTIVQGPNAVPQIVGALRELDR
DPGVDVIVLARGGGSVEDLLPFSDETLCREIASCTTPVVSAVGHEPDNPL
CDLVADLRAATPTDAAKRVVPDAAAEQAFVTDLRRRSARALRQWVHREQH
HLDQLRSRPVLARPLQAIDARADEVHRAVAAARRDVRRMVTVESERVGHL
SARLTTLGPAATLARGYAVVQTMPDTNVLRTTADAPAGTHLRIRVADGAI
TAVSEGTDEAH
108801069YP_641266.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium sp. MPPTINMGIPGASSSVTGGVSGKRVLLAEPRGYCAGVDRAVETVERALEK
HGAPVYVRHEIVHNRYVVDTLAKAGAVFVEQTDEVPEGAIVVFSAHGVAP
TVHVEAAARNLKTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGHEEVV
GTAGEAPDHVQVVDNPDAVDKVTVRDPDKVIWLSQTTLSVDETMETVRRL
REKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSNSVRL
VEVALGAGSDAAHLVDYAEDIDPTWLNGVTTVGVTSGASVPEVLVRGVLD
RLAEYGYGTVQPVTTANETLVFALPREIRPARS
108801067YP_641264.1 hypothetical protein Mmcs_4103 [Mycobacterium sp. MCS]MSGQRARSAVPADHRSVHPLFPGLPWWGAVVLAFTVTAVGFAFDAGSGSR
ELGSVFSACYVLGCLLAVLAVRQAGLFTAVIQPPLLLFITVPGAYFLFHG
SEIHGLKDLAINCGYPLIERFPLMFFTSAAVLLIGMGRWYLGMSSRHATG
TSAPAAKGTTRDVSKGASAAAAAGGLVAALKTKVSGLLSAPAATDDGQDE
EPPRRRRSSERPRRAAKPAAERTRSSRDAARGAAARKPAKRAATPSRSRH
NRPPETEIIEPVVDRPRRSRSTPRTPESPEPRRRSRTQAPREAREPRETR
DARKLPPRERRSSSYDRPERRPERSRRLDDYEPYEPLEPHTRNGSSSHHP
ISRVRYRGADEDDQRSEYRSRPRARRSWDADAWEYDV
108801065YP_641262.1 hypothetical protein Mmcs_4101 [Mycobacterium sp. MCS]MARVPEITAILGGSRFTRLDVLERERERARRALSKLGAPVSSAEVDQLRE
ALRQRKAELGHSGIEGALGRDVRWSTRVARLTATASRGRRALSTIEMVAS
QGSANGFVDWFEKRTSADDEAAMLAAHPDHFLFRTDAEGRQEVWETNGGS
PLAARFFIDYDDTSSLQTPVDREYPVQLAGVARLRDGLAIGGVRHQFRDE
GEGFRALLTVEFPALTLPTILRGHRWHLAIEFSNWIEASAAGEG
108801063YP_641260.1 type 11 methyltransferase [Mycobacterium sp. MCS]MSFVVSPEAYARFMGRYAEPLAEVFVAFAGVGADDRVLDVGSGPGALTAH
LLSVGAEVAAIDPSPPFIDAIRTRFPDIDVRLGTAEELPYDTGAFDAALA
QLVVHFMTDPVAAIRQMARVTRRDGVIAACVWDGPTGALAPFWDAVHVID
PEAEDEALLSGAHMGHLTELFEAAGLRNVDEASIAAEVVHPTFEEWWEPY
TFGVGPAGDYVQRLDDERRAVLESVARDRLGSGPFRVTANAWAARGTV
108801061YP_641258.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MNSTTTAPKRAFKDRLYTEFARIGKAVSSPHRLELLEVLAQGERTVESLA
GETGLSVANTSRHLQQLRQAQLVMTRREGLFVHYRVAGPEVVALIVALRH
TAEQHLAEVDRVVHDFFGDRDGFEPVTPDELSRRMSSGDVVLLDVRPEQE
YVSGHIAGARSMPVADIAARIDELPGDGEYVAYCRGPYCVYADDAVAVLR
AHGRKATRLSEGYPEWWLSGRPVQTGVSTDHQSVP
108801059YP_641256.1 hypothetical protein Mmcs_4095 [Mycobacterium sp. MCS]MDRMNGGDLRDVYRAYLACLNERRWDDLGQFVADDVSYNGELVGLSGYRS
MLEADTRAIPDLRYVPEILLADARIVACRLFFECTPQQEFLGFEPTGARI
AFAEHVFYRFTDRRIADVWSLIDIENVREQVSRRTDRASRIIAAPLTRVF
SALVDPDALLEWLPPRGMRGEFERFDGRAGGSYRLRLTYLEAPEAGGKSG
ADSDVVEARFLDIAPDDRVVQEVAFESDDPRFAGTMTMTWSVTAVDAGTR
VDFRADGVPPGISAEDHAEGMDSSLANLAACVETRR
108801057YP_641254.1 hypothetical protein Mmcs_4093 [Mycobacterium sp. MCS]MSLARALDDTRTGDIWLFRGASGPDRAIQAMTNAPVNHVGMTVAVDDLPP
LIWHAELGDKLLDLWTGTHHRGVQLNDAREAVERWMQTYGQRCWLRQLTP
DVTRAQEDRMLRVIARMDGTPFPSTARLTGRWLRGRLPVVSDFTRGIPYV
HRRVRESAERAKARKRTALQTAYCAETVAITFEEMGLLSTEKHDNWFDPG
SFWSGDALPLADPYRLGPEIAVVG
108801055YP_641252.1 hypothetical protein Mmcs_4091 [Mycobacterium sp. MCS]MTAGRRTAGFDFLEQPALPAPRVSEAEAQRILATHYGIEGDAVSLGSQQD
KNFLVRRTGTGEVAGVLKVANPAFTAVELAAQDAAATLIAEAEPGLRIAV
PLPNADGAEVTTVDGLLVRLLRYLPGGTLIDADHLGPAAVAGLGEVAARV
SRALTGFEHAGLDRVLQWDLRYGADVVAALIGHVADPVQRERLSTATRDA
AERIGRVADALPRQAVHLDITDANVVVSRAADGTRRPDGVIDFGDLTDTW
AVSELAIAASSVLGHSGTEPVSILPAVRAFHGIRPLTVEEIDALWPMVVL
RTAVLIVSGAQQAELDPDNAYVTDQSDGEWRMFEQATSVPIDVMTAVIRA
DLGFAAPPADVTATVPMIAGVTAEDVVTLDLSPTSDAYDFAFTPGGWLPP
DVDDRLARRAVGDGAAVVVTRFGEPRLGLAPALSQRSGDVVPTGVRLWPA
QPLTLVAPWDGEVGSDGAGDTVTVRGDAHEVTLTGVRPVGGASAVRAGDP
IAQADAAQWADVAVRPVGGVTAPPLVRPEVATGWLAQARDPRPVLGLPPD
AVTSPAADLVERRDRSFAPVQEHYYRRPPQIERGWRHYLMSTAGRCYLDM
VNNVTVLGHAHPRVADTAARQLRKLNTNSRFNYAAVVEYSERLAAELPDP
LDTVFLVNSGSEASDLAIRLALAATGRRDVVAMCEAYHGWTYGTDAVSTS
TADNPNALATRPDWVHTVESPNSFRGKYRGADVGRYATEAVAQIERLVAD
GRAPAGFICESVYGNAGGMALPDGYLQQVYAAVRGAGGLAIADEVQVGYG
RLGHWFWGFEQQGVVPDIVSMAKSTGNGYPLGAVITSREVAEAFRSQGYF
FSSTGGSPLSCAIGLTVLDVLRAEDLQGNAVRVGGHLKARLEALADRHPI
IGTVHGVGLYLGVEMVRDRQTLEPATEETAAICERMLELGVVIQPTGDHS
NILKTKPPLCIDTESADFYVDALDRVLTEGW
108801053YP_641250.1 3-demethylubiquinone-9 3-methyltransferase [Mycobacterium sp. MCS]MPQITPSLWFDDDLEEAVAFYTSIFPNSTVESLSRFTEACPGPTGEVVSA
TFVLDGTRFIGINGGPQFPFTEAVSFTVACKDQEEVDYYWDRLVDGGEES
MCGWLKDRFGVSWQIVPDRLTELLDDPDPVRAAAASKAMLGMRKIIIAEL
EEAVVAV
108801051YP_641248.1 hypothetical protein Mmcs_4087 [Mycobacterium sp. MCS]MTDTPKEEQTTVEQFEPEATAVEEPTAESSTADEPAAAPAVATRRSIPWE
RVFAYGVVPALALVLAVAGGYLFWRNYTADAAEQAREDSVAAARSIAISM
LTYEPQSVEQQLGAAKEQLTGTFRDTYSSLIDTVVVPGAKERQISAVTDV
PAAASVSAEPDHAVVLLFVNQTVTVGSEPPTNTASSVRVTLDKVGDHWRV
SEFQPI
108801049YP_641246.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MLPASSSTGVALVTGASSGIGEQIARELARRGYGLALVARRADQLRALVD
DLGSHAHALPTDLSRPDERAALPARIAALGAEVDILVNNAGMANLGRVAA
SDPAAELTLVELDVAAVVDLCSRFVPGMVARGRGAVLNVASVGAFGPVPG
QATYGAAKAFVLSYTHALREELRGTGVSAATLCPGPVRTGFGEQAGIPDD
EAEKMLPKFLWERPDTVAKAGLDGLAAGRAVIVPGTPNRVAAALNHLTPR
RLLLPMLGRAHPGMKRS
108801047YP_641244.1 DoxX protein [Mycobacterium sp. MCS]MTAYDVGVLILRVVLGLTMAAHGYNKFFGGGRIPGTAGWFDSIGMKPGMF
HARVAATTEMAAGIGLAVGLLTPVPAAGFVALMLVAAWTVHRANGFFIVK
EGWEYNLVLAAAAVAIPAIGPGKLSLDYALFHGTGVWDLVQGWWGLVIAL
VLGLGGGIGQLAMFYRPPAKTGA
108801045YP_641242.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MARTTPLAPMIGASPSTTAVRSPKTAELVAGTLRRMVVDGKLKEGDFLPN
EAELMAHFGVSRPTLREAVRVLESERLVEVRRGSRTGARVRVPGPEIVAR
PAGLLLELSGATIADVMTARSGIEPMAVRLLTESGDTAAFDELEQTLDEQ
VAHSWQSGRLAETTGDFHRRMVELSGNATLTIMAGMLHEITVRHTAFAMK
ESNPPSKADYEKLMRSYRRLLQLMRSGDGAAAEAHWRKHLDTARALLLQG
LEDVKVRDVMG
108801043YP_641240.1 short chain enoyl-CoA hydratase [Mycobacterium sp. MCS]MLIITINRPEARNAVNASVSIGVGDALQAAQEDPEIRAVILTGAGDKSFC
AGADLKAISRGENLFHPEHSEWGFAGYVRHFIDKPTIAAVNGTALGGGTE
LALASDLVVAEERAKFGLPEVKRGLIAGAGGVFRIVEQLPRKVALELIYT
GEPISAADALRWGLINDVVPDGTVVDAALKLAERITCNAPLAVQASKRVS
YGAVDGVVGSDEPFWKQTFSEFSTLLKTEDAMEGPLAFAQKREPVWKAK
108801041YP_641238.1 beta-Ig-H3/fasciclin [Mycobacterium sp. MCS]MKTRTRTLGAAVGIAAIAVSLPLSVTANAEPATVETPLPNLEGDCDPFRA
EVPNWKTFVNQPVSQVLAQIPDISTFSSAVSGGLNPAVNVASVLDNGPYV
VFAPTDEAFAKLPPEQLEALKANPAALTDLDYYHVFLGLLGPADVKGQRA
TQQGADIKVVGTNGDIKVNDTAKVICGGIAAQNARIYLIDTVLDPAAAPD
AVSPSGTSTTATTSSTESTPTTEPTPLPAEQTPAAAADIPAADAPIG
108801039YP_641236.1 aldo/keto reductase [Mycobacterium sp. MCS]MEYRRVGESGLTVSEISFGAATFGGVGDFFGAWGDTGVEGARRIVDICLE
AGVTLFDTADVYSDGASEEVLGEALRGRRDRVLISTKAALPTSTGWGTSR
ARLLRAVEDALRRLRTDRIDLFQLHGYDSGTPIEEVVATLDTLLTQGKVR
YTGVSNFSGWQLMKSLAVADGAHRTRHIAHQVYYSLVGRDYEWELMPLGL
AEGVGALVWSPLGWGRLTGRIRRGRPLPERSRLHATADAGPPVDEDRLYA
VVDTLDDIAAETGRTVAQIALNWLLRRPTVASVIIGARNEEQLRENLGAV
GWRLDDEQIARLDAVSAREAPYPYFPYRRQEGFALLDPPVAG
108801037YP_641234.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MKNVRVLVTGATGYVGSRLVSALVDVGADVVVASRTPDRLRSFGWYDDVT
SVALDAQQPQSVKQALADAGPVDVIYYLVHAIGQPDFRDTDNRAATNVAE
AAREAGVKRIVYLGGFVPTDETLSEHLAGRAEVAEALTVPGGPDVVWLGA
AIIIGAGSTSFEMLRYVADRFLVLPMPKWAAHPIDPISIRDALHYLVAAA
DIDKVPAGAYDIHGPDTTTYGELLQKYARLAGRWRAPLPVRGIDTSVVAQ
LSGLVLPVPGGLAGDLIESLDHPMTASKEGLRDFVEDPAGGLTGIDEAIR
RSLSPQRPRPVNRLVDVHHLADTDPDWAGGDYERITRLVRTVTPPIARPA
LGLLCLVPGPVAAAMRTGLDTLVNLVPKGNSA
108801035YP_641232.1 HicB protein [Mycobacterium sp. MCS]MIGPCPPTPIAPNGPRAVANTRLGVWNSPATSATPPPRHKPSRTSSAKSA
TASPSASPDLHSRLSVEAAEQGVSLNQWAITKLAGRLPSLDDLF
108801033YP_641230.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMAGPLQGLRVVELAGIGPGPHAAMILGDLGADVVRIERPGKGPGIPTKGS
DQLLRNRRSVGANLKTDEGRELVLRLIAKADVLIEGFRPGVTERLGLGPE
DCAKVNERLIYGRMTGWGQTGPRSQQAGHDINYISLNGVLHAVGRAGERP
VPPLNLAGDFGGGSMFLLVGILAALWERERSGKGQVVDAAMVDGSSVLAQ
MMWAFRAMGMWSDERGVNMLDTGAPYYDTYETSDGRYVAVGAIEPQFYAE
MLDKLGLDPAGLPDQNDMSRWPELRAVLTKAFAEHDRDHWAKVFTGSDAC
VTPVLSFGEVEAEPHNTERDTFYREGDFLFPAPAPRFSRTTTTTPTPPGV
PGADTEAVLNDWV
108801031YP_641228.1 2-nitropropane dioxygenase [Mycobacterium sp. MCS]MTLHTKFTETFGVEHPIVQGGMQWVGRAELVAAVANAGALGFITALTQPT
PADLANEIARCRDLTDKPFGVNLTILPTINPPPYDEYRQVIVDAGIKIVE
TAGSNPAPHLPMFHDNGIKVLHKCTSVRHAVKAQSLGVDGISIDGFECAG
HPGEDDIPGLVLIPAAASKIDIPMIASGGFADARGLVAALALGADGINMG
SRFMCTEESAIHQKVKEAIVAGTELDTELIFRPLRNTARVASNAVSREVV
EILNRGGQFEDVKDLVAGKRGVKVYEIGDLDAGIWSVGTSMGLINDIPTC
GELVSRMVEEAEQLITDRLAGLVKPAEEPVAV
108801029YP_641226.1 DoxX protein [Mycobacterium sp. MCS]MASTDVRSTVTTPTSTGTDIALLVLRIGVGATMIQAGLRKAVDFDTVVGF
MEAGGWRLPGLAAFMVTASETLGGIGLVLGVLTPLAATAVIAAMLDAWAV
NVSGAAFWSEPFNVPFLVAIGATALLFAGAGAYSVDARVATRIRWSTRIA
VILLAVAIVAAVVTWIALNGTNPIHLTTPTG
108801027YP_641224.1 type 12 methyltransferase [Mycobacterium sp. MCS]MSADVDNPFFARLWTVMSGHETEEMRRLRAANLAGLTGRVLEIGAGTGTN
FAHYPPSVTEVVAIEPERRLAAHAREAAAHAPVPVTVTMDSVEDFSTAEP
FDAVVCSLVLCSVDDPDGVLRELFSLLRPGGELRYLEHIAETGARARLQK
VADATVWPRMLGNCHTHRHTETAITVAGFRVEDARRERMFPSWVPLPVSE
LAVGRAVRPA
108801025YP_641222.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MAGLAEWVSLDARAARPLFDQLRTQIIDAVRDGRLSPGTRLPTVRELAGQ
MGLAVNTVARAYRELETAGVLETRGRFGTFVSRVDPADTAMATAAQNYVE
TARALGVEKSAALRYVESAFD
108801023YP_641220.1 hypothetical protein Mmcs_4059 [Mycobacterium sp. MCS]MTRFVAFLRGVNVGGVNLKMAEVAAAFEDAGFTAVKTILASGNVLLDSDA
DVTTVRRTAEQALRERFGYDAWVLAYDAATVAAVSAAYPFEREVEGHHSY
VTFVTDEQVLDELAALAADAGPEEKIERGEGVVYWQVPKSATLDTTIGKT
MGKKRYKSSTTTRNLRTLDKVLRSVDSAR
108801021YP_641218.1 hypothetical protein Mmcs_4057 [Mycobacterium sp. MCS]MAEQPEDDTKRKFREALERKKAHSTDSAGQRKGGPQQAKAHGHGPVENRR
EFRRKSG
108801019YP_641216.1 SSS family solute/sodium (Na+) symporter [Mycobacterium sp. MCS]MTVLAAETIGNPVANMSIFALFVLVTLFIVIKASKKNATATEFFTAGRAF
TGPQNGIAISGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLL
VAELLRNTGKFTMADVLSFRLKQRPVRLAAATNTLAVSLFYLLAQMAGAG
VLVALLLNIESDLGQSIVIAVVGVLMIVYVLVGGMKGTTWVQIIKAVLLI
GGAGIMTIMVLAKFNFNFSEILGSAQAMVSSSEDAKVASRDVLAPGAQYG
ASLTTQINFISLALALVLGTAGLPHVLMRFYTVPTAKEARRSVVWAIALI
GAFYLFTLALGYGAAALVGPDRILAAPGGVNSAAPQLAFELGGVVLLGVI
SAVAFATILAVVAGLTITASASFAHDIYASVMKSHQVTESEQVKISRITA
VVLGTLAIGLGILAREQNVAFLVALAFAVAAAANLPTILYSLYWRRFNTR
GALWSMYGGLISTIVLIVFSPAVSGTATSMIKGADFAWFPLANPGIVSIP
LAFILGIVGTLTSPDDEDPTIAAEMEVRSLTGVGAEKAVSH
108801017YP_641214.1 Na+/solute symporter [Mycobacterium sp. MCS]MTGSALTAAALLAAAVATIAIGAYGVRFSRTTSDFLVASRTVGPQWNAAA
ISGEYLSAASFLGVAGLIAKYGADALWYPVGFTAGYLGLLLFVAAPLRRS
GAYTVPDFAEFRLGSRRLRKVAMLVVIVICVVYLVPQYQGAGLALKTLLG
MPVWIGPVVVGGIVITNVVAGGMRSITFVQAFQYWLKLTAIAIPAIALLG
LFFTDRGELGGPLPPSVTQDTTVAIETDVVVQVTEPAGITVTGTLDGRPV
IAAPIGAPGEHELGADSTMTLADGAATPVLAGTPAAGGEWLASGGGLGGA
HPLYQVVSIIVATFLGTMGLPHVLVRFYTNPDGRVARRTALAVIALLGLF
YLFPTLIGVFSRLYVPQLLITGAADAAVLLAPAAAIGGVFGQLLAALVAA
GAIAAFLATSSGLLVSIAGALATDVLRGRVRDFRIAALVGGLIPIPLSLI
TSGLELSRSVGLAFAVAASTLCPLLVLGIWWRGLTAVGASCGLVVGGAAS
GTAVALAIAGAVDEAALGGWAAVAVGYPAAITVPLAFVTMIAVSRLTRRS
VPPDVAQIFARMHVPERLGMGIERVPGD
108801015YP_641212.1 response regulator receiver protein [Mycobacterium sp. MCS]MNRSGLTVLAVDDEMPALDELAYLLGRHPDIGEVLRVNDATSALRELNQH
SIDAIFLDINMPGLSGIELAGVLGNFAQRPAIVFVTAHDDKAVAAFDVGA
IDYLLKPIRQDRLDEAVRRVVAARSAESAGAARSAESAADEEPDSDVVPA
ELGGITHLVPRDSIGWVEAEGDYARLHSASGSHLVRIPLSTLETRWRERG
FQRIHRSYLVALRLVTGLRTSDGAVLVRLRANGSSPAVELPVSRRQAREL
RDRLVRDPLRHLRPAGGDD
108801013YP_641210.1 HhH-GPD domain-containing protein [Mycobacterium sp. MCS]MAKLQLVQDPAADALLESNPFALLVGMLLDQQYPMEAAFAGPKKIADRMG
GVDAREIAEYDPEKFAALCSTTPAVHRFPGSMAKRIQALAQLIVDRYDGD
AAALWTSGDPDGAEVLRRLKALPGFGEQKAKIFLALLGKQYGVTPQGWRE
AAGDYGKAGTYMSIADVTDPGALEKVRSYKKQAKAAAKDQAKN
108801011YP_641208.1 hypothetical protein Mmcs_4047 [Mycobacterium sp. MCS]MSPTRTLLTTAAGVGASVALLFSSATATAEPAPGLPIDTLQAPGLPAMES
LGPVIQQAAADPNNAASMLMAAAAVFAGDAAAPASSRDVASAVNQFVADP
AAHVPAPGAVPGTQAHLPAGVNPAHAVGPLPAGATPPAPGPEVAAAPVVD
PVAVPAAAPAPVPGAPVATPVAAPVAAPVAEAAGALPGPAPAPAPAPTPG
PPGFGPDAPPTQDFMYPSISNGCLKDGGNVLATAISVAGPAKIPAPGPGP
GQTAYVFTAVGTPGPAAEQKLPLNVTWVNLTTGKSGSATLKPRSDINPEG
PTTLTAIVDTGSGSIMSTIFGQVTTTEKQCQFMPTIGSTVVP
108801009YP_641206.1 mannosyltransferase [Mycobacterium sp. MCS]MCGIYSTVTEVTGIGYRISRVGPISDSTAAPAATADGANPTRLPGRLAAA
APVLLVLSIAARLAWTYLAANGANFVDLHVYVGGAGALDAPGTLYDYVYA
DQTPDFPLPFTYPPFAALLFYPLHLLPFGVVAFAWQIGIVAALYGVVRLS
QRLLADGGDRRTAMLWTAIGIWLEPLRSTFDYGQVNVLLVLAVLAAVHSS
RWWWSGLLVGLAAGVKLTPAVSGLYFVGARRWKAAVFSAVVFAGTVAVSV
AVVGPQARYYFTDLLGDADRVGPIGTSFNQSWRGGISRIVGHDAGYGPLV
VAAILVTAVLALLAWRAIGGSADRLGAIVIVQLFGLLLSPISWTHHWVWV
LPLMIWLWHGPLRRRAGARALRWGWLALTLIGVPWLLSFAQPTIWEIGRP
WYLAWAGLIYIVATLVTLAWLATTGATGRGSRRSPEPSADPSP
108801007YP_641204.1 NUDIX hydrolase [Mycobacterium sp. MCS]MAEQIVVAGALITGSQLLVAQRDRPPELAGLWELPGGKVARGESDSAALT
RELQEELGIDVAVGPRIGDDIALSATTVLRAYLVTHLGGDLRPIDHRALR
WVAVHELDDLPWVPADRAWLAALGHALRNGAG
108801005YP_641202.1 hypothetical protein Mmcs_4041 [Mycobacterium sp. MCS]MKSSKFAELKPKKKCCRSKPRCKRCPLVVHKVLKAEHMGIRGKELEKVYK
RARKA
108801003YP_641200.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MPTRPRRHRVTLGALVSAVALLLGGCTVSPPPAPQSTETPQTTPPPAPKA
TQIIVAIDSIGPGFNPHLLSDQSPVNAAIAALVLPSSFRPIPDPNTPTGS
RWELDPTLLESAEVTNENPFTVTYNIRPEAQWTDNAPIGADDYWYLWRQM
VSQPGVVDPAGYDLITGVQSVEGAKQVVVTFSQPYPAWRELFNNILPAHI
VKDVPGGFGAGLAEAMPVTGGQFRVESIDPQRDEILLARNDRYWSAPAKP
DLVLFRRGGAPAALADSIRNGDTQVAQVHGGAATFAQLSAIPDVRTARIV
TPRVMQVTLRGQLPKLADPSVRRAILGLLDVDLLASVGAGDDNTVTLAQA
QVRSPSDPGYVPTAPPALGTEAALELLAEAGYQMAPVGDGAPGAPAPDHS
RGRLSKDGAPLTLVLGVAANDPTSVAVANTAADQLRSVGIEASVLALDPV
KLYGEALAENRVDAVVGWHQAGGDLATALASRYGCPALEATPVQTAPAAP
PGSSRPTTTAAPATTAPATPTATPTTTPSPAPESGALVQAPSNITGVCDR
SIQPKIDAALDGSEPIAEVIDAVEPRLWNMWTVLPILQDTTIVAAGPSVR
NVSLTGAVPVGIVGDAGSWVKTPQ
108801001YP_641198.1 integrase catalytic subunit [Mycobacterium sp. MCS]MSFSEDCVRFGDRLARLVDAGVPVKEAAVATGVSRDRCYAILRAIGRPVG
QARGRGERADQRGVADLGVVVAVFKDTGSILQAATACGVSHSTARKLLVA
EGLVTSGKIPWGKPEAKRRCLELFEQGWSTGAAAREVGVNVRTARDWRKG
IRHTNNTRVHPDGRVVDYTDRTVYKQSVSNLICDDTGRPAIDDRYLSVQD
RVAIADGLLGKESLRTIAGRIGKNVSTVSREIRARSIDGRYLPYHADRAA
ASARARPKQSKLVVNVVLRGAVEEGLSRKLSPEQISNRLRRDHPDDESMQ
VSHETIYQALYFQARGGLKKEVQQALRTGRTRRKPHRKEGERYQRFTDPM
VMISDRPAEVDDRAVPGHWEGDLITGEKNQTAIGTLVERSTRYTMLVHLP
GGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVY
FCDPASPWQRGSNENTNGLLRQYFPKGTDLSIYGPEDLEHVAQELNGRPR
KTLGWDTPAERLRDLLLTN
108800999YP_641196.1 hypothetical protein Mmcs_4035 [Mycobacterium sp. MCS]MLLYSQVSLSYSLPIERCARGEGAMRRAIAPFLATGVVLSGAAVVVANPV
VPLPSDIRVSASDFTADGDRLDVLDPEFLESIGAIRQDWLSSIEELQRLF
NDVSNTGRDSVISAFSAGVSVTEPSVALPVEEFTAAHERTLVPNTTIPPG
VPSETLEGVVGALTDIGTSFGEAGITFVKQVTLVPAVAFVLMKQVATGLL
TGEMGPIEALHRLIVEPLSALLVGDPELTGIEAIDKAFAESALKPLIRAL
IRNLPKPLGKEGGLIDQVDQTVDGVVVDIRDGVTPPSAVGAKPQQVESGT
DLEVPLPALEVDPDGESDTPSATTQPGAPKLPKPGELARELGVRVQQGVQ
QGIDNFHSTIKRFTTGGKKTTPAKDGDQAGDAGGQGDTTGGKQPTPGSTN
DASSPADDKTTVDRETDSEK
108800997YP_641194.1 hypothetical protein Mmcs_4033 [Mycobacterium sp. MCS]MGGRFVRGAARQHPDLTAPPRGSRRAAGLLRGVILALLTLDGVLTAVLGA
FFLPLRIGVAPFPLSAFVVGAVNAALVWAAFQWTDSGRLAALPLWAWLAT
LAVLTVGGPGGDVVFGGRDVMAFGVLIYTAVGVAPSAWLLWRRGLRTG
108800995YP_641192.1 YceI protein [Mycobacterium sp. MCS]MTAATTTALSAGTWAIDPVHSTIGFSVRHLMVSKVRGTFDDYSGTITVGE
DGTASVTAEIAVASVNTRNEQRDAHLRAADFFDVENHPVATFTSTGVRAD
GDGYVIDGEFTLKGVTKPITLDLEFNGTNPGMGHGEVAGFDASVVLNRKD
FGIDFDAPLETGGAVVGDKITVTLEIEALKQA
108800993YP_641190.1 N-succinyldiaminopimelate aminotransferase [Mycobacterium sp. MCS]MDEVAPVIREALAAASGAPGYPTTAGTPELRASAKAALERRCGITGLADD
AVLPVIGSKELIAWLPTLLGAGSDDLVVVPELAYPTYDVGARLAGAQVIR
ADSLTQLGPQRPALIFLNSPSNPTGRVLGVDHLRKVVGWARDRGVLVASD
ECYLGLAWDAEPVSVLHPSVCDGDHTGLLAVHSLSKTSSLAGYRAGFVAG
DPAVIAELLAVRKHAGMMVPTPVQAAMVAALDDDAHEREQRERYARRREV
LLPALKAAGYTVDHSEAGLYLWATRGEPCRQTVDRLARLGILAAPGEFYG
PRGAQHVRLALTATDERIAAAAERLSANQG
108800991YP_641188.1 hypothetical protein Mmcs_4027 [Mycobacterium sp. MCS]MRAARIRLGELLLALDRTMVTLQQAPRGLDLPVASVALVDADDVRLGIAP
SAGNADLFFLLGVPSDDAVRWLAAQPRPPVAVFVKDPAPELVRHAIARGA
AVVAVDPHARWERLYRLVNQFFDHRGDHGDPPLPGGTDLFGLAQSIADRA
RGMVSIEDAQSHVLAYSASSEEADELRRLSILGRAGPPEHLAWIGQWGIF
DALRAGRDVVRVAERPELGLRPRMAVGIHLRSGARRTPTFAGTIWLQQGS
APFADDAEEVLRGGAVLAARVLGRMAATPSTHTLRVRELLGLSDTDTDIG
AIARELGVDADSRAALIGFGTAAPTPPADVIALSATAFRADAQVASAGDR
VYVVLPEIGAPSVTSWVRGVVGTLRREAGLTLHAVIAAPLPGLADVAASR
AEIDRVFDSAARHPGAIGQITSLADARATVLLDEIVAHVAGRPGLVDPRV
RTLREKDPLLAETLHAYLDGFGDIAAVASRMHVHPNTIRYRVRRIETLLG
TSLDDPDDRLVLALGLRATESAQPLNAPSTSSSNRSNASSRSSSIPRSGP
GSSR
108800989YP_641186.1 L-proline dehydrogenase [Mycobacterium sp. MCS]MGAFQRVARPVILAAARSDSLRHTAERLPVTRNVVHRFVPGESVEEAMYC
VTGLRNSGRMVSVDYLGEDVTDVDTANATVEAYVKLLDALGRRDEPAGAV
RPLEVSLKLSALGQALPRDGEKIALENAHTICTHAQRVGAWVTVDAEDHT
TTDSTLSIVRELRSEFDWLGTVLQAYLRRTQADCAEFAASGARIRLCKGA
YDEPASVAFRDADEVTDNYLRCLETLMAGRGYPMVASHDPVVIDAVPGLA
AAQGRASGSYEYQMLYGIRDQEQQRLADAGNVVRVYVPFGTQWYGYFVRR
LAERPANMAFFLRALAGR
108800987YP_641184.1 hypothetical protein Mmcs_4023 [Mycobacterium sp. MCS]MTYTRPPGHIGMSTETTIRQLITRWVDAVAACDIDGVLADHDPDIVMFDV
PPPHTGVRGLDAYRGTWPDFFEFLRGGARFELLELHVTAGTDVAFAYGLL
RCGTQEMCDQNPDTRLRMTIALRQHDGRWYVTHEHHSFCMT
108800985YP_641182.1 NUDIX hydrolase [Mycobacterium sp. MCS]MDSIRQVSSREVYRNDWLTLREDDIQRPDGSDGIYAVVDKPNYALVIACD
GDRLKLVEQFRYPLGLRRWEFPQGTAPGRADMEPLDLAARELREETGLRA
GTVTTLGLLDVAPGMSSQRGWVFLATDLTEGDHDREHEEQDMRSAWFTRD
EFERMVADGEITDAQSIAAYGMLLLRERLLG
108800983YP_641180.1 hypothetical protein Mmcs_4019 [Mycobacterium sp. MCS]MGLRFTDLCVDAADIHALGGWWAEVLGYAQEVTDDGDVILRPPSGAGPNI
LFLAVPDEKVVKNRLHVDLTPDDQQAEVDRLLALGARRVDIGQGEQSWVV
LADPEGNEFCVLAAQS
108800981YP_641178.1 hypothetical protein Mmcs_4017 [Mycobacterium sp. MCS]MVGDQEAIDAVLNRLRRAQGQLGGVISMIEQGRDCKDVVTQLAAVSRALD
RAGFKIVATGLRECVAGEGADGRDPMSVAELEKLFLALA
108800979YP_641176.1 hypothetical protein Mmcs_4015 [Mycobacterium sp. MCS]MAVAIGLGLGALIGVLLGLLGGGGSILAVPALVYGMGLGIEQAIPISLIV
VATASAVGALPKIRAGQVQWRLAGIFAAAGIPATVAGSAISRHLPQPALM
IGFAAVMVFAGIRMLTDQENTGTACEVEAGRVNWRRCAPRSIGAGLLVGL
LTGLFGVGGGFLIIPALVVVLGVEMSVAVGTSLLIITANSVAGIFSHLGA
ITVDWTVIAVFVAAAMAASLVAGHLGTKVDTTRLQRWFAYLVFAVAAYVI
VDTVFLQ
108800977YP_641174.1 putative transferase [Mycobacterium sp. MCS]MTSAAGIGLATIAADGTVLDTWYPAPELGADLGESGTVRLSVAEVPAELG
ELTGRDEDRDVDIVVVRTVISSLEDKPADGYDAYLRLHLLSHRLIQPRGA
NLDGVFGVLANVVWTNFGPCAVEGFETVRARLRRRGTVTVFGIDKFPRMV
DYVTPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGSSMVEGRI
SAGVVVDDGSDVGGGASIMGTLSGGGKEVISVGKRCLLGANAGLGISLGD
DCVVEAGLYVTAGTKVQTSDGQTVKARDLSGANNLLFRRNSVSGAVEVVR
RDGTGVTLNEALHAN
108800975YP_641172.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSSIVCSSLSFAWPDGTTVFSELTASFGDGRTGLVAPNGAGKSTLLRLIA
GELSPSAGTVSVTGTLGHLPQTLPLAADLTVADVLGVAPVIAALNALAEG
DAGDDVFTAIGDDWDAEECARAQLDRLGLAHVALDRRLETLSGGEIVSVG
LAAKLLERPDVLLLDEPTNNLDADARNALYAALDDFAGTLLLVSHDRVLL
DRMDRIAELSRGEIVFYGGNFTAYREAVAAEQQAAESDLRNAEQQLKREK
RQMQEARERAGRRSNTAVRNLADAGLPKILAGARKRRAQESAGRADDVHA
RRVGDARVRVEDAERSLRDDDAIALDLPDTEVPAGRNLFAGHGLRIARGG
RELFADNGIDLSLRGPERAALTGPNGAGKSTLLRIIAGAVEPDAGAVQRA
DGRTAYISQRLDLLDDDLSVAENLARFAPDMTVTRSRHLLAQFLFRGDRI
HLPVSVLSGGERLRATLACVLYGEPAPQLLLLDEPTNNLDLVSVGQLESA
LDAYRGAFVVVSHDERFLAQIGVDRWLRLADGVLVER
108800973YP_641170.1 ATPase [Mycobacterium sp. MCS]MPVDWVVAPHEPALESIEAGVRTRSGAVVIGPAGVGKTTLLRAAAERLGP
GGSVTGTAFDAAIPFGAFRRLIDIPATGKTAAIVRAAREKLRDQVLYVDD
AHLLDPLSATLLYQLGLTGTASLVVSVAAGTPVPAPLAALWEDDLLARID
LQPPGHDDTRVAAQVESFIADLPAPARHALEYLAVCDPLPAAELRALAGD
EAVVAATAAGAVAVEGDVVHAGHPLFVDAVRDRIGGPDLRRLRTEVVARL
WAARPTGVLERLQVAAMALDCDHDVPAAELTAAAEEALRLGDLRLSERLA
RAALQDSGELRARLALGYALGWQGRGREADEVLAAVDEAALDEGDLMAWA
LPCAANRFWMLSEPERATAFLRTVRNQVVNPAARTTIDALSSTFAMNAGT
PARAVEIASEVLDSADADDTAIGWAAAAAALSCARMGRFLEVDALAERAA
AADHPGLLRFTTGFGQTTALMMSGELDRAQELARRITEFAELQQPGRAIG
EVLIADVLIARGDVDGAAALLRDAAAALAPTGYSWGPLAWMLLAQALGER
GAAVEAGKALARAESRHGLKSMLFAPELGLGRAWTMSARRDTHGAVAAAR
DAARTAERGGQLAVALRALHVAVRLGDARAADHMARLGVDCEFGRIALLH
ARAFTAADPVGLDEAAGAFAAIGLQGSAADAERQADAVRA
108800971YP_641168.1 long-chain-acyl-CoA synthetase [Mycobacterium sp. MCS]MSDEKSGTRSSVGLLDIAARLPGFLMDVPTILGGVVTGFGARPSAKTSIG
KVFQERAAKYADKTFLRFEDHDISYREANETVNRYAAVLADRGVGRGDVV
AIMLRNSPEPVLLMLAAVKCGAISGMLNFHQRGDVLKHSLGLLSAKVVIA
DPDFVDPIKECGADTDGLLTIEEFEELAEGAPTDDPESASAVLAKDKAFY
IFTSGTTGMPKASVMTHYRWLRALAGFGGLGVRLSSKDTMYCCLPLYHNN
ALTVALSSVLNSGATLALGKSFSASKFWDDVIRYDATAFVYIGEICTYLL
NQPKKDTDRKHKVRVIAGNGLRPAIWDEFTNRFGIDRVCEFYAASEGNTA
FVNALNVDKTTGMCPTPVAFVEYDGDSGDPVRDEKGRVKKVRTGEPGLLL
SKVSNFQPFDGYTDEKESEKKLVRDAFKDGDVWFNTGDLMRYQGLGHAAF
VDRLGDTFRWKGENVATTEVEAALSLDPTVDECTVYGVEVEGAGGRAGMA
AIKLNEGCDFDGKTLAQTLYDRLPSYAVPLFVRVVGELEHTSTFKSLKVD
LRKEGHGSHIEDPLYVLKSRDEGYVEYYDEYAEEVKEGKKPK
108800969YP_641166.1 putative glucosyl-3-phosphoglycerate synthase [Mycobacterium sp. MCS]MTVISRLPELETPELHSADAIARHRWFDTHSWNRPTWTIAELEAAKAGRT
VSVVLPALNEEETVAGVIETITPLLGGLVDELIVLDSGSTDDTAIRALAA
GARVVSRETALPEVAPQPGKGEVLWRSLAATTGDVIAFVDSDLLDPDPMF
VPKLLGPLLLTPGVHLVKGFYRRPLKVSGREDANGGGRVTELVARPLLAS
LRPELTCLLQPLGGEYAGTRELLTSVPFAPGYGVEIGLVVDTYDRLGLDG
IAQVNLGVRTHRNRPLTELASMSRQVIATLMSRVGVGDSGVGLTQFFADG
EGFTPRASGVSLEDRPPMATLRPLSAGAKSRQSR
108800967YP_641164.1 DNA-3-methyladenine glycosylase I [Mycobacterium sp. MCS]MTVAEQRVVDDGRVRCGWLDGSRLAAADFELYRDYHDFEWGQPVLESPAL
FERISLEAFQSGLSWLIILRKRENFRRAFDGFDIDRVAGYTDRDVERLMA
DTGIVRNRAKIEATIANARAAAALSDAGVDLAQLLWSFAPARRGRPAGLS
EVPAVTPESTAMAKELKRRGFRFVGPTTAYALMQATGMVDDHIATCWVPP
AVEVPRHSG
108800965YP_641162.1 glycogen synthase [Mycobacterium sp. MCS]MTREYPPEVYGGAGVHVTELVAQLRRLCEVDVHCMGAPRADAFVAAPDPA
LAGANPALSTLSADLNMVNAAGGATVVHSHTWYAGLAGHLSSLLYGIPHV
LTAHSLEPMRPWKAEQLGGGYRVSSWVEKTAVEAADAVIAVSSGMRDDVL
KTYPALDPARVHVVRNGIDTDVWYPSQPQSGESVLAELGVDPGRPIVAFV
GRITRQKGVAHLVAAAHHFAPEVQLVLCAGAPDTPEIAAEVTSAVQQLAR
ARTGVFWVREMLPIGKIREILSAATVFVCPSVYEPLGIVNLEAMACGTAV
VASDVGGIPEVVADHQTGLLVHYDAADTGFFETRLADAVNSLIAEPQRAR
AYGAAGRERCIAEFSWAHIAEQTMEIYRKVSG
108800963YP_641160.1 isoprenylcysteine carboxyl methyltransferase [Mycobacterium sp. MCS]MKILAQTAVSGVVGLVFFGVLLFGPAGTFDYWQAWVFIAVFVVTTLVPSS
WLAVHDPEALRRRMKAGPTAETRPVQRFAMTGSVAVSVAVAVVSAFDHRF
GWSEVPVAVVIAGNLAVLLGLGAAEFVVIQNRYAAATVTVEAGQPVVSTG
LYAVVRHPMYAGALVMMAGMPLALGSYWGLVPMLAGVPVLAVRILDEEKL
LAAELAGYREYAQSVRYRLIPGLW
108800961YP_641158.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTVQTSRSPRRPEGTTPPAVEIRGLVKTFGRTRALDGLDMSVSPGDIAGF
LGPNGSGKSTTIRVLLGLLRADAGTVRLLGGDPWRDAVDLHRRIAYVPGD
VTLWPNLTGLQAIDFLARLRGPDALDIRRRDELIERFELDPHKKARTYSK
GNRQKVALVAAFSTGADLYILDEPTSGLDPLMEKAFQHCVQEVAGDGAAV
LLSSHILAEVEKLCDTVTIIRAGRTVRSGPLDELRHLMRTTVNVRTRDDA
AALRDAPFVHEFTAVDGGARFAVDRADLDAAMARLTELGITELTVTPASL
EDMFLREYSGAGR
108800959YP_641156.1 O-methyltransferase family protein [Mycobacterium sp. MCS]MPCGRVADPRLAAALYSAGMASTDDPAGQRPSRAEAIVAHAEQSISEDAI
VAAARERAVDMGAGAVTPAVGALLSVLARLTEAKAVVEVGTGAGVSGLWL
LSGMREDGVLTTIDVEPEHQRIAKQAFTEAGIGPGRTRLISGRAQDVLTR
LADESYDLVFIDADPVDQPQFVVEGVRLLRSGGAIVVHRAALGGRAGDAG
ANDAEVSAVREAARLIAEDERLTPVLIPLGDGLLAAARD
108800957YP_641154.1 hypothetical protein Mmcs_3993 [Mycobacterium sp. MCS]MVDPGHVFRRAFSWLPAQFASQSNAPVGAPRQFGSTEHLSIEAVAAFVDG
ELSMTAHMRAASHLSLCPQCAAEVDAQSQARSALRDSQPIAIPNTLLGML
SQIPQHMPHSPVEEADQPKFADDQTRDRRRRR
108800955YP_641152.1 sec-independent translocase [Mycobacterium sp. MCS]MFANIGWGEMLILVIAGLVILGPERLPGAIRWTSNALRQARDYVSGATTQ
LRQDFGPEFEDLREPITELQKLRGMTPRAALTKHLLDGDDSFFTGKFDQQ
NGKPAAGQEKPVTPVNPPVTATPPSESTATPFDSDAT
108800953YP_641150.1 hypothetical protein Mmcs_3989 [Mycobacterium sp. MCS]MAAARRRAGKALRKPAAGVFILAPLVLAGAVGATSPALQHSVSNAAVTPL
AAVETSPRNSAGPSVVAVKKSPSAFRIAASTVSSPPPAVVVNSPGSLKIP
AMALSAYRNAERMMAAAVPNCGVSWNLLAGIGRIESGHASGGATDSRGTA
VTPIYGPALDGTLAGNEVIELSRSANRVTYARAMGPMQFLPGTWARYASD
GDGDGRADVQNLYDSTLAAARYLCSGGLNLRDPSQVMSAILRYNNSVAYA
RNVLSWAGGYATGVVPVDLPPINGPVPAMGDSHLEANKGLGPGAPVNATG
LPADDPLALVPLLSRNDASRMPGTNVPGFAPGQRLGPLPGPAPEAPASTA
PAPTAPAPWVPPWMAPPPAPQPSCVVFCLEDAPAPAAAPAPGPVPPAAPA
PGPALPGPPAAPAPGPVPPPAPAAPAAPLPGPAPTGPAPGPLA
108800951YP_641148.1 MgtE integral membrane protein [Mycobacterium sp. MCS]MVVLGPDGESIGRVRDVVISISIVRQQPRVLGLVVELLTRRRIFVPILRV
TAIEPSAVTLTTANVSLRKFVQRPGEVLVVGQVLETRVRVDDPDLSQLAG
IDVVVVDLGIEQSRTRDWLVTRVAVRTQRRLGRRSNIHVVEWAHVQGLTP
SGLAMPDQGVASLLEQFEGQRPVEVAEAIRELPAKRRYEVVNALDDERLA
DVLQELPMDDQADVLRQMKTDRAADVLEAMDPDDAADLLGSMTPADAETL
LRRMDPEDSEDVRRLLSHSPDTAGGLMTSEPVVLAPDVTVAEALARVRDP
DLTPALASLAFVARPPTATPTGHYLGCVHLQRLLREPPATLVSGILDTDL
PSLSPQDSLGAVTRYFAAYNLVCGPVVDEENHLLGAVSVDDVLDHLLPDD
WRERVTEPELTGTEGNS
108800949YP_641146.1 hypothetical protein Mmcs_3985 [Mycobacterium sp. MCS]MTNPERDPEPSSAAEPGASGSEPPAGGYETPAYGEQPSYPPPPPGFEQPG
YQPPQYQQPDYQQPQYQQPQYPPPPPGYQPYGSYGSPYDAPAGYPPPPPP
GYPPYAGGYGAGPKTNALAIWSLVASLIGFVCCLGSVAGIALGLVSLNQI
KQNQEEGQGLAIAGIAVGAVSLLAGLVMAVVLMGA
108800947YP_641144.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MRARRLCAAAVTALTTASMVSACGSGGGGLVINYYTPANEAATFTAVANR
CNEELGGRFRIEQRNLPKGADDQRLQLARRLTGNDTSLDVMALDVVWTAE
FAEAGWALPLSDDPAGLAEADATANTLPGPLETAKWQDKLYAAPITTNTQ
LLWYRADLIPQPPTTWDGMVAEATRLHAAGGPSWIAVQGKQYEGLMVWFN
TLLESAGGQVLSDDGERVTLTDTPEHRAATVKALQIIKSVATAPGADPSI
TQTDETTARLALEQGKAALEVNWPYVLPSLLENAVKGGVPFLPLNQDPSL
TGAINDVGSFSPSDEQFRTAFDASRPVFGFAPYPGVQPGDPARVTLGGLN
LAVARTTQHRAEAFEAIRCLRNVENQRYTSVEGGLPAVRASLYDDPAFQA
KYPQYEIIRDQLTNAAVRPASPVYQAMSTRITVTLAPISDIDPERTADEL
TEQVQKAIDGKGLIP
108800945YP_641142.1 binding-protein-dependent transport system inner membrane protein [MycMNERVTAGRASGWAVVNILVVIYALLPVLWILSLSLKPTSSVKDGKLIPT
EITFDNYKGIFQGNAFTSALINSIGIGLITTVIAVVVGGMAAYAVARLTF
PGKRLLVGVALLIAMFPQISLVTPLFNIERSIGLFDTWPGLIIPYITFAL
PLAIYTLSAFFREIPWDLEKAAKMDGATPAQAFRKVIAPLAAPGIVTAAI
LVFIFAWNDLLLALSLTATQRAITAPVAIANFTGSSQFEEPTGSIAAGAM
VITIPIIVFVLIFQRRIVAGLTSGAVKG
108800943YP_641140.1 hypothetical protein Mmcs_3979 [Mycobacterium sp. MCS]MTDVLTAVRAHLGEHFRRAGITAEPAAASVTFLGTERIEVLRYGPGDDGV
AHYVSLGCSRHPMFDPTELVTDAIHGPRAEVVVALRGPTPTGLARSVAVL
AAAPAVEGLVLEAGALIDLETPLWEQSPFTAFLLGDSEIDDVPLPGPLPA
VTVFSATPITPTEAAWVRLKGADAMREAWTADGVDVLDPHRRAASPS
108800941YP_641138.1 malate dehydrogenase [Mycobacterium sp. MCS]MAETVVGSSQVVISDDEIFAAHEGGKLAVQLNEPLDTQRALSIAYTPGVA
QVSRAIAKDPALAARYTWANRLVAVVSDGSAVLGLGDIGAAASLPVMEGK
SALFKTFGGLDSIPIVLDTKDPDEIVETLVRLRPTFGAVNLEDISAPRCF
EIERRVIEALDCPVMHDDQHGTAIVVLAALMGAARVLGRDAATLRVVISG
AGAAGVACANILLAAGISDVTVLDSKGIVHSGRDDLNSFKAELAERTNPA
GRTGGVAEALDGADMFLGLSAGVVAEELIATMAPGGIVFALSNPDPEIHP
DLARKYAAVVATGRSDFPNQINNVLAFPGVFRGALDAGARRITERMKVAA
AEAIFSVVGDDLAVDHIVPSALDPRVAPAVAAAVGAASQVG
108800939YP_641136.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MQGFAGKVAVVTGAGSGIGQALAIELARSGASVAISDVNLEGLAVTEERI
KAIGAPVKCDRLDVTEREAFLLYADEVKEHFGKVNQIYNNAGIAFTGDIE
ISQFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVVNVSSVFGLFAVP
GQGAYNAAKFAVRGFTEALNQEMTAAGHPVKVTTVHPGGIKTAIARNATA
AEGLDPEELAKLFDKKLANTTPERAAQVILDGVRKNKARVLIGTDAKVLD
AVIRVVGPHYQRLFTSVTSKLLPRPH
108800937YP_641134.1 alpha-ketoglutarate decarboxylase [Mycobacterium sp. MCS]MSSSPSPFGQNEWLVEEMYRKFREDPSSVDPSWHEFLVDYNPEPTTDSSA
SENGQQTRTAAPKAPPEPAPAPAPKTPDSKTPDSKSQAPKQDSKPQESKP
QAKAKPAESKSSTKPADAKSEKSGKSGTNGAAKPAAQPADDSDQNQVLRG
AAAAVAKNMSASLDVPTATSVRAIPAKLMIDNRVVINNHLKRTRGGKISF
THLIGYAIVAAVKKFPNMNRHFAEVDGKPNAVTPAHTNLGLAIDLQGKDG
NRQLVVAAIKKADTMRFGQFIAAYEDIVRRARDGKLTAEDFSGVTISLTN
PGTIGTVHSVPRLMRGQGAIIGVGAMEYPAEFQGASEERIADLGIGKLIT
LTSTYDHRIIQGAESGDFLRTVHQLLLSDDFFDEIFRELGIPYEPVRWRT
DNPDSIEDKNARVIELIAAYRNRGHLMADIDPLRLDSNRFRSHPDLDVLT
HGLTLWDLDREFKVNGFAGAERKKLRDVLAVLRDAYCRHIGVEYTHILEP
EQQQWLQERIEGKHEKPTVAQQKYILSRLNAAEAFETFLQTKYVGQKRFS
LEGAETVIPAMDAVIDQCAEHALDEVVIGMPHRGRLNVLANIVGKPYSQI
FSEFEGNLNPSQAHGSGDVKYHLGSSGTYLQMFGDNDITVSLTANPSHLE
AVDPVMEGLVRAKQDLLDKGDTEDGYTVVPLMLHGDAAFAGQGVVAETLN
LALLRGYRTGGTIHLIVNNQIGFTTSPAAAKSSEYCTDVAKMIGAPIFHV
NGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQPS
MYDVIDTKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLEQVFNEVRE
LEKHEIEPSESVEADQQIPAKLATAVDKSLLARIGDAHLAVPEGFTVHPR
VKPVLEKRREMAYEGKVDWAFAELLALGTMISEGKLVRLSGQDTRRGTFT
QRHSVVIDRKTGKEFTPLQLLATDSDGNPTGGKFLVYDSPLSEFAAVGFE
YGYSVGNPDAMVLWEAQFGDFINGAQSIIDEFISSGEAKWGQLSDVVLLL
PHGHEGQGPDHTSGRIERFLQLWAEGSMTIALPSTPANYFHLLRRHSLDG
IQRPLIVFTPKSMLRNKAAVSDIRDFTEQKFRSVLEEPTYTDGDGDRNKV
TRILLTSGKIYYELVARKNKESRDDVAIVRIEQLAPLPKRRLAETLDKYP
NVEEKFWVQEEPANQGAWPTFGLTLPEMLPDHFTGIKRISRRAMSAPSSG
SSKVHAVEQQEILDEAFAP
108800935YP_641132.1 Bcr/CflA subfamily drug resistance transporter [Mycobacterium sp. MCS]MATSPHVDENPALSAPVPVAPSRARMIVVLGALVALGPLTIDMYLPALPS
IADELSVSSSVAQLTLTGTLAGLALGQLLVGALSDSLGRRRPLMAGIVLH
MLASVLCMLAPDITVLGVARGLQGMGAAAATVVAIAVVGDLFSGTAAATV
MSRLMLVLGVAPVLAPSLGAAVLLHASWQWVFAALVVLAGGLLLVAALVL
PETLPVAHRRPLKVRGIADTYASLLRDPRFVVLVLVAALGMSGLFAYIAG
AAFVLQGDYGLDQQTFALVFGAGAVALIGTTQFNVVLLRRFAPQQIMVWA
LAVASLAGVVFVGLTVAHIGGLTGFLVSVWTILAAMGLVLPNAPAVALSR
HNEAAGTAAALLGAGQFGLGAAVAPLVGVLGNDEFALALVMTVGTVVALV
ALMAVGLRGNREDSDNPDEVTDDAVEVADGALASAAEPA
108800933YP_641130.1 recombinase B [Mycobacterium sp. MCS]MFVESVGAHDEVIYSASDLAAAARCEYALLRSFDARLGWGPSVATEDELL
ARTADLGDEHEKRHLDTLRTDSDHNVTVIGRPPYTVAGLTAAAEATTRAV
ARRAPVIYQAAMFDGRFAGFADFLILEGDRYLLRDTKLARSVKVEALLQL
AAYAEALTAAGVPVADEVELVLGDGATARYPLEELLPVYRPRRAALQRLL
DDHLAGGTPVRWEDETVRACFRCPECSIEVRAQDDLLLVAGMRVSQRARF
HEAGITTVAELAAHQGPVPELPARTVTALSAQARLQTAPRVDGKPPYEVA
DPQPLMLLPEPDKGDLFFDFEGDPLWTDDGHEWGLEYLFGVLDTADGFHP
LWAHDRPQERKALEDFLELVRKRRKRHPNMHIYHYAAYEKTALLRLAGRY
GVGEDAVDDLLRSGVLVDLYPLVRKSFRIGTENYSLKSLEPLYMGGQLRT
GDVTTAAASITEYARYCELRAEGRDDDAAVVLKDIEDYNRYDCTSTRKLR
DWLVCRAIDCEVPPRGPQPVRDGAEPEPVDALDRTLCRYAGDELEGRTPE
QSAVAMVAAARGYHRREDKPFWWSHFDRLNNPVDEWADSTDVFLVDPGGA
QVEVDWHTPPRARKPQRRIRLSGVMAAGGLSRDMYALYEPPAPAGLGDDP
DRRAAGSVTVVECNAPDVPTEVVVVERTPRDGGVFDQLPFALAPGQPIRT
TALRESIEATAADLAERLPRLPETAVTDILLRRPPRTRSGAPLPTGPDVS
AAITAALLDLDSSYLAVHGPPGTGKTFTAAAIIATLVNTHGWRIGVVAQS
HAVVENLFRGVIDAGVDAARVAKKRGHGDDANWTVLEEAGFPGFVADHDG
CVIGGTAWDFANGNRIPRGCLDLLVIEEAGQFCLANTIAVAPAAANLLLL
GDPQQLPQVSQGTHPEPVDASALGWLVDGAHTLPAERGYFLDVSWRMHPA
VCAAVSRLSYDGRLQSNDAVTTARTLEGWSPGVHEVTVPHDGNATESPEE
ADAIVTRIGRLLGSVWTDENGSRPLAQDDVMVVTPYNAQVVLLRQRLDAA
RLTDVRVGTVDKFQGQQAPVVFISMVASSIDDVPRGISFLLNRNRLNVAI
SRAKYAAVIVRSEALTEYLPSTPKGLVELGAFLSLSQSPSRRE
108800931YP_641128.1 DEAD/DEAH box helicase [Mycobacterium sp. MCS]MTSPEPDAPGTETTFADLQIHPEVLRAVTDVGYETPSAIQAATIPAMLAG
SDVVGLAQTGTGKTAAFAIPILSKIDPNSRATQALVLAPTRELALQVAEA
FGRYGAHLPVNVLPVYGGSSYGPQMAGLKRGAQVVVGTPGRVIDHLEKGS
LDLSHLDYMVLDEADEMLQMGFAEDVERILSDTPEYKQVALFSATMPPGI
KKITKKYLHDPVEVTVKSKTQTAENITQRYIQVSYPRKMDALTRLLETEQ
GDGMIVFVRTKQATEEVAEKLRARGFAAAAINGDIPQAVRERTISQLKDG
SIDILVATDVAARGLDVERISHVVNFDIPHDPESYVHRIGRTGRAGRSGT
ALLFVTPRERHLLNSIERVTRQKLVEIQLPSVEDVNAQRVEKFRDSIGEA
LNAPGIDLFRRLIEDYERDNNVPLADIAAALAVQSRNGEEFLMTEPPPEK
RRERPVRDESGPRKARDRTRSDLATYRIAVGKRHKVMPGAIVGAIANEGG
LNRSDFGHIAIKPEYSLVELPADLPKDTLKKLERTRIQGVLINLEPDRGP
KARYKGK
108800929YP_641126.1 siderophore-interacting protein [Mycobacterium sp. MCS]MADRKPSRGFSGAVLKLMRAGDYTFTVTGKREIGPYYLRLSFTAGGMLAE
HAPHPTQWVRVWFADGDKQHQRGYTLVNPDPSGDTVDIEFALHDGVASQW
ARDARPGDTLEITVLGSNFALPVPRPAGYVIVGDTASLPAINSLLAAIGD
APAQVFLEAGHEEDKQLPVARTSDVTWVDRKNAGEALIETVAAAAFDAAD
HFGWVACDNRTTRAVSKVFREDYKIPKKAIKAQAYWQV
108800927YP_641124.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MLADRILDAAERLFTERDAASVGMKDVAEAAGCSRATLYRHFDSRDTLHT
AYVHREAQRLYRTLTEHLDGVSDPAERLIEGTLLTLRSVREKPALASWFA
PTARPIGGEWAERSEVVRAMVEAFVRSLGDSGDVERRARWLVRVLTSLLL
FPGGDEGEERAMLSEFLVPAMIGVAAGGLITAATSRCSACPPR
108800925YP_641122.1 D-lactate dehydrogenase [Mycobacterium sp. MCS]MADVNSALAELIADLSDGVVVTDPDIVASYRQDRAADPSAGTALAVVRPT
RTEEVQTVLRWASAHKVAVVPRGMGTGLSGGATALDGAIVLSTEKMRDIT
VDPVTRTAVAQPGLLNAEVKKAVAEYGLWYPPDPSSYEICSIGGNVATNA
GGLCCVKYGVTTDYVLGLQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGS
EGTLGVITEVTLRLLPPQPSPCTVVATFDSVEAAAGAVVTITGRIRPSML
EFMDAVAINAVEDKLRMGLDRNAAAMMVAASDDRGAAGAEDAEFMAKVFT
EAGATEVFSTSDPDEGEAFVAARRFAIPAVEAKGALLLEDVGVPVPRLAD
LCAGIEKIAADRDVMISVIAHAGDGNTHPLIVFDPADAAMAERAETAFGE
IMDLAVGLGGTITGEHGVGRLKRPWLAGQIGPEAMELNRRIKQALDPDAI
LNPGAAF
108800923YP_641120.1 HxlR family transcriptional regulator [Mycobacterium sp. MCS]MSRSYGQHCALAKSLDLVGDRWTLLIVRELLDRPRRYGDLLNSLTPIATD
MLAGRLRDLERNGLVVKRELPKPGSGNVYDLTDDGRALEDVINAFVRWGR
HLLFTRTPTDLVRPEWLARAVRAYVRDDRTGPDLVLRLATPQGGATILIG
TRRVELVGDEVAPDVVLTGEVDVLAAATDPARVDELVAAGRLHVAGAPEA
VRQLAEVFTPPRVRL
108800921YP_641118.1 uracil-DNA glycosylase superfamily protein [Mycobacterium sp. MCS]MQSPHPRTGVPFSSPVPPGTGWPGDPATPATAVAASAAAVESLAAAVGSL
DELDALVSVCRACPRLVEWREEAATVKRKSFVDQPYWGRPAPGWGDTHPR
IMVVGLAPAAHGANRTGRVFTGDRSGDFLFAALHRAGLANQSLCVDAADG
LSLNDVRVAAAVRCAPPANAPTPAERATCAPWLDAEWRLVSGDVRVVIAL
GGFAWKAALHMLRRGGASVPVPAPQFGHLAEAAIDGVTLMGCYHPSQQNT
FTGKLTPAMMDAVFIRARELAGR
108800919YP_641116.1 hypothetical protein Mmcs_3955 [Mycobacterium sp. MCS]MSHLTSLEQVGARLLKLHDLLYKKTNGRIGHHFPGAPPSLLLHTVGAKTG
QARSNTLSYARDGEDYLIVASLGGAPRSPGWYHNLKANPDVEINLGTKRF
AVTAHPVLPDDPDYARFWKIVNDNNSNRYDAYQKRTTRPIPIVKLTP
108800917YP_641114.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSVSPIPEGYTSLTPFLVIDGAAAAIDFYTSVFGATLVERMDGSDGSVAH
AELDFGDGRLQLSDPNADYGLEAPPRGESVTHSMVLYCTDVDGVVARAEA
AGATVREAVQTFVTGDRFGSIVDPFGQRWAVMTRVEDVSAAERDRRLADW
ARENV
108800915YP_641112.1 hypothetical protein Mmcs_3951 [Mycobacterium sp. MCS]MNKFGFATIIAGGLATGFLAFAAPAQAAPSGTGNAADTISSLDDRGYQVR
VTQQGMNKPLDQSSIVSVRYDNDDRVVYVTTR
108800913YP_641110.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MTEARDTEDIEGLLVGLTGTARSERAELIEWLLGRGFTMAEVHEAIAPML
LASRRHVGDDGVYVSARETSEKFGIDLDLLQRVQRAMGLSREDDPDAVVH
LRADAEAAARAQRFIDFGLDPDQVVQVVRVLSEGLAKAAEVMRYTAFAAV
LTPGATELQIAKKSEALVRELAPMLGPMVEDMLLLQLRHAMETEAVSATE
RAEGLPLPGAREVTVMFADLVGFTRLGEAVPPEKLEQLARRLGDLARELA
VAPVRFVKTIGDAVMLVSTDPAALLEAALALLDAATSDAEFPRLRVGLAV
GQAVSRAGDWFGSPVNLASRVTGAARPGTVLVSESVREAVGDDERFSWSY
AGARHLKGIRGEVKLFRARRPGG
108800911YP_641108.1 heavy metal transport/detoxification protein [Mycobacterium sp. MCS]MSLKLEVEGMSCAHCVASITKAVQPLPGVADVSVDLEAAAVTVTGEPDQA
AVVAAIEDCGYDVRPAA
108800909YP_641106.1 hypothetical protein Mmcs_3945 [Mycobacterium sp. MCS]MTGQWLPDPDGRHEFRWWDGQRWTDQVSSRGQVTQAPMAGTPAQAPAGGD
GFAGISGDLVDGRFSEKEATPIANQNTKMLRVRLGEPFMARQGAMVAYQG
NVDFSFEGGGASKFLKKALTGEGLPLMRCQGQGDVFLAERAYDVHLLKLT
NSGLSISGKNVLAFSAGLDWNIERVRGGSIATGGLFNTTLRGSGWVALTT
DGPPVVLDAAEAPTFADTNAVVAWSANLQTQLKASFKAGALIGRGSGEAL
QVAFHGQGFVIVQPSEGIQVPTQ
108800907YP_641104.1 hypothetical protein Mmcs_3943 [Mycobacterium sp. MCS]MVNTPPPAVQRCNHVIMKTHHHRRPGRAGGWQQAEQPDASDAADWFAGRL
PDGWFAGDPTVVVDREEITVIGRLPEPAEQESEARASGRAARFREQTRPE
RMQIADEAEARYGRKVAWGVEIGSGADAERILFTHIAVPVMTRLRQPERQ
VLDTLVDAGVARSRSDALAWSVRLVGQHADEWLAQLRDAMAKVDDLRAEG
PQL
108800905YP_641102.1 ABC transporter- transmembrane region [Mycobacterium sp. MCS]MGGPMRGLPQAPAERTRDFKGSALRLVRRLTPQRTLTASVIGLGVAGIAL
GVLGPRILGHATDLLFNGVIGRQLPAGLTKEQAVEAARARGDSTFADLLS
GMAVVPGQGVDFGAVARTLALALGLYLVAALLVWIQARLLNVVVQRTMVR
LRADVEDKVHRLPLSYFDTRQRGEVLSRVTNDVDNIQTSLTITISQLLTS
VLTIVAVLVMMLTISPLLALLTVLTVPLSLLAIRWITRRSQRLFVAQWRN
TGRLNAHIEETYSGFTIVKTFGHRAAAQEKFRGLNDEVYQSSFGAQFFSG
LVSPATGFIGNLSYVAVAVVGGLQVAGGQITLGNIQAFIQYVRQFNQPLG
QVAGMYNTLQSGIASAERVFDLLDAEEESADPMRDLPASGRTGPGRVEFD
HVHFAYTAGTPVIEDLSLVAEPGSTVAIVGPTGAGKTTLVNLLMRFYDVD
SGRILIDGVDIAAVSRHSLRSRIGMVLQDTWLFAGTIYDNIAYGRPDATE
DEVIEAAKTAHVDRFVHTLPDGYATNVSDDGGSISAGEKQLITIARAVLA
QPQLLVLDEATSSVDTRTELLIQQAMAELRRDRTSFIIAHRLSTIRDADL
ILVMEAGRIVERGTHEELVASRGEYWSMTQV
108800903YP_641100.1 putative lipoprotein LprB [Mycobacterium sp. MCS]MHGVNPSTRTTGRTRHAKALAALAAAALPLLAACSSDSEPAAPGESPQST
QAQQDIKHGPFFPQCGGISDQTMSQLTEVPGLVNTATTSVGCQWLAGGSI
VGPHFSFTHFRGSPIGRERKTEELSRTSVEDINIEGHDGFIATGDDLALG
TNLCEIGIQFDNDFIEWSVSFAEKPFPDPCEVAKELTRQSIVNSR
108800901YP_641098.1 integrase catalytic subunit [Mycobacterium sp. MCS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGLIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALGGLPPISRLTPTS
108800899YP_641096.1 metallophosphoesterase [Mycobacterium sp. MCS]MRFVHTADWQLGMTRHFLNGEAQPRYSAARREAVVAVGALAAEVKAEFVV
VAGDVFEHNQLSPREVGQSLEAMRTIGVPVYLLPGNHDPLDASSVYTSAL
FTAECPDNVTVLDRAGVHPVRPGLELVAAPWRSKAPTSDLVGDVLAGLPA
DGVTRIVVGHGAVDLIDPGKDKAALIRLAAVEAALARGAVHYVALGDKHS
RTDVGATGRVWYSGSPEVTNYDDIETDSGHALVVDIDEDDARRPVRVRPE
RLGRWRFVTLTRSVDNGRDVADLDLNLDLMPDKERTVVRLGLTGSLTVTD
KAALDDCLLKYSRLFAALTEWERSTDIAVLPAEGEFDDLGIGGFAAAAVD
ELVEAARADGDRAEDARAALALLLRLVERSDVA
108800897YP_641094.1 hypothetical protein Mmcs_3933 [Mycobacterium sp. MCS]MSSGDKVSSGDNASPGDNGAPLQQRVTDLLATVGAALGDLAQKARDAVEG
AAGRVGIGSSSDDAGGPAALPSGAKAATGSGRAAPIEVPAKKTPAKKTAA
KTAPAKKTAPAKKAPVKKAPVKKTAVKATPAKTEAANMAPVKKTPAKKTP
AKKAVEPAKAAAAKKTPAKKTPAKKAPAKKAVKRPGNPT
108800895YP_641092.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MTLRRLISAALVATLTLAACSSGDEETPSAGGSAEVGATNDVNPQDVSNL
RQGGNLRLALTAFPANFNSLHIDGNVADAAGMLRATMPRAFRIAADGSAT
LNTDYFTGAEITGTDPQVVTWTINPKAVWSDGAPITWEDIAAQVNATSGK
QEGFAFASPNGSDRVASVTRGADDRQAVMTFAKPYAEWRGMLSGNTMLLP
KSMTATPEAFNRGQLDAPGPSAGPFIVSNLDRTAQRITLTRNPKWWGEPP
LLDSITYSVLDDAARIPALQNNALDATGLATLDELTIARRTNGVAIRRAP
GNSWYHFTFNGAPGSILADKALRQAIAKGIDRQTIAAVTQRGLADDPVPL
NNHIFVAGQQGYQDNSGVVAFDPEKAKQELDALGWRLNGQFREKDGRQLV
IRDVLFDALSTRQFGQIAQNNLAQIGVKLELDAKGAAGFFTDYINTGDFD
IAQFSWVGDAFPLSGLTQIYASNGESNFGKIGSPQIDAKIEEALEELDPA
KAQQKANEVDKLLWDEVFSLPLTQSPGNVAVRANLANFGAFGLADADYSK
IGFVK
108800893YP_641090.1 binding-protein-dependent transport system inner membrane protein [MycMMSDSTSTTARSGLDTSRFASRRTLVTRRFLRNKPAVGALALLVLMFAGC
YLLPPLLPYSYTDLDYYALQQPPTTEHWFGTNALGQDLLAQTLRGMQKSM
LIGVAVAFISTIIAATVGSIAGYFGGWRDRTLMWLVDLLLVVPSFILIAI
VTPRTKESGTILWLILLLAAFSWMISSRIVRGLTMSLRDREFVVAARYMG
VPHWRIIVRHIVPNVASILIIDTALNVGLAVLAETGLSFLGFGVQRPDVS
LGTLIADGTGSVTTFPWVFLFPAGVLVLIILCANLIGDGLRDALDPGIRP
ARKGRKT
108800891YP_641088.1 hypothetical protein Mmcs_3927 [Mycobacterium sp. MCS]MSTDQVWGSPGDGRWSLRETAAAIAAAAVIAALGGGAIYAATDEGAGVPG
PGSHQPFGPPPGGFGGPGAPPPPQP
108800889YP_641086.1 sensor signal transduction histidine kinase [Mycobacterium sp. MCS]MSSNPPPAEPVGRTRLFSPRTWSLRGRLLATQIVLLALVCAAVGVGTELA
LQRFLVNQLDTQLDETARRSVGLFAFGPPPPPLMLPAPRFPPPPGFPHRR
IIRDDSGPGPAFLNAPGQAARTVGAVVDRGTAVDAGVITADGERVEVSGT
AAGQLAGVPADEVPRTLALDGLGRYRVIALPARGPAEVIVTGLPMSDVDD
TLLTVLVIFCVVAAIALIGATAAGVWIIRRQLAPLSRVSAAAREVADLEL
DRGEVRLPTPIVTVDPASAHTEVGQLGTSLNRMLDRIAGALSARHASETR
VRQFVADASHELRTPLAAIRGYTELAQRHSDALPGDVAHAMNRVESETAR
MTRLVEDMLLLARLDDGRPLEREPVDLSRLVVDAVSDAHAAGPDHVWSLE
LPEEPVVVDGDEARLHQVLGNLLANARVHTPAGTTVVTALAVGADGGAVL
TVTDDGPGIPPSLQPEIFERFARGDSSRSRRGGSTGLGLAIVAAVVKAHS
GTIEVDSAPGRTEFVVRLPGAQLTHREDQSGA
108800887YP_641084.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MVLMTELAVELDADRAGFGPRPDVVEAARAAGVPVLDVVVPVYNEQAALA
ASVRRLHRHLHDHFPFPARITIADNASADATPRIAAQLAAELPDVRVVRL
EEKGRGRALHAVWSQSDAPVLAYMDVDLSTDLAALAPLVASLISGHSDLA
IGTRLSRGSRVVRGAKREFISRCYNLILKSTLAAGFSDAQCGFKAIRADV
ARQLLPYVSDTGWFFDTELLVLAERSGLRIHEVPVDWVDDPDSRVDIVAT
ATADLKGIGRLLRGFANGSIPVQLLADQLAPSRSAAAPRSLLRQAVRFGA
VGVVSTLAYLLLFMLTRGWLGAQAANLIALAVTAVGNTAANRRFTFGVAG
RRGAARHHFEGFIVFAIALGITSGSLALLHSVSAEPHRLVELGVLVAANL
AATVMRFVLLRGWVFHPRRTR
108800885YP_641082.1 carbonic anhydrase [Mycobacterium sp. MCS]MSVTDEYLKNNEEYAKTFTGPLPLPPSKHVAVVACMDARLDVYRVLGLAD
GEAHVIRNAGGVVTDDEIRSLAISQRLLGTKEIILIHHTDCGMLTFTDDE
FKRSIQDETGIKPEWAAESFGDLEEDVRQSIRRIEASPFVTKHESLRGFV
FDVATGRLTEVTV
108800883YP_641080.1 sulfate adenylyltransferase subunit 2 [Mycobacterium sp. MCS]MTAAHVAAPEPGQYELSHLRLLEAEAIHIIREVAAEFERPVLLFSGGKDS
IVMLHLAIKAFAPARLPFPVMHVDTGHNFDEVISTRDRLVAENGVRLVVA
SVQEDIDAGRVVDNGPSRNPLQTITLLRAIRENRFDAAFGGARRDEEKAR
AKERVFSFRDEFGQWDPKAQRPELWNIYNGRHRKGEHIRVFPLSNWTEYD
IWAYIGAEGITLPGIYYAHTRPVFQRDGMLLAVHPYMQPRDDEEVFETSV
RFRTVGDVTCTGCVESTASTVEDIIAETAVSRLTERGATRADDRISEAGM
EDRKREGYF
108800881YP_641078.1 inositol monophosphatase [Mycobacterium sp. MCS]MNDHELAARLATRAGDLLLDVRAEFADTSAEERKAAGDKWSHDFLMAELN
EQRPGDAVLSEEGADDPVRLRSQRVWIVDPLDGTREFSELDRDDWAVHVA
LWQSGELVAGAVALPAQNTTLATPDVAAPRPLDGPPRIVVSRTRPPAIAL
AVRDALGGTLVEMGSAGAKVASIMQGLSDVYVHAGGQYEWDSAAPVAVAR
AAGLHCSRIDGSPLIYNREDPKLPDLVVCRPELAEAVLAVTR
108800879YP_641076.1 BadM/Rrf2 family transcriptional regulator [Mycobacterium sp. MCS]MRMSAKAEYAVRAMVQLATADDGVLVKTDDLAKAQGIPAQFLVDILSDLR
TDRLVRSQRGRDGGYELARPAADISIADVLRCIDGPLASVRDIGLGDLPY
SGPTAALTDVWRALRASMRSVLEQTSLADVASGALPAHVASMAGDYLDQE
RKRGHHHRVDSK
108800877YP_641074.1 general substrate transporter [Mycobacterium sp. MCS]MDSEHDRQDDRPTTADGHPDPGVVKKAIAASAIGNATEWFDYGIYAYGVS
YISAAIFPGEAGRATLLALMTFAVSFLVRPLGGFVWGPLGDRLGRKRVLA
ITIVLMAGATFCVGLVPTYAAIGMWAPFLLVLLRMIQGFSTGGEYGGAAT
FMAEYAPNRRRGLLGSFLEFGTLGGFAIGALLMLGCSLVLGDDQMHDWGW
RLPFLLAAPLGLVGVYLRSRLEDTPVFRELEEKGEAEPQVTAAFRDLLAR
YWRPILKLGGMVVALNVVNYTLLSYMPTYLETQIGLSADQSLLVPIIGML
AMMVFVPFVGLLSDRVGRKPLWWFSLIGLFVAGVPMFLLMGTNLAGAVIG
FAVLGLLYVPQLATISATFPAMFPTQVRYAGFAIAYNVSTSLFGGTAPAV
NEWLTNTTGDVLFPAYYMMAACVIGALALIKVPETARCPINGTVTPGTDE
APDPVPYEKV
108800875YP_641072.1 hypothetical protein Mmcs_3911 [Mycobacterium sp. MCS]MRRQRTKKPSEPRRPPRLEHHRREVREMTKFAATTLFAGAAATAFFGLAA
PAQAAPAGPGNAQNTIEQLDDRGYAVRVNHQGMVKPLDESSIVAVRYDND
DRVVYVTVR
108800873YP_641070.1 two component LuxR family transcriptional regulator [Mycobacterium sp.MIAEDSALLRAGIERILADAGHEVVAGVPDATNLLRLVNETRPDLAILDV
RMPPTFTDEGIRAAALLRSQNPESPVLVLSHYVEQRYAAELIASDTKGFG
YLLKDRVADVPAFLDAVEVVGHGGTVLDPEVVSQILVRSHRRAALDQLTP
REHEVLQLMAEGKTNSAIASGMHISVGSAEKHIASIFTKLNLAPDETENR
RVLAVLRFLES
108800871YP_641068.1 luciferase-like protein [Mycobacterium sp. MCS]MTLPVMEPDLDSATLRAWARVIDEGPFSALCWGERIAFDNPESLTLLGAV
AAWTERVRLVTTVIVPQLHDPVMLAKALATGDLISGGRLTVGIGVGGRHE
DYEAVSADPATQTMRQLAERVAVMKRVWAGEKVTESVLPVGPPPVQVGGP
PLLVGTIGPKTVRSAAAWADGMAGTILDLDPVKQNELFDVARTAWADAGK
PRPHLATSFWFALGDRDEARAQVHRHLRRYMNWIPGEYVDAMAPATGFAG
TEDDLLAVLEQFERIGTDEVHLIPTSSDVDQLTRIADVVKDRV
108800869YP_641066.1 group 1 glycosyl transferase [Mycobacterium sp. MCS]MSLTVLINAGPWLTVPPHGYGGIENMIATLIPELRSAGVRVVLATVAGST
VDVDEKIVGFDEPQFGHLTEPYNQVMGIAATHMHRLVTELADRHDVDLVH
DHLEAVGPTVLAAAGSRLPPVLHTLHWDLAKHPGLYGNLAVDHLWVNGVS
AAQIALGPARLRQRSLGHVHLATPLTRFPHNPVRKRRHVALVARISPTKG
QHVAARLAHRGGFELVLAGPVGPYADAAELAADPHAERYPDVRYYRDAVA
PLVDDRRVRWVGTLEGEARDRLVATARATLFPLTWNEPGGTAVIESLALG
TPVVAYRRGCLPELVAPDTGRLAEPGDEAALAELLSQVDEIEPARCRAEA
QRRFSPAVMAAGYLRMYEECVTRGRTSGPLNTRRAGGSTRRAVAGATRRA
SPPRSPDGRTG
108800867YP_641064.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MSDAGYTVVVERPGVVTCRAQPSQGALPEGQFDVATVFSGLSAGTDLSWV
KGTNPALHQNWDADLGLFLAGEPNAGYPVERFGYMQVGRVTASRVPSVAP
GRLVAMTYGHRSCYRADALRDRFVVLPAGFDAVLGIYVAHMGPICANGLL
HAAADVVGADVRTLGDGVRGRRVAVVGAGVVGLLTALLAAHHGAADVLVL
DETAARRDIAERLDLATLDPGGGDPAVAVKQRWGRSGERGADVVFQCRGR
GSALALALRLLRPQGTVIDLAFYQDGCGDVRLGEEFHHNGLSVRCAQIGR
VPRGTADLWDRDRLSAETVDFLQARGRDIKAHLITDYAPLVEAPSTLGRL
ATGRHDGLQIVFFC
108800865YP_641062.1 hypothetical protein Mmcs_3901 [Mycobacterium sp. MCS]MDIKRVLAGASIVGVVGLPAWFLGVGVASAEPVAGQECADPATCERAPEE
QPAEKKNNANKAPIQIPESWSREVAKNVANLPSPVEANASVPVSVGLPDV
VPDIGFSAPVHLHPPALGGIGLPAVGMPSVNLPAPKLGPPNNPLNLGPPN
NPFNLPKIGF
108800863YP_641060.1 hypothetical protein Mmcs_3899 [Mycobacterium sp. MCS]MRARRITLTLGFAFTVMADPVSSVAYAIEATLRSLNGDLAQLLPAMAAVI
AIIGVISATYHQLIGRFPEGGGGPDGVAHAFGEGWAFIPLGALLVDFTLT
VAVSCAAGASALIAYLPGLASLRMPIGLGLVVVVAAGVLLGQAGRIVFAV
ATLAFIVLSMWVIFSGVTASTSSPAPEGVSVETTPMLYGAGLAPVLLAIP
LGMALATGVEAPSNAIAQLPQLDDRGRRRLGRLTLWLMIGIVGALTVSFA
ALAVRLGTDLPPGDSTLIAEVARRATGGGPLFAAFQASSALLLLSAAASS
YLAGSGVLKALASFGRPGEGLVPIRFARINRFLVPEWGVALVLVASAALV
AAGGREQRLVGFYAVAVFASFLAATIACARLSYRDGRRAALTVNVIGAVL
VATILIMNATRLDGLLALLASGGVAVYLWRMWVSRGRPGGVAAAAGSG
108800861YP_641058.1 diaminopimelate decarboxylase [Mycobacterium sp. MCS]MNAHPAGPRHAEEIHHGGAPPRPAGPDEVLRLAPNVWPRNAVRGADGVVS
IAGVPVTDIAAQFGTPVFIIDEADFRSRCREISAAFGGGEYVRYAAKAFL
CTEVARWIDEEGLALDVASGGELAVALHAGFPAERIALHGNNKSPDELAL
AVKSGVGHVVVDSMIEIERLDEIAAAAGVVQDVLVRVTVGVEAHTHEFIS
TAHEDQKFGLSLASGAAMAAVRRVFETDNLRLVGLHSHIGSQIFDVAGFE
LAAHRVIGLLRDVVAEFGVDKTAQMSTVDLGGGLGISYLPQDDPPPVADL
AAKLSAIVREESAAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVAVA
SDRYRRYVSVDGGMSDNIRTSLYGAEYDVRLVSRVSDADPALSRVVGKHC
ESGDIVVRDAWLSGDVAPGDLLGVAATGAYCYSMSSRYNLIGRPAVVAVR
DGHARLILRRETVDDLLSLEVSGQ
108800859YP_641056.1 threonine synthase [Mycobacterium sp. MCS]MSTPVNAVHRRWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIHAKRLSEF
TGCTVHLKVEGLNPTGSFKDRGMTVAVTESAASGKQAVLCASTGNTSASA
AAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELAR
KLTADFPTVALVNSVNPYRIEGQKTAAFEIVDVLGTAPDIHALPVGNAGN
ITAYWKGYSEYHRDGLSDRLPRMLGTQAAGAAPLVTGEPVKNPETIATAI
RIGAPASWASAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPTVTPLAVDP
VAVAAELGLV
108800857YP_641054.1 transcription termination factor Rho [Mycobacterium sp. MCS]MTDTDLFTADSAERTELPNVVNTETSTASEGPAVTTTTAESAPTADVASG
DRAASLTSMVLPELRALARQIGVEGASGMRKSELIAAIRERRGDGGAAKA
ESAAAPQTPPRRERRSASRQAGAAEAKAPEALEAKAPEVKAPEVKAPEVK
ADAPAEEAAAEPKTERPRNDRTKAEKPAAQQPDGEQPKGDQPKGEQSRGD
QRRSDRPRGDQSDTRSDDRSDSDQQQGQGNRNNSNNSADGDDDGDGRGGR
RGRRFRDRRRRGERGGEGGGGGDTEIREDDVVQPVAGILDVLDNYAFVRT
SGYLPGPNDVYVSMNMVRKNGLRRGDAVTGAVKVPKEGEGGGQNQRQKFN
PLVRLDSVNGGPVEDARKRPEFGKLTPLYPNQRLRLETSPDKLTTRVIDL
IMPIGKGQRALIVSPPKAGKTTIMQDIANAITRNNPECHLMVVLVDERPE
EVTDMQRSVKGEVIASTFDRPPSDHTTVAELAIERAKRLVEQGKDVVVLL
DSITRLGRAYNNASPASGRILSGGVDSTALYPPKRFLGAARNIEEGGSLT
IVATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERRVFPAVDVNPSG
TRKDELLLGPDEFAIVHKLRRVLSGLDSHQAIDLLMSQLRKTKTNYEFLV
QVSKNTPGSVDND
108800855YP_641052.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MPDTLQGLLRERADSDAIAVRYGDCSWTWREHLAEASRQAAAVIAAADPA
RPLHVGVLLGNSPDMLTALAAAALGGYVLCGVNTTRRGEALARDIARVDC
QILLVNPEYRALIDGLDLPGVTVFDVSTDDWAQRVADAPELTPHREVGPD
DTFMMIFTSGTSGEPKAVQVPHAMVLFAGGALVERYGLTEADVCYLAMPL
FHSNAVYAGWSVAVGAGAAMAPATFSASRFLSDIRRYGATYMNYVGKPLA
YILATTEKPDDHDNPLRIAFGNEAADRDIEAFGRRFGCTVWDGFGSTETA
VIITRPDDCPQGSIGKGFPGVAIYDPDTVRECEVARFDENGALLNADTAV
GELVNTAGGGLFRGYYNDPNATGDRMRHGMYWSGDLAYRDAEGWIYLAGR
TGDWMRVDGENLTAAPIERILLRLPAINRVAVYPVPDEHVGDQVMAAVVL
QDDAKLTPEEFEEFLAAQRDLSTKGWPRYVWIAADLPSTATNKILKRELV
AMGTDPRGRHIWIRDRTSYRVLSGTGR
108800853YP_641050.1 hypothetical protein Mmcs_3889 [Mycobacterium sp. MCS]MDDAEIWTHIDAQRADLADFLDTLTPEQWATPSLCPDWSVRDVAVHLTQS
TTAWPRMVLEAVRSGFRFNTMVSRVAREDPRGPDEIVAALRGMAGVRRRP
PGTAVADPLTDVLVHGQDIAIPLGVDREMPPAPAVVAARRLWAMGFPFHA
RRRFTGVQLEATDADFSVGQGRLVSAPIRDIVLALSGRNSPVLPRV
108800851YP_641048.1 peptide chain release factor 1 [Mycobacterium sp. MCS]MSAPTTAIDALLAEHADLERQLADPALHADAGKARKAGRRFAQLAPIVAT
YRKLEAARGDLEAARELGADDASFAAEVPELEATVDQLETQLSDLLAPRD
PHDADDIVLEVKSGEGGEESALFAADLARMYIRYAERHGWSVTILDETTS
DLGGYKDATLSIRSKGDSADGVWSRLKFEGGVHRVQRVPVTESQGRVHTS
AAGVLVYPEPEEVEQVQIDESDLRIDVYRSSGKGGQGVNTTDSAVRITHL
PTGIVVTCQNERSQLQNKARAMQVLAARLQSLAEEQASADASADRASQIR
TVDRSERIRTYNFPENRIADHRINFKAHNLDQVLDGDLDPLFDALAAADK
QARLQSS
108800849YP_641046.1 translation factor SUA5 [Mycobacterium sp. MCS]MTQLFDCTDPDNRATGIAAAVSALKDGGLVVLPTDTVYGIGADAFNNEAV
AALLAAKGRGRDMPVPVLVGSWHTIEGLVYTVPHTARELIRAFWPGALSL
VVRQAPSLPWDLGDAHGTVMLRMPLHPVAIELLREVGPMAVSSANISGRP
AAVSAADAREQLGDLVDVYLDAGPSEQQAASTIVDLSGAHPRILRTGPVT
AEAVAEVLGVNTESLLTQ
108800847YP_641044.1 hypothetical protein Mmcs_3883 [Mycobacterium sp. MCS]MTTPAQDAPLVLPAVAFRPVRLLVICVALAAVAAVAAALLGVPMVGLFFA
IGLGLGLANAVMIQRSVESITSKDHPLKRNMALNSATRLLIMTVIGLTIA
YVFKPQGLGVVFGMALFQVILVASTTLPVVKKLKAQAADGLEGETPQQ
108800845YP_641042.1 F0F1 ATP synthase subunit C [Mycobacterium sp. MCS]MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVA
108800843YP_641040.1 F0F1 ATP synthase subunit delta [Mycobacterium sp. MCS]MSTFIGQLIGFAVIVFLLVRFVVPPVRRMMTAQQETVRRQLEESSTAANK
VAQADQQHAKAVEEAKADARRVVDEARSDAEKIAEQMRAQADAEVERIKV
QGQAQVQLLRQQLIRELRSHLGTESVARARELVRDHVSDDDNRSATVDRF
LDELDAMAPSDAALDDAVGSRMRSTSRESLKALVSRFDELTADVDADGLT
SLGDELAAVAKLLKTEPVLGKHFGEPTEDGEGKANLAEAVLSGKISDTAL
EVVKAAVAQRWSDESDLDYAVRHTARLALLVRAERNDETSEVEDQLFRFS
RILDSESRLSGVLSDYTTPVDGRIGLLDRLLGDQAGETTRALLAQTVELL
RGERADEAVRELAELAVARRGEVVAHVNAAAELSDAQRTRLAEVLGRIYG
RPASLQLHIDPDMLGGLTIAVGDEVIDGSLASRLASAETQLPD
108800841YP_641038.1 F0F1 ATP synthase subunit gamma [Mycobacterium sp. MCS]MAATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYDREI
TNMLTELATASALDHPLLVQRENPRRAGVLVVSSDRGLAGAYNANVFRRS
EELFSLLREEGKEPVLYVVGRKALSYYSFRNWDVTESWSGFSERPEYEHA
QEIGETLVKAFMAGVDDEGDDAGADGILGLDELHIVFTEFRSMLSQSAIA
RRIAPMVVEYSEEDTNEPHTLFSFEPSAETLFDALLPRYVSTRIFAAMLE
AAASESASRRRAMKSASDNADDLIKDLTLMANRERQSQITQEISEIVGGA
NALADAAKK
108800839YP_641036.1 F0F1 ATP synthase subunit epsilon [Mycobacterium sp. MCS]MADLDVDIVAVEREIWSGKATFVFTRTTSGEIGILPRHIPLVAQLVDDAM
VRVEREGEEDLRVAVGGGFMSVTESGVIILAETAELESEINADEARRDSE
SDDPATAARGRARLRALGQID
108800837YP_641034.1 ATP:cob(I)alamin adenosyltransferase [Mycobacterium sp. MCS]MAVHLTRIYTRTGDDGTTGLSDFSRVSKNDPRLIAYADCDETNAAIGVAI
ALGDPPARIAAVLRQVQNDLFDAGADLSTPVAENPEYPPLRITQPYIDRL
EAWCDEFNEPLPALTSFVLPGGTPLSAQLHVARTVARRAERSAWEAVDAH
GDTISVLPAKYLNRLSDLLFILSRAANPDGDVLWKPGTDQ
108800835YP_641032.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium sp. MTIRFRTVDSPVGLLTLAGRDDRLRHLRMVDQTYEPSRQGWEPDPTAFGD
VVAQLGAYFAGELTTFELELDLAGTAFQRRVWEALLTIPYGETRSYGDIA
RQIGAPGAFRAVGLANGHNPIGIIVPCHRVIGANGSLTGYGGGIERKRML
LGMERQFHSAVPTLFD
108800833YP_641030.1 putative fatty-acid--CoA ligase [Mycobacterium sp. MCS]MSGGTGQMVHEGLLKIEDCLDAAGNIVLPPGVTLISLIERNIAAVGDAVA
YRYLDHTGTDEVRVAELTWTELGVRLRAVGARIQQLTSRGDRVAILAPQG
LDWVTGFFAAIKAGTIAVPLFAPELQGHAERLRTALEDARPTVVLTTSAA
AGAVEGFLADLVGVTRPHVVLIDDIPDSAGESFVTTPIDVDDVSHLQYTS
GATRPPAGVEITHRAVGTNLLQMILSIDLLDRNTHGVSWLPLFHDMGLSM
IGFPAVYGGHSTLMSPTAFLRRPQRWIRALSEGSRQGRVVTAAPNFAFEW
TAQRGLPDEGEDIDLGNVVLIVGSEPVSMAAIDTFTAAFAEYGLPPTAVK
PSYGIAEATLFVATIAPDAEPSVAHFDRAQLAAGRAVRVAADAQDAVAQV
SCGQIARSQWAVIVDPDSGEEMPDGYVGEIWLHGENLGRGYWGRPDETRE
TFCAAMTSRAGGHADGVPDDGRWLRTGDLGTYLDGELYVTGRLADLIVID
GRGHYPQDIEATTADASPLVRRGHATAFTVSGEQLVIIAERASGTRRADP
APAVEAIRAAVRQRHGIEVADVRFVPAGAIPRTTSGKLARRACRTEYIDG
TLRAN
108800831YP_641028.1 hypothetical protein Mmcs_3867 [Mycobacterium sp. MCS]MRGSADPNVVRVRLVIAQCTVDYVGRLTAHLPSARRLLLIKSDGSVSVHA
DDRAYKPLNWMSPPCRLSEESGDPHPVWVVENKTGEQLRITVEEIEHDSS
HDLGVDPGLVKDGVEAHLQKLLAEHVELLGAGYTLVRREYMTAIGPVDLL
CRDETGRSVAVEIKRRGEIDGVEQLTRYLELLNRDTLLAPVSGVFAAQQI
KPQARTLANDRGIRCLILDYDQMRGMDSDEYRLF
108800829YP_641026.1 methylmalonyl-CoA epimerase [Mycobacterium sp. MCS]MTAEQIDARPVLATALVTAIDHVGIAVPDLDEAIRWYHDHLGMIVLHEEV
NEEQGIREAMLSVRGAPVGSAQIQLMSPIDDSSTIAKFLDKRGPGLQQFA
YRVSDLDGLCERLREQGVRLIYDEPRRGTSNSRINFIHPKDGGGVLIELV
EPAAEH
108800827YP_641024.1 hypothetical protein Mmcs_3863 [Mycobacterium sp. MCS]MAAMSGAFDLRNPVGWLRLVGLLEAASWVGLLLGMYFKYLASPSTEIGVK
IFGPIHGGVFVAFLAAAVVTGFTLKWRAWTWLLAGLASIVPLGTVIFLIW
ADRTGRLDGDTVSAAGRAARPAPETT
108800825YP_641022.1 glycogen branching protein [Mycobacterium sp. MCS]MAKTKGLPKDTAVTPSPHLRPHTADLNRLLAGEHHDPHSILGAHEYDDHT
VIRAYRPHATEVAAVVGGERHVFTHLEAGVFAVTLPFTGLIDYRLEVGYD
HGGDQPHIHHTADAYRFLPTLGEMDLHLFSEGRHERLWEVLGAHPRTFET
PDGVVEGVSFAVWAPNANGVQLIGDFNHWDGNEAQLRVLGSTGVWELFWP
DFPVDGLYKFRIHGADGVVSERADPMAFATEVPPQTASRVTTSSYTWNDD
AWMTQRAAQNPVFEPMSTLEVHLMSWRPGLSYVELADQLTEYIVEHGFTH
VEMLPVAEHPFGGSWGYQVTSYYAPTSRLGTPDEFRYLVDRLHQAGIGVI
VDWVPAHFPKDAWALGRFDGTALYEHADPRRGEQLDWGTYVFDFGRAEVR
NFLVANALYWLQEFHVDGLRVDAVASMLYLDYSRPEGGWTPNIYGGRENL
EAVQFLQEMNATVHKASPGIVTIAEESTSWPGVTRPTNLGGLGFSMKWNM
GWMNDTLAFISRDPIHRSYHHHEMTFSMLYAFSENYVLPISHDEVVHGKG
TLWGRMLGDDHRKAAGVRQLLAYQWAHPGKQLLFQGQEFGQRAEWSEERG
VDWYQLDENSYSGGILRMISDMNGIYTSHRALWSHDTSPEGYSWIDANDS
TNNVLSFLRYGDDGSVLACVFNFSGSEHSQYRLGLPHAGTWREVLNTDAA
DYNGAGIGNYGAVQATDEPWHGRPASAVMVLPPLSALWFEPVAAEAPVVQ
EPPTAPPLS
108800823YP_641020.1 alpha-glucan phosphorylase [Mycobacterium sp. MCS]MKALRRFTVRAHLPDRLAALERLSINLRWSWDKPTQDLFADIDPKLWQQI
GCDPVALLGGVKPGRLDELARDESFVRRLDGLAADLDDYLSRPLWYQQQL
EQGEVLPNGIAYFSMEFGVAEVLPNYSGGLGILAGDHLKSASDLGLPLIA
VGLYYRSGYFRQSLTADGWQHENYPSLDPQGLPLRLLTDADDNQVLVELE
LPDDATLRARVWVAQVGRIPLLLLDSDIPENEHELRGVTDRLYGGDQEHR
IKQEILAGIGGVRAIRAFTEVEGLPSPEVFHMNEGHAGFLGVERIRELID
AGLDFDTALTVVRSSTVFTTHTPVPAGIDRFPVEMIKRYFGGSHLLPGVP
LDRIVAFGAEDDPSKFNMAHMGLRLAQRANGVSLLHGQVSREMFNELWPG
FDPNEVPIGSITNGVHAPTWAAPQWLELGRELLGSHDLGLLRETATWERL
QEVDPGHLWWIRSQLRRALVDDVRARLRRSWLERGAAEAELGWIATAFDP
DVLTVGFARRVPTYKRLTLMLRDPARLEKLLLDKERPVQLIVAGKSHPAD
DGGKALIQQVVRFADRHDVRHRIAFLPDYDMSMARQLYYGCDVWLNNPLR
PLEACGTSGMKSALNGGLNLSIRDGWWDEWFDGENGWEIPTADGLADEAR
RDDLEAAALYDLVERSVAPKFYERDEHGIPIRWVEMVRHTLRVLGPKVLA
SRMVRDYTEKYYAPAAQSLRRTVEDADGVTFGAASELAAYRRRVQAAWPK
LEITDVDSSGLPDTPLINSELTLTATVALAGLRPDEVSVQAVLGRVDASD
TLLDPVTAPMEHTGTADDGREVFATTTPLPVAGPVGYTVRVLPHHRLLAA
DNELGLVALA
108800821YP_641018.1 hypothetical protein Mmcs_3857 [Mycobacterium sp. MCS]MWQRGFTVLAICGLLATAQPSYGWAQPAAEPVAGDAAPPPPEGAVPSTPP
SHTGTPDGWTLTLSAKDETQAVIPPLTTALSSREYVVGGTFSGDLAGPDA
ADPPTGVLEVGYEIGCGIDMSTSNGVSLTGTAGLNPSLGVIGTDVISPIP
DGILPGIGGNIGGGVTVGLKPGIINVVPVTEKEFTGAAPWVMVSNFRIKI
DGCVGQSFIRSYAILTHETEMSEAVLAWYGTTKVV
108800819YP_641016.1 helicase c2 [Mycobacterium sp. MCS]MATGNDDAGERVTDLLAAAVAAVGGAERPGQVEMARAVATAFDTGRHLAV
QAGTGTGKSLAYLVPAIAHAIAVDEPVVVSTATIALQRQLVDRDLPRLAD
ALSGSLPRRPQFALLKGRGNYLCLNKIHNGSTGIGDAPDDRPQEELFDAV
AATALGRDVQRLTKWASDTETGDRDELRPGVPERSWRQVSVSARECIGVS
RCPYGTDCFAEKAREKAADVDVVVTNHALLAIDAISDAAVLPEHSAVVID
EAHELADRVTSVATGELSATSLGIAHRRVARLVEGELADRLEAAVATVSS
AIHDGTPGRIDRLDDELATYLTALRDAADRARSAIDTAPSDPKAAAARTE
AVTALSDVSDTANRILDSFVPAIPDRVDVVWLDHEGGGAGSVSAILRVAP
LSVAGLLRTRLFEHATTVLTSATLTVGGNFEAMARAWGLADTKWHGLDVG
SPFDHAKAGILYVAAHLPPPGRDGTGSAEQLKEIEALITAAGGRTLGLFS
SMRAAKAAAEVMRDRLDTPVLCQGEDTTSALVERFADDPQTSLFGTLSLW
QGVDVPGPSLSLVLIDRIPFPRPDDPLLTARQRAVTAHGGNGFMAVAASH
AALLLAQGAGRLLRRTDDRGVVAVLDSRMATARYSGYLRASLPPFWATTD
PARVRAALERLRAGS
108800817YP_641014.1 ATP-dependent Clp protease adaptor protein ClpS [Mycobacterium sp. MCSMATVPDQDEATDAPWVTIVWDDPVNLMTYVTYVLQKLFGYSEPHATKLML
QVHNEGKAVVSAGSRESMEVDVSKLHAAGLWATMQQDR
108800815YP_641012.1 peptidase S58- DmpA [Mycobacterium sp. MCS]MSGSITDVGGILVGHHDRLDADAALGSGWASGTTVVLTPPGTVGAVDGRG
GAPGTRETDLLDPSNSVRHADAVVLTGGSAYGLAAADGVMTWLEEQGRGV
ALDGGVVPIVPAAVIFDLPVGGWACRPTAEFGYAAAASAGVDVAVGTVGA
GVGARAGVLKGGVGTASVILDGGVTVGAIVVVNSAGEAFDTATGLPWMAE
YRREFGLVDPPADQIAAYAGRHQELSPLNTTIAVVATDAALSPAGCRRVA
VAAHDGLARTLRPCHTPLDGDTVFALATGAVEVPPDPTTPASMSPEVPLM
TAIGAAAADCLARAVMVGVLAAEGAAGIPTYRDLLPGAFG
108800813YP_641010.1 sulfur transfer protein ThiS [Mycobacterium sp. MCS]MTVSVSIPTILRTHTGGEKRVSASGGTLADVIGDLEANYSGISERLVDPD
KPGKLHRFVNIYVNDEDVRFSGGLDTPISDGDSVTILPAVAGG
108800811YP_641008.1 rhomboid-like protein [Mycobacterium sp. MCS]MGVTGPTGSPAYPAPSSKRPAWIVGGATIVSFVVLLYVIELVDSLTGHRL
DENGIRPLETDGLWGIVFSPLLHADWQHLLANTGPALVLGFLMTLAGLSR
FIYATAIVWILGGLGTWLIGNLGTHCPYVGVRCEVNHIGASGLIFGWLAF
LIVFGFFTRKAWEIVVGVIVLFVYGGILLGVLPGTPGVSWQGHLCGAVAG
VVAAYVLSSPERKARELRRSRTAPPYLTS
108800809YP_641006.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MGVRITVLGCSGSVVGPDSPASGYLVTAPDTPPLVLDFGGGVLGALQRHA
DPNSVYVLLSHLHADHCLDLPGLFVWRRYHPSPAPDRGVLYGPANTWARL
GAASSPEGGEIDDISDIFEVRNWSDNSAVQIGALSVLPRLVCHPTESYGM
RLTDPSGATFVYSGDTGFCDPLIELARGADVFLCEASWTHSPEHPPGLHL
SGTEAGRAAALAGVGELLLTHIPPWTSREDVISEAKAEFDGPVHAVVCNE
SFDVTHR
108800807YP_641004.1 putative deoxyribonucleotide triphosphate pyrophosphatase [MycobacteriMVASRNRKKLAELRRVLDTAGVSGLTLLSLDDVAPFDEAPETGATFEENA
LAKARDAFRATGIATVADDSGLEVDALNGMPGVLSARWAGTHGQDAANSA
LLLAQLRDVPDERRGAGFVSACALVDGTHEVVVRGVWRGAITRAPRGEGG
FGYDPVFLPEDSDRTAAELTPAEKDAASHRGRALAQLVPALRELSG
108800805YP_641002.1 hypothetical protein Mmcs_3841 [Mycobacterium sp. MCS]MTAPETPTTAPAGVSIETIAKAVRNYRILAWATGIWLIVLCAEMVLKYIV
KVDWPFLWLVAPIHGWVYFAYLLFTANLAVKVRWPIGKTIGVLLAGTIPL
LGIIVEHYQTKNLKARFGL
108800803YP_641000.1 hypothetical protein Mmcs_3839 [Mycobacterium sp. MCS]MVWSAAQYDAAKRLFTIGKNNSQIARELGIPRTTVRDWRRDQRRPRLSDG
TPCGTSHDFTSVLAEPYCYLLGLYLGDGCISRSGRVWRLRITLDDKYPSI
ITRCREAINLLMPSQRAASLQRAGCVEVSLYSKHWPCFFPQHGVGRKHQR
AIVLEPWQQTLVDQATQEFVMGLIHSDGCRVVANDRGVASIRYHFSNRSE
DILGLFTAALDSLAIPWTRSSPHIVSVYRKAATARLDEFVGPKDQAVPWN
RVHYTA
108800801YP_640998.1 hypothetical protein Mmcs_3837 [Mycobacterium sp. MCS]MSGRDRDEAGRPRNSRPRDALGRPLPPGSEGVDRIPDDLHLPPAETLDYA
QRLVDDGRAFNAHEVLEAAWKDGPDHEKALWQGLAQLMVGITHVQRGNVD
GARALLRRAVGRLTTAPAGPYGIDVAGLIDYAEALERDLAAGREIPADRL
SPTLVVRTD
108800799YP_640996.1 LacI family transcriptional regulator [Mycobacterium sp. MCS]MNGRGTARPTKADVARLANVSTATVSYVLNNVESQRISPRTRDAVRKAAE
TLGYRPNLAARNLAVGGSGVVLYIVPRIALGELPMEVGSRLTTALARHGI
VLSLQFETDDDRNVVDAINDLNPVAVTSVFPLTGAALAAADAAGIPQIHV
GSAQLRALGDLHLSIGELRITHLKDRGHRRLAFAYSDVDKLRPLGDYWLA
GLQVAARDHGLPELTVGTLATDGSDAARVVTGWVEQGVTAVCAQSDETAF
VVLHGLREAGLRCPADLAVMGVDARPLGAVSGPPLTSVGFDAKEIVDVAV
AAMMAELGYPIEYEPNARKVAGLIQRAST
108800797YP_640994.1 hypothetical protein Mmcs_3833 [Mycobacterium sp. MCS]MTSAALIVPKDWDEITPEWMTAALSAHHPDAVVDSVGVDLRDDGTNRRAR
LRLTYSAGSGPETVFVKAVDPAHRDLVRLTSGLFHEPRLFTCGVDLPLEH
PTVFTALVDEAAEDFILVMEDLTARDADPRDATRPLTVEQAATGVRGLAR
MHGRYWGRRVLEEPALDWLEPFVPWEGMGAAPLSEAQKRLGDDAPDVVMA
LTIGELIDDIWKPYIRSLTKAPQTLLHGDPHIGNTYLLPGGEVGFLDWQV
ARRGNWSLDLGYFLQGALTIEDRRRSERHLLEEYRDALGLPADELPSLGE
IWLRYRASVAHGLTLWMCTASAGELWQRPDIAIALAQRYSAAYADLQTSE
ALADIDT
108800795YP_640992.1 general substrate transporter [Mycobacterium sp. MCS]MATIDGHRPREAEPLAVRRAVRGAAIGNTVEWFDFAIYGFLATYIAEKFF
PTADDTAALLNTFAIFAAAFFMRPLGGFFFGPLGDRIGRQRVLALVILLM
SASTFAIGLLPSYDAIGVAAPLLLLLLRCLQGFSAGGEYGSGACYLAEFA
PDRHRGFVVSFLVWSVVVGFLLGSLTVTALEAVLDESAMDSYGWRIPFLI
AGVLGGVGLYIRLRLGDTPDFEELKESGEVSTSPLKDAVRTSWKPILQIA
GLVIIHNVGFYTVFTYLPSYMTETLDFTKTDAFLSITVASVVGLVLILPL
GALSDRLGRKPLLIAGAVGFAVFAYPLFALFNTGSLLGAIAGHAGLSALE
ALFVAGSLAAGAELFATRVRSSGYSIGYNTSVALFGGTAPYVATWLTDRT
GNDLAPAYYLIVAAVISLATILTMRETATRPLRMRV
108800793YP_640990.1 hypothetical protein Mmcs_3829 [Mycobacterium sp. MCS]MIKNGTRLKSQVCDTQVIVVRSAESLDDLRAGGAPMVPLDSANGADPSDL
AIDPALSDGNVMGKRYVDDNGAEVLVTKAGAGTLSVGTTPLNLKEAKPLP
ASD
108800791YP_640988.1 short chain dehydrogenase [Mycobacterium sp. MCS]MPSEQRVPSQRTLTDRTLVVSGGSRGIGLAIAIGAARQGANVVLLAKTAE
PHPKLPGTVHTAVADVEAAGGKAVAVVGDVRKEEDVARAVDTAVEHFGGI
DICVNNASAIATEPTEQLSAKKFDLMMDINVRGTFLLTKACLPHLRESPN
PHVLTLAPPLNMNPHWLGAHPAYTLSKYGMTLLSLGWAAEYAEAGIAFNC
LWPETYIATSAVANIGADALKTSRDPQIMADAAVEVLSRPARETTGQCFI
DSAVLASAGVSDLSRYGGGDNPTLDIFVDKALDKS
108800789YP_640986.1 methylmalonyl-CoA mutase C-terminal domain-containing protein [MycobacMPTRVLVAKPGLDGHDRGAKIVARTLRDAGFEVIYTGIRQRIEDIVSIAL
QEDVAVVGLSILSGAHLALTRRTVDALRAADAGDIAVVVGGTIPQADVPK
LLEAGAAAVFPTGTPLETLVTEVRKLTGEVAQ
108800787YP_640984.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMREEPRLPVNGPLAGIRILEVGVMLAGPYATMMLADLGAEVTKVEPPGGE
ISRQVSDSYFASLNRNKRSVCLDLQSADGQRRLGELVAESHALLVNMKPS
VIRRLGLTYEALRKHNEKIVCVAMTGFGLDGGDDPAFDYVIQAATGVAAM
TGEPDGPPTLPGYSSADNSTGLTAALGLLAMIVSGRGGQVDVSLRDVMLS
QLNYRAAAYLNDGVAPRRHPNGAHSFYVPAQLFPTADGYLALFITHDGFW
RLFASEAGIEGYPTMAERAAQREEVLAVVTEALAKDTAKGWEARLRPLGI
PAAAVRGLPDALDETPEALVTAGDFRLVGSPIRIAGYRPDYRPPPQLPEA
ATGQSS
108800785YP_640982.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSDGRHVTDAAALAFGEREYSLNELDALASGMATSLEQRGVRAGDRVAMM
SSNRPEFVAALRGIWNLGAAAVLISPAWKHAEVAHALELTRPSHAVGDHP
VLAEHMPMLHLDEPVTPGRREFDAVDPGADALFVFSSGTTGMPKAVRHTH
GAFAAAVRHWRDALELSSADRMQIMTPPSHILGLLNIVMALETGTWIRLH
PRFDIDTMLHHVESDRITIEMAVAPIALALAAHPKLESYDLSSLRYIMWC
ATPVTKSVADDVTRRTGVEWVAAYGTTELPVIAANPVTGARLDTVGKPVP
GVRVRIVSLDDGTPLGPGEVGEIQVRSDSVMAGYLPREATSAAFADGWYR
TGDVGRLDAEGWLRITDRSKEMIKVRGFQVAPAEVEAVLHGHPAVEDCAV
FGEPHPTDGEAVVAAVTTNSDVPADELTELVAGTLASYKRPSRVVFVPAI
PRLPSGKVLRRVLKEQHGCTSDS
108800783YP_640980.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MRNWLTDNAKAFAASGDDYWARQGEWHQALYSAGFFGTSWPREFGGQDLP
PVYDVIVDEELARAGAPPRPSLGYLVVGLGHHGSKELQQRFLPGMINGTE
RWCQGFSEPGAGSDLASLTTTATRDGDNYLIHGHKIWTSYSDIADWCLVL
ARTDKEVPRHKGISAFIVDMHQPGIEQRPLKMINGVTTEFGQVAFDGAVV
PADQMIGAPGEGWALAMTVVSHEREPSTLGYSARYGKLVRQMAARVDGRP
PEDLVWAAVEAEMLRLHVRRRLSEQLDGITHGPQGSLDKLLMTWTEQSVG
HAALSVSGTKDPDLLSAYLYSRAQSVMGGTSQIQKNIIASRILGLGVR
108800781YP_640978.1 recombinase [Mycobacterium sp. MCS]MRAAIYTRISKDQTGEGLGVQRQLDACLALADRLGWAVVTRYDDNDLSAY
NGKTRPGFEALLDGMKRGEFDAVICWHTDRLYRSLKDLVRLLEVAVGIDI
RTVCGGDLDLSTPTGRMLATILGGVAVQESEHKGERQREANEQRAAAGRW
HTANRPFGYTMSGEALEPEASAVRQAAADVLAGKSIRRVAMEWNEAGLRS
TLAGRERKSKDGTVVKVVDGRWNAPRVRQLLLRPRYAGLRVYRGKVVGKG
DWEPLIDEDTHRGLVAFLSDPSRAPRTKFERKYQGAGVYRCGKCGGPMRT
GKPKGGRRTYLCREYSHVVRQGESLDRYVEMLVLDRLSRPDVHLVLAGGD
RLDLPTLHARREALQARLDEAAGMFAKREIDGAQLRRITNDLRTEVAGVD
KVLADAARVSPVTGLISESTDRDEVQQRWEALSPDLRGKVIDELMTVTVQ
PAPRGTNGFHPEHISVEWK
108800779YP_640976.1 hypothetical protein Mmcs_3814 [Mycobacterium sp. MCS]MLVGPVSAYRSPALSQMETDNRMSDYAPLYGEVWGDPRWRQLSKTAQWLY
LMLMSSPSRNAAGIVQMQPIGWANCAVDATVDEMHDAIGELVAQRYIDVD
DDTQEVILLGFIENDAIRNPTFYVSSLKHARNCQSPRLRAVLFKAVQGVH
PPDLSCFKAEKVRERRQAGIDAAYDAFAERVQRDAAADLNLPAVTFNSSP
LPASVAATTTASVTTTTTRGDAMGDAMGDQTMGHRMGDAMGDVMCSMHPD
QPAVDGSKWCADCLERERRWQGQS
108800777YP_640974.1 excinuclease ABC subunit C [Mycobacterium sp. MCS]MLVGRIKDAAQMASIIAHTAAAGLDFEQDLADLKSHLDRAAWSTDQHLRG
CLERLEAKEAAAQAHSERVEQIKRSMTINVVAEHLDEFFNPHGGFVYLLW
GEDPNTPLYVGQSTNILSRLGAHMGDKTKRALVKRVQLIRCSTEKLADTE
WRLIQHYQPPLNVVGCSRTGRLGESGIGHD
108800775YP_640972.1 hypothetical protein Mmcs_3810 [Mycobacterium sp. MCS]MPANIFRLELNERDYQRVGAALAALVHCDARGIADVLKDATEAKRGFHYH
VAVLQTLAHRMGLDGPDRDELLANLQQEIAELARRAEAGGDD
108800773YP_640970.1 hypothetical protein Mmcs_3808 [Mycobacterium sp. MCS]MLWLAVIDRDYPAVDRALDMLPADPEVRAIAITLCEIGIAIEPRLRCDAA
RDQALTQLALLDHTFKMLTGRD
108800771YP_640968.1 hypothetical protein Mmcs_3806 [Mycobacterium sp. MCS]MPASKRSKRQIAIQRSQRRHRPDDPAMKPQPWHPLPDGDVRPFVPRNQRN
ATRDERGRVRNTEEVHDELRRLNP
108800769YP_640966.1 hypothetical protein Mmcs_3804 [Mycobacterium sp. MCS]MPRNRFKPGAEHPNWRGDAASYAAIHYRLRTTLGSARDHRCVDCGEPAKH
WSFSGCESEIPRRRNEAGRVISPPYCPHPEHFSPRCIPCHWRHDGAADRL
NKKPAKKSA
108800767YP_640964.1 HNH endonuclease [Mycobacterium sp. MCS]MPRAPKMCGRNGCRTIVHPPRKHCPEHSGWNTSPRTASAAATERSYWRTV
IRPQALARDNHQCQLRFPGICTGHATEVDHIVAVSDGGADELDNARSACR
RCHARRTAQDAARASHRAR
108800765YP_640962.1 hypothetical protein Mmcs_3800 [Mycobacterium sp. MCS]MDKKQATVYDKEIRRLVGKIQDDLDTLAHLINQMLEGQAHLALGFKTPQA
YLQDVFRIDGVSRVIEQRRPVVAMLTQKGLSQRAIADIVGVSVGTVVNDQ
AASGAQKLSTSSEDRVIGRDGKSYPATKPKPEPEVSDDEIIDYQAAQDDF
NRLTSSMFAAKRKAQDALSLALHLRGFNEDEKRSIVADVADEVIDVFNAI
KDAAKGRSMDAELRKLLDQG
108800763YP_640960.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MSLAGKVAFVAGASRGIGATVAKALAAEGAAVAVAARSEQPGKLPGTIHT
VAESITASGGRALPVSCDVTDESSVETAVAETVSEFGGIDILVANAGVLW
LGPIESTPLKRWQLCLNVNLTGVFLVTKAVIPHVRARGGGSLIAVTTTGV
TMTDQGSNAYWVSKAAAERLYLGLAADLRADNIAVNCLSPSRVVLTEGWQ
AGGAGMEIPPEMVEPPEAMGRAAVLLAAQDASGITGTIQRSEEVVR
108800761YP_640958.1 acetyl-CoA C-acetyltransferase [Mycobacterium sp. MCS]MPEAVIVSALRTPIGTAMKGTLRDTDAYRLAEHVVAAAAEDLPTGQIDDV
VLGEGLYGGGVIARHAAITAGLISVPGLSNNRHCAAGQAAVQSAAASIRA
GMDQLVIAGGVNSASTTPRFTRRASSAKDAAMLDWFPPTHPDRADAPNMD
MSITVGWNAAVRAGVSREEMDQWALDSHRKAIQAIDEGRFKEEIVPIDTP
YGLFDTDEHPRRDTSIEKLASLKPLHPEIEGFSITAGNACGANDGAAVLA
LASDRLGLPALGAVKAWASVGVDPAFTGLAPVEAIPKALKRAGISLSDVD
LFEINEAFAAMCVATVKMLDIDPAKVNVSGSGCSLGHPVAATGARMLVTL
VHELRRRGGGIGVAAMCAGGGMGSATVIEVPAP
108800759YP_640956.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPPVHDHPAVRRSAAQVRVLDAALDLIAENGVGGTSLQMIADRIGVTKAA
VYHQFKTKEEIVIALTERELAGLEDALAAAEAEENRSRAREVLLTRVVDL
AINRRRVASVLQFDPVIVRLLAEHEPFQRFIDRLYSAMLGNETGTRARVH
AAMLSGVISVAVMHPLVVDIDDDTLRDEVLQTMRRIVDLPG
108800757YP_640954.1 hypothetical protein Mmcs_3792 [Mycobacterium sp. MCS]MSPPIVEPPPGSVIGRFFWNVRHHPKKELWFAWWVMVVFYQLYGVLFFLV
TRVQPPPSPAWDIPTVVQWFDDRHLGILAGFGVVFLISGMCGPMNALLAY
SMRRMSVSPIFGYSYLAMYALSAIPGMLVMAIAMTVAALRPDRDPELIHW
LYDFAFLSFSGTMGVFLIGSLVWMVAILLDKNRVLPKWFGYLGLCNALTE
VVVAPAWMFQRGVFAWNGAIAWWINMVVFLLYTAAFIMLLRRMIQREDFG
TGPLPDLPAEGIREDSDTVEAVR
108800755YP_640952.1 hypothetical protein Mmcs_3790 [Mycobacterium sp. MCS]MSVSVNMRLLLVWVVLSALTVVYVWLDHGADQDGTLKASSVVTVGAIVIA
LIKVRIIFREFMEVRHAPAWLCRLTDGWVVLIGTALIGTYLVGAALSA
108800753YP_640950.1 IclR family transcriptional regulator [Mycobacterium sp. MCS]MLISLTNVHYVKSIALAMTSVKGSGGTGGGMGDGKVPDKLAAGSQTLARG
LSALQAVATAPGGLTVQQVADYVGVHRTIAYRLLGTLTQFRYVAKGEDGR
YRPAAGLALLGSSFDNNVRALSVPVLRGLADELGTTVSLLVAEGDQQVAV
AVISPTNVYYHLSFHEGSRYPLDRGAAGIALLASMPPRPGERELVPRARE
QGWVITHGEVEPNTYGLAVPVRRRPPSPPTCINLISHREDVVLDGKDAVI
AAAKELAAIL
108800751YP_640948.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium sp. MCS]MTPATARDATERDATDTDVVIVGAGPVGLTLANILGLQGVRTMIVEERAT
LIDYPRGVGLDDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEM
APPDARFGWPKRNGFVQPMVDAELHAGLARFPHVEVRWGHRMAECEETAD
GVTVRLDGDPTPVRARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVVDI
ANDPLGHPNSEVGADPARPYASISIAHGIRRFEFMIHADETDEQAEDPAF
IHRMLGLLVPHPERVEVIRHRVYTHHSRIAGAFRKGRMFLAGDAAHLMPV
WQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDTYDVERRKHARAMIDL
STMVGRVISPTNRRVAAVRDKLIRGASVVPTLKRYVLEMRFKPMPRYEQG
AVFHPEAPSPTSPAGTLFIQPRVDTRDAQNVLLDEVLGTGFAVLCWNNNP
RALLGADLFDRWKALGARFVAARPLTQLHWTGHDDPDVTVIGDRTGALKG
WFDAHAESVLFLRPDRCIAGACIAQRAPEVSTALFGVLHLTQGGGNGHHG
ADRPVLHVAQSATEPSGTVAGTP
108800749YP_640946.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium sp. MCS]MNFDRHVDVLVVGSGGGGMTAALTAHSCGLDTLVVEKAAHFGGSTALSGG
GIWVPGAPSQRKAGYTPDPDAVFGYLKQITGGLVSDARLRTYVDAAPQMM
EFLENLSPWFEFVWKPGYADYYPELPGGSELGSTINVPAIDLRRLEEDEQ
HLLQPLALAPKGIWFAPKDLRLFYQVRQNWRGKAVLVKLIWRMVRARVFG
DRMAAIGQSLAARMRLAMKQENIPLWLDAPMTELITGPDGEVVGAVVETD
GRAVRIGARRGVILAAGGFDHDMDWRREHLPVLEKDWSFGNPANLGDGIR
AAEKVGAATELLDEAWWFPAMCWPDGRLQFMLNERMMPAQFVVNGDGKRF
INEAAPYMDFAHAMIDGQRSGVEHIPCWLITDIRSFHRYVVGGHLPIPKV
PFAPVPTGWKVPKAWLDSGVVKEAHSWDEMAAKIGVPAENLRRTAERFNE
LARKGHDDDFNRGDSAYDNYYGDPTLPNPNLHPLGKPPYYAFQIILGDLG
TSGGLRTDEYARVLRDDDSAVPGLYAVGNNSAAVMGRSYAGAGATIGPAM
TFGYVAARHIAAKDAAAQPDSGTAHVDHQAQPSPGPSPIGGST
108800747YP_640944.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium sp. MCS]MSHIEQLWRYDGKRVVVTGCASGIGAHLVRQLSELGARVVGLDMRRPAAD
LDEFGEIDLSDRASIDTAVAAIGGDVDVLFNVAGVSSGIGDPPLVVRINF
LGTRHFTESMLPRMRPGSSIVSVSSLAAASYLDNAPTTAGLVRTATMEDG
IAWCAEHPEALADGGYRLAKEALILYTMRSAGPLGARGIRINCTGPGVTE
TPILDQLRTAYGPAFLDDIPKPLGRVSDPEEQSAVLTFLGSNAASYITGQ
VIWVDGGNLAGRVAASLDATSEGK
108800745YP_640942.1 NADPH-dependent FMN reductase [Mycobacterium sp. MCS]MTDPGEIPFVVGLGGTLRANSSTERAVRYCLEAVERQGGRTRMFAGPDLD
LPMYAPHQLERTPGALELVAALRDADAVVVGSPGYHGAISGLVKNALDYI
EDLREDPRVYLDNTPWGCISCAYGWQAAVNTLGQLRSIGHALRAWPTPLG
VAINSADPIWDGDGLLVDEPVRNQLDLLANQVLTFAAAHRTAK
108800743YP_640940.1 type I site-specific deoxyribonuclease [Mycobacterium sp. MCS]MTDLVSLVRYATGVEDELVPYGDRVREKYAAWLTQQEQAGVTFSDTERWW
LDRMVSVIASSAGIRVEDLDDAPFIERGGTDGAIRDLGDRAAELIDELNA
ELTA
108800741YP_640938.1 hypothetical protein Mmcs_3776 [Mycobacterium sp. MCS]MTGRQIKLFLVDGSPGSLTTAEITNWTGHVLSAPRSELADLLKRDEAQRT
GAYLLLGEDEEAVGNTRCYIGEADVVAERLRYHQREKDFWDRVVVITSKD
SN
108800739YP_640936.1 hypothetical protein Mmcs_3774 [Mycobacterium sp. MCS]MIKQIELRLVDGSAPSGEITLKDLSGIAAALQELVTRLSREAADAAGPGR
SKQYVEEFAELRLDGITAGSTVLKVSKGPTDKLDVDVPGLTEADDRLWDI
LGAISADHRPAWTSTLVAESVGKLATALRGAAPTTVISSPDRGEVRIDAA
RIHPETWAVNRVTAAGSGTAAGWLEKVDLHSHTFRIRDDVGNTVELRRVA
DDKAAGRLVGQWVTAEGDATLSPSGRVVALNHARVRETGDPAAEFLGSRV
VPLDEILASAPGPDPNGGIDLTDEEAAEFLRAIRS
108800737YP_640934.1 N-6 DNA methylase [Mycobacterium sp. MCS]MRRAPTSKSSTPTFWSGWPSNPGTLGTIYRKAQNRVQDPAKLKRLIVDLI
DKENWSASGTDLKGDAYEELLAKGASDKGSGAGQYFTPRDLIRAIVDVID
PSVADTVVDPACGTGGFLLVAHEHVAEEAGKLTPTQRNHLRDKFVTGYEL
VDGTARLAAMNLLLHGIGTADGPSLIEVRDALIADPGQRWSVVLSNPPFG
RKSSLTMVGADGREARDDVEIERQDFVVTTSNKQLNFLQHIMTILDINGR
AAVVLPDNVLFEGGAGETLRRKLLDDFDLHTMLRLPTGIFYAQGVKANVL
FFDKRQANEQPWTSKLWVYDLRTNQHFTLKQNRLRRHHLDGFVDSYLTGK
PREERVESERWKAFTYDDLIARDKVNLDITWLRDESLEDADNLPAPEVIA
REIVEDLTAALAEFEAVAAALEAAATDRS
108800735YP_640932.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MVTRPNDELHGRVAIVTGGASGIGRGVAERFVAEGAKVVIADVQDELGEA
LAEQCGPNALFHHTDVGDQEQMRRLVDVAVERFGALDVMVNNAGISSPLR
RGLFTEDLEEFDRVMRVNLLSVMAGTRDAGRYMSEHGGGSIINLSSIGGI
QAGGGVPVYRASKAAILHFTKCAAIELAHYDIRVNCIAPGNIPTPILQSS
ATGEDRERLEKFEARIRAQMRNDRPLKREGTPDDVAEAALYLATDRSRYV
TGIVLPVEGGTIAGKIIPRKAEPGATVNGAQT
108800733YP_640930.1 putative ferredoxin [Mycobacterium sp. MCS]MKVTVDQDKCVSSGQCVLNASDVFDQRDDDGVVELLVDHPAPDQEEDVRR
AAAACPALAIHLEE
108800731YP_640928.1 amidohydrolase 2 [Mycobacterium sp. MCS]MSAPSPTQTLYPPEGFGAPKHRHGHSAGAVTGLPEGTEIFSADNHISVAD
DIFYERFPEELKGAAPRIWYEDGAYMVGMKGKAWTGGDFGRVLMQYDDLA
GAASNNIEARIRELKEDGIDKELAFPNAVLALFHYPDKALRERVFRIYNE
HIADLQERSNGHFYGVGLINWWDPKGTRSTLEELKSLGLKTFLLPLNPGK
DDEGNIYDYGSTAMDAVWDEIEASGIPVSHHIGETPPKTPCQNNSVVVGM
MVNVDSFREQFAKYVFSGILDRHPSLKIGWFEGGIAWVPTALQDAEHMLA
SYRHMFNHQLEHDVRHYWDNHMSASFMVDPLGLQLIDRIGVDNVMWSSDY
PHNESTFGYSEKSLATVVDAVGPENAVKIVSTNVRKFLGV
108800729YP_640926.1 peptidase M24 [Mycobacterium sp. MCS]MGIEIEADGRALRHSRRERALAQMKAYDLDMLVLGRQANVRYISGAPQLW
VVGTRPFGPICEFVRATGEIHLNSTWDEGIPEEIPHENLYGFAWNPMTLV
GILQNIKGADTVRRVGTDALTPTFAKLLPMAFPNAELVDAEQAMQAARRI
KTPEEVQALRRALVVAEEGLAAGVAALGPGTTEKALAGAVLEAEAAGGVS
TPATQDAAWVTSKEHPWRRADSDGLVREGDLVALSAGVLADGYVAEVART
LCVGEPTDAVRALFRRRDDLWDRLIEACRPGMTTSGLLAAYEQAGERLPA
MPVAHGLGLGFDPPVVSPALRATAEADVLEEGMVLAVTAYVWEQGVGAVF
TRDAVLITVDGAEILSTAPAYGEAVHG
108800727YP_640924.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMGADVDSDPRRGPLDGFRVVDLSTGIAGAYCTKLLVDGGAEVVKVEPPEG
DPLRRWSASGADTGGDGALFSYLACSKHSVVADPAESSDIAFVEDLLASA
DAVVWSRGSALAEHPDVAPAAIHRRHPGLIVTAITPFGLDGPWTDRPATE
FTLQAWSGGIVGLGRGAPDRAPVYVGGQVGEYLAGAYASAATLAVRLRGV
GELIDLSMLETQILGLTYYPVTYHQMLGRPWRDARKLTVPGIARAKDGLV
DIGCGTAQQWFDLCAMTGHDEWIDEDSPLSITEQANEKAEELYAWVAEQT
VDEIRDLASAFRIPNAPVANGETVATLDHYVERGSFVTNPRDGFTQPGPP
YRLNPPVLRTPQPAPRLGEHTETYRRNSIPGRQAGGLAAGNPVSAQPTGA
QLPFEGLRVLDLTTFWAGPSCTHILALLGAEVIHVESARRPDGTRLIAGI
PATEQQWWERSPIFSGLNTNKKGLTLDLHTPRGRELLNRLIETADVVAEN
FTPRVLDHLGLDFAAVQALRPDAIMLRMPGFGLDGPWRDNPAFAYVIEAA
AGISWLTGYPDRNPNEPYSVGDPNAGIHALNGLLLALEHRRRTGQGVLVE
AAMVDAALNVAAEQVIEYSAYGALLGRSGNRGPTAAPQNLYLSDGIDEFG
RPDIWVAIAVATDAQWDALCAAIGAADWASDPALATQAGRRAAHDEIDER
LERWCGQRSADDIVEILWTAGVPVAKVMQPHRQTELPQLTHRGFFEEVAH
PVNPPAPHSSLPFRLSAGPQRFHRHPAPLLGEHTEELLAELGLTADDIAR
LAADKVIGHTV
108800725YP_640922.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MSDAVLVTGGFGLVGSQTVRRLVELGRRVVATDLQTDANRKAAGSLPDGA
EVRWADLTDSDQVDQLLTEVAPSAIIHLAAVIPPPIYRNPKVARKVNVDA
TATLVRAAEALPQPPRFVQASSNAVYGARNPHRHKAPVTAETPPNPTELY
GAHKLEAEEIVRASSLEWVVLRLGGVLSVDPKAMPLTTDALFFESALPTD
GRLHSVDVRDVAWAFAAATTADVVGEILLIAGDDTHKRRQGEVGPALAGA
RGLAGALPPGRPGDPERDDAWFITDWMDATRAQEALQFQHHSWPDMVAEM
SGQVGLLRYPLQLIAPLARVFVARQGAYRNKPGKYADPWAAIRSRLGDPG
LDRPR
108800723YP_640920.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MIPVLGDTAAKVGASVGLMQTLWRSRLIAPMRPDRYLKMGAAVRRVGMTA
TVGFATAAQRCPDRPGLIDERGMLTFAELDDASDALAVALQGLPGGTPGT
VAIMCRNHRGFIEALLAANRIGANALLLNTSFAGPALAEVAEREGADVVI
YDEEFSETVERALSGLPDAVRIIAWTDEPGGGAETTVDALIEAHRGERPR
PAERSSEIILLTSGTTGTPKGAKRSAGSGGAGDLKAVLDRTPWRAEETTV
IVAPMFHAWGFSQLLFAGLLACTIVTRRRFDPEATLALVDEHKATGLIVV
PVMFDRIMDLPDEVRARYSGRSLRFAAASGSRMRPDVVTAFMDQFGDVIY
NNYNATEAGMIATATPADLRAAPDTAGTPADGTEIRIFDPDFRELPPGET
GSIFVRSGTLFDGYTSGSTKDFHDGFMASGDVGYLDENGRLFVVGRDDEM
IVSGGENVYPIEVEKTLAAHPGVAEAEVLGVDDEKYGQRLAAFVVPAAGA
SLTPDELKEHVRDNLANYKVPRDIVILDELPRGGTGKVLRNELRAHLN
108800721YP_640918.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MAGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKQIDSVRIPL
STPEDLAETADLVKGLNRRIYTAEVDTRDFEALKAAVDAGVEQLGRLDII
VANAGIGNGGETLDKTSDGDWEDMIDVNLGGVWKTVKAGVPHILAGGRGG
SIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRTFAVELGAQNIRVNSVHP
TNVNTPLFMNEGTMKLFRPDLENPGPEDMKVVGQMMHTLPIGWVEPEDIA
NAVLFLASDEARYITGVTLPVDGGSCLK
108800719YP_640916.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MQLTFDADVEAFRAEFVAFLDANQPDEADTAQRPRSSADLPDWARRWQRL
LFDNGWLLPGHPPEFGGRNATILQQYAYQLELSRRRIYHSFNPQGVGIIA
ASLISFGTPEQQQKWAVPILRAEMTAALGMSEPGAGSDLASLRTRAVRAP
DAAHYVVNGQKVWTSGASEADVILTFVRTDPDAAKHRGISVLMIPTDSPG
VIRRPFASICDAGELDFNEVFFNDVEVPVENLIGPENDGWRVANGSLGHE
RTMLWLSYADRLQDLIDDFPAHTALDRDRYATMVIDSMAVRLLGSVALAR
AARGVDDAGALSVLKLLGSETGQRATEHALEAVGVDGLAHPTTVGPWTPL
NLDAYSCGWFERYTRTFAGTIAGGTSEIQRNIIAQRLLGLPRN
108800717YP_640914.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MIVDQQSLEMLETSLRKTMLSTSGPDLDAALTELGWAEMLTDMPDTAVPL
VFRLLGETGSHASALVDVVLHATGNTIGDTVELPLPYAGNSWVVWDRVGT
APNTTLGGLPLRREEEGYPIRVAEARLAVGWWLVGSARAMLRLACTHARD
RVQFGKPIAQFQAVRHRLAETLVAIEGAEATLTLPGSENPDLTALLAKAA
AGKAALTAARNCQQVLGGIGFTEEHELHVHVKRALVLDGLLGSARELTRK
AGAGLRARGSAPRLVSL
108800715YP_640912.1 hypothetical protein Mmcs_3750 [Mycobacterium sp. MCS]MTAPISESRLADHIEIQQLLAKYAVTITQGDIDGLISVFTPDGTYSAFGS
TYTLARFPELVDAAPKGLFMTGTALVHLDPDDPDKATGTQPLCFIEHSKH
DMRIGYYNDTYVRTDGGWRLRTRAMTFIRRSGEHDSGRPHAIGRPEAG
108800713YP_640910.1 hypothetical protein Mmcs_3748 [Mycobacterium sp. MCS]MSDTQERLLPEEFADLERFSDWILPTEPERYAKRLASTMEEMQDLYDVGM
ARLEEVMTYLDARFPLHGMPDDAKRLMHLMQSVVMVSFPVEVWKQPRVLD
SGAAWVEIIREPVV
108800711YP_640908.1 carboxymuconolactone decarboxylase [Mycobacterium sp. MCS]MRVAPLPADQWDDDVRRALSVMLPDERLNPEGAGNLLTTLARHPRLTRAF
LRFNVHLLFRSTLPARLRELAILRVAHLLGSEYEWEHHVAMGREVGLSDA
AIEGAARGEGADELDQAILDAVDQLQEKANISDHTWAQLSAHLDERQRMD
LVFTIGCYGALAMAINTFGVEPDQER
108800709YP_640906.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MQQSFSNTEENQVSGGMNFELTEDQQLIYKSVSELAARFDDQYWMEKDSN
HEFPTEFYDAIAGGGWLGMTIPEEYGGHGLGITEATLLAEAVARSGGGMN
AASSIHMSIFGMHPVVKHGSDELKARTLPRIASGDLHVCFGVTEPGAGLD
TSRITTFAKRDGDSYVVNGRKVWISKALESEKILLLTRTTPYDEVTKKTD
GMTLFMTDLDRAHVDIRPIAKMGRNAVSSNELFIDDLRIPVEDRVGEEGR
GFFYILDGLNPERMLIAAEALGIGRIALDKAVKYANDRHVFDRPIGMNQG
IQFPLADSLARLDAAELMLRKATWLYDNGKSCGREANTAKYLCADAGFTA
ADRALQTHGGMGYAEEYHVARFFREARLMKIAPVSQEMILNFLGSHVLGL
PRSY
108800707YP_640904.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMQTLPPLAGITVVTLEQAVSAPMCTRVLADFGARVIKIENPKGGDFARHY
DDVVHGQAAHFVWANRGKESLSLDLKSPAGMDILHRLLDGADVLVSNLAP
GATARMGIGAADLKHRHPRVIPVEIDGYGAGGPISHKRAYDLLIQAESGA
CAVTGYPGMPAKPGPPVADISTGLYAALSILALLYARKGDGAEPAPAVAV
SLFDTMTDIMGYQLTYTQHSGVDQQPLGMSSPAVAPYGAFPTRDGQTVVL
GTTNDREWQRLAREIIERRDLADDPMFASNSDRCAHRDILNEAIGSWCAQ
HDLAHIQKKADDAGIGNSRYNLPSEVVAHPHLTARDRWRPVETPNGEISA
LLPPPVIEGFEQPMGAVPGLGQHTDEILGGLGLSADEIAALREQGAVGPA
QS
108800705YP_640902.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MRRDLFTDDHDAFRQLARDFVEKEVVPQYPEWEKAGRMPREVFKQMGALG
MLGMAIPEEYGGAGIDDYRYNVVLQEEAARALVTLSTVRTQLEVILPYFL
HYANDEQRKRWFPGLADGTLLTAIAMTEPGTGSDLAGVRTTAVRDGDDYI
VNGAKTFITGGIQADLVVVVARTSTDPENRRRGLSLIVVEDGMPGFERGR
ELEKMGCKVQDTAELSFTDVRVPAANLLGEEGEAFSYLGHNLAQERLTVA
VGSVAQARSALHATIDYVKNRKAFGTPVASFQNTKFELAAVSTEIEAAQT
MLDRAVLDHVDGVLSREDAARVKLFCTEMQARAVDRCLQLFGGYGYMMEY
PIARLYNDARVARIYAGTSEVMKVIIAKSLGL
108800703YP_640900.1 hypothetical protein Mmcs_3738 [Mycobacterium sp. MCS]MTEQPDMRYRLDIVSPNVRDAVRFAGGWLYDRSMAGWDVTVLIDAAGEDV
RPLEILGATVLPLQPVLEAWTDRPHPQTVAVAADLIDCDERVRRHVRTAL
DSGYTEVTLWGERCPADLDDDVDAVRHELSAAARAFKAQALAAVNDIEAA
FVGQIETFRCGMMARPSVAADLIPAS
108800701YP_640898.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MTQSDSAPHVRDIDTARLATWMDEAALPGKGEPLQTFFLSGGTQNVIYEV
RRGEHRCVLRMPPPGAPPDRDKGILREWRIIEALDGTDVPHTAAVGVCDD
PGVLGRPFYLMGFVDGWSPMDTHARWPEPFDSDLSARPGLSYQLAEGIAL
LSKVDWRARGLADLGRPEGFHERQVDRWIGFLERIKRRDLPGLDVATAWL
RARRPLDFIPGLMHGDYQFANVMYRHGAPAQLAAIVDWEMGTVGDPKLDL
GWMVQSWPDDTDAPGESEMSYVDMRGMPSRDAVVAHYAEVSGRQVDDLDY
YLVLAKWKLAIVLEQGFQRAGDDEKLLAFGPVVTDLMASAAELAESSDYR
108800699YP_640896.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPRPATPMPTDRGQRRTSLQQERSRETKRMLVQAAMALWRTNGYANTTVA
DICTAAGVSKALFYFYFPRKEDVLFEVGVMSTRSARQTADALLAKPYEVP
AVIAAALADLERSMARNPPELVVAAILEGYRHEHRILAGAEAVEDDGGMF
TALFDRAQRDGKLARHIDAGHLAYLAHTLVSEGARHWAVGAFGDRSFTEV
VGADIDALIAGLSREP
108800697YP_640894.1 hypothetical protein Mmcs_3732 [Mycobacterium sp. MCS]MPSSTTGFVPSAPRAARLEACFEELAELTGQRNAIDGRIVEIVAEIDRDQ
LWGATGARSIPALVAWKLGLSSKNAKTIAAIAHRLDEFPRCTQALREGRL
SLDQVGAIAERATTGSDDHYAELATHASVSQLRTAIKLEPPPQPQPEPEP
VSDADVEPKPLPDPADLQPSITTTSDEQYTHWHIKVPHVDAAKVDAALHS
RLDGLIAQWKRDHGDHGDTDHKDARGFGRPPMPRLADAFMDLIDTAWDAE
AARRPHGDRTTVVMHLDINDRIAALHLGPLLSDADRRYLGCDATCEVWFE
RNGQPIGTGRTTRLINRRLRRALEHRNRTCVVPGCESTRGLHAHHIQHWE
DGGPTDLDNLVLVCPYHHRLHHRGIITITGPASKLTVTDATGRQLHSGSL
ARPPTTPPPTVPLYRGPSGERADWWWYTPFQPPPQAAN
108800695YP_640892.1 hypothetical protein Mmcs_3730 [Mycobacterium sp. MCS]MELPGTPSDDVPAVLAEGRGDIGTLFVSMATRHPDGADADYLRWHTLDHR
PEQHRLSAVRASLRLVSTPACRSARAVSTGPYDAIDHVMTYFFTDPGGME
PFLALSKALGDAGRKLPLLPPVERGVYEVGAKAAAPRVKVGADVLPWWPV
RGVYLLLERGASTSTDLLGVDGVAGVWTATSLPVGARLASAPAGQTLSYC
FLDEDPVDTAGRLLPVLQQRWREPGVTPLFAAPFHPVVPYEWDRYVP
108800693YP_640890.1 alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]MTVVLVHGNPETDAVWDPLVDALGRTDVVRLSPPGFGAPLPGGFPATFIA
YRDWLVAELQSIGEPVDLVGHDWGGGHVVNVMMHRPELVRSWASDVVGLF
DRDYVWHDMAQGFQTAETGEQLVAMMQEGSVQDRTQQLVGFGVPADVAAS
FATALGPEMGRAILALYRSARQPALADAGRALENAAARPGVSLVATEDPF
VGSEEMRRRAADRAGARTEVLDGLGHWWMVEDPTAGAAALTRFWESLDG
108800691YP_640888.1 ATPase [Mycobacterium sp. MCS]MLNSTAAVTTPVSNAPFYRAVRDEVEVFRAAARRGLPVLLKGPTGCGKTR
FVEAMAHQLGRDLITVAGHEDMTSADLVGRFLLKGGETVWVDGPLTRAVR
EGAIFYLDEVVEARQDTTVVIHPLADHRRELPVDRLGTTLQAAPGFQLVI
SYNPGYQSVLKNLKESTRQRFVAIELGYPSPEVETEVVAYEAGIDTQTAR
ALVKLAYAIRNLDGSPLREVSSTRMLILAGGLAAEGLNLRSAVHAAVVQV
LSDDEDVIRALDELVDTVLPRSRGGGDIRPET
108800689YP_640886.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVEPWTRERRLERTRSLLLDAAEEVFAEKGFMTATLDDIAKAAGYSKGAI
YKYFATKEELFLAASDRYWRRYFDNFAEVMSSSDHIGARELENIGERWRQ
LSRDRGAEHAALGLEFNLYLLRNPEARERVAAKRSEVVDQLAAYIVEGID
SLGATLLIPATTFAHIIIATTDAVELASHLDDIDLYQSIVEMYVSAVKMP
108800687YP_640884.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVERWTRERRLEHTRSLLLDAAEDVFAEKGFAPATLDDIAHAAGYTKGAI
YKHFSTKEELFLAVSDRYWRRYFENFAEVMSSSEQVGSRELDEIAARWRE
LSRDRGAEHAALGHEFALYLIRNPEARKRVAAKRSEVVEALAAFIVEGID
RLGGALLIPPMTLAQVLVATSDSVVLGSELDDVDLYRPVIEMYMSAIKLP
DH
108800685YP_640882.1 integrase catalytic subunit [Mycobacterium sp. MCS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGRIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALGGLPPISRLTPTS
108800683YP_640880.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MAVRGDELFIGGTWCAPSTDRRIEVISPHTETTVGHVAAAAPADVDRAVG
AAREAFDTGGWPRTSPAGRIDAVRRLAANYERRRSEMAELITSEIGAPIS
FSQRAQVALPWSMINAFCDLAQTYPWREARPGRYGSDIQVLREPVGVVGA
VVPWNMPQFLIVTKLIPALLAGCTVVVKPAPESPLNALLLAEVIAESGLP
PGVVSVLPGDGSVGEYLVGHRGVDKVSFTGSTAAGRAVATACAADLRRVS
LELGGKSAAIVLDDADPVVVAAGVRSASLSNSGQICNALTRVLVPRSRAG
EFTDALAAEVSALVVGDPTDGATQVGPLVARRQQQRVTGYLEQGVRDGAR
VVTGGTGMPDGLDRGWYVKPTVFDRADNSMTIAREEIFGPVLTVVAYDNE
DEAVAIANDSDYGLAGSVFTADTDRGLAVGAAIRTGTFGVNQGYTMDPFA
PFGGVKSSGYGRELGREGIDGYVDTKSISVAPKQDLATAAAGKGA
108800681YP_640878.1 hypothetical protein Mmcs_3716 [Mycobacterium sp. MCS]MSDTATTTAKLPPEFADLEQFSDWCLGSEAERYAKRLNSSMREMQAFYDA
ITARAEEAISYCDKFPLDDMPDDVLNLMHLLYSMIQVSFPVECWKQPKVP
DSGATTLDCDAEPFP
108800679YP_640876.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MELTDNILWLLKQAFYFSLTTVNEAVSEHGVSTAQIGVLRQLSNEPGLSG
AELARRLLITPQGVQLAVKALEQRGFVERRPDPQHARILQAYLTAEGRRV
AAAVVSDAIAAHEAVFGVLTPDEQKTLRDLLARVVVKGTGHTLADDHVGE
108800677YP_640874.1 ferredoxin [Mycobacterium sp. MCS]MSEPVADFSPLRVKRVVRETSDAVSLVLDVPRHCSGRFRYQAGQFLTLRV
NLDGQELRRCYSMSSAPVEEELRITVKRDPGGLVSNWLNDTVSEGAEIHA
APPEGRFLLRDTDSEIVAFAGGSGITPIMSLIRTALATSARSIRLFYANR
NRGSVIFADDLARLVEHNADRLVLTHHYDDDSGVVTPAAIESFVAGAGDA
DFYICGPGPFMDTVEGALATRGAPRDRVHLERFQVAQVPAGADASEAQAT
EEIVIELDRKTTTVPYRSGNTLLQTARTAGLRAPSSCETGSCGTCMAQVV
SGSARMLNNDALDDDEVADGWVLTCQSLPTSRSVHVVYE
108800675YP_640872.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MGRWPKPPEGSWTEHYPELGTGPISFRDSVSPEFYELEREAVFKRAWLNV
GRVEELPRVGSYLTKQIDVAGVSVIVVKGRDEQIRAFYNICRHRGNKLVW
NDFPGEEVKGTCRQFTCKYHGWRYGLDGALKFVQQPGEFFDLDTEKLGLA
PVQCDVWNGFIFINLDPEPRWSLREFLGPMITALDDYPFELMTERYEFEA
HNNSNWKIFADAFQEYYHVPSLHSQQVPSAVRQPNATFECGHFQIDGPHR
LVSTAGTRRWLLDPEFMYPVERITRSGLVGPWRTPETLQSAGLNPGGIEP
WGITNFQIFPNLEILIYHGWYLLYRYWPTSHNTHKFEAYNAFHPARTVRE
RIEHEVASVVLKEFALQDAGMLGGTQAALEYGLDEPIIDDYPLSDQEILV
RHLHHEAVKWVDDYRAERAPVGVRA
108800673YP_640870.1 taurine catabolism dioxygenase TauD/TfdA [Mycobacterium sp. MCS]MTVLTINKLTASVGAEVTGLDPDALAGDEALGAAVLEALEDNGVLVFPGL
HLDPQAQVEFCRRLGEVDHSSDGHHPVAGIYPVTLDKSKNSSAAYLRATF
DWHIDGCTPTGDEYPQMATVLSARRVAESGGETEFASSYGAYDHLDDDEK
QRLASLRVVHSLEASQRRVTPDPSPELLARWRSRPTHEHPLVWTHRSGRK
SLVLGASADYIVGMDLDEGRALLADLLDRATQPELVYSHTWSVGDTVIWD
NRGVLHRAAPYPENSPREMLRTTVLGDEPIQ
108800671YP_640868.1 cytochrome P450 [Mycobacterium sp. MCS]MAEDLTSVDFFRDGRLTDDPYPFYAALRDKCPVTREDHYGVTMVTGWQEA
VDVYNDAETFSSCISVTGPFPGFPIPLEDFKDGDVTELIEKHRDEIPFSD
QLPTLDPPTHTNHRALLMRLITPKRLKENEDAMWQLADDILDEFLAPGQG
EFIKGFAAPFTLRVIADLLGVPDEDRPELLERLAKGTHGGALGSADKALT
KTPLEYLYDVFAEYVEDRRREPRDDVLTGLATASFPDGTMPEVGDVVRVA
TNVFSAGQETTVRLLSTALKVMGDQPEIQRALREDRSLLPNFIEECLRIE
SPVKGDFRLSRVPTTVGDETLAAGTTVMVINGAANRDPRRFEDPDTFDPQ
RKNARQHLAFGRGIHSCPGAPLARAETRVGLERLLDRTTDIRISEAHHGP
AGERRYDYIPTYILRGLTELHLEFDTTGVEAEEKP
108800669YP_640866.1 hypothetical protein Mmcs_3704 [Mycobacterium sp. MCS]MPKAYVLLTEDVKDPAGMAEYGKLAGQTMGTAKVLAFGPAVENLEGQWHG
NQTVLLEFESVDAAKQWYYSDEYQAAAKLRQAAADCNGVIVSGLG
108800667YP_640864.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MLPATRPGDWLDPASGLGSSLDDVEPGTFNTTIPTDRYTCRDYAARERDA
IWMRVWQIAGRVEDLPKPGDWKKYQILDQSFIIVRGKDGTLRGFVNACRH
RGNALCVTETGNAKRGFLCQYHLWSYDLEGRLKGMLREDLAGPIDKTENS
LLPVSVDTFAGFLFLNPDPDAEPLREYLGEDVVTLLEPYNIEQFTTVMDV
TEAIDCNWKVVMDAFEEGYHINGIHPQLLQVLHINPRTARYRFFENHSVA
MAPFEVVGAGVQDQVAGILALPETFPGTVAVIPRFQELIAPYQDSDGNVD
FPEGVTARLLLQQATREVLTGMGLDVSALTDDQMVDNQGWVLFPNYFMTV
RAGECHVIMSAPHPDGDPNRCIWHVASYMYVPQEFRDAVRAEAIVVDTPG
SHKYFEALQQDYEQMPRQQKGLRNDRLDHMSLVKEEVVIAHYHSVVDRYM
ESRTR
108800665YP_640862.1 hypothetical protein Mmcs_3700 [Mycobacterium sp. MCS]MTTIEDVIGESTGRSRAVLEYSQTMGRLVKSAKDPGFSVDSWAPLAELIA
VDEFIRIGPFKEVMNWDEYVEFLTNWAKSSDWDCSFKRLTETADVAFLEL
EERSRIGDFSSVVNSASVYEFNADNKIRYIAVYLQMQLPDPATLPDFQGD
108800663YP_640860.1 cytochrome P450 [Mycobacterium sp. MCS]MTTPKTNSDLVFDPFSEEYFNEPWEIYRRMREEAPVYYNEELDFYALSRH
ADVAAAFKDYQTFSSAYGLDLSMVKTGEPAPFKMIILMDPPEHRQMRSLV
NKVFTPRQIAKLQPMVEETIDSCFRAADPEHFDVVQEFAAFFPVEVITRM
LGVPEDRRQQVRQWVDTSLHREPGQEEMSPEGMQAIADAMGLYFELIAQR
RENPQDDMFTALVQAEIEREDGRMERLDDLEIAGFATLLGGAGAETVTKL
IGNAAVTFARFPDQWQKLLDDRSKIPAAVEELLRYEAPAQYNVRRSMQDV
TIHGVTIPAGKPVFLLGGSANRDPEAFTNADTFDIDRDRTEAQNLGFGYG
VHSCLGAALARMESAIALERLLDFMPRYEVLWDECRRVAMQNVAGWSHVP
VRVLR
108800661YP_640858.1 cytochrome P450 [Mycobacterium sp. MCS]MTKPRLKFDPVSQEYFDNPYEIYRRMRDEAPVYYDEAEDFYALTRHEDVA
AALKDHESFSSSRGCDLAMVRSEEGPAKSIIFMDPPEHRHMRSLVNKAFT
PRAIQSQRETITELVEHYLSQVDPDGFDVVQDFSGPFPVEVITRMAGVPE
AFRQQVRHWIDKGLERKPGQLAWSDENMQANIDSGVYYYGLVQERRRNPQ
DDMISRLIAAEIPGENGEMRKLDDIEITGFTSLLGGAGAETVTKLVGSAV
VEFARNPEQWQLLLDDRSLIPAAVEELLRYVGPVQYNVRYTLKEAVLPNG
TVPAHKPVFLMNAAANRDPRAFDNAETFDITRDRAQAQNLGLGYGIHSCL
GAALARMETAIALEHLLDFMPRYEVDFDGLERVHMQNVAGYHHVPVRVLK
108800659YP_640856.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MRVGFIGLGSQGGPMARRIVEGGYELTLWARRPASLEPYADTAAKTAGSP
AELAAASDLVCVCVVGDDDVREVLYGDTGVLAGLAPGAMIAIHSTVHPDT
CREIAEKAAAQNVSVIDAPVSGGAPAVEQGKLLVMVGGEEADVEKARPVF
ATYADPIVHLGPLGSGQVTKILNNLLFTANLGSALSTLELGESLGIPRTQ
LAEVLNGGSATSKALGSISMFGGTVEALAPIAGALLQKDVRHAASIAARA
SAPKGSVFTAADTALESMDHPR
108800657YP_640854.1 hypothetical protein Mmcs_3692 [Mycobacterium sp. MCS]MADIPGRPLPQVTAQNEFFWTAGADGELRIQQCQDCESLIHPPQPICRYC
RSQKLGVRTVSGRGTLAGFTVNHRFGFPDLPPPYVVAQVAIDEDPRVRLT
TNIVESDPDGLELGQPVEVVFQQADDVWLPLFRPVAGDPGELPADEIAPE
RFGDHIRPMLRTEKFEQHSAITGIGASRLGRRLMVPPLSLTIEACEAAVA
DAGLTLDDIDGLSTYPGLDVAGMGEGGVTALEGALGLRPTWINGGMDTFG
PGGSVIAAMMAVATGMARHVLCFRTLWEATFGQLLKEGKMAPPGGGRTTS
WQMPFGATSAAHTLALNAQRHFHRYGTTRETLGWIALNQRANAALNPTAI
YRDPMSMEDYLSARPITTPFGLYDCDVPCDGAVAVVVSAVDAARDMPKKP
VFIEAVGTQIVERTDWDQTTLTHEPQVLGQSAHLWTRTSLRPSDVDVAEL
YDGFTFNCLSWIEALGFCGIGEAKDFLDGGHNIARDGVLPLNTHGGQLSH
GRTHGMGLMHEAVSQLRGEAGDRQVADARVAVVSSGGLTPSGVLLLRSDA
108800655YP_640852.1 respiratory-chain NADH dehydrogenase domain-containing protein [MycobaMNPTAATDLTTAVWPGTTPRLLHVPAGREDYADYAQSGGYRELPDPERLL
EEVELSGLLGRGGAAFPMAVKLRSVRDHGRTRGGAVAIANGEEGEPASIK
DRWLLRHRPHLVLDGLRLAARVVEAERAIVYVSDPESARSVETALTQVDS
PVLDGVSISVVVVDPGYVAGEETAAVRAIDGGPAKPTDKPPRPFEEGVGG
LPTLVSNVETLANLPYLHEHGAREYRSAGTPSSPGTFLATVTGGGGPPAL
YELPHGVALADVLTWHGISPDSVSGVLMGGYFTGLLNRDVLDATLDHEAL
RRLGSGLGCGAVGVLTDECPVAVAASVLAYFDRENAGQCGSCFNGTAAMA
AVAVALRDGVASDDDLARLERWSVVLRGRGACGTLDAATNVAASLLTAFP
QAVARHREGSCDRCAVDLYDVRRPYEVEAVVSA
108800653YP_640850.1 hypothetical protein Mmcs_3688 [Mycobacterium sp. MCS]MTTTDDTTEQVGPQLKRGEKVIEINGGRVVYEILGKTGDFIALTPGGRFS
KDIPGLRPLAQALVKGGYRVLLWDRPNCGKSDVQFYGQSESHMRAETLYQ
LITTLDIGPCILAGGSGGARDSMLTTMLYPEIVTKLVVWNIVGGVYGSFV
LGSYYIVPSILAVRGAGMKAVAQVAEWQERIAENPANRDRILSLDADEFL
KLMLRWLNAFVPKPGQTIPGVEDEMFDNIRVPTLIIRGGENDLDHPKRTS
LEVSCLIKGSTVIDPPWPEDAWERAGEKRASGKVKRFNMFDTWVQAAPAI
LDFLGR
108800651YP_640848.1 amidohydrolase 2 [Mycobacterium sp. MCS]MTVTANPRVPAAERIAVRCVDSDVHPTPRSGELGQYIPEPWRSRYFGTHK
VGDQIYYDAPDYAHSYAMRVDSFPPDGEFACSDPDLAFKQLIMEAGADIA
ILEPAAYPARIPEAQHAMSVGLNDWQANHWLDSHNNWHERWRGSICLAIE
EPEASVAEIERWVGHPYMAQILIKAEPRPSWGNPKYDPIWAAAAKHDITV
ACHLSRSHYDELPMPPVGLPSYNHDFMVTYSLLAANQVMSLIFDGTFDRH
PNLRIVFVEHAFSWILPLMWRMDALYEARKSWLDIKRKPSEYVKDHIKFT
TQPLDYPEDKTELTRAFEWMECEKILLFSSDYPHWTFDDPRWLVKHLPEH
TREAIMFRNGIETYKLPDTVPALEGQVRVF
108800649YP_640846.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MLLEFDADQRLWQETVRDAVTKQCPASLVREIAENGVDPTPLWKSYVDAG
WTELTDPENAVELAIVCEEMGRATDPTPFLSTMTQYAPLAADRFDPQQAG
AAVYDGISAVRDTEGWVLDGAARYVLDGDRADRLAVVTDAGVFVVDAAVA
IRRRSPVFDPVLHVADVSFDAVRVPDTDRVRTDSERARHLALTGIAVTTV
GACQRILDLALDHVKQRQQFGVPIGSFQAVQHKAVDMHVAVERARALAYF
AALTIAADDPRRRLAASMAKAAAGECQSLVFRHGLQLFGAMGFTWENDLQ
FALKRAKAGELLLGGAAEHRATIAEEFHAADF
108800647YP_640844.1 hypothetical protein Mmcs_3682 [Mycobacterium sp. MCS]MLKLSRKNIAITLGGLAVAIPLSAGVASAQPNLGPIINTTCTYDQVIAAL
NDQHPDLAAQFAQQRSGQQAVRNFLAASPQQRQATVAFLQSNPTAQAYFG
PISNVAATCNNY
108800645YP_640842.1 cytochrome P450 [Mycobacterium sp. MCS]MSSVDDLRGEPASSDRKKNSYHFDRHTPEYRLQFEKITEEMQTKCPMAWS
DTYGGHWVAADSRHVFELARCPAVSNHHDISGETPFQGITIPKASRATVV
RGGILEMDEPEHSAYRGALNPYLSPAAIKRWEPFVDEITRAALDEHIESG
RIDFVEHLANVVPAVFTLAMMGISLKKWNVYSEPTHASVFTPEHSPEREK
INEQHREMGIDLITNMMEIRENPRPGLVNALVQLRIDGEPAPDMEILGNL
GLIIGGGFDTTTALTAHALEWLGEHPDQRERLSRERATLLHPATEEFLRF
FTPAPGDGRTFADDVEVEGQQFKKYERLWLSWAMANRDPSVFTAPNEVIL
DRKGNRHFSFGIGVHRCVGSNVARTVFKSMLTAVLDRMPDYVCDPEGTVH
YDTIGVIQGMRNLPATFTPSKPLGPGLDETLEKLQRICDEQELARPITER
KEAAVID
108800643YP_640840.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MGRVEGKVAFITGAARGQGRSHAIRLAEEGADIIAIDICADIETVGYPLA
TREDLEETAQYVEKAGRKAVIAQADVRDAAQLKQAVDNGVAELGHLDIVV
AQAGIAAMKGAPPMQAWTDGINTNFVGTINAIQVALPHLKEGASIIATAS
AAALMDASKKDRPGADPGGMGYMTSKRLISQYMHDLATELAVRNIRANVI
HPTNCNTDMLQSEPMYRSFRPDLEKPTRADAELAFGVQQAMPVPFIEPED
ISNAVLWLASDESRFVTGMQLRVDAGGYLKWYDYHV
108800641YP_640838.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MAQTPTVSADRQSAAGSRAGDVQADRRLLIDGRLVDTGRVFPSLNPATGQ
VLGYAPDATVADAEAAVAAARRAFDTTDWATNVELRLRCLDQLHTALVEH
RDELAALTIAEVGATEALCQGAQLDQPIAIVRYYADLLADYPMTEDLGNI
ESRGMQHHRWVEKEAAGVVAAIIAYNYPNQLALAKLAPALAAGCTVVLKS
APDTPLITLALGELIAEHTDIPAGVVNVLSGADPEVGAVLTTSPDVDMVT
FTGSTPTGRRIMAAASETLKKVFLELGGKSAAIVLDDADFNTAALFSAFS
MVTHAGQGCALTSRLLVPARHKDEIVEKIKNNFGLVRFGDPADPSTYMGP
LISEKQRDKVDGMVQRAVAAGASLVTGGEKVDPGYFYSPTLLADVDPDSE
IAQEEVFGPVLVVIAYEDDDDAVRIANNSIYGLSGAVFGSEERALAVARR
IRTGTFSINGGNYFSPDSPFGGYKQSGIGREMGTAGLEEFLESKTFATVV
G
108800639YP_640836.1 hypothetical protein Mmcs_3673 [Mycobacterium sp. MCS]MARGSGPERWTPGLPQVKNLAGPMAAVGGLFAMSADAIRNVFRRPFQWRE
FLEQSWFVAKVSLAPTVLVAIPFTVLVSFTLNILLRELGAADLSGAGAAF
GAVTQVGPLVTVLIVAGAGATAMCADLGSRTIREEISAMEVLGIDPVQRL
VTPRMLASGLVALLLNSLVVIIGILGGYTFSVFIQDVNPGAFAAGITLLT
GVPEMIISCVKALLFGLIAGLVACYRGLTVSGGGAKAVGNAVNETVVYAF
MALFAINVLVTTVGIHMASE
108800637YP_640834.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MKGSAVRPLTGLALLVAIGLIIALAIGLFAGTFTRTVPVTVVSDRAGLVM
NPDAEVKMRGVEVGRVETIERRPDGKAVLHLAMNPSQLHLIPSNVNVDIA
STTVFGAKFVRFFPPEDPSPEKLRKGQVIEGQHVTVEVNTVFQQLVEVLD
KIDPAKLNETLGAISSAFNGRGEKFGQTLVDLNAVLAKIEPSLPNLAQDI
EASVPTLTAYGDAAPDLISAVQNTTQFSNTIVDQQQNLDEFLVSAIGLAD
IGNEVIGGNREALGDVLENLVPTAELLNTYKKSLWCGIGGLIPFAKSGPQ
YSGIMVSAGLTLGVERYRYPGDLPKVAAKSGGRDYCKELGLPELPPEFVP
PMVVGDVGSNPAQYGNAGILLNSEGLKNWLFGPLDGPPRNTAQIGMPG
108800635YP_640832.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MDKYRGSQLIKAGIIGVVLMILVIMIGLQPIRLLSWATALRYQALFTEAG
GIAGGNDVTVSGLKVGQVSSVELVNGDALVSFTVDGKYALGSDTTAHIRT
GTLLGERVLALESEGSGTLDRDQPIPTSRTSSPFSLTDAVSELTANTAET
DTDSLNRSLDTLSETLDQIAPQLGPTFDGVSRLSRSLNNRNESLAELLKT
AGDVTGIFSERSQQVNSLILNSNDLLAVLNERRYAITSLLRSTAAVSREL
TGVVAENEQELAPTLKHLNEVMAMLERNRDNLAKILPGAAKYYLTQGEIV
SNGAYYNALVPNIQPAQLLQPFLDYAFGFRRGMDAGQPPDDAGPRAELPF
PINAIPQPGDLPDDGTP
108800633YP_640830.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MKRLTVAGSCLALTLTGCSFQGVNSLPLPGAEGTGPGATSYTVEIANVAT
LESNAPVLIDDVVVGSVRKMTVDDWHAEVQISVKPDVVVPANAVATVGQT
SLLGSMHLALNPPLGESPEGRLQAGATIPLSDSSTYPSTERTLSSLSVVA
NGGGLGQIGDIIHNFNLALSGREPEIRQLITRLDNFVGVLDAQRENIIAS
IQQLNRVAGTFAGQRDAIDRALKEIPPALDVLISERPRLTAALDKLGKLG
DTATALVEDAGDDLVKDLENLGPALGALADIGPDLNLALLWASAFPYGPT
FADRITRGDYINLFATFDITYPRLKKTLLLGTRWGDENAKLIPAPGDPYY
LNYSYSPMSIGVAPPPAEAPAGATMPPVSGPLLPVSPPPPAAPWLPQAPV
STSAQIFAGPYGAESAPPADAQLPAPPADAQLPAPPADAQPPAPPADAQP
GGGG
108800631YP_640828.1 hypothetical protein Mmcs_3665 [Mycobacterium sp. MCS]MRGFDIAVGAAAIALVASVGVATPAAASNFGVELNGTYSVMSDGEWALRN
AGPFGMGGAQSFFDQQTVVETWTVTTECVSPIECFGEVKSDRGYTATIRL
EDFWLIDHDVPNWLPCPNGTFAPGHQKFILEGVNPARNEFVNNPDFLVGR
NVTKSASGACGRNQPVVVEMPVKMQKLS
108800629YP_640826.1 cytochrome P450 [Mycobacterium sp. MCS]MTADFDSVDYFTDPSLVPDPHPYYDHIREKNPVCCPINNGVLAVTGWEAA
NTVYKDSENFSSCVAVMGPFTPMPFTPEGDDICAQLEAHRTEIPMYEHMV
TMDPPQHTDARSILSRLLTPKRLKENEDFMWRLADRHIDEFIADGQCEFL
AAYAKPFSLLVVADLLGVPEEDHEEFREAFGAERPGSNIGGLDHEVIAAN
PLAWADEKFSRYIEERRESPRDDVLTSIATAKYPDGSTPEVVDVVRTATF
LFAAGQETTAKLLGAAMRVLADRPDIQQQLRDDRSLIPVFIEECLRMDSP
VKSVFRMARKTTTLGDAAVPAGTTVMVSPGAANRDPKRFDNPHEFSLDRK
NVREHIAFSRGIHSCPGAPLARVEGRVSIERILDRMADITVSEEKHGPID
ARRYVYEPTFILRGLTEINIEFKPVG
108800627YP_640824.1 hypothetical protein Mmcs_3661 [Mycobacterium sp. MCS]MKLSQTNGRTRRSVLPTLIAATAIAAGGVLFAPTQAGAQGPPPLPPLHNV
KYTVFAEQPFFVDIYYRDVDPENWAAYSHNPYVYSPKVAAQVGPDQQWNL
DVQLAKPDQWAMVTATSGPGEQTPNIHCVLAVDGVVVATHQGPKGALCSI
RKW
108800625YP_640822.1 hypothetical protein Mmcs_3659 [Mycobacterium sp. MCS]MAKALAPEISTWPEDQPQLIGSRCGRCEATTFPVQNHCPKCSAGEMSPVL
LPRRGTLIAWTTQGFPPGAPYKGPTGKDFAPFGVGLVQLEDVIRVEGRLT
ENDPARLEFGMPVELTMIPFTKDEDGEDIVTFAFQPV
108800623YP_640820.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MREIPVELIKRYEQEGWWTPETLGELLARHLATGPDTGFCVYSDVRPYRG
TFGDVELQARRLAAGLRRRGVGPGDVVAFQLPNWAEAAMAFWASAFLGAV
VVPIVHFYGRKELAHIMATARPKVFITVAEFGRMTFQPDLCADVPIVGLV
GEAGFDELFDDESMTDTVHTDPAGPALIAFTSGTTRDPKGVIHSHQTLGF
ETRQLLENYPPDRGRQLTATPVGHFIGMVGAFLIPVLENAPIDLCDVWDP
GKVLGLIETEGLSVGGGPPYFVTSLLDHPDCTPEHIARFSTVGLGGSTVP
AAVTRRLADLGLFVFRSYGSTEHPSITGSRPTAPEDKRLYTDGDPRPGVE
IRLTDDGEILSRGPDLCLGYTDDALTAQAFDDDGWYHTGDVGVLDADGYL
TITDRKADVIIRGGENISALEVEEVLLSMPAVAEAVVVAAPDARLGEHAA
AVLRLRNGHPMPTLDDVRAHFEHAGVARQKWPEELHQVDEDFPRTASGKV
QKVLVREQIRQCSPTRDIAAFSK
108800621YP_640818.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. MCS]MTYVPKWSTIPEMVLSAADRFGDAEAVVDGPLRLSFAEVVHRIRCAAGAF
ADLGIGKGDRVAIWAPNSAEWIIAAFGLLTAGGVLVPVNTRFKGEEAADV
ITRSGARAVLVQQGFLGVEYAAPEGVPVIDLKSDFLAGGEPFSRTVDSSD
ISDIIFTSGTTGRPKGVMMNHRQNLRLYEEWCNLADLRQGDRYLMVNPYF
HTFGYKAGLIASFIRGATMVPVPVFDVDRVVDLIAAERITMLPGPPTLYH
SLLSVADKSKLATLRAGVTGAADIPVELVRRVLEELPFQTLATGYGLTEA
GTATLSRPGDSFADIATTVGTACDGVEVRIADDGEVLVRGYSVMQGYLDD
PAATAEAIDPDGWLHTGDLGTLDDAGRLRIVGRKKDMFIVGGFNAYPAEI
EGFLLEHPDVAQAAVIGVPDERMGQVGKAFVVRRDGHAGPLSAEGLIAWS
RERMAGFKVPRYVEFLDELPLNATGKVMKDQLR
108800619YP_640816.1 twin-arginine translocation pathway signal [Mycobacterium sp. MCS]MTEKDDASVTDTSVTDVEPSVDEIDRRDESLEDVSEGESEGAVQSRRRLV
GAVGMAVLAIALIASVGATAWLYFFQFRPDQETDSEAAKVAIDAASQASV
SLLTYSPETLDKDFAAAKTQLTGDFLDYYTDFTEKIVTPAAKQKQVKTSA
AVVQAALSQLSPESAEVLLFINQTTTSKENPDGAYAASSVKVGMTKIDGA
WKISSFDPV
108800617YP_640814.1 major facilitator transporter [Mycobacterium sp. MCS]MRPWIVWATGLLAYIVAVMDRTTLGVSGLDAAERFSATPSVLATFVVLQV
VVYAGAQVPAGVLLDRFGSKVLIAAGAALMAAGQLTLAVSEALPAAIAAR
AVLGLGDALTFISVLRLVPHWFTPKQVPLVTQLTGICGQLGQVLSAVPFL
AILGVAGWTTAYTSGAALGLASLVLTLVLVKDTPSGRHVPESRGTVGDTL
RSVKTVWLRPGTRLGFFTHMGTQFSVTVFALMWGVPYLTVSQGLSTSAAG
TLLSVSVASAIASGIVIGVLTGRHPHRRSWLVLGIIGSNALVWTVVLALP
GRAPLWLLVTLVIVISVGGPGSMVGFDFARTFNPSATLGTAQGMVNMGGF
LASLLVMQAMGQILDATGGYSFESFRWAWTAQYAVWTLATVGILITRGKA
RRGMRLEQERMLLESFEAHPAPRSEG
108800615YP_640812.1 hypothetical protein Mmcs_3649 [Mycobacterium sp. MCS]MAAPAVLGMSAGLQAVASALAPTAAAAPLGVLLDYAAGVLKATDIRASGA
IGAIRYVSDRRPGGAWMLGKPILLSEARDLYQNGLKIVSCYQFGKADTAD
WLGGQNAGVQHAKRGWELHVAAGGSYGAPIYASIDDDPTFEQYKQQVAPY
LKGWEAVLGRQRVGIYANSKTIEWALQDGIGTYFWQHNWGSPGRVAHPAA
HLHQVEIDARTVAGVGVDINHILRPQFGQWD
108800613YP_640810.1 4'-phosphopantetheinyl transferase [Mycobacterium sp. MCS]MAIVGVGIDLVSIPDFAEQVDRPGTVFAETFTPGERRDAADKSSSAARHL
AARWAAKEAVIKAWSGSRFAKRPALPEGIHRDIEVVTDMWGRPKVRLTGD
IAEHLREATIHVSLTHEGDTAAAVAVIEEP
108800611YP_640808.1 hypothetical protein Mmcs_3645 [Mycobacterium sp. MCS]MKRRPTTLVPMSDVVARVQEVLPSVRSDLEDLVRIESVWADPARRDEVQR
SARAVADLLGAAGFDDVSIVAEGGAPAVIARHPAPPGAPTVLLYAHHDVQ
PEGDPGQWSSPPFEPTERDGRLYGRGTADDKAGIATHLAAFRAFDGKPPV
GVTVFVEGEEESGSPSLANLLAAHKESLAADVIVIADSDNWSTDRPALTV
SLRGLADCVVEVATLDHGLHSGLWGGVVPDALTVLVRLLASLHDDDGNVA
VAGLHEGSAADVDRGPDWVREESGLLPGVSEIGSGSVVQRLWAKPAITVI
GIDTTPIDKSSNTLIPRARAKISMRVAPGGDAKAHLDALTRHLEAHVPWG
ARLTVTPGDTGQPYAIDAAGPVYDAARAAFTQAWGATPVDMGMGGSIPFI
AEFAAAFPQATILVTGVEDPGTQAHSVNESLHLGVLERAATAEALLLEKL
GAS
108800609YP_640806.1 hypothetical protein Mmcs_3643 [Mycobacterium sp. MCS]MADRDPEAIKKDIDAARDQLALTVDSLAERANPRRLADDIKTQVIRFVSQ
PPVAVSLAGVTLLIVVVAVRRRR
108800607YP_640804.1 ErfK/YbiS/YcfS/YnhG [Mycobacterium sp. MCS]MWQVRSVTRPRRQRAWWAGMLVVPAMVLGLTSCSSDSEEQAQQVITDKGT
PFGDLLVPKLTSSVTDGAVGVAVDSPVTVAAEGGVLGSVTMVNEDGEAVS
GKLSQDGLTWATTEPLGYNKSYTLTAKSMGLGGVTSRQMTFETHSPENLT
MPYVLPNEGEVVGVGQPVAIRFDENITNRLAAQRAISVKTDPPVEGAFYW
LSNQEVRWRPAEYWEPGTKVQVEVNTYGVDLGDGLFGQDNVKTQFTVGDQ
VVATADDSTKTLTVRRNGAVVKTMPISMGKNSTPTNNGTYIIGDRYSHLV
MDSSTYGVPVNSPNGYRTEVDWATQMSYSGIYVHSAPWSVGSQGQSNVSH
GCLNVSPSNAKWFFDNTKRGDIVEVVNTVGSVLPGTDGLGDWNIPWEQWQ
AGNAGV
108800605YP_640802.1 hypothetical protein Mmcs_3639 [Mycobacterium sp. MCS]MTSESTDGRAAGIAAGYATEGQALELGTVVVDGVADPAARVRIPLATVNR
HGLVAGATGTGKTKSLQVLAEQLSAAGVPVLMADVKGDLSGLARPGEPGE
KVSERAADTGDAWTPTAYPVEFLTLGTGGVGVPVRATVSSFGPILLSKVL
GLNQTQESTLGLIFHWADQKGLPLLDLKDLRSVIHFLTSEEGKPELKALG
AVSSTTAGVILRTLINLEAEGADTFFGEPEFEPDDLLRLHADGRGVATLL
ELGSQAARPVLFSTFLMWVLADLFTTLPEVGDLDKPKLVFFFDEAHLLFA
DASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDVPNGVLSQLGARVQHAL
RAFTPDDEKALRKTVRTYPKTDVYDLQSALSTLGIGEAIVTVLSEQGVPT
PVAWTRMRAPRSLMDTIGAEAITAAATASPLQAEYGQTVDRESAYERLAA
RLAPPPVAPPADLPPVPPPYDIPPMPAPAPEPGLFDKVMDSPAFKSAMRS
AGTVIGREITRSIFGTGRRRRR
108800603YP_640800.1 major facilitator transporter [Mycobacterium sp. MCS]MTQHAPKPPPSAPTAGRARIVAWALWDCGNTGMNAIVATFVFAVYLTGAV
GSDLPGDTSATSWLGRAMTVAGLVVAVLAPVTGVWVQAPRRRRVVLTVLT
GTAVLLTASMSLIRDDHRYLWAGLVLLACTAACGDLASVPYNAMLRQLAG
PQRSGRISGIGWASGYLGSVFLLLLVYVGFVSGDGDTRGLLGIPVSDGQN
IRAAMLLAAAWFLLFALPLLLTVPPHLPGADEVDPDQPSGVFAAYRRLWT
EIAGEWRRDRNIVYYLLASAVFRDGLAGVFAFGAVLGVSVYGISEADVLL
FGVSACVVAAVGAVIGGLIDDRVGSKPVIVVSLTAMIAVGLTLLSLSGPS
AFWVCGLLLCLFIGPTQSSARTLMLRMSPPGKEGVAFGLYTTTGRAVAFL
APWLFFMFIDLFDSDRAGMAGLCVVLAAGLAAMLAVRAPHRRPALAHADA
EGQP
108800601YP_640798.1 peptidase S9- prolyl oligopeptidase active site region [Mycobacterium MIADADTVRGGRSVARTRTTKSEENQRVRRQVRANYGASLSPDATAFAHL
VDDGGFPRAVQRFLLGWRASSSRDVELPVEGPVTRVMHSADGHWLACQVA
PDGSDRFQIWVVTTDPDDRDARRIDSWPMDQPDGSAELIGWDGTQVAAIL
TGEDGVGSSCLIDPADGATIVLDRRTAGRLVDAWAGAALVRVGPRGYRDL
IMLRGLTETALLPYDPGSTTDLGFILDDHSPRRLRSGPMGESFTLYHPAK
DYGLNSTEGYVRALIRSDNGGSHARLIEVTTTAEGVSYHVVAEKPGFDLD
EFVVSDDMSTVALLWNVNGCSELQILEYADNTLSEPIPLPGLVATELTIS
AGGSMVAMTVESPSLPPTVELVDPRSREWQRVDREPSEGPLTADPTLEVV
VARDGMELTGWLYRPPAPVEPVGAMIFLHGGPEGQSRPGYNEYYPALLAA
GITVFTPNVRGSGGFGRAFMHADDKELRFAAIDDVADCVRYLIEHEAVPA
DRVACCGWSYGGYLTQAALTFHPELFAAGISICGMSDLNTWYRNTEPWIA
AAAYPKYGHPIGDRDLLERLSPLLRAPALTAPLLLVHGGNDTNVPPSESQ
QMFDALRALDRTVELLVFDDDGHEIVKRENRAALVNAMTTWLLKAFSAAS
VL
108800599YP_640796.1 hypothetical protein Mmcs_3633 [Mycobacterium sp. MCS]MVVLGFVLGMNILTTIGAVLIVIGAVFWILGATGRAVGGRKVWY
108800597YP_640794.1 propionyl-CoA carboxylase [Mycobacterium sp. MCS]MAPRASHRDAHTALVEELRTKLAGAALGGPAKSRERHVSRGKLLPRDRVD
GLLDAGSPFLEIAPLAADGMYDDECPGAGMIAGIGRISGRECMIVANDAT
VKGGTYYPVTVKKHLRAQEIAGQNRLPCVYLVDSGGAFLPRQDEVFPDRD
HFGRIFYNQATLSAQGIAQIAAVLGSCTAGGAYVPAMSDEAVIVRNQGTI
FLGGPPLVKAATGEVVSAEDLGGGDLHSKTSGVTDHLAHDDRDALRIVRR
IVGTLGRPQPPPWDVAPAVDAVADQSELYDVVPVDSRVPYDVHEVITRIV
DGGEFAEFKAEYGTTLVTGFARIHGHPVGIVANNGVLFGESAQKGAHFIE
LCDKRVIPLLFLQNIAGFMVGRDYEASGIAKHGAKMVTAVACARVPKLTV
VIGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRGEM
TPEQEQEFKAPIREQYERQGNPYYSTARLWDDGVIDPADTRTVVGLALSI
VGQAPLEPVSYGVFRM
108800595YP_640792.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MTDFLASGTLPDHYEQLAKTVRDFARSVVAPVAAKHDAEHSFPYEVVRGM
ADMGLFGLPFPEEYGGMGGDYFALCLALEELGKVDQSVAITLEAGVSLGA
MPVYRFGNEDQKREWLPQLTSGQALAAFGLTEPGGGSDAGAPKTTARLDD
GHWVINGSKQFITNSGTDITKLVTVTAVTGEVDGRKEISSILVPVPTQGF
TAEPAYNKVGWNASDTHPLSFDDVRVPEENLLGERGRGYANFLRILDEGR
IAIAALSVGAAQGCVDESVRYAKEREAFGRTIGSNQAIAFKIARMEARAH
TARAAYYDAAALMLSGKPFKKQAAIAKLVASEAAMDNARDATQIFGGYGF
MNEYPVARHYRDSKILEIGEGTTEVQLMLIGRELGL
108800593YP_640790.1 HpcH/HpaI aldolase [Mycobacterium sp. MCS]MTLGNNGPGWLFCPADRPERFEKAAAAADVVILDLEDGVAARDREAARAA
LVDTPLDPSRTVVRVNPTTTPDHALDLQALARTDYTTVMLAKTESAEQVS
ALAPLEVVALIETPLGALTVVESSRVDNTVAVMWGAEDLLAVTGGTSSRW
PDGSYRDFAVHVRSRSLLAAKAYGRMALDSVYLDIKDLDGLRAETDDAVA
VGFDAKVAIHPTQVAVIRDGYRPTDEQVDWARRVLDTAHDERGVFQFEGI
MVDAPVLRRAERIVALAPHPGS
108800591YP_640788.1 transketolase [Mycobacterium sp. MCS]MTQLIERPTGADDHDRFFTDVPTVTELTMVQAINRALHDAMAADDRVLVF
GEDVATLGGVFRVTDGLSETFGEQRCFDTPLAESAIVGIAIGMAIRGFVP
VPEIQFDGFAAPAFDQVVSHLAKYRMRTRGDVDMPVTIRIPSFGGIGAVE
HHSESTETYWLHTAGLKVVTPSSPTDAYWLLRHAIAARDPVIYLEPKRRY
WARGAVDTTEPGLPIGRAAVRREGTDVTVLTYGPLVATALSAAEHAAAES
DWSLEVVDLRSLNPLDFDTVAASVGKTGRAVVMHEGPRTLGFGAELAARI
SEELFYDLEAPVLRATGFDTPYPPARLEKLWLPGVDRLLDCVQRTLEMP
108800589YP_640786.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MADSVLMQVDDHVALVTVNDPDRRNAVTFEMSAALRAAVDAAEADPEVHA
LIVTGAGKAFCAGADLTALGEATEDGLRRIYDGFLAVAHCPLPTIAAVNG
AAVGAGLNLALAADVRIAGPNALFDPRFQKLGIHPGGGATWMLQRAVGPE
VARAALLFGMRFDAEAAVRHGLALEVADDPVATARQLAAGPAAAPREVVL
ATKASMRATASPGTVDTEQHRTAVDIELGPQAASIESPEFARRLAAAKRK
108800587YP_640784.1 hypothetical protein Mmcs_3621 [Mycobacterium sp. MCS]MSTAVHPGIVVGVDGSVGSHAAVRWSAREAVMRRVPLVLVNVLATDVTAA
WAMAVPAAPLPAEYFESREQDARAVLAEAETVAKDAGAVDVTTELVQAAA
VPGLVDVAKEADMLVVGTRGHGAVKRLLLGSVTTGLLHHARCPVAVIGPD
ADQPSETGPVVVGVDGSRASQRAVEIAFEEASMRGVDLVALHSWSDRNES
LHPYVDWATVRAPAEETLAVSLAGWCERYPDVTVHRESVFDRPVEHLLER
SESAQLLVVGSHGRGGFAGMLLGSVSTAVVQAARSPVIVARGR
108800585YP_640782.1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. MCS]MSPDDGQQSERRPMRLPGSVAEILAAPEGPQVGAFFDLDGTLVAGFTGVI
MTRDRLRRRQMSVGEFIGMVQAGLNHQLGRSEFEDLIGKGARMLRGSSLS
DIDELAERLFLQHVRDRIYPEMRALVRAHMARGHTVVLSSSALTVQVEPV
ARYLGIQNVLSNKFETDDNGCITGEVVRPILWGPGKAHAVQAFAARNGVD
LSKSYFYADGDEDVALMYLVGNPRPTNPAGKLAAVAAKRGWPVLRFSSRS
GSSPLSQLRTVAGIGSVLPVAASALGVGLLTRNRRTGVNFFTSTWSRLLL
TTAGINLNVLGRENLTAQRPAVFIFNHRNQADPLIAGRLVETDFTAVGKK
ELENDPLIGTIGKVMDAAFIDRDDPKAAVEGLRKVEELAGKGLSILIAPE
GTRLDTTEVGEFKKGPFRIAMSARIPIVPIVIRNAEVVAARDSSTFNPGT
VDIAVYPPIPTEDWTLQDLPDRIAEIRQIYLDTLKAWPHGNLPVPALYKR
SPGEAVEPRKVEDKPAKKAAKKAAKKTPAKKTPAKKAAKTAEPQPKTSAN
GRSQPGVKGRQ
108800583YP_640780.1 copper resistance D [Mycobacterium sp. MCS]MTTVAVKTRPSAVWPVLVGVAALAGLTAAGIGALSLADALTATGLPDPGP
VTTYGLPFVRAAGEIAAVTAVGAFLFAAFLVPPQANGVLDVAGYRALRLG
TAASAVWTVCAVLLVPLTVSDVSGQALRDHLNPVEIWSVAGQVDVASAWR
WTALLAAVVTLAALPVLRWAWTPPLFAGSLLTLMPLALTGHSSSGGAHDL
ATNSLVIHLVAGALWAGGLLALLVHALRGGEHGDVAARRFSAVALWCFVA
MALSGVINALVRMSPADLFRTEYGGLVLAKAAALTVLGVLGYLQRRKGVA
GLQADPGARGPLVRLALVEAVLFGATFGIAVGLGRTPPPPPGRQPTPVEV
EIGYDLAGPPTVTRILFDWRFDLILGSAAIILALVYLAGWWRLRRRGDAW
PAGRTVAWLLGCATLLITTSSGLGRYMPAMFSVHMVAHMLLSMLVPILLV
LGAPVTMALRALPVAGKGKPPGPREWLLAALHSRVSRVLTHPIVALALFV
AGFYGLYFGGLFEAAVDDHAAHVVMNIHFLLSGYLFYWVVIGVDPTPRRI
PQLAKLAIVFASLPLHAFFGVVLMGMNSVLAEDFYRSLHLSWHNDLLADQ
KLGGSIAWAAGEIPLVLVLLALLIQWRRSDDRDAKRLDRAAERDHDADLA
AYNAMLAELARRDGR
108800581YP_640778.1 putative ABC transporter ATP-binding protein [Mycobacterium sp. MCS]MAEFIYTMRKVRKAHGDKVILDDVNLNFLPGAKIGVVGPNGAGKSSVLRI
MAGLDTPNNGDAYLAPGASVGILQQEPHLDETKTVRENVEEGVPIKGKLN
RYNEVAELMATDYSDELMEEMGRLQEELDAADAWDIDSQLEQAMDALRCP
PPDEPVTHLSGGERRRVALCKLLLSKPDLLLLDEPTNHLDAESVLWLEQH
LASYKGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGNYSTYLEKKAER
LEVQGKKDQKLQKRLKEELAWVRSGAKARQAKNKARLGRYEEMAAEAEKS
RKLDFEEIQIPTPPRLGNVVVEVEHLDKGFEGRTLIKDLSFTLPRNGIVG
VIGPNGVGKTTLFKTIVGLEQPDSGVVRVGDTVKLSYVDQNRAGIDPKKN
VWEVVSDGLDYIEVGQNEIPSRAYVSAFGFKGPDQQKPAGVLSGGERNRL
NLALTLKEGGNLILLDEPTNDLDVETLSSLEHALEQFPGCAVVISHDRWF
LDRTCTHILAWEGDDDNEAKWFWFEGNFGAYEENKVQRLGAEAARPHRVT
HRRLTRD
108800579YP_640776.1 hypothetical protein Mmcs_3613 [Mycobacterium sp. MCS]MTAGFVAPVHVRWSDIDMYQHINHATMVTILEEARIPFLREPFEARITDI
GLLIADVHITYKGQLRLIDSPLQVTMWSKRVRAVDFTIGYEVRSVGAPAD
SKPSVIAETQLAAVHIEEQRLERLTPEQRTYLQRYLR
108800577YP_640774.1 alpha amylase [Mycobacterium sp. MCS]MGAMAHPPTADQPWWSRAVFYQVYPRSFHDSDGDGVGDLDGVTAKLDYLS
ELGVDALWLNPVTVSPMADHGYDVADPRDIDPLFGGIDALDRLIAAAHDR
GIRITMDLVPNHTSSAHPWFQAALAAGPGSAQRERYIFREGTGPDGLLPP
NNWISVFGGPAWTRIVEPDGQPGQWYLHLFDPEQPDLNWDNPEVFEDLEK
TLRFWLDRGVDGFRIDVAHGMAKPPDLPDMEIAENRMLAETASDPRFDHQ
GVHDIHRNIRSVLDDYPGAVAVGEVWVYDNAAFAAYLRADELHLGFNFRL
VRADFDADEIHDAIENSLAAVALENATPTWTLSNHDVEREVTRYGGGALG
LARARAMALVMLALPGVVFVYNGEELGLPNVDLPDEVLQDPVWERSDRTE
RGRDGCRVPMPWSGDAPPFGFSTTADTWLPMPAEWSSLTVERQLAEPDSM
LHFFRRALRLRRDRCGVDGATLTQLSAEDGVVTFRTDGGLTCVLNAGERP
VDLPPGEVLLASAPLQAHSPSLRSPQDRRLPPDTAAWVV
108800575YP_640772.1 HNH endonuclease [Mycobacterium sp. MCS]MAHRKKSPSRPTGHKRAAAVGPSGPAASARVLHSVEIHGGETAASIHDGS
LWGRRRVLLLNSTYEPLTALPLRRAVVMLICGKADVVHEDPSGPVIHSAT
RSISVPTVIRLRSFVRVPYRARVPMTRAALMHRDRFRCAYCGAKADTVDH
VVPRSRGGDHSWENCVAACAPCNHRKADHLLAELGWTLRHVPLPPKGQHW
RLLSTVKELDPAWMRYLGEGAA
108800573YP_640770.1 hypothetical protein Mmcs_3607 [Mycobacterium sp. MCS]MASGEVQVTGHRAAVERQGLPYGWALTSSGRLSGVTEPGTMSVDYPFATK
DLVVLDDALKYGSRAAKARFAVYIGDLGADTAATAREILSQVPTPNNAVL
LAVSPDQRAIEVVYGVDVKGRGIETAAPLGVSAAAASFKEGNLIDGLISG
IRVLSAGVSPR
108800571YP_640768.1 aminopeptidase N [Mycobacterium sp. MCS]MALPNLTREAAVERAALITVDNYRIELDLTDGAGAPGEKTFHSVTTVTFD
ATPGADTYIDIAADTIRAATLNGHDVDVSGYDESTGIPLAGLAEHNVLVV
DADCRYSNTGEGLHRFVDPVDDEVYLYSQFETADAKRMFACFDQPDLKAT
FDVTVTAPAHWEVVSNGALEGSRDDRAAQANGGTKTHVFVQTPRMSTYLV
ALIAGPYARWDDLYRDEHGEIPLGLFCRKSLAEFMDAERLFTETKQGFGF
YHNNFGVPYAFGKYDQLFVPEFNAGAMENAGAVTFLEDYVFRSKVTRASY
ERRAETVLHEMAHMWFGDLVTMTWWDDLWLNESFATFASVLCQAESTEYT
EAWTTFANVEKSWAYRQDQLPSTHPVAADIPDLHAVEVNFDGITYAKGAS
VLKQLVAYVGLESFLAGLRDYFRDHAFGNATFGDLLGALEKASGRDLSGW
GRQWLKTTGLNTLRADFDVDADGRFTRFAVTQSGAAPGAGETRVHRLAIG
VYDDDPTTGKLVRVHREELDVEGESTEVPALQGVPRGKLVLVNDDDLTYC
ASRLDPDSLQTVLTRIADIAEPLPRTLAWSAAWEMTREAELRARDFVALV
MSGVHAETEVGVAQRLLLQAQTALNSYADPQWARETGWPAFADRLLDLAH
ESAPGSDHQLAFVNALCASVLSRNHVAVLATLLDNEPAAVNLTGLVLDTD
LRWRIVTALAASGDIDADGPETPFIDAEAERDPTAAGRRHAAAASAARPQ
PAVKEAAWQQVIEDDTLANITTRSIVGGIVQPGQQALLAPYTEKYFAAIA
GVWERRSSEVAQTVVIGLYPSWDISDEGLAAADRFLSGDVPPALRRLVLE
GRAGVERALRARKHDVS
108800569YP_640766.1 DSBA oxidoreductase [Mycobacterium sp. MCS]MPEKSRADFWFDPLCPWCWITSRWILEVEKVRDIDVNFHVMSLAVLNEGR
DLPEEYQEAMKRAWGPVRVAIAAEQAKGADVLGPLYTAMGTRIHNRGYGE
SDPDFTAVISESLAEVGLPAELAEAATSGEYDEALRKSHHEGMDPVGDDV
GTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFWELKRTRT
EKPSFD
108800567YP_640764.1 zinc-binding CMP/dCMP deaminase protein [Mycobacterium sp. MCS]MPSPPRPVTSVADMLDVAYAEARKGLSEGGIPIGAALFSAGGTLLGSGHN
RRVQDDDPSVHAETDAFRNAGRQRDYRSTVMVTTLSPCWYCSGLVRQFNI
GAVIVGESRTFTGGHEWLAEHGVEVTVLDDDRCVSMMTEFIDAEPDLWNE
DIGR
108800565YP_640762.1 ribose-5-phosphate isomerase B [Mycobacterium sp. MCS]MAAMRVYLGADHAGYELKQVIIEHLRSTGHEPVDCGAFDYDADDDYPAFC
IAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAR
EHNNAQLIGLGGRMHSEADALAIVDAFLATPWSKAERHQRRIDILSEYER
THEAPPVPGAPA
108800563YP_640760.1 sodium/hydrogen exchanger [Mycobacterium sp. MCS]MELILVVVGAIVVTAIAHRRGLEPALVLVVVGFAVSFAPDFNGIELESDV
LLSVVLPPLLYSAALSFSFPTFLRNIRPILGLGVGLVVITTFAVAGLASW
LVPSLTFGTALILGAVVAPPDAVTAVAVGRRLGLPKKVMAILTGESLVND
AAALSLFSIAVAQVAGTRAFIENPVLLFGYSALLGPVVGAALGFITLWIR
RRLANPGLETIQGLVVPFAAFISAEHLHASGVLAVVVAGFVVGHGSLDAG
YQTRLQERYVWNSVDVMLEAFVFAYIGLQLRFVLEDLNEAHESLAEVAVA
SAVVLLVVLLIRPVCVFAMFGRGVLSRKVESKLSVPKPEQGGRGALGVRR
RGGAGRLSGLVDRRMLTWQENVVVSWTGMRGVVTLAAASGIPMMTIDGEP
FPERATIQAIAFVVSVGTLLLQGWTLPPLIRWLQPSFEHDRQSDETETRK
AEQVVHAAADDVLNRFADAPPPGLDDATLANIRQTIARHAQDADEMPDPE
SHTPRAEVFSKLYRDVLCAQRNALIAERDAGRIEDEAVRAMLERLDLQEA
GVSARLESRI
108800561YP_640758.1 beta-lactamase [Mycobacterium sp. MCS]MICSTAPLISGCCADEFTGVREAFARNFTDRAEVGAAVAVWVDGELVVDL
WGGSADGSGTRPWRRDTLASIYSGSKGLTSTCVHLLAERGDIDLYAPVAR
YWPEFGRAGKEDITLAMVMSHRSGVIGPRSRLHWSQATDWDAVCAHIAAA
EPWWAPGTAQGYHMVTFGFILGEVVRRVTGRTIGQYLRTEISEPLGADVH
IGLPAAEHHRCAEMVGKPHIRDVLAAGTAPDHPHSLTEHPMAGLAVAMGF
VPDDELGSNALDAWREAEFPATNAHVSALGMATFYNALAQEKLLSRRHME
TVRVCQGGFDTDMVLGPRVADHGWGLGYMLNQRGVAGPNRRTFGHGGSGG
SFAFVDLEHRIGYAYVMNHFDATKCNADPRTVALSDEVYRVLGVRVR
108800559YP_640756.1 hypothetical protein Mmcs_3593 [Mycobacterium sp. MCS]MRRRNMAGRLSVVPGAILFACGAIGAAIWLWVKRRQLAVAAAKAVPEQTA
AAATDQVSTVTGAVPGQVDEIKAKRPPSVP
108800557YP_640754.1 hypothetical protein Mmcs_3591 [Mycobacterium sp. MCS]MSVNGSRVPAPAIAMISSLESRLVRVKYIAAALVGVCVGALLGGLAFAAM
GTDTTATAFVRLQNPADLTAIAAGASQVTPDNQGNTSNFVGGEIAYLSGE
GFAQAVARKMAMDEPAELNVAQASESAVVTISNSSKSRGDAIRTVQVAID
LYRQELAQRVDEQLRTILAALSRWQQDETVDPVRMQELARIRAAVELQAS
EASTLLVVQPPTPNHDSSGQWLIGVFLGGLLGGSVAVAILLARGRRSGRA
AMTATLTDSVDGVLVPAVDLGAASPDNHDGEQARVARTLYAQCPTARGGV
LLVIGASPSSGSAEVAELLELGAADQPPSVRVRHGGVVGDPTLTPELIAA
ATGIVLVARIDADTAAQAVALRSATADSDAPVVAAFTYHRAGGAHRKKRK
PEVSPRQDVDDAERSMQ
108800555YP_640752.1 hypothetical protein Mmcs_3589 [Mycobacterium sp. MCS]MPDTKHLQAGVQVAAGLALNVFPAIFIAIYARIAPIETQGFLALALAVGV
YVAQLFNAFIVEGRLATPDADGELGLPTWVVLLSTAACGLLVFGPAVASS
AILMASAIGVMTGLLMTRSIGVVTGEWKNEGAAAGALIVASLIALWMADQ
GSPHSVRVLAIGALLAVVVRYRPRKAMPRMGFPPDVRRSSWVTAETAVVG
AVQPAITSLLLVLVGPAASVTFRVISTVAGALEPILAYGRYRLLAHGHRG
ELKAFVAVFAVGMAAVLIAAFGGVGSLVFGPAWQDVGVAAMLLACLWKAA
MLVSTVPFAALRKAGKTVLVFWIRGASTVVYLVVSVGLLFVWQNTAAIFL
AFVVAEMITAVVYHFAAVMGAPDYAATFGTRRLRQRFG
108800553YP_640750.1 hypothetical protein Mmcs_3587 [Mycobacterium sp. MCS]MTLSRRELLARTSAAAASALLAGCSTNGPRTVVDVRAHGATGDGITDDSR
AVQAAAAALRPGSTLRFSRGTYRFAQRWPPGGAAVVISGLADVRVEFDPG
AELYMDNLHPTKHTGSSHGLLVRGPASRIHLRGLNIRWADGARRSLGDGI
RVEGFPDLDGAQPKGWSGQSRPVTEVTVSDCTVRSSPQTGVVMMGVSDIE
VTGLRVTDSGADGLHFNACRRATVTEYSAVNTGDDGLALVTYFEAEPTFD
PAAHTFSLPELTDWSNADFTVENVNVFGCRANGVRLAGAHRVTVEGLDVV
GVHAGSAFLIDSAEPGTDVGWHYVASRAVRLDDVTATDCDMGIHLLARPG
TSGDPRFTDFDIHVGDATIDDCPTWAVRAESLTDTRVNGMRIDNCSVTTA
STTGGNGGVGVGDANGITFGIMTIRHAEPVIAFQTVNAGALTVEKLGVAI
TRRDRPEGKLDPCVRLDNSDGVIDQLTIGWPAAGDGWVPVRLSEPGPCED
DIGETPLAIRGLTVTPPVERPSAVVCGR
108800551YP_640748.1 putative GAF sensor protein [Mycobacterium sp. MCS]MTGFDEWLNRLLEDCARDAGEDVVSYVARAVASQMVADLRRTERASIDEL
MAHLNECRVFAETEMPSVESEITDPDRLQALYATGLLDSPPDEAYDRITR
AAAAALDAPSAAMSLIDVDRQFFKSSVGMGDDERQTPLDRSVCQYAVANG
SALLLEDARTDPVFRNHPAVRDGTMVAYLGIPLTDKDDNAVGTLCVFDVK
PRLWGTGHVRILSDLAQLAAEKMFGSRAGQQ
108800549YP_640746.1 di-trans-poly-cis-decaprenylcistransferase [Mycobacterium sp. MCS]MGLIPDGLRRWADANKATLVDAYRRGAMKVVDILLALQEHGVQTVSVYNL
SRANLARRDDELEAVFAASTHFFSTLIPANFDHTACGVRIHGDLDLLPDE
YVAAARSVEQTMTGRDFRINILAAYDAADELRAAHRRARQNGCDITAALE
IGDVDLVIRTTPEPLLSGFLPLQSQYAQLMFLTTALNDLQRADIDDLIAD
YRRFPQRRGR
108800547YP_640744.1 hypothetical protein Mmcs_3581 [Mycobacterium sp. MCS]MVSQSCRAGGAALAVGIGMLLAPGIAAADPSADAAGTDVSAHAPADTRQD
DHTEKADEETDAPEDNAEDIPEDSAEDEAEDEAAPVEDEDTDAKTGHRDA
DDEEPTEDPVDEPVADDPVEDNEVDPEEPAESPAPVATLTDTVGAGGTPA
PVESPATWAVLAWARRQPFSTTTAANTSARHTTASSSTATPATTVDVKDY
GAVGDGVTDDSAAIKAAEAALASGQRLYFPEGSYRFAQQNPAGNAAVLLK
GLSDVTVEFAPHARLLMDNLDAAEHGTSHGIRVEGAASNVTILNATIEWK
TRPSARSFGDGFSILGWASNTAPPPGWTGSTGTVSNVSLVNATVINAPQT
GAIFMGASDVTVTNFTAIGTLADGLHFNANRRVTVHGLLAQNTGDDGLAF
VTYYDPTLPWTYGPGDGPFNQPGLGEWNNGGSVATNITVTGGAASGVRVQ
GGYDITITDVTVTGKEFGLQVNSAKATGPGDWTSLASRDISISDVTISAT
VTGIVLATNNIDGTEASMWWDFSGLTISDVTIHNSRNWSLAVETPASTTS
RFAGVTLRNIHAEVDADVGPLGGGNGGILLASLRDSVIDGVRLVSVHGSD
INVVGAAQIRSQYSVADLPSSNLTIDDLVLEGPGRILIQDIAGLDVGTVA
SHGANSAAIELFRVKSASFDTIGAYLPGRGNGAGWGVRLLQVHDLDVANI
EVITDDHIGTSWWAVELGGGNPAQDIAGAGVRIDDVTYVSGRDATDSDIV
VQGGPYGPVDWYINATWRHEGEASPLWRAGLWGDAIPSLTS
108800545YP_640742.1 trigger factor [Mycobacterium sp. MCS]MKSTVEKLSPTRVRINVEVPFTELEPDFDRAFKELAKQVRLPGFRPGKAP
RKLLEARVGREAMLDQVVGEAVPGRYTEAVTSSDVQPLGQPEIEITKKEY
GEDLVFTAEVDVRPEITLPDLSALEITVDPIEITDEEVDTELQSLRARFG
TLTGVDRPAKDGDFVSIDLSATVDGKDVPEATTEGLSHEVGSGQLIEGLD
DAIVGLSEGESKEFTTTLAAGEHAGKEAIVTVTVKSIKERELPEPDDEFA
QLASEFDTIDELKESLTEQVRRVKRVQQAEQIRDKALELLLEQTEVPLPE
KIVQAQIDDTVHNAIHGLDHDEDRFAEQLAEQGSSREEFDANTRTEAEKA
VKTQLLMDALADQLEVQVGQGDLTERLVLMSRQYGLEPQQLLQILQQNNQ
LPAMFADVRRGLTIAAVVHGATVKDTDGNDIDTTEFFGPSGGAQAEAEGA
DEADADSDADSDTEADSDTEADEADEAK
108800543YP_640740.1 ATP-dependent Clp protease proteolytic subunit [Mycobacterium sp. MCS]MSNQTDPRLQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVD
DASANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRAD
IQTVCLGQAASAAAVLLAAGTPGKRLALPNARILIHQPALSGVIQGQFSD
LEIQAKEIERMRTLMEVTLARHTGKDPETIRKDTDRDKILTAEEAKDYGI
IDTVLEYRKLSAQTS
108800541YP_640738.1 fatty acid desaturase [Mycobacterium sp. MCS]MAITDVAAYAHLSEADVEALATELDAIRTDVEASLGARDAAYIRRTIRTQ
RLLDAAARILIHRSRGKVGWVLGTVALATAKSIENMEIGHNVGHGQWDWM
NDPEIHSNTWEWDMAGLSSQWRYSHNYTHHVYNNIIGVDDDLGFGVLRVS
PDQEWKPDYLAAPVRNVLLALIFEWGIALHGLHSSRDRALLVGGSKGGRE
LLAKVARQVGKDYVVLPALSGRRFRRTLLANVAANVLRNLWAYVVIFCGH
FPDGADKFDPAVLEDETRGAWYLRQMLGSANFHAGPAMGFMSGHLCYQIE
HHLFPDLPSNRLAQIADRVRALCDKYDLPYTTGPLSRQYLQTFRTIHRYA
LPNRFTVAKMH
108800539YP_640736.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MPEVLIASMSPIGHLGPLLNLARGLVDRGDRVTVLTSAARAGMIRAAGAR
PRALPPQTDIDESRLNESLPGREKTSGIKRVDFDITNVFVTPMPHQAAAL
AEAFAETRYDAVIVDAMFLGILPFLLGEHAARPPVLAYSTTPLLISSRDT
APPGLGLPPSSSPLGRLRNSALTTLTHRVLLRGCHRAADEALHRMNSRPL
PMFVTDAALLADRFIAPTVPEFDYPRGDLPPHVRYVGAVHPARTQTFTPP
PWWGALDGERPVVHVTQGTVDNADPRRLLLPTVEALAGEEVTVVVTTGGR
GLSVPHTALPTNTHVAEFIPHDVLLPKVDVMVTNGGFGAVQRALSLGVPL
VVAGDTEDKPEVAARVAWTGAGVDLRTGTPTPGAIRSAVRDVLDRAHYRE
NARRLEVAFTRRDGVAEIAAVIDEVLAERRQTVR
108800537YP_640734.1 hypothetical protein Mmcs_3571 [Mycobacterium sp. MCS]MALLRAAAAAAAVLTVVGGCASEQSAQPPSTSAATATTTGLLPSGVPTEG
SRPPVEGLPPPAEPQRAPAPTTPVPGRTVAVGAQPEGIVVDAQTRTVAVL
KRQPDELVLLDADTGEVTGRTALPGFGRHLQLARPGGPVLVPVESADALI
RVALPGGESQSQIVTGTFPHDASEAPNGTVFVANELGGTVTVLRGDEIVK
VFTDSVQPAGLAPVGDSMGLLDVRKNDLTVYDTEELTIVGATTAGEGPTH
QVADKHGRLIVTDTRGDAVRVFTPRPEPREVGLAAQPGGPYGITYDPNRD
RVWVASSCTNEVVGYDMAEPTPREVARFPTVQNPYTVAVDPTTGRLFVAG
LTGGVVQIIDVTS
108800535YP_640732.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MAKPPLSMKPTGWFCVAWSDEVGVGDVRAMHYFGEEMVAWRTQSGRVTVM
NAYCEHLGAHLGHGGHVVDEVIQCPFHGWQWNAEGRNVCIPYQDRPNRGR
RMRTYPVVERNDAIWIWHDVDGREPFFDAPDVFASFADGSSAAGYYPQQR
LFRGSLEMHPQYVLENGVDFAHFKYVHQTPIVPVFTRHDFSAPVSYVDFT
ITFEGDEGQSIDDVRSGVEAINGGLGIAVTKSWGMVDNRTISAVTPVDER
TSDVRFMVYIGRTPGRDDQRAADKARGFGEEVIRQFAQDIHIWSHQRYSD
PPALATAEFEGFTAIRQWAKQFYPDGIGGSAAEVHAALQKG
108800533YP_640730.1 pyruvate flavodoxin/ferredoxin oxidoreductase-like protein [MycobacterMGLNGNGAAPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQ
PNYPAEIRAPQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKAN
VSDLPRGGLIIANSDEFTKRNLAKVGYDANPLETDELSDYVVQAVPMTTL
TLGAVEEIGASKKDGQRAKNMFALGLLSWMYGRELHQSEAFIQEKFARKP
DVAAANVLALKAGWNFGETTEAFATTYEVSPAKLKSGEYRQISGNTALAY
GLVAAGQLANTQLVLGTYPITPASDILHELSKHKNFNVLTFQAEDEIAGI
GAALGASYGGALGVTSTSGPGVALKAEAIGLGVMTELPLVIVDVQRGGPS
TGLPTKTEQADLLQALYGRNGESPVAVLAPRSPSDCFDIAVDAARIALTY
RTPVIILSDGAIANGSEPWRIPDITGYERIDHTFAQSGDDFAPYARDPET
LARQFAVPGTAGLEHRIGGLEKANGSGNISYEPKNHDLMVRLRQAKIDGI
TVPDLEVDDPTGDAELLLIGWGSSYGPIGEACRRARRKGVKVAHAHLRHL
NPFPANLGDVLARYPKLVAPEMNMGQLALLLRGRYLADVQSVTKVEGMAF
LADEVEGIIDAAIDGTLGDKENEKATFARLAAATVGAGVGADE
108800531YP_640728.1 molybdopterin-guanine dinucleotide biosynthesis protein A [MycobacteriMTQGATTSPVPLAAVVLAGGASRRMGRDKATLVVDGSTLVEHVVTTVGRR
CSQVFVIAAPGQPLPELEAHVLRDEVRGVGPLLATGRGLRAAAEAGCEWA
FVCAVDMPYLTMDFVDDLAVPAARLGVDVVLPWDGRDHYLAGVYRTSLAG
HISALVAAGERSMRALVDTVDTQRIVMPEQRALTNANTPADLPVTR
108800529YP_640726.1 transglycosylase-like protein [Mycobacterium sp. MCS]MINIGKALTRGIWLTVIGAAFALVPTFFSSATASADSVNWDAIAQCESGG
NWSTNTGNGYFGGLQFKPTTWSSHGGRGNPANASRSEQIQVAERVLATQG
LKAWPKCGPRGVATRAAVWNNPQTPRVAAPAAAPRPATGCAAVRSGSVLG
IVDLKQLCSTVLSPLGTLGQR
108800527YP_640724.1 FAD-binding monooxygenase protein [Mycobacterium sp. MCS]MSQQILVVGAGIAGLATAVALQRIGHPVTVVEEKADTSAGAGISIWPNAL
AALDAFGLGDAVRASGGRVTAGALRWHDGTWLRRPSADRMVRALGEPLVV
TRRADLTAILAGALAPGTVQRGVAARVIDTTPAGVRITLSDGSVRDAAAV
IGADGVGSMVARHLNGPLRHRYAGYTAWRGIAAHRLDPQLAGQTLGAGTE
VGHVPLGPDHTYWFATERTAEGGSIPQGELDYLRRKYRGWAEPIPTLLAT
TAARDVLRNDLYDREQIRVWSRGPVTLVGDAAHPMRPHLGQGGCQGLEDA
AVLARFVAAATGTETDFATAFVRFAGFRRARVRALVRESKLIGRVVNLRP
AVLSALASRATVVIPEAVLGRHLAAVAAGSAFTLPEAPG
108800525YP_640722.1 saccharopine dehydrogenase [Mycobacterium sp. MCS]MSPAQQREFDIVVYGATGFVGKLTAEYLADHGAGARIALAGRSQDKLLEV
RESLGPKATDWELITADASQPSTLNAMAARARVVITTVGPYTKYGLPLVA
ACAAAGTDYADLTGETMFVRDSIDHYHKQAVDTGARIVHACGFDSIPSDL
TVYALHRKVAADGEGELGDTSMVVRTLAGGASGGTIASILEVLNTASTDP
EARREMTDPYTLSPDRSAEPELGAQPDMRWRRGAEIAPELSGYWTAAFAM
AGPNTRIVRRSNALLGYAYGRRLEYSEVMSTGRTPVAPALAALTTAGSAA
VMGLGSRYFNRLPRKLVDRVLPAPGTGPSEQTRERGHYTVETYTTTTTGA
RYLARMSQRGDPGYKATSVLLGECGLALALDRDKLSDLRGVLTPAAAMGD
ALLARFPGAGVSLETSRLA
108800523YP_640720.1 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase [MycoMSRPEPTPDEIAALLQVEHLLDARWPETKIEPSTARISALLEMLGNPQRG
YPSIHIAGTNGKTSVARMVDALLTALSRRTGRTTSPHLQSAVERVAIDGE
PISPARYVEVYREIEPFVLMVDERSEEAGGPRLSKFEVLTAMAFAAFADA
PVDVAVVEVGMGGRWDATNVVNAPVAVITPIGIDHADYLGDTIAEIAGEK
AGIITRQPDDLVPTDTVAVIGRQAPEAMEVLLAQAVRADAAVAREDSEFA
VLSRQVAVGGQLLELQGLGGVYPEIFLPLHGEHQAHNAILALAAVEAFFG
AGAERQLDIDAVRAGFAAAASPGRLERLRSAPTVFIDAAHNPAGAAALAD
ALQTEFDFRFLVGVVSVMGDKDVDGILAALEPAFDQIVVTHNGSPRALDV
EALAVRAEERFGPERVIRAATLPDAIETATAVVEDSGGEGLAGAGMVITG
SVVTAGAARTLFGRDPQ
108800521YP_640718.1 hypothetical protein Mmcs_3555 [Mycobacterium sp. MCS]MSDLCSPTFADLAERLGFSCDEAGGLVEFRNPFGLENWTLPVLEVLIVVG
AVLTLVYAINRLRRHGDPTNLVLWFGAIAYLLIIEPPLYFPSAFGIDEHV
DTMFAHNVFTVEFLWGRLPLYIVAIYPMMATVSFEIVRRLGVFRRYGTFV
GALCVGFVHHAFYEIFDHLGPQLRWWEWTLDNPLNQPFFASVPLPSVVVF
AALWPTSLAFCVQFFVGRHVDAGRSFSGGSLVLRTVVVGVLASVGTFVLP
LPATIAGGVSGSTDVGGVVYALELVVLSVISAAVLAAQWRRLRAGRPHRD
PSPTLIFGYAGVYLAVMAVLWLTALPAFFGAVNGVTADGDPIGSLWYTVA
CFVVAALSLAAAATVPTRRVAAADEAVDVTT
108800519YP_640716.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MARRRGWNGSPPADDEEASRRIVEAAVGLLAQTGTAISISDVAASLGVIR
QTVYRYYPTADALMRAAAIASVDDFLDRLAEAVRGIEDPAEAMTEGVLYV
LDEVARTPHLGILLSEPYVNTHSGEVASDEARAIGMRMVNRFDVDWVDHG
YDDAALVDLVEFTLRTMLSFFVAPNPPSRSRDDLRRFVHRWLGGAIMAQN
RL
108800517YP_640714.1 ribonuclease [Mycobacterium sp. MCS]MADSENTQAQDSPDSSEEASPRERLPERLRVHSLARVLGTTSRRVLDALA
ELDGRARSAHSTVDKTEAERVREVLAGSDGDAPVEAPAPAEIAESVADAP
EVVIETVESVEVTIDVAPVGDTSDVPEPEDEPESRTILETAPVERADYLP
LFVAPQPVRFEPADEDDDEDEDDDVAASADSEDDDEDDQSERPAARRRRR
GRRGRGRGRGEQSDDNGEPDAAEGTETKTDGQADSDQDTGDDSDEDGDED
TSGGDGSSRRRRRRRRRKSGASDDSDNGSPDDPPNTVVHERPPRERGGKS
GDSDDNEIQGISGSTRLEAKRQRRRDGRDAGRRRPPILSEAEFLARREAV
ERVMVVRDKVRTEPPHEGARYTQIAVLEDGVVVEHFVTSPASASLVGNIY
LGIVQNVLPSMEAAFVDIGRGRNGVLYAGEVNWEAAGLGGQNRKIEQALK
PGDYVVVQVSKDPVGHKGARLTTQVSLAGRYLVYVPGASSTGISRKLPDT
ERQRLKEILREVVPADAGVIIRTASEGVKEDDIRSDVNRLQERWTQIEAK
AAEITAKKAGAAVALYEEPDVLVKVIRDLFNEDFSGLIVSGDEAWNTINS
YVESVAPDLMPRLTKYEPAGNPNGEGPDVFAVHRIDEQLAKAMDRKVWLP
SGGTLVIDRTEAMTVVDVNTGKFTGSGGNLEQTVTRNNLEAAEEIVRQLR
LRDIGGIIVIDFIDMVLESNRDLVLRRLTEALARDRTRHQVSEVTSLGLV
QLTRKRLGTGLIEAFSTPCPHCAGRGIVLHGDPIDNASGNGRKSEPGTGR
RSKRGKKGGKPEEAPAAVPVIKVPPHPAGEHPMFKAMAAANGRDDESEDE
SDESADEQSGAREDDTAEKVHEAVGEELDDEDFEDAEDAEDSDDSDEDED
EDEDEDSDDSDEDEIDLDNDDDEEDDDIEVLDDEDSDEDEDSDEDEDSDE
DSDEDSDEDSDDEDEPEVIAVPVRRPRRRAAARPAGPPSSE
108800515YP_640712.1 50S ribosomal protein L27 [Mycobacterium sp. MCS]MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEIIVRQRGTHFHPGVN
VGRGGDDTLFATAPGSVEFGSRRGRKTVNIVPVARPEA
108800513YP_640710.1 gamma-glutamyl kinase [Mycobacterium sp. MCS]MTEAATRPSVHREAVRTARSVVVKIGTTALTTPTGVFDANRLATLVEAIE
KRMKAGSDVVIVSSGAIAAGIEPLRLSKRPTDLATKQAAASVGQVALINS
WNTAFARYERTVGQVLLTAHDISMRVQHTNAARTLDRLRALHAVAIVNEN
DTVATNEIRFGDNDRLSALVAHLVGADALVLLSDIDGLYDGDPRKAGPDN
PARFIAEVNGADDLDGVVAGRGSHLGTGGMASKLSSALLAADAGVPVLLA
AAADAATALSDASVGTVFAPRAERMSARRFWVRYAAESTGALTLDEGAVN
AVVRQRRSLLPAGITGVSGRFYGGDVVELRAPDATMVARGVVAYDATELA
TMLGRSTSDLPADMRRPAVHADDLVAV
108800511YP_640708.1 silent information regulator protein Sir2 [Mycobacterium sp. MCS]MESPELVALLAGRRVAVLTGAGMSTDSGIPDYRGPDSPPSNPMTIRQFTS
DPAFRQRYWARNHVGWRHMAATLPNAGHRALAAMERTGVVLGVVTQNVDL
LHTKAGSRNVVDLHGTYARVICLDCGYTMSRADLAEMLEAANPGFLERAE
RVGGIAVAPDADAIIGDTDRFRIVDCPACGGMLKPDIVYFGESVPKPRVE
QAFAVVDDADVLLVAGSSLTVFSGYRFVRHAAAHGMPVAIINRGPTRGDD
LATVKLDNGCSPMLALLADELPAFASSA
108800509YP_640706.1 NAD synthetase [Mycobacterium sp. MCS]MDFYSAYRHGFARIAACTHHTSIADPKGNAESVLRMARDCHDDNAALAVF
PELTLTGYSIEDIVMQDGLLEAVEAALLQVVTASAELLPVLVVGAPLRYR
HRVYNTAVVIHRGQVLGVVPKSYIPNYREFYENRQIAAGDEERGEIRVGG
QEVPFGPDLLFEATDVPGFVLHVEICEDMWVPVPPSAEAALAGATVLANL
SGSPITIGRSEDRCLLARSASSRCLAAYVYAAAGEGESTTDLAWDGQTMI
WENGSCLAQSERFPKGERRSIADVDLQLLRNERLRMGTFDDNRRHHLIDE
DSFRRIEFTLDPPTGDIGLYREVERFPFVPADPARLEQDCYEAYNIQVAG
LEQRLRALHYPKIVLGLSGGLDSTHALIVAARAMDREERPRSDILAFTLP
GFATGEHTRNNATRLAEALGVTFETIDITSTAKLMLTEMDHPFSRGEKVY
DVTFENVQAGLRTDYLFRLANQRGGIVLGTGDLSELALGWSTYGVGDQMS
HYNVNGGVPKTLIQHLIRWVILSKQFDDTVNEVLQSVLDTEITPELVPSG
EDEEIQSSEAKVGPYVLQDFSLFQVLRYGFRPSKVAFLAWHAWRDADSGN
WPTGFPDSKRPSYTLDEIRHWLQVFAQRFYSFSQFKRSALPNGPKVSAGG
SLSPRGDWRAPSDMSARVWLDEIENAIPKG
108800507YP_640704.1 diacylglycerol O-acyltransferase [Mycobacterium sp. MCS]MEHLKTLDAGFLEAEDADPHVSLAIGGVAVLDGPMPDFAALTATLTERLT
AVPRLTQLVHTRPLDIGAPEWVPDEHFDISHHIRRAALPRPGGDADLDRL
VADIMERRLDRARPLWECWVIEGLSRHRWAVLMKVHHCLADGIAATQILT
ALCDDGPTAALRPYPRAVPSPGWSLRIDPVGWMSSAVRTSLGLTTAAVRA
VRGAIDLAGGVLRPAPSSVLNGPVGSMRRYAAVDVSLPDVRRVCDEFGVT
LNDVALAAITHSYRELLIRRGENPGRDSLRTLVPVSVRPADAMDEPDNRV
SLLLPRLPVDKADPLHQLQAVHRRLTYVKGSGQRQAGSAVMSAANAIPFA
VTAWAVRNLTRLPQRGVVALATNVPGPQEELTIMGRKVGRLLPIPPIALQ
LRTGIAILSYADKLFFGIISDYDAVPDVDELARGIAQGVGRLADLASVPH
RSTPLGTLALVT
108800505YP_640702.1 PfkB protein [Mycobacterium sp. MCS]MAAARVCVVGSVNADLRFAVPSLPRPGQTVLASSMTTSPGGKGGNQAIAA
ARAGGDVSLVAALGDDPAAGQLRAHLRANGVGLDGVVTVPGPSGSAVVIV
DAAAENAIVVAPGANAHLSVASSAVREAIAGADVVLLQLEIPLHTANDAA
RVARDAGAVVMVNASPAGAPPHELLRLSEVADVVVVNQAEAGEWHWPVPH
LVITRGARGASYLGDGERFDVPAPAVEAVDTTGAGDVFAGVLAVHWRSGH
ENALRRACVAGALATLVPGAGDCAPTAEAIDDTLR
108800503YP_640700.1 ATPase [Mycobacterium sp. MCS]MSVPARPAPLFADIDDVARRLAETGYLPDTATATAVFLADRLGKPLLVEG
PAGVGKTELARAVAQATGSELVRLQCYEGVDEARALYEWNHAKQILRIQA
GNAGEAGDWDRTKLDVFSEEFLLSRPLLTAIRRTDPTVLLVDETDKADIE
IEGLLLEVLSDFAVTVPELGTIKAERTPFVVLTSNATRELSEALKRRCLF
LHIDFPDPDLERRILLSRVPELPEHLASELVRIIGVLRGMQLKKLPSVAE
TIDWGRTVLALGMDTIDDAMIAATLGVVLKHQSDQQRAAGELRLN
108800501YP_640698.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTAPTQKVAVAIIGGGPAGLTAAAALAPDVDVLVLEREAMTGGIPRHSDH
PGYGMRDLRRFMSGPAYARRLTAQALDAGAMLETEAMVTGWGGERLLQVT
TPRGVRTVSADAVVLATGARERPRPARLIPGDRPDGVYTTGQLQNLVHLH
HARVGTRALIVGAELVSWSAVLTLREAGCATVAMVSRYPRSEAYAGFRVP
GRALMSGPVLTRSRLVSIHGKDRVRKAVVENLDAGERTTVDCDTVVFTGD
WIPDHELARTGGLAMDARTRGPVVDAALRTSAPGVFAVGNLLHPVDTADG
AALDGRHVAAAVRGWLQRREEPSPGVRIRTDEPFKWVAPQLISPNGGAAA
RGDLLFWVDEYRRLPKLRAVQDGRVLATARTPWPAAPGRVYRAPWSLVAN
ADPNGGDVTVEFA
108800499YP_640696.1 carbohydrate kinase [Mycobacterium sp. MCS]MTHLLAIDQGTSGTKAIVVDYGSDGSGRVVSVAEVALRPQYLAGGAVEQD
PEAMWDSVVGAGREALARAGVPVAAVALANQGETVLAWDRDTGRPLTPAI
VWQDRRAESVCAPLAGSADRIAQRTGLVLDPYFSAPKMAWLRAALTRSGV
VTTTDTWLVHRMCGAFVTDTSTASRSLLTALESPTWDDELLDLFGLAGES
LPAIVDSDQIVGETDVFGPTIPVAGLIVDQQAALLAESCLEPGAAKCTYG
TGAFLLAQLGETPARSSSGLTTSVAWRLRGQTSYCADGQVYTAASAVRWA
IDLGLVPAADHLDTVATDSSDGVLCVPALAGLAAPWWDSAATASFTGMTL
SSTRGHLVRALLEGIAAQVTALADLVGTDLGRPLTRLRVDGGLTRSTVLM
QAQADLAQIPVDVYPSLHATALGAAACARLALEPSLTPAEAVGTWTPVHT
YEPRWSADHAADYLQRWRRAAESTLQNQGETS
108800497YP_640694.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MPAAARKSPPQGGGDPPRYLAIAALVRDRIATEQLGPHTLLPSERELAEQ
HGVSRMTARQALSLLESEGVVYRRPPRGTFVAEPRVRFHIGSFSEEVSRL
GRRPAARLLWAERQQPTPAVQLALALPDGAAVHVFHRLRSVDDAPVALET
TFLPADLTPGILDTPEEGSLWAVLRDRYGMRLARSTAVLESIVLDDTSSS
QLAVRAGSAGTLLTRRTEDDAGRCVEYARDVYRADRAAFEVSEVLTVDRT
TV
108800495YP_640692.1 Iojap-like protein [Mycobacterium sp. MCS]MTASDEAIQMATVAARAASSKLADDVVVIDVSGQLVITDCFVIASASNER
QVNAIVDEVEEKMRLAGHKPARREGTREGRWTLLDYVDIVVHIQHQDERN
FYALDRLWRDCPTVPVDLDGLS
108800493YP_640690.1 hypothetical protein Mmcs_3527 [Mycobacterium sp. MCS]MTSSEPDPARRTLLVFADSLAYYGPTGGLPSDDPRIWPNLVAGQLGWDLE
LIGRIGWTCRDVWWAATQDPRAWAALPRAGAVVFATGGMDSLPSPLPTAL
RELIRYVRPPWLRRWVRDGYGWIQPRLSPVARAALPPHLSAEYLEMTRGA
IDFNRPGIPIVASLPSVHIAETYGKAHHGRAGTVRAITEWAEEHDVPLVD
LKAAVAEQVLGGHGNPDGIHWNFEAHQAVAELMLKALAEAGVPQGN
108800491YP_640688.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MLTASPRISRHPTAVSTRDSVSDSLRFVVTYQQDEAWVAMADRTRRSIVE
RLARGPCAVGELARDLPVSRPAVSQHLKVLKRAGLVHDHADGTRRVYQLN
PDGLAAMRADLDRFWARALADFKEIVEQREGEGP
108800489YP_640686.1 hypothetical protein Mmcs_3523 [Mycobacterium sp. MCS]MTAQAPLTELTRAERADLAGFLATLTPEEWYAPSLCAGWTVKDVVAHVIS
YEDLGVAGFLGRLVKGRITDANQVGVNEFSHLSPSELLDHLNRHLDPSGL
TAQFGGMIGFVDGTIHHQDIRRALDRPRTIPADRLSRILPLVPGNPRLGA
GRRIRGLRLRATDVDWTHGDGPEVVGPGEALLMAMTGRPAALADLDGPAK
ALLAQRLRPRRDHGS
108800487YP_640684.1 endoribonuclease L-PSP [Mycobacterium sp. MCS]MAIRSFTFTPDDGVPPAVAPFAHATAAGQTLYVTGQMPTDHTGEIVGTGI
EAQTDQVLRNLLRVTRLCGGGLDDVVAVRAYLTDWAEYAAFNTAYAAWFP
DRLPSRTCVGVTGLAVGARVEIDWTCWRADGWGR
108800485YP_640682.1 hypothetical protein Mmcs_3519 [Mycobacterium sp. MCS]MSDEAAPLDLRLVPAASTGWAVTAAAIHWHTAAAVLVLLGGIAATAAAAV
WGGAAVTAVAAIRSAAAGLAGVAVVGAAFTVAVTVRVDQVRHHPVTALYG
ATAPVTVTPGDSPRPLGGGRLMFRAVLHAVDGRPMSGRVVVFASAKGFSE
VSAGRPAAFRAGIGRPTRRDLTVAVLSATGEAAVGTAPPVHRMAQSVRSG
LADAARGALPVDQAAMLPALVLGDTATVPPDTTADFRTAGLTHLSLSLRH
G
108800483YP_640680.1 putative phiRv1 phage protein [Mycobacterium sp. MCS]MGLNMPEIRSAACRVARATKAGDPTAEADARRELAEAKIADYVRRCLAAA
PPLSDEQRTRLAELIRPVRVNGGIR
108800481YP_640678.1 hypothetical protein Mmcs_3515 [Mycobacterium sp. MCS]MAASPAHRLTAIDGPLDLLSQLSVRLPVATRSAAEPWRSLTAGGHRSPLV
AAHPAKAVAMSSPRSSAATSSRAASSKSELVEAVTVGP
108800479YP_640676.1 hypothetical protein Mmcs_3513 [Mycobacterium sp. MCS]MTEPTGRDRPPTLTAMVAWALLYPEGRRADDYDQRYARLVELHGEDAVAD
VIAEVNKLALDGMRASGDVTERQPLTREMKMRIFDQFLDDGS
108800477YP_640674.1 hypothetical protein Mmcs_3511 [Mycobacterium sp. MCS]MSQQVAALHLVLGDEELLVERAVAAVLKSARKLAGTDDVPVDRLRAGEVS
TSELAELLSPSLFSDERVVVLESAAEAGKDAVALIAGAAADLPPGTMLVV
VHSGGGRAKALADQLKKLGAEVHPCAKIAKAADRADFVRREFRSHKVKVT
DDTVTAVLDAVGSDIRELAAACSQLVADTAGEVTAVAVRRYHSGKAEVKG
FDIADKAVTGDVAGAAEALRWAMLSGEPQVVLADALAEAVHTIARVAPLS
GDPYRLAGELGMPPWRVQKAQKQARRWSRASVAEAMRLVAALNADVKGAA
ADADYALESAVRRVAELVAD
108800475YP_640672.1 hypothetical protein Mmcs_3509 [Mycobacterium sp. MCS]MSPANLPERPVWGKVSWVSLRTLPTESSRSSRTNGARTKRHEGIFDGYNS
VGGYDKAFDEMFDPQGNVRGPYKGIFAELEPADASDLQARADALDRAFIN
QGITFSLSGQERPLPLDLVPRVISAAEWTRLERGITQRVRALEAYLDDIY
GEQHILRDGVIPRRLVTSCEHFHREAVGISPPNGVRIHVAGIDLIRDEHG
SFRVLEDNLRSPSGVSYVMENRRTMARVFPNLFATHRVRAVDDYASHLLR
ALRNAAASNEADPTVVVLTPGVYNSAYFEHSLLARQMGVELVEGRDLFCR
DNTVYMRTTAGERQVDVIYRRIDDAFLDPMQFRPDSVLGVAGLLNAARAG
NVVISSAVGNGVGDDKLVYTYVPTIIEYYLGEKPLLANVDTYRCWLDEER
EEVLDRVTELVIKPVEGSGGYGIVFGPDASDKELNTICKKIRNDPRGWIA
QPVMQLSTVPTQIGGKLAPRHVDLRPFAVNDGDDVWVLPGGLTRVALPEG
SLVVNSSQGGGSKDTWVLASRASAADRELAAAEVVRSLPKSAKANKVDKN
ADAQSAEQLQQQQQQQQ
108800473YP_640670.1 transglutaminase [Mycobacterium sp. MCS]MWRMRVVHATGYAYKSPVTASFNEARLTPRSDARQNVILNRVETAPATRQ
YRYVDYWGTAVTAFDLHAPHTELEVTSSSVVETDVDDRPAETVTWDDLRS
EAVIDRFDEVLTASHYTPDSRRIARVGQRIAKYHDPYEAVIAAANWVHTE
LDYVPGTTGVHSSGLDALREGKGVCQDFAHLSLVLLRSMGIPARYVSGYL
HPRKDAAIGDTVDGQSHAWVQAWTGGWWHYDPTNDSDINEQYISVGVGRD
YADVSPLKGIYSGEGSTDLDVVVEITRLA
108800471YP_640668.1 signal-transduction protein [Mycobacterium sp. MCS]MRIADVLRSKGSAVATITETTTVTGLLAELATHNIGAMVVVGQDGVVGMV
SERDVVRRLHERGAELLRCPVSEIMTSVLVTCTPADPVDDLSALMTNNRV
RHVPVLDNGRLAGIVSIGDVVKNRMEQLQTEQEQLQAYITRG
108800469YP_640666.1 NLPA lipoprotein [Mycobacterium sp. MCS]MTSQTSSPAGPGLDLEIKKHKRWPWIAGAVVAVLAVTGGVVYANVSNQDK
PFGPNLKVATWSTDIAAENLLGYIAENIAPSHGITIEPVQIDNLIEINRA
VDAGNVAGNFFEHQPFLNDAIAANGFELTLAAPTFTWDQATYSDKYRSWN
QLPDGARIALRDDPAGQAIALLDLAEAGQITLKPGKDTVAGLPQLGDIES
NPKNYRFIQVPIGQLARSLADVDAVVVHISDVYAAGLTEDQILARHPAPK
GSEGGLVVSDRHLDDPNVQKLIATFQDPKIAEFLETTDNKLIRDTLGPIS
108800467YP_640664.1 binding-protein-dependent transport system inner membrane protein [MycMNLLAAEDFNTPWPNVPDLLLPAYGETWLMVGITMALVVTIGIPVGITLH
NTSELGLYPNPRVFAVLNTIVNIGRSLPFLILMAAIIPVTRFIVGTTIGI
QAAIVPMTVAGVPFFARLVQNALREVRTDVADMGLVSGGSTLQVIRTVQL
SEALPGLAGALTVNTIAMIEYSAIAGSIGAGGVGNLAITYGYNRFDDNIM
IATAVSLIITVQIVQFTGDRVVKALTR
108800465YP_640662.1 coenzyme F420-dependent N5 N10-methylene tetrahydromethanopterin reducMPLHSRWFEPSTPPAATTRVLPVSGYPRFGVWANVHGTMAALSHPDDPVN
ASWSRVRDQILLVEQAQGIEEISGGRFAVNIVNAWWVPDLERSGIGMLEH
GERYVYGAEWLHIVRRLLAGERTTFHGKYFHVDDFHLHPTGTHRTRPRIY
LGGESGPARDLAAAEADVLFLNGQAPEEAVTLLTDVRRRPRHGLDPIRFG
LAAFVVTAPTQREAAELLDYHWELNARDRAGDGDTIDRFSRDTDPASVMW
QRLRERPHIGPNGGTAAGLVGDYDTVAQRIVEWHRLGIETFMLAFQPFEA
EMQRFAAEIMPRVQVLSQRAEVAV
108800463YP_640660.1 N-acetyltransferase GCN5 [Mycobacterium sp. MCS]MCDRGRMAAVDVRPGRRSDVRELADVLGRAFHDDPVMKWILPDDADRGRG
LTRMFATMTRHHFLRGGGVEVAAADDGLGAAALWDPPGRWKQTRLEEFLM
MPAFVRAFGKRVAIGQQVADLMKEHHPEEPHWYLAIIGSDPTVRGAGLGQ
ALMRSRLDRCDAEYAPAYLESSNPDNIAYYERFGFEVTGELRVPDGGPSL
WAMWRQPR
108800461YP_640658.1 hypothetical protein Mmcs_3495 [Mycobacterium sp. MCS]MRVLRGLLGALLWILGGVVGLVGVVLCLTAILLPLGVPLLALARRLVTRA
AQLMLPRPLAHPVKELAKTTDKTSRDARKAVRGQRKRLSRMVSK
108800459YP_640656.1 GTP-binding protein LepA [Mycobacterium sp. MCS]MCRRAPRSIPLRCAHAPRRDVYQEIPISSFADQTFTAPAQIRNFCIIAHI
DHGKSTLADRMLGITGVVADRDMRAQYLDRMDIERERGITIKAQNVRLPW
EVNGEKFVLHLIDTPGHVDFTYEVSRALEACEGAILLVDAAQGIEAQTLA
NLYLALDRDLAIIPVLNKIDLPAADPDRYAGELAHIIGCEPSDVLRVSGK
TGAGVRELLDEVVRLVPPPTGDADAPARAMIFDSVYDIYRGVVTYVRVVD
GKITPRERIAMMSTGATHELLEVGIVSPDPKPSAGLGVGEVGYLITGVKD
VRQSKVGDTVTTARHGAKEALTGYREPRPMVYSGLYPVDGSDYPVLREAL
DKLQLNDAALTYEPETSVALGFGFRCGFLGLLHMEITRERLEREFNLDLI
STAPNVVYRVEKDDGTEIVVTNPSDWPEGKVRTVYEPVVKTTVIAPSEFI
GTIMELCQSRRGELGGMDYLSPERVELRYTMPLGEIIFDFFDSLKSRTRG
YASLDYEEAGEQEADLVKVDILLQGEAVDAFSAIVHKDGASAYGNKMTTK
LKELIPRQQFEVPVQAAVGSRIIARENIRAIRKDVLSKCYGGDITRKRKL
LEKQKEGKKRMKTIGRVDVPQEAFVAALSTDAAGDKPKK
108800457YP_640654.1 hypothetical protein Mmcs_3491 [Mycobacterium sp. MCS]MMGRIWAVAIGVVALTAGCADTVSGNAVRPANIVPVGVPPLSETHLADVL
LSIGELNGIVGSTRMTVTSDSAEMTDHSGDVSDPGCLGAIYGAEAPVYAD
SGWTVMRDQVAREPDEGNQHWVEQTAVLYPSDKEAQDFVDASRTTWQDCA
SAALTVDDGVVRSVWDMASVINDGSLLTQVSVQRDADGWGCQHALSAVSN
LTVEAWACAFGPGGEAATIATEMVANAAEAVR
108800455YP_640652.1 LysR family transcriptional regulator [Mycobacterium sp. MCS]MPPYGHNVFDVRRLVVLREVVRCGSLSAAAVSLNYTTSAVSQQITALERD
VGAKLLERGPSGTRVTAAGTRLLEHTDVILGAVTAAEQDLARAASAVPDT
LRVASFSSAAATILPRVITRLRHEYPTTGIELVTADPDDGVALLGADGAD
AAMVTEVPGEPPEFRGVYTVPVYDDEFFVVLPRDHRFAAAVEVPFEALAA
ERWVVSTATGTCPDTRVFHTACRRAGFDPQVTFRADDYGTVQGMVAAGMG
VSLVPSLAAWAARGDVAVRRLTHRPVRRVAVATAAEPAAASALARLVSLM
ADTGARLRARGVFSVPASPSSVA
108800453YP_640650.1 hypothetical protein Mmcs_3487 [Mycobacterium sp. MCS]MSCSDFVRRTGDLIMTDHEDPRFYLTGSINVPGVEDAFRLVGAHLQPGVT
RVPDGEPGDRANWVLTQAGHFLDNPTLDIVDGRARIRPGVSVEFPAVDYH
SVAAESYALFRAARDRGVLAPDSRFLVSIPTPFNAVNSFAEFDSRVEIAF
AYEQRLRESVEAVQEAVPPRDLAIQWDLPTELATVEGWFDNPYGGLEPIF
AATARLAHWVHEDAELTFHLCYGDSKFGASPFMGDPPDEEAAARGGRHVL
PRDARAIVTLANGLSRHVQRRIDAIQAATVAAWTRRAHWQPLADLALEPG
TEIYLGLVHAEDGADGARARSALAREFLPEFGLSTECGLGRHSTEQLAAV
LAAWQNLTTREFVPA
108800451YP_640648.1 hypothetical protein Mmcs_3485 [Mycobacterium sp. MCS]MDNRITDVTSRRVIDIAIGILVGLRGCTERQAFDELVTVVKQTGLGIGRV
AGGLVALAAGSSSAEHAEAFAAWGELIRGARRVPTG
108800449YP_640646.1 hypothetical protein Mmcs_3483 [Mycobacterium sp. MCS]MDAFLSWWDGVELWLTGLGFVAQTAVVMPVALLLAYGLAVLLDGALAAGV
RVLRRARHDGQEPS
108800447YP_640644.1 sulfate ABC transporter permease [Mycobacterium sp. MCS]MITAVDGDNGRAPGGFARRRGTASLRVGVATIWLSVIVLLPLAAILWQSV
GGGWEAFYRAVTGNAALESFRVTLTISVGVTIVNAFFGLLVAWVLTRDDF
PGRRLVDAVIDLPFALPTIVASLVMLALYGPASPVQLHLQHTKWGVGIAL
LFVTLPFVVRSVQPVLLELDREVEEAAASLGANNWTILTRIILPALLPSL
LSGAGLAFSRAIGEFGSVVLIGGAVPGETEVSSQWIRTLIENDDRTGAAA
ISIVLLAISFVVLLILRALGARAAKREQMAG
108800445YP_640642.1 sulfate transport system permease 1 [Mycobacterium sp. MCS]MTDAIIVRGANKHYGDFAALDNIDFEVPAGSLTALLGPSGSGKSTLLRAI
AGLDQPDTGTITINGRDVTAVPPQRRGIGFVFQHYAAFKHLSVRENVAFG
LKIRKRPKAEIKEKVDNLLEVVGLAGFQNRYPNQLSGGQRQRMALARALA
VDPQVLLLDEPFGALDAKVREDLRAWLRRLHDEVHVTTVLVTHDQAEALD
VADRIAVLNKGRIEQVGSPTEVYDTPANAFVMSFLGAVSSLNGTLVRPHD
IRVGRNPELPIYESESIQATGVVKAVIDRIVVLGFEVRLELTNAATHAPF
TAQITRGDAEALGLREGETVYVRATRVPEIPGDTEAPKAAVLR
108800443YP_640640.1 hypothetical protein Mmcs_3477 [Mycobacterium sp. MCS]MLTAVVGILVGFLVVLAITALTGYFVAQEFAYMAVDRSRLKARAEAGDHA
AARALTVTRRTSFMLSGAQLGITVTGLLVGYVAEPLIGRGLETLLGGAGI
PTAVAVGIGGLVAIAVSTVVQMVFGELFPKNLAIARPEPLARWLALSTTI
YLKLFGWLIWLFDQSSNMLLRLLRIEPVHDVEHSATPRDLEHIVAASRDA
GEIPRELSALLDRILDFPTSTAEHAMIPRSRVDVVRADEAVPDVLERMAR
GHTRYPVTGSGPDDVIGVIDLHDLLGPSTQSTSGTAGARCRPAVVVPETL
PLPNVVRELAQTGDEMAIVIDEYGGFAGIVTVEDLAEELVGEIDDEHDTE
STADIVARDGGWLLAGDLPLDEAERTLGLTLPEGDYETVAGMVIAHAAGL
PDAGDTVVIELPSDNADLLNDGPAPARQIVAEVRAVDRRVPSRVLVTVDT
RTEGGDDE
108800441YP_640638.1 phosphoadenosine phosphosulfate reductase [Mycobacterium sp. MCS]MSDIDLQQLAERGAAELGPNASAIDLLRWTDENFSGNYVVASNMQDAVLV
DMAAKVRPGVDVLFLDTGYHFAETIGTRDAVQAVYDVNVVNVTPERTVAE
QEALLGKDLFAREPNECCRLRKVEPLTKALSGYSAWVTGIRRVEAPTRAN
APLISWDRAFGLVKINPIAAWSDDDMQAYIAANGVLVNPLVDEGYPSIGC
APCTAKPIEGADPRSGRWQGLNKIECGLHQS
108800439YP_640636.1 coproporphyrinogen III oxidase [Mycobacterium sp. MCS]MSLRTAPVRAPELAATAGRPFGLYIHVPFCATRCGYCDFNTYTPAEAGGA
NPEGWLVAMRQELALAARTLGTPPPVRTVFVGGGTPSLLGGAGLTAVLAA
VREHFDLAPGAEVTTEANPESSGPELFDALLAAGYTRVSLGMQSTARHVL
KVLDRLHSPGRAVAAAGEARAAGFGHVNLDLIYGTPGETDDDLRRSADAA
IGAGVDHVSAYALVVEDGTALARRVRRGEVTAPDDDVLAARYELLDARLG
EAGFDWYEVSNWARSGGECRHNLGYWAGGEWWGVGPGAHGFLGDTRWWNV
KHPNAYATALGDGALPVSDFEVLDPAARHTEDVMLRVRLRSGLPLDMLTA
DERSRVGTVVADGLAVVDGAALVLTDRGRLLADGVVRTLLAD
108800437YP_640634.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSTGFQHVHSDLTDGFVPFPEDRAEQYRRAGYWTGRPLESLLLDAAHRRP
DHPAVVDVDGSLTFAELTARADTVAAALAGLGIRPGDRVLLQLPNSVRFA
VAFFGLLRAGAVPVMCLPGHRTAELGHFADVSGAVALIVPDEVGGFDYRE
MAAQLVADRPTLRHVLVDGDPGPFLSWAALIDSGGVAPEIGPVDTSLPAL
LLVSGGTTGLPKLIPRTHDDYVYTAVSSAQACHFTPDDVYLVALPAGHNF
PLACPGMLGAMTVGATTVFTADPSPEEAFALIDKHQVTVTGLVNALGKLW
AQACDWEPVLPTSLRLVQVGGSRMSPEEARFILDRLTPGLSQIFGMAEGM
LNFTRPGDPLDVVVHTQGRPVSPHDEMRVVDESGVEVAPGEEGELLVRGP
NTLNGYYRADEANARCFSPDGFYRTGDRVRIFADGPLAGNVEVTGRIKDV
IHRGGETVSATDLEDHLLTHPAIYAAAAVALPDDYLGEKICAAVVFRGKQ
LTLAELNAFLDERGASTHARPDVLAAMPSLPLTAVGKVDKKKLVAQLTG
108800435YP_640632.1 thioesterase [Mycobacterium sp. MCS]MTARQLEFAPWVKHFPASGGATAVVFPHAGGAAAAYRALAKSLSGNGIDT
HVVQYPQRADRLRHPAADSIGALAAQLFEAGPWDRLGPLDLFGHCMGAVV
AFEFARVAERNGVTVRTLWASAGQAPSTVAEAAPLPSTDRDVLADMVDLG
GTDPRLLEDEDFVELLVTAVRADYRALSGYACGRDVQIRADIHALRGDRD
HRISREWSQRWASHTAGRFTLSTFQGGHFYLDEHLDEVAALVGGG
108800433YP_640630.1 acyl transferase domain-containing protein [Mycobacterium sp. MCS]MTRPNRWPDGRIPVLLSAHAGDLVAEDARAVLGYLDHDPAASVADVAGHL
LTTRRVRRHRTVVRAGDRDELADGLRAVAHGAEHPLVARSAEGSPSRIAF
VFPGQGTQWPSMGTQAYEELPQYRAAADACAEAFTAAGAASPMRYLTTPG
TAEGFSEAEIEGAQFTHAVALAHVWRSYGVLPDITVGHSLGEIGAAYLAG
AITLADAVAVVIARAEVVDRLSGDHAVAVLGVDPETAQQVIAATPGWLEL
SVVNAATSVAVSGDRRAVSAAVARVREQGRFAREITVGFPVHTSILEPLR
DDFVKQLPQAVFADSPVQFIGGATGDVVPAGAMFGDYWYANLRTMVRFDR
AFESARRCGATTFVELSAHPQLLFAMGDLLGDTTATLVGSGRRDTPITEA
LSDNLAVAAVSDPGHGWRDAVERTAHRLRGFPNAPMRATPLWAQPEPLSE
TADITVAQEVWQPIDDVTPSAHTAPVTVTVLELGATGPFGERLRTAVDAH
PGMALGTPDTADVMVVVAPQPGGADAKTAVTTVTDLVGSGALRYPASAGP
RCRDIWLVTAGAERVRAGEPQALSAAAIAAMHRSLGLENPELGFHHLDLP
ADPTIDTAVVDTLLTGAGELAIRGGDGPVLYRRTVADAPVAPAWSLGSGI
LDEVVITGGAGRIGLHYARHLAERGARRIVLLSRRAVDPAVLAELTAPRG
TEVVSVPCDLTDRESIRTATDFAGIGASLVIHAAGAATFAEGDRLDAAAA
VNTLGAKVTGLAHLADLWPLHPDARIVLCSSVSGLWGGHGHAVYSAANRM
LDAMAGRLRADGHRCVSVRWGLWRSDSGEGIVGAAETARIERSGLRPMAP
LPAIEASLCDHTVDPLVFSADPHRMQMFSAATEPVRDPQTAETTAAPVDT
ADAVRAELAAVLKITDPGGIDLDASLFDLGVDSLLALDLGKRFRRVLGRT
VPLATLLGGVTGAELVAELDEKVEIPRD
108800431YP_640628.1 amino acid adenylation [Mycobacterium sp. MCS]MTRTQAAANAIEDVMALSPLQQGLYSMTMLADSEHADGDPRPDPYVIAMA
ADVTGTLDTALLRDCATALLTRHPNLRAGFFRGDLPRPVQVVPARVDLPW
QHVRARTAEKAAELEHRERRRPFDLERGPAIRFLLIELPGPAWRLVIVAH
HIVIDGWSLPLFVGEMLTLYRAGGDPGALGDPPRPYRDYIGWLAGRDQAA
SRALWTEHLAGIDAPTLLTPALSAVEPAAGLPRRTEVALDAGASRRLTET
ARSRGVTVNTLVQMAWAAMLSVFTDRRDVTFGMTVSGRPGELAGVETMVG
LFINTVPLRVRLDPVDTVGSQCLSLQRTAAALREHSYLAHSELRALAGVG
EMFDSLLVYENFPPGGLVGGDHRFEAAGATFIPAALESLSHFPVTIAAHM
ADERLTVLVETLDGALGALTPHDVGQGLLDTVERLIALWDRPLRDVRMLS
GDDPAVPAVTEPPPRTGVHCAFTEAARRTPDAVALSWDGGTLTYREVDAA
ADRLAAGLTARGVGAETPVAVRLSRGPDYVIAMLAVLKAGGMIVPLDPGM
AGERIEEILRQTAAPVVVDDALSAGVGAPDGAWAPATVAPGQAAYAVFTS
GTTGIPKGVVGTHDAVLAYADDHARHVLRPAATRLGRPLRIAHAWSFTFD
AAWQPLVALFEGHSVHIIGDAVQRDAEALVDTIDRYDIDMIDTTPSMFAQ
LKAFGLMSRVPLAVLALGGEAVGSGAWRFIREECARTSMTAFNCYGPTET
TVESVVAAIAEHPQPVIGSPTRHARAYVLDAWLRPVPDGVAGELYLSGAQ
LARGYLDRACETAGRFVADPFLAGNRMYRTGDVVRRDATGALQYLGRSDD
QVKIRGFRVEPGEVCAVLQTHPAVRAAHVTVRRHGAGPRLTAYAATGGTD
VAVAELRHMLSTRLPRYLVPHHIAVLDELPLTAHGKIDDATLATYDAAAA
GPAAAPETPTEAALAEAVAELLGTTAVDVNADLLSLGLDSIVALSVVQAA
RRRGVALRARLMLECGSIRELATAVDAEAGIESSSQATEAASSDPIPVLP
NVHWLYEYGHPRRLAQTEAIPLPDGITADALRTVLRTVLDGHEVLRTRFD
RTAMTLVPQAETPADELLSEVAVSGDLADAVAEHTETAVQRLDPERGRLW
SALWLRPAHGPGVLVVTAHVLAIDPASWRVVIGELDTAWHALRAGRTPTP
TREHTTYRQWSARVRERAHRLDTADFWAAQLDGADPELGARRVRPETDRA
GDLEVSVAITEPDLTARLIASAQAMPTLLTLAAARTVTAWRRRRGQPTPP
PLLALETHGRADSAVSADADTGDTVGLFSAIYPVRVDPDAGPVEIPGEGI
DFGLLRYLRADTAERLCAYRQPQLLLNYLGRADVGGAGTFNVDKGLLRAV
SVLPEPELAVRHEVTVMAAILPQGDAPVLATQWRTLPEVLSADDVAVLQT
LWQDALQEVAR
108800429YP_640626.1 MbtH-like protein [Mycobacterium sp. MCS]MSTNPFDDENGRFYVLVNDEEQHSLWPTFADVPAGWRVVFGEATRAECLA
YVERNWTDLRPRSLREAMASE
108800427YP_640624.1 hypothetical protein Mmcs_3461 [Mycobacterium sp. MCS]MIFKGVRDGKPYPEHGLSYREWSRIPPRQIRLDEIVTTTTVLALDRLLSE
DSTFYGDLFPHAVRWQGVIYLEDGLHRAVRSALRNRTVLHARLYDMDVPY
SQQI
108800425YP_640622.1 chaperone protein DnaJ [Mycobacterium sp. MCS]MARDYYGLLGVSKGASDQEIKRAYRKLARELHPDVNPDEEAQARFKEISA
AYEVLSDPEKRRIVDLGGDPLESAGASGGNGFGAGFGGLGDVFEAFFGGG
GGSRGPIGRVRPGSDSLLRMRLDLAECATGVTKQVTVDTAVLCDLCHGKG
THGTSTPATCDTCGGRGEIQTVQRSLLGQVMTTRPCPVCGGVGEVIPDPC
HRCGGDGRVRARREISVKIPAGVGDGMRVRLAAQGEVGPGGGPAGDLYVE
VHEKPHDVYVRDGDDLHCTVSVPMVDAALGTTVSVDDILGGPLELTIAAG
TQPGAVSTLRGHGMPHLRSGVRGDLHAHIDVVVPAKLDHTDIELLRQLKE
HRSRDVAEVRTSSSPAASNAGGLFSRLRETFTGR
108800423YP_640620.1 hypothetical protein Mmcs_3457 [Mycobacterium sp. MCS]MLNLGAPMIPRPRAAATAWILGATAYLTAEAVTAAAYRPSYSYVRDYISE
LGAPGQPWAALMNIAFVVQGVLFLSGAVLVSGSRHRMLTAFAVANAVGNI
LVGTVPAGGGVLHIVGAALAIGGGNAAALAGASLRPGRTFRLFSRVIGGF
GLASLGALGVQTWTGIVMLPDPVWERASVYPILTWQVCAAASLVGALPPA
RRQHP
108800421YP_640618.1 putative metalloprotease [Mycobacterium sp. MCS]MSIEVSNESGIDVSEEELISVARFVIEKMNVNPAAELSMVLLDTSSMADL
HMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPAMLGDIVLCPEFAAKQ
AETAGHSLGHELALLTVHGVLHLLGYDHAEPDEEKEMFALQRELLEEWVA
HQVEAYHLDRQTERDRRLLDKSRYFDE
108800419YP_640616.1 hypothetical protein Mmcs_3453 [Mycobacterium sp. MCS]MTELDPEDDKLVVLARGAMARAEAAGGAAVRDLDGRTYAGAPVALNALPL
TALQAAVAAAVSSGAAGFEAAVLVGGSADDAGVAAVRELSADAAVIVTDR
SGKVLS
108800417YP_640614.1 amidase [Mycobacterium sp. MCS]MADSSAPRPARTAFPTLTDQLYQLASGAVTADDLVRRSLHAISASQPTLN
AFRVVLAEQALAEAAEADRRRAAGDQRPLLGIPIAVKDDVDIAGVPTRFG
TAGTVRPADADAEVVRRLRAAGAVIVGKTNTCELGQWPFTSGPAFGHTRN
PWSREHTPGGSSGGSAAAVAAGLVTAAIGSDGAGSVRIPAAWCHLVGIKP
QRGRISTSPLAEAFNGITVNGVLARTVTDAALVLDAASGNAAGDRHRPAP
VRVSEYVARAPGPLRIGLSTKFPFTGFHATLHPDIRAALHTVSGHLEELG
HTVRPADPDYTVGMSWNFLSRSTSGLLDWAERLGYGVDFDKRTKANLRMG
RLLSEHVLRKARAKEAAAQRRIGWVFNICDVVLAPTTAQPPPRVHDFDEL
GGLATDRTMIKACPVTWPWNLLGWPSINVPAGFTADGLPIGVQLMGPAES
EPLLISLAAELEAVSGWVARQPKVWWDTPQMSQAAKAPTDDGPSGDPLEL
RETA
108800415YP_640612.1 undecaprenyl pyrophosphate synthase [Mycobacterium sp. MCS]MTSSRRGAERKKSQFPQLDPPADDYPTFPDKSTWPVVFPELPPNTNGRFA
RPPQHTSKAAAPKIPADQVPQHVAVVMDGNGRWATQRGLGRTEGHKMGEA
VLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRE
NLNDMGVRMRWVGSRPRMWRSVSKEFDIAEEMTVDNDVITINYCVNYGGR
TEIVEAARQLAQEAVDGKVNPSRITEAAFARHLHRPDIPDVDLFIRTSGE
QRASNFLLWQSAYAEYVFQDKLWPDYDRRDLWAACEEYVSRNRRFGRA
108800413YP_640610.1 zinc uptake regulator [Mycobacterium sp. MCS]MSPAPVRATRQRAAIADLLDGLDEFRSAQELHDALKRRGEGIGLTTVYRT
LQSMAESGLVDVLRTDTGESVYRRCSADHHHHLVCRACGAAVEIQGGQVE
TWAADIAREHGFSDVSHTIEIFGLCGDCSAR
108800411YP_640608.1 glycyl-tRNA synthetase [Mycobacterium sp. MCS]MAPSSSIIDTVANLAKRRGLVYQSGEIYGGTKSAWDYGPLGVELKENIKR
QWWRSVVTGRDDVVGLDSAIILPRQVWVASGHVEVFNDPLVECLNCHKRH
RQDHLQEAYFEKKGAKDGLAGPDSVPMDEIVCPDCGTKGQWTEPRDFNMM
LKTYLGPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKS
FRNEITPGNFIFRTREFEQMEMEFFVEPSTAKEWHQYWIDTRLQWYVDLG
IDRDNLRLYEHPKDKLSHYSDRTVDIEYKFGFAGNPWGELEGVANRTDFD
LSTHAKHSGADLSFYDQATETRYTPYVIEPAAGLTRSLMAFLVDSYTEDE
APNAKGGVDKRTVLRLDPRLAPVKAAVLPLSRHADLSPKARDLAAELRKN
WNVEFDDAGAIGRRYRRQDEIGTPYCITVDFDSLTDHAVTIRERDTMTQD
RVALSEVSDYLALRLKGC
108800409YP_640606.1 deoxyguanosinetriphosphate triphosphohydrolase-like protein [MycobacteMNPRLQDSYDEFDRQRRVDEPAKSAVLPGTGTEHRTDFARDRARVLHCAA
LRRLADKTQVVGPREGDTPRTRLTHSLEVAQIGRGMAVGLGCDPDLVDLA
GLAHDIGHPPYGHNGERALNEIAKAFGGFEGNAQNFRILTRLEPKVLDAT
GRSAGLNLTRAALDAVTKYPWQRGDRTKFGFYGDDMAAAWWVRDGAPAER
PCLEAQVMDWADDVAYSVHDVEDGVVSGRIDLRVLADDDAAASLARLGAE
AFPTLAPDDLLAAAERLSQMPVVSQVGKYDGTLGASVALKRMTSELVGRF
ANAAITETRSVAGGGALHRFVTELAVPTLVRAEVAVLKMLALQFIMSDHG
HLGIQADQRTRIHEVALILWGQAPSSLDPLFAPEFVAAEDDGARLRVVID
QIASYTEGRLERVHEARSPRPLD
108800407YP_640604.1 hypothetical protein Mmcs_3441 [Mycobacterium sp. MCS]MATMIRIRRSVAIGAFAAAAVAAPLAAALSTTPEQVTQAGPACLAWFGNK
DDGKCLSYSNGTPVGVATPGVAFGGAGVGLTTGPLLPGTTISQGIGN
108800405YP_640602.1 hypothetical protein Mmcs_3439 [Mycobacterium sp. MCS]MGREKGSRWDVGTRDNAITLERFDDGDERVSEDVLEVEEARALAALLTKH
ADKLESSDRDKSSDSDKSSDDEKSSDDDESDDSDDSEKSEKSDSEKS
108800403YP_640600.1 hypothetical protein Mmcs_3437 [Mycobacterium sp. MCS]MAWFLAMQGPPSKLGQSLIYELPESADRAKLAEEMASAATLDRVVPVPAI
FGGQRQEVTLYVRPAAWGVWAFYEMSDEERRQMMAAANPLMSALAQAAKQ
QQTGRGQRQGPGPSQTPLGL
108800401YP_640598.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MTTTAEHLRNALDGRWRDVKNDMRDKLSHEVFKPHYTPNTVIARTKVNEQ
LRIMAAEGAAEDGFAKEHGGNGNVGAAITQIEMLAMSDLSLMVKAGVQWG
LFGGAVENLGTERHHEQYVKHIIDCDLLGCFAMTETGHGSDVQSLETTAT
YDPDTQEFVVNSSTPTARKDYIGGAAQTARMAAVFAQLITHEDGKPVNHG
VHCVLVPIRDENGNDLPGVTTSDCDYKGGLPGVDNGRIVFDNVRVPRVNL
LNRYGDVAEDGTYTSPIENPNRRFFTMLGTLIRGRVTVGGSGAAAARVAL
DIATRYALQRKQFSAPDGGEVVIMDYLVHQRRLLPLIARSYALQFAQNEL
VAKCHELQSAEHPDAEEQRELEARAAGLKAANTWHASRAIQESREACGGA
GYLAENRLIGLRGDIDVFTTFEGDNHVLTQLVAKELLTAYADDVKGMSPV
EWVRFAANTVGTRVMKRTAAETIMQTILDTRQDNEEEGSLFNRGTQVQMF
EDREEYLLSSVARRLQGKSKEMSAFDAFNAVQDHVLHTAQAHIDRIVLEA
FVAGIDACEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAV
TRGINERCRSLRPYAELLVDGFGIPEQLRYAAMMDHKELLTAEPA
108800399YP_640596.1 major facilitator transporter [Mycobacterium sp. MCS]MWRQPKAVWAVAFASVVAFMGIGLVDPILKPIADNLNASPSQVSLLFTSY
MAVMGVAMLITGVVSSRIGPKRTLLLGLVVIIAGAGLAGMSGTVMEIVGW
RALWGLGNALFIATALATIVNSARGSVAQAIILYEAALGLGIAVGPLVGG
LLGEISWRGPFFGVSALMVVAVVVTAILLPPTPRPERATTLADPFRALRH
RGLLGTSITALLYNFGFFTLLAFTPFPLDMSAQQIGLIFFGWGVALAFTS
VVVAPRLQHRFGTVPTLIVNLLAMTATLVVMAIGTDSKAVLATCVVVAGL
FIGVNNTLITETVMKAAPVERAVASAAYSFLRFGGAAVAPWLAGVLGEQV
DVHLPYWVGAGAVLAAAVVLTATRGHLRGIDVEEDELTERTDEARAVTVG
SET
108800397YP_640594.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTATPTPSQPRRAGSLQPGELAQASVMAALCAATAIIAVVVPFAAALSLL
GTVPMGLLAYRYRLRVLIAATVAGATIAFLIAGMGGMMSVIDCAYIGGLT
GIVKRRGRGTPTVFVAALVAGTAFGAAAVAALAVLSRLRNLIFDSLTANI
NGIAAVLSRIPNMEDSAERLKRDFATALDYWPLVIGGSGILSITMVTLIG
WWALSRVLGRLVNIPDVHKLEAAAESGPVAPVPTELRDVRFRYPNTGQDA
LGPVSLAVSPGEHLAITGANGSGKTTLMLVLAGREPTAGTVERPGAVGLG
RLGGTAVVMQHPESQVLGTRVADDVVWGLPPGTKTDVPRLLSEVGLSGME
ERDTGGLSGGELQRLAVAAALAREPALLIADEVTSMVDQQGRDGLIQVLS
GLTEHHDMSLVHITHYNDEAGVADRTINLTGNGGAADNAEMVETAAAPTG
TTPVAHTGAAPVLELVGVGHEYATGTPWAKTALRDIDFTVPEGDGLLIHG
LNGSGKSTLAWIMAGLTVPTTGSCLLDGEPVSDQVGAVAISFQAARLQLM
RSHVDREIASAAGFSHHDHDRVRQALATVGLDPTMASRRIDQLSGGQMRR
VVLAGLLARKPRALILDEPLAGLDAASQRGLLRLVTDLRRNAGLTVVVIS
HDFSGLEELCPRTLHLRDGLLAPASATAGGVS
108800395YP_640592.1 C69 family peptidase [Mycobacterium sp. MCS]MTAPRRVDADFLALPRQHLADAALSAALAAGATYADLRIHAITSELVQLR
DGELETAVIDREIGLAVRVIVDGTWGFASHAELDPAVAADTARRAVAVAT
TLAPLNAERIELAPEPVYRDVSWVSDYRVDPFIVPAADKIAVLGEYSGRL
LAADGVDHVSAGLHTAKEQTFYADTFGSSITQQRVRVLPTLDAVAVDSAA
GTFETMRTLAPPTARGWEVVAGDEVWDWTAELAELPSLLAEKVKAPGVTA
GPTDLVIDPTNLWLTIHESIGHATEYDRAIGYEAAYAGTSFATPDKLGTM
RYGSPVMNVTADRTVEYGLASIGFDDEGVRAQSWDLVRDGIFVGYQLDRV
FAPRLGVARSNGCAYADSPHHVPIQRMANVSLQPAAEDVGTDDLIARVED
GLYIVGDKSWSIDMQRYNFQFTGQRFFRIRDGRLDGQVRDVAYQATTTDF
WGALEAVGGPSTWRLGGAFNCGKAQPGQVAAVSHGCPSALFRGINVLNTR
EEAGR
108800393YP_640590.1 hypothetical protein Mmcs_3427 [Mycobacterium sp. MCS]MFRQLSALVATSSGDLRLDTVIRLTCGRALRLLPLPVEVDLFDGKSDAES
VVAAFAEQFATDVTGVSDNQRTCFVTALGDRAFRVSAAVFVADFVPRVWA
GLEALGLGHPGRDVPVDWDHETDPAQALLGEFVPAVARLRALDPLTTEVV
RLRGAVAHNCRLCKSLREGHALDAGGSESLYAEIQDYEHSEQLSDDHKAA
LRYVDALVWTPSAIPVEVARGVRSCFSEDESLELTLDIMRNATNKIAVAL
GADTPRVASGTERYLIDDDGQTVFAGAP
108800391YP_640588.1 hypothetical protein Mmcs_3425 [Mycobacterium sp. MCS]MNPQLDGSCVSIDLPTSIVELVGGYGFLSNLLCGLALGAVAFLLGKKEAA
PPHTIALLASGVLILAADSFLFASVHSRKPFVIDDVIAPGGEYVCYLVWT
LAMPGFGMLMVGATVLVVSIGWMIVQYAITNDIESPIFAALGGVFSFFIV
LTTTLSLVNVSNQYLVFMMYPDRPSGLAVAAVWIFGLVMAAIACSMIVLR
TAGLYRYRKAQADWGAVADSRFRALALAAISISAYGFLAITVDALIFLFR
ADDSVRAPGVMWSAIVLCLGLPWVIYLPICYALPGPVFRAGRRPPVR
108800389YP_640586.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVRDDWVVGGDRRDAAAERIYASAVDVVVTEGLDALDIDALAKRLHCSRA
TIYRYAGGKAQIRDAVLMRLAAGVIDTVRRAVADRSGADRVVTAITVALG
ELRSDPMRKLLMGAPNAPELGALHSSPVLGQLAADLSGITGDDPLAAQWI
VRVVVSLAYWPDPDPRQEEQLLRRFVAPAFSAASSR
108800387YP_640584.1 hypothetical protein Mmcs_3421 [Mycobacterium sp. MCS]MNGSVRAVFTAGVIALTGGALVVSTPLLPTTVEVVRPVVNTAGVATLAPP
VEPPSADELRSALALVGQLAQAPIVADEPPVRVAAAAFDDPAVLDTASTV
IDDVYSVARYWANYVALDLGPWLLNWVPLGYLISDQIYIWYPDLVLPTVD
SFVYDFLDPVVNDALNPAVWLEGINAVIGTAANGVVNGIVDEIDYVLSLG
WFPIPLPPLPTPPLPRLASESAPAVTVTVSSEFDEIVTDTTDGPLADAAP
QASVEQIATEKIDETETDPVAEVQDPGDSGSAAEDVEEPASDSEDEEPQE
VADDKSVDDPSDADQPDADQGEGAEQESAAKTAETSSGENGSGD
108800385YP_640582.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MLAALIERGYRVVGPTVSDNAIVLAELTSADDLPRGWGVDVAPGSYRLRR
RDDDALFGHSAGPQSWKQFLHQPRQRLWSSDGAPSDEPPRYAFIGVRACD
LSAIRVLDGVLGGGAHPDRGFTGRLERLFVVAVNCTEPGGLCFCASMGTG
PAVGPGYDLALTERIDGQGRRYVVDVGSDDGADVLAAVAHRDAEPAEVDS
ARADVREAANHMGRQMPELDLRRLLIDSRESPQWEEVAGRCLTCGNCTMV
CPTCFCTSVEDVTDLSGEHAERWMHWASCFEFDFTFVHEGSTRQTASSRY
RHWLTHKLGSWHDQFGSSGCVGCGRCIAWCPTGIDITEEMNRMADGADAA
DD
108800383YP_640580.1 NADH ubiquinone oxidoreductase- 20 kDa subunit [Mycobacterium sp. MCS]MSPPTLGVWKFASCDGCQLTLLDCEDELLTLAGQVQIATFLEASSAILGG
PYDVSLVEGSITTAADERRIKEIREQSRVLVTIGACATAGGVQALRNFAD
VDEFASVVYARPDYIDTLATSTPAAAHVEVDYQLQGCPIDRGQLLETLAA
LLVGRKPRLPAKTVCTECKLRGVTCVMVAEGVPCLGPVTHAGCGALCPTY
HRGCYGCFGPAATPNTAALIPVLRRDGMSGGDVDRVFSTFNVAKFAEHRD
DT
108800381YP_640578.1 peptidase M52- hydrogen uptake protein [Mycobacterium sp. MCS]MSDIVVIGVGNSCRRDDGVGPAVASAVDARGTPGVRVLSVADDPCAILDA
WAGARLAVVIDAAVATPSTPGRIHRCAADQLPASSTVTSHAVDLATVLEL
GRALDRMPGELLVFAVEAADTGVGLGLSATVAAAVPEVVDAVLAEIEHMP
SGRQQGSKCPGRGSPR
108800379YP_640576.1 3-oxoacyl-(acyl-carrier-protein) synthase III [Mycobacterium sp. MCS]MGTIIDRVELTRGGWRTRHSALHLAVAAARSCLDAAQRDPDDLDLLVNAG
IYRDRNLGEPALAALIQEDIGANPEDPHGGPFDDAHGTFSFDIANGSCGI
LTGLQIVDGFLRSRAVTHALITASDADPGRGMSRDFPFTPVGAALLCDWT
DDDSGLGRVSWVNDPDGGANFRATVGSADARNVLRFEESPDFDDRLAQAA
VHAVHSCLDDAGLTLSDIDVVVAAPGRHRYGVALAERLDLRAGRLVVAED
ENAHTASLASALQPALAALPPEGLILIVAAGAGITAGAALYRAPARPGAG
GRIR
108800377YP_640574.1 hypothetical protein Mmcs_3411 [Mycobacterium sp. MCS]MNANGSGILVGVDGSAESDAAIRWATQEAVMRRAPLTLAHVVAAVATSSP
IGPILAEINEWQQDNARHVLEQALKTAQACAPESHHPDIHTEVLGASVVP
TLVRESADKQMIVVGNRGTGALGRLLLGSVSTGLVHHAHCPVAVIRPTRG
GSPDADAPVLLGIDGSPASEAATAMAFDEAARRGVDLVALHAWSDVAVFP
IVGPAWREYESQGEEVLGERLAGWQEQYPDVRVHRRLVCDQPARWLIRES
EHAQLVVVGVRGRGGFASTWLGSVSSAVAQSADTPVLVVRDASRGQGR
108800375YP_640572.1 diacylglycerol O-acyltransferase [Mycobacterium sp. MCS]MRGPQGADSGDMDHLSTLDASFLEAEDSDPHVSLAIGSVSVLDGPVPDDD
AFVSGLADRVLAVPRFRQVLRTHPLDLEAPEWADAENFDISHHVHRTALP
HPGDDAALFRLTADVMERRLDRERPLWECWIVEGLPDDQWAMIMKLHHCI
ADGIATMHMLAGLSDSGEGDTYATEIRAAGSTAQRRFRLPQLSPDPRQWV
GTLWRTSTGLVGAAARGVGGAAEIVGGLLRPSPTSLVGSVSTMRRFAGAE
VSLDDAQHVCSAFGVTLNDVVLAAITDAFRAMLIRRGEKPQGNSLRTLVP
VSVRANNAVGKVDNRVSLMLPYLPVDKADPEEQLMTVHARLTQAKNSGQR
QAGHAVISATNIIPFPLTAWAVRAMTRLPQRSVVTVATNVPGPRHHMQIM
GRKVVRMFPIPPIALGLRTGIAIVTYADRLVFGITGDFDTAPDVDDLARG
IEHAMDRLVEISTDAENRRPH
108800373YP_640570.1 HAD family hydrolase [Mycobacterium sp. MCS]MTVPVVIDPRYHDAVIFDLDGVLSDPAPTVTLARELQDVGVKTAACSSNS
HGRDMVKSIGAEGFDVCVDGSAEDRAGAPCLEAARRLGVRPQRAVLIEDS
AAGRTPGRDGGFALVIRVDRTRHPDEPIDGDADRVVAGLAGIAVRTGDRR
VSEVPNALESYGQLIGITGARESVLFLDYDGTLSPIVSEPDAAVLVDGAA
EALALVAAVCPVAILSGRDLADVRTRVGAPGLWYAGSHGFELTGPDGTYH
QNEAAAAFVPVLERAAGDLRDLLGHVPGIFVEHKRFAVAVHYREVGSSDE
VAEIVSTTHRLGRQAGLRVTSGRMLVELRPDIDWDKGTTLRWIRDRIDAA
GSLMPIYIGDDLTDEDAFDAVRFDGVGIVVRHDEDSDRKTAARFSLQSPD
QVREFLQRGSQWLAYKHQVASEAWDLTYEGYDPQSEKLREALCTVGNGYF
ATRGAAPESKAGQVHYPGTYAAGIFNRLVDDVSGTAVDNESLVNLPDWLS
LTFRIDGGDWFDIDEVEVLSYRQTLDLRGATLTREVRFRDDAGRTTSVTQ
QRFVAMHLPHVGALQTKIVAEDWSGRITIRSTLDGNVTNSLVERYRDLGK
EHLELIEKRQLSDDSVLLTVRTTQSGIPIAMAARCIVWRDDAPVGASYRL
VGDGAEIGHEITVEQSVGEALTVEKLVTLFTGRDVATSDPAVDAERWVAR
LGRYAEVREGHLTDWTHLWERLSIEFDDFTDEVRILRLHLLHLLQTVSPN
SADLDVGVPARGLHGEAYRGHIFWDELFIFPVLNLRLPMITRSLLAYRYR
RLPEARHAAREAGYAGAMFPWQSGSDGREESQRLHLNPRSGNWNPDASAR
AHHIGIAVAYSAWKFYQATGDLAYLIDYGAEMLAEVARFWVSLASYDEDR
GRYSIRGVIGPDEFHSGYPDAPYDGIDNNAYTNVMAVWVIMRALDALDLL
PLPNRLDLLETLGLTSGELAHWDDVSRRMYVPFHDGVISQFEGYGELEEL
DWDRYRAHYGNIQRLDRILEAENDDVNRYKASKQADVLMLLYLMSVPELG
EILNRLGYHFPADQVPSMVDYYLARTSHGSTLSGVVHTWVLARANRDRAM
EFFELALKSDVSDIQGGTTSEGIHLAAMAGTVDLMQRCFTGLETRSNRLI
LSPYWPESLGVLAVPIHYRGLHLHLRVSGKGVIISVDPREAAGVVVECRG
RVVQLMPGTTVRFPG
108800371YP_640568.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MKAMQLSAWQTPPEIREVPEPEPGPGEVVIRVAGAGACHSDLHLLHDFAP
GMMPWNPPFTLGHENAGWVHTLGAGVSGFSVGEPVAVYGPWGCGRCKRCQ
VGMENYCERAADQPAAGGGLGYDGGMAEYMLVPAARLLVPLGDLDPVEAA
PLTDAALTPYHAIKRSLPLLTPGATAVAIGIGGLGHLGVQILRALTAARI
IAVDNRPEALRLAERSGADHAVRAGDDAAGEIRDLTEGLGADVVVDFVGV
DATLALATAVARPRSDITVVGIGGGTVPFGFFSVPYEASLATTYWGSRPE
LMEVLELARHGRIKTEVHRFPLEEGPQVYERLAAGEFTGRAVITPNS
108800369YP_640566.1 hypothetical protein Mmcs_3403 [Mycobacterium sp. MCS]MKRHEPAPRHDTSRRRRDDAMEPFEIRVPRWPLLVRLFDRGPLVRPTDRF
EALVVTLAIVVVLLAVPVAAAIGTAIHDSRSHFYNEQNATRQHVTAVVTD
VPEYRSFTRTGMMTVPVEWWEGDTRHTETVQAHGSVDPGDAVDLWIDADG
ARVLAPAPASRAAVEAVAGAAAIWLSVAAGAAILSTLVQMTCDRIRSAAW
QHDLDTLVDGGGHTTTHP
108800367YP_640564.1 transporter [Mycobacterium sp. MCS]MPNSHVEAGRRLGPPSERTARTGPAKWIRRFAIPIILGWILLVAVLSLTV
PQLEVVSQMRSVSMAPAEAPSVIAMTRAGEVFEEFESDSSVMIVLEGEQR
LGDEAHRFYNDMVDRLEADTVHVEHIQDFWGDPLTEAGALSGDGKAAYVQ
LYLAGNQGEALANESVKAVQDVVTGLSPPPGVKVHVTGGSALAADQQIAG
DRSVRVIEMVTFAVIIVVLLIVYRSITTVLLVLGMVLLGLSAARGVVAFL
GYHELIGLSTFATTLLVALAIAAATDYAIFLIGRYQEARTAGEDRESAFY
TMFAGTAHVVLGSGMTIAGATFCLSFTRLPYFQSLGVPLAVGMTIAVFVA
LTLGPALITVATRFGLLEPKRAMRIRGWRRLGAAVVRWPGPILLLTIALS
LIGLLTLPGYKTNYNDRNYLPDDLPAMEGFAAAERHFSVATMNPELLLVE
TDRDLRNPADFLVIDKIAKAVYRVEGIGSVQAITRPQGKPLENATIPAQM
SLGGVMQAMTRPYLQGNMEMLLLQADEMEKSVDTMTEMIALMEQMSATTH
DLVGKSKDLSVEIAELRDSISDFDDFFRPIRNYFYWEPHCFNIPVCASMR
SVFDALDGVNTMTEDFQAIIPDMERLDALMPQLLAIMPQTIETMQTARAT
MLSMHSTQSALLEQQAAMDVNSTAMADAFNEAMNDDTFYLPPEIFENEDF
KRGMESFISPNGRAVRFIISHEGDPLTVEGIERIDAIETAAKEAIKGTPL
EGSRIYIGGTAAAFKDMQEGNNWDLLIAGIAALSLIFIIMLILTRALVAA
AVIVGTVVLSLGASFGLSVLVWQHVFGIELHFMVMAMAVIILLAVGADYN
LLLVARLKEEIPAGINTGIIRAMGGTGSVVTAAGLVFAFTMMSMVVSELT
VAAQIGTTIGLGLIFDTLVIRAFMTPSIAALLGRWFWWPQRVRQRPATTG
SLIRR
108800365YP_640562.1 hypothetical protein Mmcs_3399 [Mycobacterium sp. MCS]MRVTDVPFAVLRFQYQIARIPLQVIEDRVVARLDAEAPARLFYERSLGML
DLAVGNALSAPEVEHRGAALIERSEALRRAAQLDETATEVHQQAEANLES
TREQAKREQMQAEQDREREIKESRETASERKQNAVQTAQKKAADAKQQAD
QIAAQRVKSAEAARRQEEAVISATERSIEKVAQGKLDDAADKAGNAAAKR
AQADRVEDLAETEKEKRQQERAAKNGN
108800363YP_640560.1 hypothetical protein Mmcs_3397 [Mycobacterium sp. MCS]MYTNEFPEETLRINFEHWLCEAIRTGVRNAHLQPLTPLSAQTWQAIDEVA
DAAAAVGGQSAHVARLQNVVLAARDQFARQLDGTHRTPHILLGRAAS
108800361YP_640558.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MRRRETVVAMTQLSGKVALVTGASSGLGAATAKVFAERGATVFGISRDAD
RMASVFADVPGGTYASVDITSPEACRRAVDDCVAKFGRLDVLANIAGYHQ
MRHTPTMSDADWDHDLAVNLNGPFFLCRAALPHLLETGGSIVNVASIAGV
EGEVYSAGYCAAKHGLVGLTRALAIEFTADRVRINAVCPGGMVTPQTTEF
SAPDQADWNLIMRIAAPRGMMDVADVAKTIAFLASDDAAAVHGAVYVVDN
GKTAG
108800359YP_640556.1 binding-protein-dependent transport system inner membrane protein [MycMSAPADHTSPETRIASWRLLLGNPVTVVSAVILAVVIVVALFAQWLIPYG
VNDIDVPNALQAPSGAHWFGTDELGRDVLSRVLAAIQASMRVSVVSVSFA
VVVGVTVGVVAGYRGGWLDTVLMRIVDVMFAFPVLLLALAVVAILGPGVT
TTILAIGIVFTPIFARVARASTLSVRVEPYVAVSRTMGTGHLYILTRHVL
PNISGPLIVQTSLSLAFAILSEAALSFLGLGIQPPQPSLGRMIFDSQGFV
TLAWWMAVFPGAAIFVIVLAFNLLGDGLRDVLDPKQRTMIEARAREERE
108800357YP_640554.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MRRDAVQAAGLALIVALLLAVTGCSTGERVDLGDATSGNLVAAIAGEPDQ
LDPHKTSAYFSFEVLENVFDTLVEPDAALEMRPALAESWEVSPDQRVWTF
HLRRGVTFHDGSPFTADDVVYSYRRIIDEELTNVDKFSAVTDVTAVDPAT
VRITVDKPTPNLLTNLGGFKGMAIVSRANVESGRIATHPVGTGPFSFAGA
TSGDSITLRANPSFWGGPPRISGVTFRFISEPSTALSALQAGEIDWTDSV
PPQRVSQLRDDESLRLAVTPSNDYWYLALNEARAPWNDVRVRQAIAYGID
REAIVAATSYGTAAENQLAIPEGNPWYTPYDRYSADLEKARSLLAEANAE
PDRLDMLVTSEYPETVTAAQIIADNLAPLGITVDIRTVDFATWLDEQNNG
NFDMLMMGWLGNIDPDDFYYAQHHTNGTSNAQKFSDPEVDRLLDAGRVET
DRDARHDVYAKAATRIADEVSYIYLYNPSVIQAWTPALSGYEARRDGAVR
FRDAVLGEDESS
108800355YP_640552.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MTAAVEQRLAGRRALVTGGSRGIGAEIVRRLAFEGAAVAFTYGSSVSDAD
KVVVDVSRGGGRVLPIRADSSDAGQIASAVDETVTRLGGLDILVNNAGVA
HLGAVESFPLDQFDRLVAVNVRGVFVAIQCAVPHLGDGGRIINIGSVNAD
RVPSPGLSVYAMTKAAVAGLTRGLARELGPRGITVNTVAPGPIATDMNPA
EGEFADAAREIIAVGHYGNPTDVAGVASYLAGPDAGYVTGANWTVDGGFT
A
108800353YP_640550.1 hypothetical protein Mmcs_3387 [Mycobacterium sp. MCS]MQETAFRFTDGSGRDAAAAGCLATGMRALNAVPAVNDLRPGWVTALDLPL
IAGAGTIR
108800351YP_640548.1 hypothetical protein Mmcs_3385 [Mycobacterium sp. MCS]MRIRTPIGSLSTTYEFVVDGGALRGSATSRDETVALHDITVTDEPDGQRV
TWRQSVTRPMRLHLAFDVVVAGDRMTGHSRAGRLPRSAVTGVRRAR
108800349YP_640546.1 transcriptional regulator [Mycobacterium sp. MCS]MHTVAVLALPDVIAFDLATAVEVFGRARKTDGTTAYDVRVCATAAQVDAG
PLRIGTDHGIDALADADTIVVPGCNDIGAEAPADVLETLRAAHAAGARVA
SICTGAFTVAAAGLLDGRRATTHWMAADAFRAAFPAVHLDPDVLYVDEGQ
VLTSAGASAGLDLCLHMVARDHGAAVAADSARMAVAPLHRGGGQAQFILR
NRAATGPLAEHTRLDGVLAWLEEHAHRDLTLADIAQYASMSVRTLNRRFQ
AETGQTPMQWVTGVRVRHAQQLLETTGFGVERVGRQVGFSSPANFREQFR
RLTGVAPLSYRNTFRERVAG
108800347YP_640544.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MMSGGPIQRVVTHGTFELDGGSWEVDNNIWVVGDDDEVIVFDAAHDAAPI
VMAVGGRNVVAVICTHGHNDHVTVAPELGQALDAPVLLHPADDMLWQMTH
PDKTFRAVEDGATLRAGGIELRALHTPGHSPGSVCWYAPDLGAVFSGDTL
FQGGPGATGRSFSDFPTILDSISGRLGTLPGDTVVYTGHGDTTTVGDEIV
NYDDWVARGH
108800345YP_640542.1 LuxR family transcriptional regulator [Mycobacterium sp. MCS]MNAGDMKTTTDLHTELVTAARAAHAGRDWHGSYANFARANAVAALSTDDL
DALSVAAWRIGEAKEAVRIAERVFAQLARSDPNAAARKAVELALAWLTRG
DLNIAAGWMNRARRLLDGVPESPTHGYLTYLDAVVAVLGDDLDTLTRLVA
DLRAMSGRLDVPALTALAMVAEAIEAVYAGRMSHAGGLLDEVMLPLMADD
VPIDWAGDIYCIVLHICHKVADLPRMRAWVHSMERWCAAAGSDTYGGVCD
VHRLQVRAATDDYQSLENQLARASQMLESVNSWAAGEGFYQLGEVRRLRG
DADGAFAAYARARASGVDPQPGEAMLRCRLGQSQAAWADLRVALTSADRL
DRMRLLRAAVEIALARGQFEEAEQYCRELEDGAAQFGTAGFRAWAAHARG
AVHVQAGRHAEALDSLGAALREYRTQQSRYETAEVYEWMALAHRALGDHA
TADADSATAESIYAHLGVEPATVCGRPPGGLTKREIDILRRIAADGASNR
QLAQQMFISEKTVGRHLANIYLKLQVSSRAAAVAWAHQHNIA
108800343YP_640540.1 beta-lactamase [Mycobacterium sp. MCS]MGVLDVIADWPVGTAAAAVVGPAGVLAEYGDQRHRFRLASVTKPLAARAA
QIAVEEGVVDLDTEAGPPGSTVRHLLAHTSGLSMHSDETMAEPGDRRVYS
NYGFGVLAATIERAADIEFGRYLAEAVFEPLGMSDSTLDGGAEAAGYGAY
STVADVAAFAGDLLRPKLVSQQMHDEATSVQFPGLDGVLPGFGVQRPNDW
GLGFEIRDDKSPHWTGSTNSKRTYGHFGQSGTFLWVDPDADLALVTFADR
DFGDWAYERWPTISDGVLREFGPH
108800341YP_640538.1 diacylglycerol kinase [Mycobacterium sp. MCS]MSPMTIGHVTVLTNPLSGHGNAPHATERAVARFQRRGVDVTAIVGTDAAH
ARRLVDEALAGGTDALVVVGGDGVISLALQALAHGDVPLGIVPAGTGNDH
AREYRLPTGDPEAAADVIADGHTETVDLGRIDDASGGHKWFGTVMAAGFD
SLVSDRTNRMRWPHGRMRYNVAMVAELSKLRLLPFRLRFDGGEEVRTDLT
LAAFGNTRSYGGGMLICPDADHTDGLLDVTMVHSASRTRLIRLFPTVFKG
THVNLDDVTTARARVVEVDCPGINAYADGDYACPLPVTVSAVPGALRILV
PAP
108800339YP_640536.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MVSIRKDSPRSVEERILDAAAECVVAYGVNRVTLAEIARRARVSRPTIYR
RWRDTDAVLAALLTARIAGVLDAVPGSAVGREPLVDRIVRVGDRLRNDEI
VIAVLHSAPELAMVYITERLGTSQQILIDALAGEIKLAQDEGSVRSGEPR
QLAAMCLLITQSTIQSAQMVAPLLDEEALSVELARSLNGYLRP
108800337YP_640534.1 amino acid permease-associated protein [Mycobacterium sp. MCS]MSAAPTLKKALNQRQLRMIAIGGVIGAGLFVGSGVVIADTGPGSFLTYAM
SGVLIIMVMRMLAEMAVANPSTGSFADYSRNALGNWAGFSVGWLYWYFWV
IVVGFEAIAGAKIIQYWIDVPLWASSLVFMVLMTATNLFSVKSYGEFEFW
FAGIKVAAIVAFIALGALFVVGLWPGKDADFSNLTAHGGFMPMGFGVITV
GIVTVIFSMVGAEIATIAAAESADPERAVSKAANSVIVRILLFYVGSALL
LVTILPWNDEGIAASPFVAAFTEMGIPYADHVMNAVVLTAVLSCLNSGMY
TASRMLFVLAARREAPPSLVRVTRRGVPAQAILASSVVGFLCVIAAAVSP
DTIFAFLLNSSGAIILFVYLLIAVSQIILRRRTPDSELRVKMWLFPVLSV
LTAVGIVAILVQMFIDDALRSQLVLSLLSWGVVLLLYFANKHFLKRRPTK
AGVTGTGKPHRVLVLANQTVNSTELLDELHRIGADQETHYFVVVPVSPIE
TGTAETHGPLDVEEATQKAASERLDLTLNALRGHDFTADGELGDRRPLRA
LADAVESFDPDQIVISTLPPEKSVWQRFDVVDRARAQHRVPVTHVVATGA
EATATP
108800335YP_640532.1 hypothetical protein Mmcs_3369 [Mycobacterium sp. MCS]MITSGITMRRKLAGVLSTGALLGVAAATIAIPSASAQPQCTAAGLSSALS
SVSGQTAAYLNSHPGANDAITNAGSGGEAVIRNYFVANPQEWADLQRIAQ
PLRTLRQQCQVDVAPAEIARLYDAMAA
108800333YP_640530.1 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium sp. MCS]MARLTRLSTGNGFPNVVVTGVAMTTALATDAETTWQRLLDGQSGIRTLED
PFVEEYDLPVRIGGHLLEDFDSELTRVELRRLSYLQKMSTVLGRRVWANA
GSPEVDPRRLMVSIGTGMGSTEELVFSYDGMRAKGLKAVSPLAVQMYMPN
AAAAAVGLERKARAGVITPVSACASGSEGIAQAWRNIVLGEADIAICGGV
ETRIEAVPIAGFAQMRIVLSTTNDDPAGACRPFDKDRNGFVFGEGGALLV
IETEEHAKARGANILARIMGASVTSDGYHIVAPDPNGEQAGWAMTRAIQL
AGLQPTDIDHVNAHATGTSVGDVAEGKAINNAMGGHKPAVYAPKGALGHS
VGAVGAVESILTVLALKNGVIPPTLNLKNLDPEIDLDVVAGSPRPGNYQY
AINNSFGFGGHNVALAFGKY
108800331YP_640528.1 acyl carrier protein [Mycobacterium sp. MCS]MPATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQ
TEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALRDKFSQ
108800329YP_640526.1 hypothetical protein Mmcs_3363 [Mycobacterium sp. MCS]MPDNRYVPPASTVEVLQTVPDSVLRRLKQYSGRLATEAVASMQDRLPFFA
GLEASQRASVHLVVQTAVVNFVEWMRNPQSNVSYTAQAFEVVPQDLTRRI
ALRQTVEMVRTTMEFFEEAVPLLARSDEQVTALTAGILRYSRDLAFAAAS
AYADAAEARGAWDTRMEANVVDAVVRGDVGPELQSQAATLNWDATAPATV
IVGLPHPDRIDLAADDVRDIVTRNDRAALSDVHGTWLVAIVSGPISPTDR
FLKEILVAFADGPVVVGPTAPTLSAAHLSATEAIAGMNAVAGWSGAPRPV
SARELLPERALLGDATAIAALETEVMRPLGDAGPALTETLDAYLDAGGAI
EACARQLFVHPNTVRYRLKRIADFTGRDPTLPRDAYVLRVASTVGRLNRQ
AAQSSRASGPSPQVPAARPASATLYRSG
108800327YP_640524.1 hypothetical protein Mmcs_3361 [Mycobacterium sp. MCS]MVARILGSLAAAAMVIVGCTSVTSGSGQVDREAAPVYRASVSASVEESIA
QSSARESRRQQSLTTAAIHTACEDLSSSSVNAIGAVNAYVDAVNENTPEV
GVRAGPAVEALNISADLVATGISDVLTPELRDALGAWVGAARDVAGTITR
DAGPDEFNDAVTRLNDSREVALELCDASY
108800325YP_640522.1 redoxin [Mycobacterium sp. MCS]MAALDVGTEAPDFTLKDQNGQPVTLGDFRGAKNVLLVFFPLAFTGICQGE
LDEIRDNLPTYENDDTATLAISVGPPPTHKIWATQSGFTFPVLSDFWPHG
AVAQAYGVFNADAGIANRGTFVVDRSGIIRFSEMKSPGEARDQAVWTDAL
AALRSS
108800323YP_640520.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MAIGGLTHVAVTVRDLEVSTPWYRALIGTEPVLDEHTDAGFHHVVWAFGD
GTLFGIHQHDSPAGQVRFSEFAPGLDHVAFGCADRTELEQWVRRLDELGV
SHGGIVDAGYGSGLSFRDPDGVALEFFAPPPR
108800321YP_640518.1 chitinase [Mycobacterium sp. MCS]MRQNPLLGPGDVVTLGEECNRQIGRFDMRYLRTAACLAVAAVVGCGAQSM
PVPPHADADPASAFVVSREEFDRAFPGRIGFYSYDDLVDALPSFPAFATT
GDETTRRREVAAFFGNISHETGGLEIIEESPQRRRVYCDADLPFGCPAGE
DAYFGRGPGQLSWNYNYRAAGDALGVDLLTEPELVAQDAPLAWRTALWFW
TTQKAAAAATPHDAMVRGLGFGETIRAFNGVLECGGGNPAQVQSRVDAYL
RISALLGVPPGEDLYC
108800319YP_640516.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MRAVVTGAAGFIGSALVDRLLDDGHQVVGIDNLSTGSLANLGSALRHSAT
AARRFTLVRRDIQAPELTDIIAGTNPAVIFHLAAHVNCEASWADPHFDAR
SNVLGTINLCEASRRAGVEKIVYATEGASCSSSPSSVAKAAGEMYLRAYA
ERYGLAPICLAMAGVYGPRQHPGGDAGLVTRLASALITGAPSETCRDDFV
HRDFLFVDDAVEALVHAGCTPVAAGTYHVGSGRPTTVLRMHQMICAAVGT
TRPCLVVSMDEWKAAAAGATSTAGEWDWTPAVTLAEGVARTVEWLRATLD
SDCDRQEAG
108800317YP_640514.1 hypothetical protein Mmcs_3351 [Mycobacterium sp. MCS]MLHRAPSRAQRANKRVIGASVVSVGLVLSAALYPLPGDSRLLDLFPPEGG
ASDSLSPGSSLVQLQLTDRDMLDAIAASALPEAIRELLNGGDTMLPGFDD
LSVSTLNTLVETYGLPNLVLALNTLARIVPLVAGGGHGSSGPPIELGQGV
LPTLVILLDFLQQELPALFVPGSPALVVMVMPAVLRSLGFLATPAPPPPG
PTVSTFAGPPVADPGPNLEPAPSHDPVPPPEPTPVSAPTYEPQVAVQDQV
FTPTPEPLPEVPAVVTVLSTPDPAPELPLETREPLEPGGIDGDPVEEPSD
PDPPATAEPDDTATAEPDPPQQTQQNEPDENKPDDNPPGGTDENGA
108800315YP_640512.1 cobalamin biosynthesis protein [Mycobacterium sp. MCS]MVSPIMRARAAGIAAGLVADALLGDPRRGHPVAGFGRAAAQLERISYADS
RRAGALHTGALLSALAVAGATAQRAARRSPWATTALTAAATFVAAGGTSL
CRVGDRLSEVLDTGDIEAGRDLLPSLCGRDPSVLDAGGLTRAAVESIAEN
TSDAQVAPLVWAAVAGVPGLLVYRGANTLDAMIGNRSPRYARFGWAAARL
DDALNYLPARLTGLLAALCAPVVGGSPVAAMHAWRRDAHRHPSPNAGVAE
ATFAGALGVRLGGPTQYAHELEIRPTLGDGRAPVPADLRRAVRLSRVVQG
AAAVLAVAVSAAGRSGRPACPRGSRARWSPRQPCRGGADGPRRR
108800313YP_640510.1 protein tyrosine phosphatase [Mycobacterium sp. MCS]MSETPLHITFVCSGNICRSPMAEKMFAHQIAERGLSGAVRVSSAGTGGWH
AGDPADRRAIHVLRAHGYPSGHEAAQVDDDHLAADLVVALGRNHVRMLTE
LGVPPGRLRMLRSFDPRSAAHPLDVEDPYYGTQDDFEDVFRVIEAALPGL
HDWVDEQLTIRGIAS
108800311YP_640508.1 hypothetical protein Mmcs_3345 [Mycobacterium sp. MCS]MPRPAPQAIRYHGDQAVLPGMLDFAVNVRAAAPPSWLAERLADRLADLGR
YPSPADERRAVAAVAARHGRAEDEVALLAGGAEGFALLARLQPRLAALVA
PSFTEPDAVFAAAGVPLAHVVLDPPFALTGARVPDAADLVVVGNPTNPTG
VLHPRADILALRRPGRIVVVDEAFADAVPGEPESLADDAPPDVLVLRSLT
KTWALAGLRVGYALGAPDVLRRLTAQRAHWALGTLQLEALAACNAPSALR
EAKAGAERLAALRAEMVTGLRRIGAECVAGSAPFVLFAVPDAELVRKRLE
VRGIAVRRCDTFVGLDGQFLRAAVREEWPVLAEALAEAMR
108800309YP_640506.1 hypothetical protein Mmcs_3343 [Mycobacterium sp. MCS]MKADVWQQHSLLQLAEVDAGLARIEHRVRKLPEQDELDRVRAEHGAATDK
VAVLGIAMDDLDEQVAKFESEIDAVRQREDRDRALLEGDSVGAKQVAELQ
HELETLERRQASLEDSLLELMERREELAAQRAAELARVDELQITLSAAQR
AVADAVAELDGSRQENLSRREELLGSLQSDLVDLYERQRARGGAGAGQLQ
GRRCGACRLEIDRGEMARISAAPDDEVLRCPECNAILVRAEGFKK
108800307YP_640504.1 XRE family transcriptional regulator [Mycobacterium sp. MCS]MQANEASEDSVDQRVRKRLRELRRQRGFTLEEVAARSAIDVSTLSRLESG
KRRLALDHLPRLAAALAVTTDELLRSPEAEDPRVRSDSHTRHGVTYWPLT
RQGSPSGLHAFKLRVSARRRKPPEDLPVHEGQDWMYVLSGRLRLILGDRD
FIVEPGEAVEFSTWTPHWFGVVDGPVEAIGIFGPHGERLHLHT
108800305YP_640502.1 type 12 methyltransferase [Mycobacterium sp. MCS]MSETVEFWEEHYGAKDRVWSGRVNVRLAEIVEPLPPGRALDLGCGEGADA
IWLAGHGWQVVGVDVSHTALQRAAEDAAAAGVAERVRFEQHDLAETFPEG
RFDLVSAQFFHSPLDVDRTGALRRAADAVTVGGLLLIVDHGATPEWTWKD
GHPHDLPSLQDALASLAVDPEAWEELRVEAVERDGVSPDGQPVTWLDNVI
LLRRR
108800303YP_640500.1 DNA-binding protein [Mycobacterium sp. MCS]MSSAALRGPTVMPQLLRVQNFNVSSDGFGAGENQSLERPFGHVDPGDMFA
WAGATASWPNRTDPGGSRGLDDYFTRDFTNNIGAEIMGRNKFSPHRGPWR
DHEWQGWWGDEPPFHTPVFVMTHHPRPSFTLSDTTFHFVDDAPAAVLEQA
REAAQGRDVRLGGGATVIRQFLDAGLVDTLHVAVSDVRIGRGSRLWESPE
ELEDRYSTRRCRAPAG
108800301YP_640498.1 AraC family transcriptional regulator [Mycobacterium sp. MCS]MPQVPPARYLQRARDLVDARYAEPITVDDLAAAAGLSRAHFSRMFTRTFG
ESPREYLQTRRLERAAALLRYTDRSVADICAMVGLQSVGSFTTSFARVYG
LPPAAYRASLPPAATYARVPTCILKRDTRPPADSRVKTAHGEKTKAPVRS
108800299YP_640496.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MSEYEAITFEQSGPVARIVLNRPEAANGMNDTMTAELADAAARCDTSATK
AVVLTGSGRFFCAGGDLKAFATAPSRGRFIKGVADDLHRAVSTFARMDAV
LVTAVNGAAAGAGFSIAVAGDLVLAAESASFTMAYTKVGLSPDGSASYHL
PRLIGMRRAQELMLTNRTLSAGEALDWGLVTDVVPDAELGDRATALADQL
AGGSAPSHGAVKTLLLASLKNGLEEQMELEGRTIARRADSADGREGVDAF
LAKRRADFA
108800297YP_640494.1 diacylglycerol O-acyltransferase [Mycobacterium sp. MCS]MLSGFAHTVVPDPYAGRMQRLSGLDASFLYLETAQQLLHVCSILELDTTT
MPGGYTFAKLRDALSRRIESMPQFREKLADSRFNPDHPVWVEDKDFDVDR
HLHRIGLPAPGGREELAEILGHIASLPLDRSRPLWEKWIIEGIDGTDARD
GGPLVVLTKVHHAAVDGVTGASLMSQLCSTEPDAPDPEPVAGVGGGNQLE
IAVNGAIKFATRPLKLANALPATVNTVLDTVKRARSGLSMAPPFVAPQTA
WNANVTSHRNIAFAQLELDDVKAVKNHFGVKLNDVVMALVSGVLRKFLQD
RGELPTSTLIAAVPVSVHDKSDRPGRNQVSAMFSRLETQIEDPVERLKAI
SEANSVAKQHNSAIGATLLQDWTTFAAPAVFGMAMRVYAASRLSGARPVL
NLVVSNVPGPQMPLYYLGNEVKAMYPIGPVFHGSGLNITVMSLNGKLDVG
IVSCPELLPDLWDMADDFGHALEELLDATR
108800295YP_640492.1 tripeptidyl-peptidase B [Mycobacterium sp. MCS]MPLSGDHSPVTVCLRGAYERVGRATMIAMWRVGRGSVLAALALVVAGAVA
PPASATPEGDATQRYGQPPVWGTCQQWGDASRIPTAQCGTVPVPVNYDQP
DGAQAQLAVIRVPATGDRIGALMVNPGGPGASAVDTVRGMGAALAETEIG
RRFDLVGFDPRGVGHSTPQLRCRTDAEFDAYRREPMVDYSPAGVAQIEGI
HQRFAQQCVDRMGVEFLANVGTAAAARDMDVVRAALGENQLNYLGFSYGT
ELGAAYAERYPDRVRAMVLDGAVDPSLGPIDESVAQQAGFQRAFDAYAAD
CAKSAGCPLGTDPAQFVARYHQLVDPLVARPAATSDPRGLSYQDAITGTG
NALYTPRLWAYLTSGLLGLQRGTDPGDLLTLADEYQRRDASGHYANRQDA
FTAIRCVDAPYPTDPAAWVQADRRFREAAPFLSYGPFTGYAPRDVCGLWP
VPATSAPRPATSPGPGKVVVVSTTGDPATPYEAGVALARQMGASLITFEG
KQHTVVFNGDACVDTAVVRFLVDGVVPPNGLRC
108800293YP_640490.1 bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferMARPSTERSKLPSTGRLGLVEKQAPAHLDRLGWNTDRHVELLWSLSRAPD
ADSALHTMVRLADALGDDWDALNAALLTDKPLRGRLFAVLGSSLALGDHL
VAHPEKWGLLAGKVALPTAEALREEFTALARSATDTASAMLPLRNLYRDR
LLVLAALDVAPTVENEPVLPFPTVGEHLSDLADAALASALEVAMSSVCGD
GDRPRLAIIAMGKCGARELNYVSDVDVIFVVGEAAESDIRTTTRVAGEMM
RFAADAFFEVDAALRPEGKHGQLVRTLESHIAYYQRWAKTWEFQALMKAR
PAAGDAELGREYIDALSPMVWTACEREDFVPEVQAMRRRVEELVPAGVRA
RELKLGTGGLRDVEFAVQLLQLVHGRNDQSLHVASTVDALAALGAGGYVG
RDDAANLTASYEFLRLLEHRLQLQRLKRTHMLPEADDDEALRWLARAAHV
RPDGQRDALGVLREELKRQSLRVSRLHAKLFYQPLLESVGQPALGIEPGM
GAAAAERQLAALGYEGPQSALTHLAALTGEGGRRGRVQRVLLPTLLDWLS
DTPDPDAGLLSYRRISEALAEQRWYLGTLRDEGAVAKRLMRVLGTSAYVP
DLLMRAPEVIQLYADGPNGPKLLDTEPEAMARGLVASAGRHADPVRAIAA
ARTLRRRELARIASADLLGMLEVTEVCRALTALWVAVLQAALDAVMRANE
PDGGPPARIAVIGMGRLGGGELGYGSDADVMFVCEPCSGAEESTAVRWAT
GIAERVRSLLGTPSSDPPLEVDTGLRPEGRNGPLVRTLASYEAYYTQWAQ
PWEVQALLRAHRVAGDLELGERFLLMIDKTRYPAGGVSTQAVQEIRRIKA
RVDAERLPRGADPNTHTKLGRGGLADIEWTVQLMQLRFAHKVPALHCTST
LEALNAIGAAELIAEGDIDLLRQAWLTATRARNALVLVRGKPTDQLPGPG
RMLNAVAVAAGWDNDDGGEFLDNYLRVTRRAKTVVRKVFGG
108800291YP_640488.1 anti-sigma-factor antagonist [Mycobacterium sp. MCS]MNLTSSLDAADRSATVRIAGELDAETTSEFVDTASRLLETNPGLRALRLD
CADMTFCDSAGLSGLLLIERRTTAAGVDLHLDNRPTYFERVLDITGILEY
IAGRRATSAPAPTEEPDGDRGETELG
108800289YP_640486.1 serine phosphatase [Mycobacterium sp. MCS]MGADGPIGVAMGLDAAWSSIPHPVIVVTSDGVVRAVSTSTHSVLPSAIPG
SDLDDVAPPWLAQAHRRLVQRLGTPDADDAAASGSLHGKRFEARPTVLDG
QIAWWLVEDAGRELWDTKQALTREQARTSFLGEASAVLMATLNVDRCMSA
TVHLAVRHLADAASVVAPVTGNRLPVVCGDRGAVEQRTVEADPSDVPGLS
EALRGFPPVPSRWLDPAALPEWLVPSTFDGPVGSVLITPLPGLGVPAGAL
VLLRRASEPVFGEDDELSARLFAARAGAALSTAGLYAEQSAITRTLMRDL
VPPQLRRLHGFELAGGYRASEDHQIVGGDFYDVHPGATPEDDTLVVLGDV
CGKGLEAAVLTGKIRNTLQALAPLAQDHGGVLRLLNSALLSADHTRFATL
VLASVARRDGQVVLRLTSAGHCAPLIVRSDGRVEEADTRGQLVGVLEQIQ
ARTFETVLAPGETCVLYTDGVTEAWGGPLGTDMFGEQRLAAALEECAGMP
AEAVVERIMMLTTQWVRRREHDDIAVVAITAPRRTHLSAVDGHTAGRYTA
108800287YP_640484.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium sp. MCS]MPPGLFAWMEPMRVLVQRVSSARVVVDGEVVGAIAPAHQGLLALVGVTHT
DDADIARKLAEKLWQLRILDGERSAADETAPILVVSQFTLYANTVKGRRP
SWNAAAPRPVAEPLVVAFCEALRGLGAPVQTGVFGAHMNVELVNDGPVTV
LLEL
108800285YP_640482.1 RDD domain-containing protein [Mycobacterium sp. MCS]MARALGSWLSGPESNRGPGGPGQPPNEYPGQRLGLPDSGPGSMARFGRRV
AAMLVDWFIAYGLAALAMTLGLISVGAMSTVILVIWFVIGAVSVRLFRFT
PGQYALGLMVVSMDDREHVGFGRALVRGLMIALVIPALFTDEDLRGLHDL
ATKTAVVRR
108800283YP_640480.1 hypothetical protein Mmcs_3317 [Mycobacterium sp. MCS]MAKTRNTAATKAAKAEAKAARKAASKQRRSQLWQAFQIQRKEDKRLLPYM
IGAFVLIVGAAVAVGVLAGGFTMYTLIPLGIVLGALVAFIIFGRRAQKSV
YRKAEGQTGAAAWALDNLRGKWRVTPGVAATGHFDAVHRVIGRPGVIFVG
EGNPGRVKPLLAQEKKRTARLIGDTPIYDVIVGNGEGEVPLSKLERHLNK
LPANITVKQMDSLESRLAALGTKLGPAAMPKGPMPAQAKMRGVQRTVRRR
108800281YP_640478.1 lipoate-protein ligase B [Mycobacterium sp. MCS]MSMAISIRSSTRPVEVRRLGTVEYLDAWELQRGLVDARVAGGSDALLLLQ
HPSVYTAGKRTEPHERPADGTPVVDTDRGGKITWHGPGQLVGYPIVGLAE
PLDVVNFVRRIEEALIAVCTGLGLDAGRVEGRSGVWLPGDGLRPERKIGA
IGIRVSRGTTLHGFALNCDCDLSAFSAIVPCGIADAGVTSLTAELGRRVT
VDEVTDAVAARVCDALDGRLAVSGVSVDTYASGVASTQ
108800278YP_640475.1 hypothetical protein Mmcs_3312 [Mycobacterium sp. MCS]MGLFDKWRGRRAARADGRDPAADLKYLRQWVAEHRGVEAYVEPKTTVTDV
TVVLVAADGEWTRRRAGGDAGARRLSERLKIPVYDVQKVGYPQRMRDYDA
RRRIERKRAARRELEG
108800276YP_640473.1 leucyl aminopeptidase [Mycobacterium sp. MCS]MSSDPGYQAPVVTVSSSIPRRGVGDSVLIVPVVTRDDAAAVLAAAPFLDK
DAVREIEAALKSLGATGGEGQTHRLVVSALPVASVLTIGLGKERDEWPAD
TVRRVAGNAARSLDKVAAVLTTLSALDLEAAIEGLILGSYRFTEFRSAKT
APKDGGLRAITALSQESKSRARDAAQRATDIATAVATARDFVNTPPSHLY
PDEFAKRAKALGEAAGLEVEILDDKALVKAGYGGIVGVGKGSSRPPRLVR
LSHKGAVRTRTRGARPGGSKRVALVGKGITFDTGGISIKPAANMHHMTSD
MGGAAAVIATVVLAAKQKLPIDVIATVPMAENMPSATAQRPGDVLTQYGG
TTVEVLNTDAEGRLILADAIVRACEDNPDYLIETSTLTGAQTVALGSRTP
GVMGSDAFRDRVATLSQQVGENAWAMPLPEELKDDLKSTVADLANVSGSR
FAGMLVAGTYLREFVADGVEWAHIDVAAPAYNSGGPWGYTPKGGTGVPTR
TMFAVLEEIAREG
108800274YP_640471.1 branched-chain amino acid aminotransferase [Mycobacterium sp. MCS]MTDGPLEFTVHRNAEPATDEVRAEILANPGFGRFHTDHMVSIDYTADAGW
HNAQVLPYGPIELDPSAVVLHYAQEIFEGLKAYRWADGSVVSFRPESNAA
RLRSSARRLAIPELPEELFLESLRQLIAIDEQWVPPAGGEESLYLRPFVI
ATEPGLGVRPANEYRYLVIGSPAGAYFPRGIKPVSVWLSHEYVRASPGGT
GAAKFGGNYAASLLAQAQATEHGCDQVVWLDAIERRYVEEMGGMNLFFVF
GSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKK
AAAGEISEVFACGTAAVITPVSHVKHHDGEFTIADGEPGEVTMALRDTLT
GIQRGKFADTHGWMVKLN
108800272YP_640469.1 cobalamin synthase [Mycobacterium sp. MCS]MIGSLAGAFAFGTVLPVPAGSTATLGRGVMTALPGVGIVLGAVAAAVLWA
GSWAFGPHSALAGLLAVAVLLLATRGMHIDGLSDTVDGLGCYGAPERALR
VMRDGSAGAFGAASIVVAVGAQTLAFSMLPGGWSGAVGVVVAVTAGRVAA
LVACRRGIPAAEGSALGGRVAGTQPAAVVLVWLAAVAALAIPATERIWQG
PLTVVVAVGMTALLVRHCVRRFGGITGDVLGAAIEVTTTVVAVGLVIR
108800270YP_640467.1 adenosylcobinamide kinase [Mycobacterium sp. MCS]MRTLVLGGIRSGKSRWAEAVIAAAAQPDPVRYVATGASPGADDEWARRVA
AHRRRRPSGWRTTETTDVPGALRDDPATATLVDDIGGWLTAEMDRCDAWH
GGSVAAGADALVAAVAEFTASLVLVSPEVGLTVVPATAAGRRFADELGAL
NQRLAATCERVVLIVAGQPITVKEPS
108800268YP_640465.1 HesB/YadR/YfhF [Mycobacterium sp. MCS]MTVQDESATATATHGVLLTEAAAAKAKALLDQEGRDDLALRIAVQPGGCA
GLRYNLFFDDRALDGDLTAEFGGVNLTVDRMSAPYVQGATIDFVDTIEKQ
GFTIDNPNATGSCACGDSFN
108800266YP_640463.1 adenosine kinase [Mycobacterium sp. MCS]MTIAVTGSIATDHLMRFPGRFADQLLAEHLQKVSLSFLVDDLVVHRGGVA
GNMAYAMGILGGQPTLVGAVGKDFDDYRGWLTAHGVDCDNVLVSETAYTA
RFVCTTDEDMAQLASFYPGAMSESRNIKLADVVARTGTPDLVIIGANDPD
AMFLLTEECRTLGLPFAADPSQQLARLSGEEIRKLIDGATYLFTNDYEWD
LLLQKSGWSEAEVMRQIQLRVTTLGEKGVDLVGRDGTFVHVDVVPETHKE
DPTGIGDAFRAGFLTGRSAGLSLERAAQLASMVATLVLEAPGPQEWRWDK
DAGITRLADAYGEDAAKEIASALA
108800264YP_640461.1 cytochrome c oxidase subunit II [Mycobacterium sp. MCS]MTPRGLKAVARKAALVVVLGATALVLSGCSWTEALALGWPKGITPEAHLN
RELWIGSMIAALVVGGIVYFLIFWVSAFHRKKASDTELPRQFGYNMPLEL
VLTVIPFLIISVLFYFTVVVQEQMVGKEDNPEVVVDVTAFQWNWKFGYNK
VNFADGTMNYDGVDEERSAAVASRPSEEGAGAVGEPEAAHTEHGAIAGQN
PEDRSYLAFDEIETLGTSDEIPVLVLPSEKRVEFRIASADVAHAFWVPEF
LFKRDVYPNPEQNNSDNVFQVSEITETGAFVGRCAELCGTYHAMMNFEVR
VVPPNDFKAYLNQRMAGKTNAEALIAINQPPTAVTTKPFDTRRGEMAPQA
SR
108800262YP_640459.1 hypothetical protein Mmcs_3296 [Mycobacterium sp. MCS]MSGPNPPGPDSPGPDQPEREGGRHSAPDEATEQVGAAEQPAAATGATEAY
SQAYSAPESEQFSSGPYVPADPALYDYDSYEPVSDVGEEQAPPRWPWVVG
VTAIIAAISLVVSVALLVTKTDTDQLATPATTTTTPPPPVQDEITTTTPP
PPPPPPPTTEPPPPPPPETVTVTEPPPPPPSAEAPPPPPPETTTPPPPPP
PTTTTPAGPRQVTYSVTGTKAPGDIITVTYVDASGRRRTQRNVYIPWSLT
VTPISQSEVGSVQASSLFLVSKLNCSITTSDGTVLSSNTGNAAQTSC
108800260YP_640457.1 cytochrome b/b6-like protein [Mycobacterium sp. MCS]MSAQSGSKMAARLAAQGNAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIA
LYSFIILLITGVWLTLFFDPSMSEVVYDGVYQPLRGVEMSKAYESALDIS
FEVRGGLFVRQIHHWAALLFAASIMVHLARIFFTGAFRRPREANWVIGSL
LLILAMFEGFFGYSLPDDLLSGTGLRAALSGITMGIPVVGTWMHWALFGG
DFPGTIIIPRLYALHILLIPGIMLALIAAHLALVWFQKHTQFPGPGRTEK
NVVGVRVMPVFAVKSGAFFALTVGILGLMGGLLQINPIWVLGPYKPSQVS
AGSQPDFYMMWTDGLIRLWPAWEFYIGNYTIPQPVWIAVLMGLILGLLTV
YPFLEKRLTGDDAHHNLLQRPRDAPVRTAIGAMAIAFYILLTFACMNDII
ALKFHISLNATTWIGRIGMVVLPVIVYYVTYRWAVSLQRSDREVLEHGIE
TGIIKRLPHGAYIELHQPLGPVDAHGHPIPLEYQGAPLPKRMNKLGSGGA
PGSGSFLTADPIVEHEALTEAAHASHRRALTALRERQGTNGSNGAANGDG
DGSPNGHH
108800258YP_640455.1 cytochrome c- class I [Mycobacterium sp. MCS]MRRGSMISKSRRRFRRRLSAAVLLLVGLGVAGGVAATLTPAPQVAVADES
QSALLRTGKELYDMSCVSCHGSNLQGVQDRGPSLIGVGEAAVYFQVSTGR
MPARRNEAQAPNKPADFDEAQTDALGAYVQANGGGPVVPRDENGEIANQS
LIGDNVARGGDLFRLNCASCHNFTGRGGALSSGKYAPELQASPAQVYTAM
QTGPQNMPKFSDRQLSPEEKRDIVAYVEESRKTPPPGGYGLGGFGPTSEG
MAAWIIGMVAVIGAALWIGARA
108800256YP_640453.1 anthranilate phosphoribosyltransferase [Mycobacterium sp. MCS]MAWEHLRVTDTPTWPSILGRLTTGQNLGTGQAAWAMDQIMTGTATPAQIA
GFAVAMKLKRPTSAEVTELADVMLKHARRIPTDIIGNETVDIVGTGGDGA
NTVNLSTMAAIVVAAAGVPVMKHGNRAASSLSGGADTLEALGVRIDLGPE
QVAASVAEVGIGFAFANQFHPSYKHASAVRRELGVPTVFNLLGPLTNPAR
PRAGLIGCAWAELAEVMAGVFASRNSSVLVVHGDDGLDELTTTTTSTIWR
VQAGTVERLTFDPAAFGFQRAHLSELVGGDAEYNAAEVRAVLGGAKGAVR
DAVVLNAAGALVAHAGLSSDAKWVPAWEAGLARATETIDSGAAEKLLARW
VRFTQKL
108800254YP_640451.1 hypothetical protein Mmcs_3288 [Mycobacterium sp. MCS]MAQGHQPRGHQPRGADPHADTDPDTVIIDCDDCAVRGPGCQDCVVSVLLG
VPDTLLVDERRALEVLAEAGMAPRLRLVPIHRQNNSGVA
108800252YP_640449.1 hypothetical protein Mmcs_3286 [Mycobacterium sp. MCS]MATGPGSTRPRRVLLALLLAEFVSAVLMLDRSQPPAAPPMAAEVAVEQPT
ATGTPTIDTQLPDGRRAQFVALGGTRSAGLLSRIAGELPAAAELVTDFWG
PDWRQEIVIVATGSDPQFAALAGGGVDIAAATTADRIVFAPGAAAMTDED
LRIVLRHELFHHAVREQTAADAPRWLTEGVADHLARPRTTPAPDAETALP
TDSDLDTPGAVRSQAYDRAWRFATYVADRYGPERLRALYLRACGPGHPDV
ATAVRDTLGAGLDEVLAGWRHWPQG
108800250YP_640447.1 purine catabolism PurC-like protein [Mycobacterium sp. MCS]MTLTVADLVEMPHLGLGVLSGAAGLDRAVSWTHTSDLPEPWRWITGGELL
MTNGLSFPKSAADQETLLTRLDESGVAGLAIGDKMYCPRLTQRFTRCSDR
LGFPVLQIRYPLPFVAISRAVAEATLLDQSSRLSRTVRIYDLLRRHIGSA
SSSADLVAALARELGCELHVCDRRTGDPWFPQTPPLDPVLRQAVVGLSDS
STNVAAGVYGLPGDGARQAMLTDIARHPDVALVVIPRAADRVDPIRLQHI
ATVISLELSEVQSVLEHDRRERAALLERLLENRVDRHAVESRLGELHLDP
ARTVLVAARNSDEARALTVHNSLWRNDIPYLCTLREGLLYALVPDRSGFE
AVLSRALGPSARIGVSARLDSISRFPEAVREASWACSLAGRRGIPISRYG
SEEPWLGLSNVGDAQALVDRVLTPLRTYDEQHHSNLVATLEAYLRHQRSL
QLTATALCVHRQTVLYRMKRVADLTGLNLAETDAVAALWLALRAAALLDA
ED
108800248YP_640445.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MPEFSVPAPFTVGERDTVVSAVFDHERDDPDHVIFRRLVDGDWTDVTCGQ
AAAQIRSVALGLIASGVQPGDRVALLSATRYEWPIIDFAILAVGALTVPI
YETSSAEQVRWVLSDSGAVLAIVENDAHADRVEQLRADLPELRTVLRIEG
SGTGAIDALAEAGRDVAPAELDDRLAGIRSAEPATMIYTSGTTGRPKGCQ
LTHANLVFEIRGAKSCFRTQLTKGERMLVFLPLAHVLARAITIAAFANKV
TLGFTSDIKNLVPTFGVFKPTLVVSVPRVFEKVYNTAEQNARNDGKGRIF
DIAAATAIEYSQAEGGPGLLLRAKHAVFDRLVYGKLRAALGGECRAAISG
GAPLGARLGHFYRGVGLTIYEGYGLTETSAAITVNRVDDIKIGSVGKLLP
GNSMRLGDDDELLVSGGVVFGGYWRNEEETAKAFTDGWFHTGDLGAIDDD
GFLTIIGRKKEIIVTAGGKNVAPAVMEDQLRAHPLISQAMAVGDARPFVG
ALITIDPEAFEGWKQRNGKDSGASVGDLATDPDLLSEIDTAVKEANQAVS
KAEAIRKFRILPVDFTEDTGELTPTLKVKRAVVAEKFADHIEALYTG
108800246YP_640443.1 cyclase/dehydrase [Mycobacterium sp. MCS]MADKTAQTIYIEADPATVMDVIADIGSYPEWVKEYRETEVLDTDADGYPK
TARLVLDAAVLKDTMVLAYQWPADRTSVTWTLVSSSLLKSLEGAYRLAPK
GSGTDVTYELAVDLMIPMIGLLKRKAERRLTETALKDLKKRAEAE
108800244YP_640441.1 hypothetical protein Mmcs_3278 [Mycobacterium sp. MCS]MSADHPDLGPELRALAQAILNRVDPAIRFAAARAAGSGADRPGSCQQVWC
PVCALAALVQGEQHPLLNVVAEHSVALLGVVRALVDDIDAAGPPPQPPQP
PQPSPPPPSGEPPPRPGPGRYQHIPVTVQE
108800242YP_640439.1 hypothetical protein Mmcs_3276 [Mycobacterium sp. MCS]MSTRRTPAWAPTLAWRTFCLLTLAALGWAGWRLLGETPYRIDIDVYRMGG
RAWLDGSPLYADGAMFATEGGLDLPFTYPPLAAIVFSPFAVMSLPAASAV
ITAITLLLLIVAVLIVLTRLDVWTPGRRIWLAAAIVAPAVVLLEPIRANF
DFGQINVVLMTLVIADCVPRRTPWPRGVLLGVAIALKLTPAVFLLYFLLR
RDTRALLVSAASVVVMTLLGFALAWRDSWEYWTETVRNTDRIGTATLNTN
QNIAGTLARFGVGEDLRFILWVVGCFAVLGLTVWAARRALRADEPVLALV
CVAMFGLVVSPVSWSHHWVWSLPTVLVTLVVAYRTRHAVLAVAGALGCAL
MVWSPITLLPEHQETSAPLWRQLAGGSYVWWALLVIAAAGTLSARSTHRT
EPVTAAQPAAASGSRAAG
108800240YP_640437.1 hypothetical protein Mmcs_3274 [Mycobacterium sp. MCS]MRYFYDTEFIDNGRTIELISIGVAAEDGREYYAVSTEFDPERAGSWVRKH
VLPKLPSPASKSWRSRREIRSELEDFFGIDGDEPIELWAWVGAYDHVVLC
QLWGPMTALPPAIPRFTRELRQFWEDRGSPRMPPRPRDSHDALVDARHNL
LRYQVMTGSAGMDGRSRP
108800238YP_640435.1 serine/threonine protein kinase [Mycobacterium sp. MCS]MCSVEAYPQSDPLAGAVLDGRYRVDAPIATGGMSTVYRGLDVRLDRPVAL
KVMDARYSGDQQFLTRFQREARAVARLKDPGLVAVYDQGLDGQYPFLVME
LVEGGTLRELLRERGPMPPHAAAAVLAPVLSGLAVAHRAGLVHRDVKPEN
VLISDDGEVKIADFGLVRAVAEAKITSTSVILGTAAYLSPEQVGTGNAGP
RSDVYSVGVMAFELLTGVTPFNGDSALAVAYQRMDNDVPPPSSVISGVPS
QFDELVLRATMRDPADRYADALDMGAELEEIIEELRLPPFRVPAPRHSAQ
HASAVLYHSQPPDQQATTDTTARPPASAPRQHTRVFTRDSGEIAYPAGQF
AGIDIDEFYWARQRAKRALLFWVVAVITLAGLLAAGAWTLGSNLVNLI
108800236YP_640433.1 hypothetical protein Mmcs_3270 [Mycobacterium sp. MCS]MVTPTPTETPKPGSAQHVSRLIAFASSPSGRPALLGFLGATLITAGGLGA
GSTRVHDPLLESLHLSWLRFGHGLVLSSVLLWGGVAIMLAAWLWLGRRVV
GDDPGRTADEYTMVATTGFWLAPLLLSVPVFSRDTYSYLAQGALLRDGFD
PYVVGPIANPNPLLDDVSPIWTTTTAPYGPAFIMVAKFVTMIVGEHVVEG
TMLLRLCMLPGLILLIWAAPRVARHIGASGAAALWICVLNPLVIIHLMGG
VHNEMLMVGLMMAGLALTLNNRPAVGVAVIVVAVAVKATAGLALPFTVWI
WMRQLRDRRGYGAPRAFATATAAGLAIFVAVFAVLSWVAGVGLGWLTALA
AGNVKIINWLTLPTAAANVINAVGGLFLPVNFYAVIDVTRIVGLAIIVVA
LPLLWWRFRHDDREALIGIASVMLVVVLFVPAALPWYYTWPLAVVSALAQ
SRRSIALIAGFSTWIMVIFKPDGAHGMYSWLHVLLAAGCAVVAWYSLAKV
RERAPTAGGQ
108800234YP_640431.1 protein LppM [Mycobacterium sp. MCS]MTSVLARRQRTRLVAWVLLLLMLPMVVGCVRVRASITVSPDDRVSGQIVA
AAKPRGPDDKGPQLLNNLPFATKVAVSDYNRDDYVGTQAVFSDLTFAELP
QLANMNRDAAGVDISLRRAGDLVILEGRVDLTSVSDPEADVSLSVAFPGE
VTSTNGDQVSTEVVEWKLNPGVVSTLNAQARYTDPSARSFTTAAIWLTVA
TLVVAAIIGGLAWSSRDRSPTLADPNPNDERGTR
108800232YP_640429.1 hypothetical protein Mmcs_3266 [Mycobacterium sp. MCS]MPLSDHEQRMLDQIESALYAEDPKFASSVRGGTLRAPSARRRLQGAALFV
VGLAMLVSGVAFKATMIGSFPILSVIGFIVMFGGVVFAITGPRVAGGRDR
SAPPVGGGARQKRPKGSGGGSFTSRMEDRFRRRFDE
108800230YP_640427.1 S-adenosyl-methyltransferase MraW [Mycobacterium sp. MCS]MEHIPVLLDRCVELLTPALTRRNPDGRGAVLVDATLGAGGHAHRFLSDLP
GLHLIGLDRDPQALQIAGERLAPFGDRVSLVRTRYDGIDDALAQTGVAEV
SGFLFDLGVSSMQLDRTERGFSYSADAPLDMRMDSDAPLTAADVVNTFAE
KDITRILREFGEERFAARIAKHIVRRRPLNTTGELVELLYDAIPAPARRT
GGHPAKRTFQALRIAVNSELDSLRAAVPAALAALETGGRIVVMAYQSLED
RIVKTEFAAATASRTPPGLPVELPGHEPEFVALTRGAERATPEEIERNPR
SAPVRLRALEKVAGRPTTARRDAR
108800228YP_640425.1 peptidoglycan glycosyltransferase [Mycobacterium sp. MCS]MSPRRDPRGGAPRRARGPKAASAQGRPAKARRTRKAVAGESGLRSSSFVF
RHRAGTAVMLVLLLVAAAQLFNLQVPRAEGLRAEAAGQLKVTDVQKAVRG
SIVDRNDDKLAFTIEARALTFQPVKVRKQLEEARAKSEEAPDPKRRLVEI
ADEVAARLNNKPDAKTVLRKLNSNETFVYLARAVDPVISDAITEKFPEVG
SERQDIRQYPGGSLAANIVGGIDWDGHGLLGLEDSLDAVLAGTDGSVTYD
RGSDGVVIPGSYRNRHDAVDGSTVQLTIDDDIQFYVQQQVQMAKDASGAK
NVSAVVLDAKTSEVLAMSNDNTFDPSQDIGKQDNRQIGNLPVSSPFEPGS
VNKIVTAAAAIEYGLTNPDEVLQVPGSINMGGVTVGDAWKHGTMPYTTTG
VFGKSSNVGTLMLADRIGPERYAEMLKKFGLGQRTGVGLPGESAGLVPPI
HQWSGSTFSNLPIGQGLSMTLLQMAGMYQAIANDGVRIPPRVLKATIAPD
GTRTEEERPEGVRVVSPQTAQTVRNMFRSVVQRDPMGEQQGTGPAAAVEG
YQIAGKTGTAQQINPACGCYYSDVYWITFAGMATVDDPRYVIGIMMDAPH
RAADGSPGSSAAPLFHNIASWLLQRQNVPLSPPGAPLTLQAT
108800226YP_640423.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacterMIELTLARVAEIVGGRLADITPEDAAATRITGTVEFDSRAVTAGGLFLAL
PGARSDGHDFAAAAVAAGAAAVLAARPVGVPAVVVPPAAGPEGSGVLEHD
TDGAGAAVLAALARLAAAVAAELVDGGLRIVGITGSSGKTSTKDLVAAVL
APLGEVIAPPGSFNNELGHPWTVLRADRSTDFLVLEMSARHPGNIAALAA
IAPPSIAVVLNVGTAHLGEFGSREAIAATKSELPQAVPESGVVILNADDS
AVAAMAEVTAARVVRVSREPGADIWADAVTLDELARPRFTLHAAGGEVPV
NLAVHGDHQVSNALCAAAVALECGATLDQVAAALAGAGPVSRHRMQVTTR
EDGVTVVNDAYNANPDSMRAGLKALAWMSRGGAAKRRSWAVLGEMAELGD
DSISEHDSIGRLAVRLDVSRLVVVGTGRSASAMHQGAVMEGSWGAEATRV
DDADAALALLSDELQPGDVVLVKASNSAGLGALADSLTAGRDGTATR
108800224YP_640421.1 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Mycobacterium spMARAVVEPLTPGVRVLITGAGLTGRSVSAVLEPTGVRLTICDDDPLALQR
LITPAAVVTTGEAVAGIADYALVVTSPGFPPTAPVLAAAAAAGVPIWGDV
ELAWRLDRAGWFGPPRRWLVVTGTNGKTTTTSMLYAILRAADRRAMLCGN
IGNPVLDVLGESPRTRGDEEPELLAVELSSFQLHWAPSLRPDAGVVLNVA
EDHLDWHGSMTAYARDKARALDGRVAVAGLDDPVAAELLTTAAAPVRVGF
RLGPPGAGELGVHDGWLVDNAFADGLRLARADDIRVAGPVGVLNALAAAA
LARAVDVPAEAVAAALASFEVGRHRAEVVAVSGGVTWVDDSKATNPHAAR
ASIAAYPRVVWIAGGLLKGVSVDALVAEVADRLAGVVLIGRDRAVVAEAL
SRHAPDVPVVELVTGEDSGVHGTTESAVNHVTRVIDTGGRPLPDAVMRAA
VDAARHLARPGDAVLLAPAGASFDQFSGYTQRGDAFAAAVRADLG
108800222YP_640419.1 undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltMNGTISVLLAGGGTAGHVEPAMAVADALAALEPGVRITALGTERGLETRL
VPERGYALELITPVPLPRKLSGDLARLPMRVRRAVRETREILDTVHADVV
IGFGGYVALPAYLAARRNRVPIVVHEANASAGLANKVGARFARRVLSAVA
DPGLGRVEVVGTPVRSSITELDRAALRAEARAHFGFADDARVLLVFGGSQ
GARSLNNVVSGAAKALAAAGISVLHAYGAKNTLELPDPAPGDPPYVAVPY
LSRMDLAYAAADLAICRSGAMTVAEVTAVGLPAVYVPLPIGNGEQRLNAR
PVVETGGGLVVDDADLSPQFVADTVVPLLTDTGRLQTMTAGAALSGHRDA
ARHVAHVALDVAREAAGGRKGVR
108800220YP_640417.1 cell division protein FtsQ [Mycobacterium sp. MCS]MTVPPENPEPPEEPTPPPAAPPAEDPTAPAPSADDEEDREGPRRRARRER
EQRRAVKDRAMAIEEARREAKRRATSGPVREATPIPRRAVRGLKVLVWSA
LLSVAAVGVGLLLYFTPIMSVRDIVVVGLEAIPQEEVLGAAAVVPGTPLL
QVDTDAVAERVATIRRVASARVQREYPSSLRITVVERVPVVVKDYPDGPH
LFDRDGVDFATAPPPPNLPYLETATPGPNDPATEAALQVMLALPPEVAGQ
VGRIAAPSVASITLTLVDGRVVVWGTTDRTDEKALKLAALLTQPGRTYDV
SSPDLPTVK
108800218YP_640415.1 hypothetical protein Mmcs_3252 [Mycobacterium sp. MCS]MRRVTTTRAGGVSAPPYDTFNLGDHVGDDPAAVAANRERLAKATGLDGRL
VWMHQVHSDRVVRVTGPHDGPVDDADGLVTTTRRLGLAVVTADCVPVLLA
DARAGVIGAVHAGRVGARDGVVARAVETMCEAGARVEDISVLLGPAVSGR
NYEVPEAMAADVEAALPGSRTTTARGTAGLDLRAGIARQLTDLGITAIDV
DPRCTVADRNLFSHRRNAPTGRLASLVWME
108800216YP_640413.1 hypothetical protein Mmcs_3250 [Mycobacterium sp. MCS]MSTLHKVKAYFGMAPMDDYDDEYYEDDDRAERGAARGYARRPREDRFEEE
GYIDRAGREYDDRPAPREYDEPPIYRGGYDEPRFDPRLRGPREFERPAPR
LGALRGSTRGALAMDPRRMAMLFEEGSPLAKITTLRPKDYSEARTIGEKF
RDGTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPAD
VDVTADERRRIAEAGFYAYQ
108800214YP_640411.1 hypothetical protein Mmcs_3248 [Mycobacterium sp. MCS]MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENTDLR
QRVAELDQELSSARSGGGVSQPQAAPVYEPEPEPTPPPQPVYEAPPAAPA
PTAQQSEDSALRAAKVLSLAQETADRLTSTAKAESDKLLADARAQADAMV
SDARQTAETTVTEARQRADAMLADAQTRSETQLRQAQEKADALQADAERK
HSEIMGTINQQRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA
APVDSSANNDGGGFNQFNRGNN
108800212YP_640409.1 phosphoribosyltransferase [Mycobacterium sp. MCS]MAMSGWERLGGRSAGRTFRDRRDAGRVLAEKLSAYRGRDDVVVLGLARGG
VPVGWEVAHGLGAPLDVFLVRKLGVPQWEELAMGAIASGGGVVVNDELVS
RLNITEEALQRAIERETVELRRRETAYRQGRPPPELTGATVVLTDDGIAT
GASMLAAVRAVRASEPARVVVAVPVAPPSACRAVDAEADAVICATTPAGF
EAVGQVYADFHQVTDDEVRDLLATPTR
108800210YP_640407.1 glutamine amidotransferase [Mycobacterium sp. MCS]MTSRVLFLYNDPVATEALLGEAFVDAGYDVDTFTVVPPERAANPAVDVVF
PDPTGYDVIVPLGARWPVYDDALRRTWVGAEMAMLREAAEAGVALLGVCF
GGQILAQAFGGTVGRAPAPEIGWYDIGTDRPDLVSTGPWFQWHFDRWTVP
PGAVEIARTAGASQAFLLDRCLALQFHPELDHGLLTDWLADDRDGEALAF
GLDHDELLTRTKELEGDAATRIRGLVDAFLSYVGGVPCPS
108800208YP_640405.1 phospholipase D/transphosphatidylase [Mycobacterium sp. MCS]MADVSDWFLTADERGNPDTTLPAWCAGNRVEPLVHGATYFDRLATEVEAL
RDGDPDEKLRDDGPTIRELFCRAAERGVVVKGLVWRSHLDKLAYSEEENR
HLGEHIEEAGGEVLLDQRVRIGGSHHQKLVVIRHPGAPERDVAFAGGIDL
CHSRRDDASHRGDPQAVQMSKQYGDRPPWHDVQLQLRGPVVGALDTTFRE
RWNDPASLDMLNPLAWLRDKFGGADMTADPLPEQPPDPPACGPHNVQVLR
TYPDAHFAYDFAPHGERSIARAYSKAVPRARRLIYLEDQYLWSKRVAALF
ARALRANPDLHLVAVVPRHPDVDGRLALPPNQVGRWQAIATCREAAPQRV
HVFDVENHEGTPVYVHAKVCVIDDVWACSGSDNFNRRSWTHDSELSCAVL
DDEGVFARDLRLRLMREHLDRADDQGLVDPSDAVREIVSAADDLDAWYEG
GRVGPRPPGRLRPHRTEQLGRLTRLWAAPVYRMVYDPDGRSYRARIRGKM
VISVRRRRPAVTSPGR
108800206YP_640403.1 hypothetical protein Mmcs_3240 [Mycobacterium sp. MCS]MSVSFTITRRLRRVPLAVLAVAGLVGGMCWSAPSAQAFYIHNHAAVTRAA
LPPDQVNEIAILQILNGPPPGGGAMGSDAFATDQWRHIDNAKNPGDICAR
AQQAWSTLSPVILRGSQPVGPGANALRDGPGARAAFGGLMHAQQDFYSHS
NWVETNIAAGQPERPAPALFPACNPSAFPADLHTGYFNALYSAQFPLDGC
PPAGPPPGFQECHAVLNKDGPNTARGGQPVPGTSMNMYDLAARLSTATSA
DLYRHVRGLIASTVSAQNPGVDGECIASKFFRPDLLGPCAKFVSPFGGPG
FMPR
108800204YP_640401.1 signal transduction histidine kinase regulating citrate/malate metabolMSSRWSATVRGFGARSLAGRFLVFQLLVVAVVLPAVAAVSIAQSTREFRE
TRSQRMIAVAENVASTPIVRDRLADPFAARVLAPEVDRAVALSGAALAEI
VAADGTVLVSSDPSRVGNRVDLSVTRADEGRAWYGDDDIDGVHSLIGHVP
VLTNRGEVLAIASVSEPYPSVWQLLSGAGERLVLYLGLAAALGLVASWLL
SRRIKRHTRGLEVAEIAGLADHREALLHSIREGVVAVNTDGVITLLNDSA
QELLGLSGAAVGRRADAVGLDPAVVEFLLSGEDGRDVVIATRTRVLALNR
RTASSGGEWIGTVTTMRDSTELAALQAQLSSHKSVTDTLRAQTHEFANQL
HTISGLVQLGEYDAVRDLIGELTRRRAEISDAVTRRIADPAVAALLIAKT
TLAAESGVTLWLDPDSHLGALDPAAATDVITLLGNLIDNAVDVSVGSGAA
RVSVRIDDADGLSITVADTGPGVPEHLREEIFARGVTSKPESPGGRGIGL
ALVRLVTAQHGGVVDVSDRADGGAVFTVRLPPSRVAAHA
108800202YP_640399.1 integral membrane protein [Mycobacterium sp. MCS]MTTTDKPARVDRAQYLICAVLVAVGAFLIVDALRLTAGFAKVDPVGPRAF
PIVVGAVLIVLAVILAIAIPRGSVGEADAGEDVDPEAPSDWRTVGLLVGL
FVAVILLVQPLGWVITGTLLFAGAVAVLGNRHWVRNIAIGLALSLASFYA
FYSGLGIPLPVGILDGIL
108800200YP_640397.1 hypothetical protein Mmcs_3234 [Mycobacterium sp. MCS]MIVVGYTADRFGEVAVEHGITEANRRGTGLLVVNSTAGDSYVDAAFAQPK
DVSGLEAQLADCGVPYEVQQPVGVYAADALLTAMERDDAELLVIGLRHRS
PVGKLLLGSVSQQVLLECPKPVLAVKPDEG
108800198YP_640395.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MSDVELGAVDEIPVGEGRTFTVDGDQIAVFRLRDGSLRAVDAVCPHRGGP
LADGLADERVVVCPLHGHTFDLCSGAEAGGAELSVRSYPVTAVGGAIRLS
RS
108800196YP_640393.1 hypothetical protein Mmcs_3230 [Mycobacterium sp. MCS]MSDGSTPRFLQGAFEFEGNGLDKPMPIDPGLRYVVPAGAVAQPVYFRGGN
STAEMVTVVLFRDGKPMRYFPIAAKGSTHVALRVVEDLLGDTVLELFVAA
PAGCAGTLIVDLGLVEI
108800194YP_640391.1 integral membrane protein TerC [Mycobacterium sp. MCS]MNISPVLWGLTVAVIIALVLFDFFFHVRKAHIPTLREAAVWSAFYVGIAI
LFGLGVLVFGGTKPGLEYFAGYVTEKALSVDNLFVFLVIIGSFAVPRADQ
QKVLLFGIVFALIARTGLIFVGAALINAFAWVFYLFALILLLTAGQLIKP
DDDDRGADNLVIRLARRFLRTTDDYDGDKLFTVENGKRMLTPMLLVMVAI
GGTDLLFALDSIPAIFGLTQDVYIVFTATAFSLLGLRQLYFLIDGLLDRL
IYLHFGLAAILAFIGVKLFLHALHENNVPFINDGEPVNVVEVSTPVSLGV
IITLLLVTTVASLVSPKGRVKNAIGSAQRHATTYLNKTYYGEDAAEREKA
FAKLCAEEQQIKQMPPKYRAMIRREDDLMDLLRRAHAEHDRYLAEEKST
108800192YP_640389.1 carboxymuconolactone decarboxylase [Mycobacterium sp. MCS]MAERVPMLDREQAQLRAAECGLPEELADLSVFRVALHQPRVAVALYGLLD
ALLFRGSLDARLRELVIMRIGWITGSEYEWTQHWRIATLLGVPEHDLLAV
RDWQNSESLGPVERAVLAATDDVVRDGVISEENWAGCQKAFNSDHAVLVE
LVGAIANWRLFSILLRSLNIPLESGTDGWPPDGRAPQGCD
108800190YP_640387.1 acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]MDPIDLAVEAARRAVKDASRPVERRIDTVATPGILVIPRDNPASRIAEAM
HISPARRISCPVGGNTPQYLVEVLGGEIGEGRADVVLVVGAESGHSARKL
QGGALLDSPPPPRSDDESLGDARPGLSQAELSVGLSWPHEVYPIFESAIA
ARHGRDFDAQREWLGTLMAPFTAEAARHPEQAWFPRARSATELSEVTAEN
RMVCLPYPKLLNSIMSVDMAAAFILMAAEVADELGVARDRWVFPWSAATC
NDVYFPVERPDLSRSSGIEVAARKALDAGRLTTDDIRWFDLYSCFPSAIE
MAAEALDLDPLDDRGLTVTGGLPYHGGPGNNYVSHSIVEMVRRCRRDPTD
AGLVTGLGWYSTKHSVGVWSATPPPAGWRLLDTAVEQAQIDSSRLAVAGA
DEATGCATVDGYTVVYDRDGQPRWTPIIAHLSDGQRVVARSDDPQIAEAM
GAEMYVGKTVCLRNTGSFTGFELP
108800188YP_640385.1 phenylacetic acid degradation-like protein [Mycobacterium sp. MCS]MQFTTFNEQVAEQLKSAAETTGGLAGYLGFRHTEFTAGRLVAEMDARDDL
KTPFGNLHGGCLSAMVDHCLGVVFYPVIPLGSWVATTEFKLNLLRPVSSG
TCVATAEIISLGRTSGVARIDICNDGRAVCAAQGTVTVVAPKTSS
108800186YP_640383.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPTEPARVSFRRHVREKVLRATRELAIEKGWDQVRMSEVAESVGVSRPTL
YKEFGDKQGLGDALVVSEGQRFMEGILAVLAEHVGDVRGGITAAVQFTLC
EAEDSPLLKAVLTSNPSGNDRGGSSSTGVLPLLPTSASLLQLCSAALITW
FNDHFDDLDPEDVEEVADVLVRLTVSHVVLPAADIATTGERISRVALRYL
GVVHSL
108800184YP_640381.1 cytochrome P450 [Mycobacterium sp. MCS]MSIPAAVAAKAQSAVPLELQIRGAHLYDKTRRWVTGTNGKKIFTETPIPP
VEDVDIADIDLSNPFLYRQGRWKSYFERVRNEAPVHYQAHSAFGPFWSVT
RHADIIAVDKNHEAFSAEPFIIIGRPPRFMDIAMFIAMDPPQHDLQRASV
QGVVAPKNLREMEGLIRSRVQEVLDDLPVDQPFNWVHHVSIELTARMLAT
LLDFPYEQRHKLVEWSDLATSMEQANGGPSDNDRVFRGMVDMAKGLSALW
HDKAARTANGERPGFDLITMLQANEDTKDLIDRPMEFLGNLVLLIVGGND
TTRNSMSGGVLALNQFPDQFEKLKANPDLIPNMVSEIIRWQTPLAYMRRV
AKKDIMLNGQFIRKGDKVVMWYASGNRDERVFERADELIIDRSNARNHIS
FGFGVHRCMGNRLAELQLRILWEELLPRFENIEVVGEPEYVQSNFVRGIS
KLMVRLTPRPSA
108800182YP_640379.1 AraC family transcriptional regulator [Mycobacterium sp. MCS]MKLDDSGMPALAFLQMLDSEALGHDASIALRSIMVREHVTESMLVGRDAQ
VPLRWFREIYSDFDCDQGTRLGFAFAEHAKLTSFGALSVPLVSAGSVAEV
VELLAYLPVITTALSPTFHSTERGLTIGLTGRTGDAGLNCLAVTYGGLAL
LRLLDMLAGAVPNIELHLSHSAPESWVLHDEVLAGRIFFDAPSSFVHVPA
ASLEEVCRFSDPVAYRIAVTDLQRTLDQRRDTSVSEKVRDLLEKDPGKTN
ISRTAGELSISPSTLKRRLREEGTTFRELRQSFLRERAILRLLDRSLSVS
EIAAELGYAELTNFTHAFKRWTGRSPRHFRKTRD
108800180YP_640377.1 hypothetical protein Mmcs_3214 [Mycobacterium sp. MCS]MTAASSSLDGLHDPEALPPLTDVNRPYFAAAARGVLVFQRCANDHPFLYP
RLVCPVCHDGELAWETAAGTGEIVSFAPVYRPPWDSFPRSEPYVVVLVRL
DEGPQLLASLEGVAPDEVAIGARVRAVFERVNEDLGLVRFRLAAS
108800178YP_640375.1 MaoC-like dehydratase [Mycobacterium sp. MCS]MADASLIGTQLGRTTFPVDRSKVREFALSLGDRDPIYQDVAAARAAGFGA
IPAPPTFVVSSAHWRADDDMFGALGLDLRRVLHGECGWEYFAPVFVGDEL
TETRRVSNVTSREGKRGGIMTIVTIETDFTNQRDELVVRQTDVLIETGGS
TQ
108800176YP_640373.1 hypothetical protein Mmcs_3210 [Mycobacterium sp. MCS]MSAPTSDVTGLGMTFGTFDEGRAWVGHRSEPRHAWFPIDRSMVLYYCSLV
EDANPRYWEGEDCPPGLLMSLGFAPQWVPGYLARADMMFALSVPLPGHHI
INASTTTEFERRPRVGDHVSIVEEIASISEPKTTRVGTGVFITTVSTFSD
QHGEVIGRNTNVLFRYDTADSEGAS
108800174YP_640371.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. MCS]MAEQPVRYEVVDSVAWLTINRPEARNALNNAVRTGLFDAVRRFNDDDAAK
VLVLTGVGDKAFCAGGDLKEMAQNALKVPPKDFAPQFGRNIDVAKPTIAA
VNGVAFAGGFLLAQQCDLVVAAEHATFAVSEVKVGRGSPWAAPLSWLVPP
RVAMQILLTGDPITAERAHQVGLVNEVVPADQLRERTRQLALSIAANAPL
SVLASKRTVYLSAQHHLAAAYDLADEIWEPVYLSDDAQEGPTAFREKRAP
QWKGR
108800172YP_640369.1 hypothetical protein Mmcs_3206 [Mycobacterium sp. MCS]MSVPVRIGNCSGFYGDRIAAAREMVEGGPIDVLCGDYLAELTMLILAKAQ
AKDPSGGYARTFLTQMEQVLGTCLDRGIKVVANAGGLNPAGLAAALRELS
ARLGLTARVAHVEGDDLRGDLHAITPPVGDIKPVSANAYLGAWGITEALH
SGADVVVTGRVTDASLVVGPAAWWHAWARADWDRLAGAVVAGHVIECGPQ
ATGGNYAFLDEITDRRYPGFPIAEVAEDGSSVITKHPGTGGLVSVGTVTA
QLLYEIAEPAYLGPDVVAHFDTIRLAQQGEHRVAISGTKGSPPPDTLKVA
LNEVGGFRNTMTMVLTGLDIEAKAAFAEQQLFDVLGGRDAFDEVDVRLLR
FDVSDAPTNEQACAHLRVTVKDADPRKVGRAFSGGVMEIALAGFAGFHTT
TPPSSETAFGVYRPAYVPRSALTHVLVDADGNRHVIPDPPTGAVPPAGIA
PPAKLPAPSGPTRLAPLGSVLGARSGDKGGNANLGLWARDDPGYAWAREY
LSVERLRTLLGPETAHLRIERFELPNLRALNVVVHGLLGDGVASSTRPDA
QAKGLGEYVRSRVVDVPESLLDTH
108800170YP_640367.1 o-succinylbenzoate--CoA ligase [Mycobacterium sp. MCS]MQLGIGQWVSRRAFLNGGRTALISNGAHITYADLDRRTNQVAAALIALGV
RKGDRVAMLLVNSTEFIEVLLGCAKIGALAVPLNVRLAGPEIGYILADSG
ADVLVFHEPFAAQARSAVTESGVRVRHVVRAGGVPAPGELGYEDVVSGAA
PEPLNGDVDGRDPAFIMYTSGTTGRPKGAILTHDNLLWNAINVLGTDIGL
RGEDVTVAVAPMFHIGGLGVHTLPLLYVGGTSVIMPSFEPRATLQAMADH
HVTVQFMVPAMWTALTQVPDFDSFNLSALRFAMGGGSPVPLTVIDFMRER
GVPFTEGFGMTETAPLVTVLDAENVSTRAGSIGRVAMHVDARIVDDDDRD
VATDTVGELIVRGPNVFTGYWMKAEASAEALRGGWFHTGDLGRMDAEGFI
TLVDRKKDMIISGGENVYPIEVEQVLFRHPAVFDAAVIGGKDAKWGERVV
AVVVADPATQAPSAEEIVAWCRERLAHFKCPRDVHFVAELPRNATGKLLK
TELRAQFTGIEGGVVLR
108800168YP_640365.1 carbamoyl-phosphate synthase L chain- ATP-binding protein [MycobacteriMPKIRKVLVANRGEIARRVFRTCRDLGIATVAVYSDADADAWHVADADEA
VHLPGSSAAETYLDIHRIIAAASLTGADAVHPGYGFLSENAGFARACAAA
DLVFIGPPPGAIDAMGSKLQAKKTMSDAGVPVLPGGDTTGLSAEQLAKLA
ADVGYPVLVKASAGGGGRGMRIVASPDELDEAVTSASREAAAAFADGTVF
LERYVQRPRHVEIQIMADTHGNVVSLFERECSVQRRHQKVIEEAPSPVVD
DALRARMSEAAIAAARAVGYVGAGTVEFVYDAAQDGKADSFAFLEMNTRL
QVEHPVTELITGLDLVRAQLLVAMGRPLPEEMHNPRIRGHAVEARLCAED
PADDYRPCTGTLRTLDVPALAGVRVDSGFRAGSVISHYYDSLLAKVIAWA
PTRDEALASLSAALAGARIHGVTTNRNLLVRVLRHDEFAGRGTDTGFLDR
HDVAQLGAALPDTQSERLHAVAATVAGVAARRAVATLQATLPAGWRNNPS
QPQTTTWQTQGGREVRVGYTLGSTGTCLQVDDEPLADVEVVEGSSERVVL
RVDGVRRTYDVVLDGDVAHLDSVAGYSALRLAPRFVDPSTLNPPGSLTAP
MPGSVIRLPVAEGETVSAGQTLVVLEAMKMEHTVASPIDGVLSALPVQVG
HQVSSGDVLAVVEAVDGGEVASDATEL
108800166YP_640363.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSPARVYGGLSATQRDAQRRVMLIDAAVSIMGTHGATACTVTAVCAKSGV
TSRYFYQQFRDRDALLRAVFAKISTTFQAVITSAIPDDTVAPQELAYAPI
KALVQVIENDPRMARILFVESGAEPLLRQLRSDLMTDFAELVLREARLHL
DIPSDVLQVADLAATYGVGGLFEILRRWIDGQLNLSTEMLIEHCAGFLGI
LGLYTLGQAPDQAAPPLAKAEETR
108800164YP_640361.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSHATSLVVERAPCQDGEVRSRNKRWGGRTGAERRAERRQQLIEAATEIW
SESGWAAVTMRGVCARTGLNDRYFYEGFKTRDELLVAAWDGVRNDMLGEV
AALFNERANRPPIETITAAITIVVDRIARDPGRARILLAQHVGSSPLQDR
RAVALQEATQLVVEASRPHLRQDADEIALRMDTLIAVGGFVEVITAWHSG
LLAVTEKEVVAHTSRLAETLAQRYVISD
108800162YP_640359.1 hypothetical protein Mmcs_3196 [Mycobacterium sp. MCS]MAFAYSDMLETIKNKQWALADIDWNAPGAELITDEQRPKLKQFMSDVVWI
EHVGARAFAAMAPKAPFEALGDIYRYFHAEEQRHANAELALMRRWGMLEE
GEKPVPNKNIRLVIEWLDRYAEALPLTVIGAAIPALETALDGALLKFLLD
EVDDPVCGEVFNKVNSDESRHLAVGFQVLNDLGASPMRIHAIQTAGALVD
PRILTGALLYIPLLTRMLMNLNAMGLSEEKLYNAVTRYANVGDRSEHTRR
VPGYHILKAHMSSSIKRSQPLHFVSQRLGNAIDVFPVQIFGRPPSWTDEL
TYEPVAK
108800160YP_640357.1 putative monooxygenase [Mycobacterium sp. MCS]MDRKSDRNYEIIIIGAGFSGIGSGISLMKAGFTDFLMVDDADGVGGTWHW
NTYPGIAVDIPSFSYQFSYEMRPSWSRTYAHGNELKAYAERCVEKYRLWD
HIRFNTTITEACFDENATRWHLTSANGEEFTARFVINCSGVLSRPKWPEI
KGVRDFAGVTLHTARWDNAKDLSGKRVAVIGTGASAVQLIPEVAKKAESL
TVFQRTPIYCLPKPDFPIPTWGGRLLHFLPGAQLATRTASQAFVEITFPI
AAHFHTVIPFADVMESAAKRYMRREVHDPTTREQLIPRYSLGCKRPSFHN
SYLATYNRSNVSLETSGITHIDHASVHTRDGKAHPIDVLILATGFKVMES
GNMPTYVLKGRGGLEQATWWDEHRLQAFEGVSVPGFPNHFNIFGPYGYNG
SSYFTLIEAQSRHIVRCLRRARALGANCVEVKKEANDRYFAEVLRRRHRQ
VFWQPSCSNANSYYFDRHGDVPLRPSTTLETYWRSRTFRLSDYRFENRPE
EVCPR
108800158YP_640355.1 flavoprotein involved in K+ transport-like protein [Mycobacterium sp. MSSNFATACRAYDPSIVIIGAGFAGVAMAHRLKKDGFTNFTILEKAADIG
GVWRDNTYPGAACDVPSALYSLSYKPNPRWSRRYAEQPEILKYLQQLVES
GGLAAHLRTQTEVVAMTFDDQLGRWGLAPM
108800156YP_640353.1 transposase IS3/IS911 [Mycobacterium sp. MCS]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
108800154YP_640351.1 cytochrome P450 [Mycobacterium sp. MCS]MTNHLLAPAHHVKERLSSVIMVPAPHAVDDRWRRWSRDWPVRELAPAPAG
SGLKAVRGDAGLPFVGHTLDYIRFGSDFSRERYDRLGSVSWMGAFGTKMV
VIAGPDATREAFTSEAKAFSQDGWSFLIDAFFHRGLMLMSFDEHLMHRRI
MQEAFTRPRLTGYVEQVTPCVRSAVPAWPVGPSVRIYPLLKELTLDIATD
VFMGGRGKDESDAVNKAFVATVRAASSLVRAPLPGTRFRAGVQGRRVLED
YFFRHLPAARAGETEDLFAALCQATTEDGERFSDEDVVNHMIFLMMAAHD
TSTITTTAVTYFLAKYPQWQEAAAAEAAAIGDGLPDIEALEKMTVIDLVI
KEALRLLAPVPLVMRKTVRDVAIDGYHIPSNTLCAITPAVNHFDRTIWSD
PERFDPSRFDEPRREDQHHRFAWVPFGGGAHKCIGMQFGTLEVKAILHRM
LRSFTWKVPENYHVRWDNTSLPIPVDGLPLEMKRR
108800152YP_640349.1 long-chain-fatty-acid--CoA ligase [Mycobacterium sp. MCS]MQSTMQNVPLTVSAIVQHAAAIHGDSEVVTPTGNGYRRTPYRIVLARVAR
LANALRSLGVTADQRVATFQWSNQEHLEAYCAIPSMGAVLHTLNIRLAPE
QLAYIANHASDQIVLVDASVAPLLARALPAMASVHTVIVTGEGDLAPLQG
CGKTVLRYEEVLAGQEESFDWPELDELSAAAMCYTSGTTGDPKGVVYSHR
STYLHSLTACTANALSVSEADRVLAIVPMFHANAWGLIYAALMSGADLVL
PDRYLQAEPLVSIIEDTRPTLAGAVPTIWNDVDRYLDSHPERDISSLRLV
ACGGSAVPLSLMRAFEEKYDVPIVQAWGMTETSPLATVARPAHRADATRR
WELRASQGRPICGVEIRLRDDDGKDVPWDGQSVGEIQARGPWITGSYFGN
NDTEKFDEGWLRTGDVGKIDAEGYLTLTDRSKDVIKSGGEWISSVELENT
LIGHPAVYEAAVVGVADDKWQERPLALVVVHPGTDVDIDQLRSFLADKVA
KWWIPERWSFVSDIPRTSVGKYDKKVIRARHSAGEYLIEIETS
108800150YP_640347.1 hypothetical protein Mmcs_3184 [Mycobacterium sp. MCS]MASMVVPYRHDMGGHCGSGALRDLTEWAGIRWGDDTPDEGIVFALGGALD
FSYVRSAHLRPPIYLVGRSADLEDEYLTRLGARFECRSTDDPDLGWKWVT
EQIDAGTPVMVWTDIAELPYLRTRLSMSRHDVVIVGYDDDEELAFVVDND
RDTPQAVPYENLRKARASTGFPVPTRHTTYVVEWPGAAPDLGNAARSAFR
RSADAMQGSCVSAPITEDSDCEIQVRGLPGVSTFVEDLKRWPKIFDDDTL
DGALFALSAFIEKAGTGGGLFRDLQARGCRRVAEELSFEPAFKAAEAAKT
ASELWTAVAHAAYDRGADPHRRASGAASVAAQLPTAERRLAEALREAGDL
LL
108800148YP_640345.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MKTRAAVLWGLEQKWEVEEVDLDPPGPGEVLVRLAATGLCHSDEHLVTGD
LPIPLPVVGGHEGAGTVVECGEGVEELSEGDSVILTFLPSCGRCSYCARG
MGNLCELGAALMMGPQIDGTYRFHARGEDVGQMCLLGTFSEYTVVPQASV
VKIDGGIPLDRAALIGCGVTTGYGSAVRTGEVRAGDTVVVVGAGGIGMNA
IQGARIAGALAIVAVDPVKFKREQASGFGATHTAASMDEAWSLVSDMTLG
KLADVCILTTDVAEASYTAEALALVGKRGRVVVTAIGHPDDSSISGSLLE
MTLYEKQIRGALYGSSNAPHDIPRLVELYSAGLLKLDELVTREYSLDQIN
EGYQDMRSGKNIRGLVRF
108800146YP_640343.1 putative transposase [Mycobacterium sp. MCS]MIVGWRVASHMRTTMVLDALEMARWSRGNTLPGLTCHSDAGSQFTSIRYG
ERLAEIGAVRSIGTIGDSYDNALETVNGYYKAELIYGPVRTRPWKTVEDV
ELATLSWVYWHNTSRLHSYLNDIPPTEFEAAFHDAHGTDQPLAGIQ
108800144YP_640341.1 integrase catalytic subunit [Mycobacterium sp. MCS]MTRRVLKLARQPYYRWRANPITNAELVEAYRANALFDAHGEDPEFGYRYL
VEEAREAGEPMAERTAWRICSQQQLWSVFGKKRGKNGKPGPPVHDDLVQR
DFTAETPNMLWLSDITEHYTGEGKLYLCAIKDAFSNRIVGYSIDSRMKSR
LATAALRNAVGRRGVVAGCVVHTDRGSQFRSRKFVQALHHHGMVGSMGRV
GAAGDNAAMESFFSLLQKNVLDRRRWATREELRIAIVTWIERTYHRRRRQ
GALGRLTPVEYEAIMTTTASQAA
108800142YP_640339.1 hypothetical protein Mmcs_3176 [Mycobacterium sp. MCS]MTGTASVQIACTAVADDNGMRALRDVAAVTADIEYRVIGGHMVRLLRHVY
NVSGIPRLTSDADTGIDVNVASTGNLHDRLTALGYTAECGNRYERGEQAV
DLLVPTAAKPGKRIIGERAFDGAPGLRLALALPPIEVAVTARLTDGDTVE
FEIPVPDVEAAFVLKMLARTVRDSERDLQDIETLLEIVASQPDYHASPWR
LGDPKITKAGERGDAARVAAQMISSPPTRVPARVRALLRRHVAIVSR
108800140YP_640337.1 hypothetical protein Mmcs_3174 [Mycobacterium sp. MCS]MQLADHFNVLLKDTVNLSQFKLDLLNQRVEAIYKALKADVEIGALITGKT
PQGSWAHRTIINPVGDNEFDADFMLDMSQNPDWADNPKTYIDEVYAALHR
HSTYGTMPHSRKCRCARLVYANSMHVDIVPHLNLADGREVIVNRDDNEWE
LTNPQGFTDWMKKQDSIASGNLRKVIRLMKYLRDHKNSFTGTRSVLLTTM
LGEQVTDLRKLLDPSYYSNVPTTLLHVVQDLDTWLQANPIKPSIADPSGS
GVTFDHRWGPDPESAQATYSYFRDRIHVHAADIEAAYEEKDKDRSVQLWQ
NIFGDGFKAPATTTASAKFPAATSAADSTVGRSGRAG
108800138YP_640335.1 hypothetical protein Mmcs_3172 [Mycobacterium sp. MCS]MRATERQRNAPSEGVIVERLRTEATNWINAVALQSGRIDRRFNKRHADHV
ELQTLERDLHFFLLAAVRLRRCIEQVSRYQ
108800136YP_640333.1 NUDIX hydrolase [Mycobacterium sp. MCS]MRTDYYNDPNAPAPNSVVPSASAIVTDEQGRILLIKRRDNTLWALPGGGH
DIGETIADTAVREVKEETGLDVEVTGLVGVYTNPHHVVAFTDGEVRQQFS
LLFATTVLGGTLAIDHESTDIAWTAPDDIAGLDMHPSMRLRVEHYLQRRD
SPYLG
108800134YP_640331.1 regulatory protein [Mycobacterium sp. MCS]MRLRIDTSGTRFIVTRAPEPRLNFETGAPKVDTATGMPMYATQVLALDDS
GGEVLNVTVAGDPKVTVTQSISVVGLVAIPWAQGDRSGVAFRADALTPAT
ASGAAPSEQTRPQK
108800132YP_640329.1 putative plasmid replication initiator protein [Mycobacterium sp. MCS]MTSAQLALPGVPDTVDTTRVVEQMVRRAASMGYQSWWRRAESVGFCAHPI
QLIGTDEYGRQRVVWTRCNNRRAHICPSCSDLYARDTWQLVHAGAAGGHH
GMPTAVGDHPQVFLTLTAPSFGAVHTATTSGDKKAQVCRDQHRIGGYRRC
PHGKQLWCSMSHDHGDERVGQPLCPECYDYAGHVLFAWHLPELWRRFTIT
MRRTLRKELKATGVDPDAVRVSFIKIVELQARAIPHIHALIRLDPQDDPD
QTDWESPIGAVELATIIQHAARTVTLTIDDPTADTDARTMRFGTQIDTQP
LAASAKPVKSAPPEPEPEPGSGSGRSMSGRLVARYLAKYVTKSLVDLGIS
ARRLSTEAIPDLDVSEHVRTILTTISDLADKGLSGIGRWLHTLGFRGHIT
SKSRRYSTTMTVLREQRAIWTREERLKSTAYQYDPNCDFAGRDDLVAWEF
ERAGLGSLGDRSLVYSAALQRIHSRLIGLVEARRQAHNEQWDPLGASDG
108800130YP_640327.1 hypothetical protein Mmcs_3164 [Mycobacterium sp. MCS]MVVVTGPADEVVELVSSLIRFDTSNTGDPATTKGEGDCARWVAAQLEEVG
YECEYLEAGAPNRGNVFARLPGADPSRGALMIHGHLDVVPAEPADWSVHP
FSGAVSDGYVWGRGAVDMKDMCGMMIAVARHFKREGIVPPRDLVFAFVSD
EEHGGTYGADWLVDNRPDLFNGVTEAIGEVGGFSLTVPRRDGGERRLYLI
ETAEKGLSWMRLTARGRAGHGSMVHDDNAVTAVAEAVAKLGRHRFPLVLS
DTVQQFLTAVAEETGYSFDPDSPDLDGTIAKLGGIARIVGATLRDTANPT
MLKAGYKANVIPQTAEAMVDCRVLPGRKEAFEREVDALIGPDVVRSWERD
LPSYETTFDGDLVDQMNASLLALDPDARTVPYMLSGGTDAKSFQRLGIRC
FGFIPLRLPPELDFAALFHGIDERVPVDALEFGAQVLQHFLEHC
108800128YP_640325.1 dihydroorotate dehydrogenase 2 [Mycobacterium sp. MCS]MTGYHALRRVLFLISPERIHTWVFALLRAVTTPDLLRRALQGRLAPRDPV
LASTVFGVRFPGPLGLAAGFDKDGRGLHTWPALGFGYAEVGTVTAHPQPG
NPEPRLFRLPEDRALLNRMGFNNDGAARLAQRLTRHTSDAPVGVNIGKTK
ATPADRAVEDYAQSARQLGPLATFLVVNVSSPNTPGLRDLQAVESLRPIL
TAVRAQTSTPVLVKIAPDLSDADVDEIADLAVELGLAGIVATNTTISRAG
LKTPGVEELGPGGVSGAPVAARSLEVLRRLYRRAGDRLVLISVGGIETAD
DAWERITSGASLLQGYTGFVYGGGLWAKHIHDGLATRLRAEGFTSLSDAV
GSAMRQ
108800126YP_640323.1 hypothetical protein Mmcs_3160 [Mycobacterium sp. MCS]MPLRLNPRSRPLAAAVAALAIAAAGCSSNPVDAPPPTITPATAAVSPPVT
GAPAGTVRPLTVDPRAALFEPATRSLVVLGSGPGGRSALTVLTASAPPRT
VPTPATATAMAGTDDGVLYLSTRGGYLRVDVAAGAVDRIDVEGEADTDFT
AITRRDDGRLVLGTSDGAVLTLDSDTTVGARLGIFARVDALVAQGNTTVV
LDRGQTSVTTVDASGTKAAQALRAGEGATTMAADSQGRVLVADTRGDELL
VFGTDPLIMRQRYPVPGAPYGLAGSSGLAWVSQTATNTVIGYDLSTGIPV
EKVRHRTVQQPNLLAYDDTSGTLYVVSGTGAGVQVIGDAAEPR
108800124YP_640321.1 undecaprenyl pyrophosphate phosphatase [Mycobacterium sp. MCS]MIDAPDMSWLQVIVLAVVQGLTEFLPVSSSGHLAIVSRVFFDDDAGASFT
AVTQLGTEVAVLVYFARDIGRIATAWFRGLRNPGRRDADYRLGWYVIIGT
IPIGVIGLLLKDEIRTAARNLWAIAIALIVFSAVIAAAEYFGRQVRHVEQ
LTWRDGVIVGVAQCLALLPGVSRSGATISAGLFLGLDRELAARFGFLLAI
PAVFASGLFSLPDAFAPVGEGMSATGPQLLVATVIAFVVGFAAVAWFLRF
LVRHGMYWFVGYRVVLGVVVLILLSTGVVAAI
108800122YP_640319.1 hypothetical protein Mmcs_3156 [Mycobacterium sp. MCS]MARAIHVFRTPDRFVAGTVGQPGNRTFYLQAVHDKRVVSVVLEKQQVAVL
AERIAALLQEINRRFGTPIPPDTGEVDDLSPLVTPVDAEFRVGTMGLGWD
SEAQTIVVELLAVSDTEFDASVVLDDAEDGPDAVRVFLTPESARQFATRS
NRVISAGRPPCPLCDEPLDPEGHICVRTNGYRRGALAGTDDDTDI
108800120YP_640317.1 inositol monophosphatase [Mycobacterium sp. MCS]MQTDAELAAAVAAEAGEMLVALREEYDWYHPYDLGDAGDKRANVLILDRL
REHRPHDAVLSEEAVDDLARVEADRVWIVDPVDGTREYSLPPRSDWAVHI
ALWQRTGGPGGGLTDAAVALPARGEVYRTDTVSPPPPRRDGPIRITASAT
RPPAVLWWIRDHLDIEMVRIGSAGAKAMAVVRGDVDAYIHAGGQWEWDSA
APAAVVRAAGLHASRLDGSPLVYNRRDPYLPDLLMCRTEVVDVLLAAIHS
AY
108800118YP_640315.1 short chain dehydrogenase [Mycobacterium sp. MCS]MRRMTSVHGKVVLITGGARGVGEELARRLHAKGAKLVLTDLDDGPLSALA
ADLGAERVLTVVADVCDLETMQSAAEQAVSRFGGIDIVIANAGIASYGSV
LVVDPDAFRRVLDVNVVGVFNTVRAALPSVIERKGYILVVSSLAAFAAAP
GMAPYDASKAGVEHFANALRLEVAHHGVTVGCAHMSWIDTPLVQDTKADL
PSFRTMLDSLPGPLSKTTSVQKCGEVFVKGIERRRERIYCPGWVGLIRWA
KPILTTRIGQASVLKTAPKVLPQMDAEVTALKRSLGARTHGLKK
108800116YP_640313.1 hypothetical protein Mmcs_3150 [Mycobacterium sp. MCS]MTPSDFGPEKGPDLPPLRDAVVVAAFEGWNDAGDAASDALEHLDAIWEAE
TIAEIDDESYYDYQVNRPVIRQVDGVTRELVWPSMRISHCRPPGADRDIV
LMHGVEPNMRWRTFCAELLNIADKLNVQTVVILGALLADTPHTRPVPVSG
AAYSPESAKFFGLEETRYEGPTGIAGVFQDACVQAGIPAVTFWAAVPHYV
SQPPNPKATVALLRRVEDVLDIEVPLADLPTQAEEWEEAVTEMTAEDDEI
AEYVASLEQRGDAEVDMTEVLGKIDGDALAAEFERYLRRRGPGFRS
108800114YP_640311.1 HAD family hydrolase [Mycobacterium sp. MCS]MRAVLWDMDGTLVDSEKLWDVSLAALYDRLGGVITDELRTALVGSSAENT
IKTIFADLGLEPDPAAMAEADRWLHDHTGDLFATHGLPWCDGARELLEAL
AGEGVPMALVTNTQRALTEQALDSIGRHFFSVTVCGDEVPNGKPEPDPYR
RAAALLDLDPGHCLAVEDSVTGTLAAELAGCPVLVVPNDVVVPPSPRRRH
VDSLRDVAVDDLRAFHAEIAAASGKRSA
108800112YP_640309.1 phosphoribosyl-ATP pyrophosphatase [Mycobacterium sp. MCS]MGESQPVKTFDALFDELTERARTRPEGSGTVAALDGGVHGLGKKILEEAG
EVWLAAEHESDEALAEEISQLLYWTQVLMIARGLSPDDVYRKL
108800110YP_640307.1 hypothetical protein Mmcs_3144 [Mycobacterium sp. MCS]MQYSPQWVQYDNYYRPRICNPYRNPLRVVYYYEGAPRVSIIPPLGNIVVE
AAAVGAYNFTAMVLDAVGAATNVAVGSFFGGGYFPGLDSPAQAPLPGDYA
LELVSDEASGLSLRDKFLIGLAGTLGALALAAVGLNVHLSRRRPRV
108800108YP_640305.1 mercuric reductase [Mycobacterium sp. MCS]MDTEPTTFDAIIIGAGQAGPPLAGRLTEAGQTVAVIERKLVGGTCVNYGC
IPTKTLVASAHAAHLARRGAEYGVGTGDVTVDMAKVKARKDKIMLGDREG
VESWLQGMDGCTFIRGHARFEDPHTVRVDDQVLKADRIYLNVGGRAVAPD
LPGLSDIDYLTNVGILDLDTLPEHLVIVGGSYIALEFAQMYRRFGARVTV
LEHGPRLTSREDEDVSAAIKDILEAEGIDIVLDAKDIRFTKRDNGFDVVP
RDGAAPIAGSHLLIAVGRQPNTDDLGLDAAGVQTDERGYVVVDDQLRTTA
DHIWAMGDCNGKGAFTHTSYNDFEIVAANLLDDDPRRVSDRVTTYALYID
PPLGRAGMTAEQVRKSGRKALVGKRPMTRVGRAVEKGETQGFMKVVVDAD
TEEILGAAILGVGGDEVVHAILDIMTAKKPYTAISRTMHIHPTVSELVPT
LLQDLKPLT
108800106YP_640303.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MDTIDLLWRHDRPLPSRRGRPPRFTADQVVTAAIAVADRLGLRFTLRDVA
DALEVPVMTLYSYVRNREQLLELMVDHCRAAMQFTDPAGDWRARLATVVA
DNMRLFDEHPWLADLESERAVLGPGTLAKYDRELGAVDSLPLGDADKDAA
LTLVLDFARSCARALAHARREREQESPGQWWAREGARLAALGVAERYPLA
SRIGAAAGAAHGAAHDAEAALAFGLNVLLNGLAATPPAASEAVRSPRRSS
108800104YP_640301.1 hypothetical protein Mmcs_3138 [Mycobacterium sp. MCS]MIGHLYHRLPDDPSAGEGLAAFESTADTRSNWDPTIQHGSPPLALLTRAV
EDLAAGSGLRVGRLALDILGAIPVAPVLVRSEVLRPGTRISLMAAEMLAS
RPDGSHRAVARVTAWLLAPSDTADAVTDRYPPLAEGEVTGLAHAWEGAPG
YLETVNWRRQADDGNSAVAWLTPLVPLIDNEPTTALQRLAMVVDSANGIG
AALDPTEFMFMNTDTVVHLHRLPEGSDFGLRTRGSIGPDGVGVTTAELFD
RRGFIGASAQTLLVQRQR
108800102YP_640299.1 tRNA (adenine-N(1)-)-methyltransferase [Mycobacterium sp. MCS]MPRTGPFAVGDRVQLTDAKGRHYTMLLTPGGEFHTHRGMIALDSVIGLPE
GSVVKSTSGDQFLVLRPLLVDYVMSMPRGAQVIYPKDAAQIVHEGDIFPG
ARVLEAGAGSGALTCSLLRAVGPQGRVTSYEVRDDHAVHAARNVETFFGE
RPANWDLVIADLNDYNGGEVDRVVLDMLAPWEVLDTVSRNLVPGGVLMIY
VATVTQLSRAVEALRQQQCWTEPRAWESMQRGWYVVGLAVRPQHTMRGHT
AFLISARRLAPGAIAPIPLRRKRQLAAPPAEPSD
108800100YP_640297.1 protein LppK [Mycobacterium sp. MCS]MTADVRSAVTLVVAAFGLSLGLSGCGSDNPPAPPPSPVASSPAAPPAPPV
PAPLPPPSALTDVLYRLADPNVPGAEKLVLIEDSGPGDAAALDRFGKALA
DNGYHPMTFDAADLAWTASGVDVVATVIARTPPGRTGGDFTFPMEFARTP
DGGWQLTRDSADTLLEVDAGQSPPR
108800098YP_640295.1 vesicle-fusing ATPase [Mycobacterium sp. MCS]MSESQRHEAREDGFTTPHESGLSSEDAAELEELRREAAALREQLENAVGP
QSGLRSARDVHQLEARIDSLAARNAKLMDTLKEARQQLLALREEVDRLGQ
PPSGYGVLLASHEDDTVDVFTSGRKMRLTCSPNIDVKALKQGQTVRLNEA
LTVVEAGTFEAVGEISTLREILSDGHRALVVGHADEERIVWLAEPLVSVE
HLPDNEVAGPELDDDRPRRLRPGDSLLVDTKAGYAFERIPKAEVEDLVLE
EVPDVSYSDIGGLTRQIEQIRDAVELPFLHKDLYREYSLRPPKGVLLYGP
PGCGKTLIAKAVANSLAKKMAEVRGDDAREAKSYFLNIKGPELLNKFVGE
TERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVP
QLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEA
AQDIFSKYLTEELPVNEDDLAEFGGDRSLTIKAMIEKVVDRMYAEIDDNR
FLEVTYANGDKEVMYFKDFNSGAMIQNVVDRAKKYAIKSVLETGQKGLRI
QHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSS
ANRAIDTESNLGQYL
108800096YP_640293.1 proteasome subunit beta [Mycobacterium sp. MCS]MTWPHFEQLAFPDLSRHSSHSTTRGVPSVPMDLSSFSDMLRRQAPHLLPF
RGDASLTPTDAVPHGTTIVALKFPGGVVMAGDRRATQGNMIASRDVQKVY
ITDDYTATGIAGTAAIAVEFARLYAVELEHYEKLEGVALTFAGKVNRLAT
MVRGNLGAALQGFVALPLLAGFDLDDPDPQAAGRIVSFDAAGGHNLEEEG
FQSVGSGSIFAKSSMKKLYHQVTDADSALRVAVEALYDAADDDSATGGPD
LVRGIFPTAVLITADGAEEVTQERIAGLAREVIQNRSRADTFGPDAHAPR
GTDS
108800094YP_640291.1 hypothetical protein Mmcs_3128 [Mycobacterium sp. MCS]MWCPSATLAVWANSWLAGTAAPDDVLDSLSHWAPRHSVTAYDSAAAGRTG
LPWPDLNGTGAVSLLQTLRTAAGPAPSGPSVSVALPAPGDVRGLPAGTQF
QRDAIAVGEALIVTDPHLPSTAVGLVPDFEFDDDSDDPEFDPEVSALSWT
VYSAPATPPAPHIDLGEAEYELRSAVRAAAEALTALRAGMAGADVDDPRG
LVEQVLESGRGHRLPDHAPNRAERVLENAAHVDAIITVSSGLMPIGLQSS
SEVQIASDALRPLVGVVRTARIAALTAILHSAWRR
108800092YP_640289.1 hypothetical protein Mmcs_3126 [Mycobacterium sp. MCS]MDGAVAGLVLLLVLVVFAVVVVAKSVALIPQAEAAVIERLGRYSRTVSGQ
LTLLIPFIDKIRARVDLRERVVSFPPQPVITEDNLTVAIDTVVYFQVTNP
QAAVYQISNYIVGVEQLTTTTLRNLVGGMTLEQTLTSRDQINTALRGVLD
EATNRWGLRVARVELRAIDPPPSIQDSMEKQMRADREKRAMILTAEGSRE
AAIKQAEGQKQAQILSAEGAKQAAILAAEAERQSRMLRAQGERAAAYLQA
QGQAKAIEKTFAAIKAARPTPELLAYQYLQTLPEMARGEANKVWVVPSDF
AGALGGFTKLLGTPGEDGVIRYTPSPDEGRPPAEDDSEEVADWFSTETDP
AIAQAVAKAEAEARTPIEGPGLLSSTEPPGQLGAPRPGVTDQ
108800090YP_640287.1 hypothetical protein Mmcs_3124 [Mycobacterium sp. MCS]MPDPARRHVAVGLVNVKAVVRTLQAVQAVRATVAAAALQVPRRRLIAIAA
AIVILVAVAWWVPIPNALELRDWATSVGAWFPLVFLATHIVVTTLPFPRT
AFTLAAGLLFGPLLGIAIAVAASTVSALLAVLFIRALGWQLNNLVSHPAV
DRIDVRLRRRGWPSVIALRLIPAVPFAVLNYAAGASAVRLLPYSLATFFG
LLPGTAAVVVLGDALTGRVNPLLVLISAATASIGVFVLLYENRVQRRRPA
PVTVS
108800088YP_640285.1 methylmalonyl-CoA mutase [Mycobacterium sp. MCS]MTVNDVAGKPAPETTGIGSFADVPLHGEGAGAPATEAAVAAHIEAAAAAH
GYTPEQLDWVTPEGIDVKPVYVAADRAAAASAGYPLDSFPGAPPFLRGPY
PTMYVNQPWTIRQYAGFSTAAESNAFYRRNLAAGQKGLSVAFDLATHRGY
DSDHPRVQGDVGMAGVAIDSILDMRQLFDGIDLSTVSVSMTMNGAVLPIL
ALYVVAAEEQRVPPEKLAGTIQNDILKEFMVRNTYIYPPKASMRIISDIF
GYTSTKMPKFNSISISGYHIQEAGATADLELAYTLADGVEYIKAGLDAGL
SIDKFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAEFDPKNEKSLSL
RTHSQTSGWSLTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALP
TDFSARIARNTQLLLQQESGTTRPIDPWGGSYYVEWLTHQLATAARMHIG
EVVAHGGMAQAISEGIPKLRIEEAAARTQARIDSGAQTVIGVNKYQVTED
HEIEVLKVENSRVRAEQLAKLQQLRADRDEDATRAALDELTRAAGAQGSA
GEDGLGNNLLALAINAARAKATVGEISDALEKVYGRHVAEIRTISGVYRD
EAGKATNISSATELVEKFAEADGRRPRILVAKMGQDGHDRGQKVIATAFA
DIGFDVDVGSLFSTPDEVAQQAADNDVHVVGVSSLAAGHLTLVPALRDAL
AAVGRPDIMVVVGGVIPPGDFDELYAAGAAAIFPPGTVIADAATGLLHKL
AERLGYDLNA
108800086YP_640283.1 beta-lactamase [Mycobacterium sp. MCS]MLVRRARFIAVSNLSARGDGTALPHGVQGAADRNFACTLQGFSQLFPGRR
FGGGALCIYLHGEPVVDVWTGYSDRRGRQYWTADTGAMVFSATKGMAATV
IHRLVDRGLLEYDAPVARFWPEFGANGKERITVRDVMRHRAGLSHLNGVR
KEDLLDHLAMEQRLAASPVNRLLHGHPAYHALTYGWLVSGLARAVTGQGM
GDLIRTELAGPLNTDGLHLGRPPAHAPTRAAQILAPQSTLANPVFNFVAP
KVAALQFSGMFGSMYFPGMKGVVQGDIPFLDAEIPSANGVATARGLARMY
GAIANGGVIGGEQFLSSQVAAGLTGRPNLRPDRNIGIPLAFHLGYHSLPF
GLMRGFGHVGLGGSVGWADPSSGLAIGFVHNRLLTPMLLDMGSFAGLNVL
IRRDVARARRRGFQVIPDLGAPFAVPKPVAG
108800084YP_640281.1 condensation domain-containing protein [Mycobacterium sp. MCS]MIRAHRVRREDGSHGVDEVAREHIRSTGGLMVAIKAIHDWTGAPGTLVSW
NPSATSLAKMQDAPISPVPVSYQQEQHIRGYRKHLSQGTDMARLNIPAWD
MPGQCDLRAMTHVINAYIRRHDTYHSRFEFTEAGEVVRRTIRNPRDIKFV
PTQHGEMTADQWRRHVLLTPDPLQWNCFGFGIIQRADHFTFYISVDHVHT
DAMFMGLVLVEIHMMYATLVGGGAPLKLPDAGSYDDYCLRQREYTDSLTL
ESPEVQDWVRFAKSNGGTLPHFPLPLGDPAEPCSGELLTVRLLDKHQGER
FEAACNAADARFIGGVFACAALTDHEFTGDSDYHIITPTTTRRTPEEFMT
TGWFTGLVPVTVSVDRNSFGDTARSAQKSFDSGLDLAHVPFERVLELAES
VGVRPADPGVPMVSYLDAGLPPLSPSVIAQWEGMNGKVYSDARAAFQVGM
WVNRTERETTVTVAFPDNPIARESITRYLQVMMSWYLRVADGGAAGPLAG
RHGAAVRRRDELVPVVGG
108800082YP_640279.1 hypothetical protein Mmcs_3116 [Mycobacterium sp. MCS]MAIQMRPATLRAGRGEDGGLRDDHLAYIDQAAYLQQRATGVGKLAQAVWV
YEHPLNMDALKRFHANLDHSLIGRRVETSVLPFGRHRWVSAEGAPIAVSA
PRSRADLSDWIDERSAVPTDPEIGPSWHLGVLPMDDGSVAISLAASHVVT
DGIGLLRSIADAAEGRTRHLGYAPARSRSTLTALRADLRQTARDMPEVGR
TVAAAAKLAYRRRHELRQPASPRAAAATVAEGGKPVIIPAITAFIDAKHW
DSCAEMRNGTTYSLLAGFAARLAERTGRHRPDDGAVSLLIAISERTPDDT
RANAVAITNACVDPARVTADLSESRIAIRQAITTLREVPDETFALLPLNP
FVPKRAVKRAADIMFGDLPVSCSNLGEIDPAVGRVDGTDAEYFMLRGVDQ
NLTREQIERAGGQLVVASVRLGDMISLGIVSYEPGRTNTKRRLRDLTTLT
LAEFDLYGEIV
108800080YP_640277.1 transporter [Mycobacterium sp. MCS]MFDRTKLRGAFADGGLPQLGRFIVRHPVLIIVAWVAAAAVLFLLIPPLAV
VSQKNPPEFLPKDAPVMVDSKKMSDAFKGAEETNTSNLNVVILSNPNGLS
PDDEQTYEELVERLKADEEHVISTQDFVTTPQLREVMTSKDGKAWNLPVS
LVGSMGTPKGQAAYRAAGKIVKETTADTTLQANMVGAAATLEDINAIGAR
DQRVIEIATVGTILAILLVVYRSIIGMLIPLLTIGLALGVANQAVAGLGE
LGLGLGPQTIVLMTGMLMGAGTDFSIFFFSRYHELVREGMESDDAMIGAL
VTIGKVVAGSAATTAIAFLGLAFTTLGVFATVGPALSVTIAIGFLASITL
LPSLIVLAGRRGWVNPRKDLTGRFWRRSGIHIVRRPVVHLVGSLTVLIAL
AACAGFIKFNYDDRKALPADSESNRAYQAMDDHFPISTTMQQFVVIHAPD
QDLRSPRSLAVMEQMAQRIAALPDIDMVRGITRPTGEMLEQAKATYQAGE
VGGKLDEASTLIEDNDANLNRLSGGAHQLADVLDEIRDGVVGAVGSVRGL
AGALDDMSRKYGGAKTLDEIDRTARLVTNMRDLGNAIGVDVNRMTDIYAW
ADPVLRSLDTSPTCDADPECVQSREDMRRIVSTRESPYLNSISDLGSQLQ
NTEGYQTLDETIQGLSKSLKTATAAARELGLDEPNGVQNKIREVTQGANT
LADSSRQLAEGVQLLVDQTKNIGGGLDQASDFLLAMKRDASEPSQAGFYI
PPQILTQPEFKKAANLFVSKDGHTARYLVQTALDPFGTEAMDQVDDIVGA
AEGARPDTTLANADISMVGFSPVQSNLREYYNGDIRFIIGFTLLVVFLVL
CLLLRAVVAPIYLVASVVLSYVSAIGIGVLFFQFILGQELAWTVPGMAFL
VLVAVGADYNLLLIARIREESRDGIRTGIIRTVGATGGVITSAGLIFAAS
MLSLTVSSIGTVIQLGFVIGVGLLLDTFIVRTITVPAAAVLIGNANWWPT
KPKYEKRVPRADVADAVTAPLLPRSPRARVRQRLAEITQEYRALREDRPP
EQVPEATARTDV
108800078YP_640275.1 polysaccharide pyruvyl transferase [Mycobacterium sp. MCS]MTDFVERIRDRLMNDLRRVFAGVPEWDLVDFPHHFNCGDSAIWLGEVKIA
EELGIRVASATSSQMYRRDKLRANGPVVIHGGGNLGGLYPQHDDLRIRIL
TDFSTRPIVQLPQSIEVTNAAGLERLKRAIGSHRDFTLLVRDRRSLDIAR
REFYCRIELVPDAAFALGNLERRPAVEEAVVQARRDKEASGEQISGHPTV
DWNTASILSLRNLGRSAVTAAGKLPVPALTSTLADSFARQNLRWAIRTLS
RGHVLVTDRLHGHVIATLCGIEHIVVSDRYGKVRALWETWTQDAPMATFA
PTWSAAETALAERISRRYAS
108800076YP_640273.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MPEPTIEVIIPVRDMAEHLPKLLRPLYDQMSDGDRVTVVDDASRDDTEAV
ARSLGAGVVALKDSRGPYYARQVAASRSTADVLLFTDARCRPLPGLLEAH
RDLQERPGVALSCTNVRTLSGPRLAARLAASMQPFMLPRGGGAMKATIGM
VPPRPDYYPTANLGIDRIAFAKVGGFRSMRGGGDTDICWRIQEQSLGTIA
TDTRVLMEWEPRTSMRDLASQWKRYGHSNAYMRWVHRNDDVSKGDDSPRR
HSPMEAWATLRAELRRPPAELAATALVGLAFQYGYFSAKFKSSQFEMPAY
FDVAPNLDSA
108800074YP_640271.1 hypothetical protein Mmcs_3108 [Mycobacterium sp. MCS]MTRTSKRTVRIVFAATFVWIALLQYGLFAIDRMEPYPALVLPGFPAHCPG
CLLETGEPATQEPELLVRFADGTTQRVPTETVLPPGPSVRLIAFTTAYKN
DGFTSDPEAVAWLKSRIAERFPGEAVSGLDIVWRKATYKAADESAIEYEP
SHTIHVNFGTTR
108800072YP_640269.1 ABC-2 type transporter [Mycobacterium sp. MCS]MDLVFAVLMPTFVLAGLVLLLQDVIATGQMSYTQYVLPAVVVQAMLFGAL
TTTDRAAWDTISGLSTRMRTLPISPYAMLTARMIYCLIRGVLAVIASVLA
AHWFGFRFTTGFGYGAAFVLMALTLTLALSLGADVTGTKAGRTEVASQLL
LVPQLLLVLLSTGLAPLEAFPSWLQGFVQYQPVSQITEAMRGFTSGHVDA
GNLGVSLAWCVGLLLVFGTMAVRLQGRTP
108800070YP_640267.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MRVLGIGCLMLGRIVRYRKDEGPAMTASTLPTVLRERASLQPNDTAFTFI
DYEKAVEGVHESLTWAQLYRRTVNLAHELSEHAQPGDRAVIVAPQGLDYL
VAFLGSLQAGLIAVPLSTPMPGVHDERISAVLRDAAPTVVLTTSSIGAMV
TEYVAPDDAETAATLIEVDLLDLESRRKSAARRVERPETAYLQYTSGSTR
TPAGVMVSYRNLSANFEQIMASFLAHYGGIAPPGTTAVTWLPFYHDMGLL
LGVFAPILAGWPTVFTTPLSFLARPARWMQMVAGSPLAITAGPNFAFELA
VGKTSDDDMAGYDLGNTCIIISGSERVHDATLKRFAQRFRKFNLPEEVLR
PAYGLAEATLYVATNSPGKPPTIVHFEPEKLSAGHAKRTETGTPLVSYGS
PDSPAVRIVDPQTRRELSAGAIGEIWVRGENVCLGYWGKPEQTEEVFNAF
LDSPSPGTDAGPWLRTGDLGFISDDELFIMGRLKDLLIVRGRNHYPDDIE
GTIQEISGGRVAAISVEQDRTEQLVAIVEVKKRGDTDEDVAAYFADLKNR
VTSAISTAHGISAADLVLVPRGSIPITTSGKVRRASCAELYRDGAFTRLD
A
108800068YP_640265.1 hypothetical protein Mmcs_3102 [Mycobacterium sp. MCS]MPRTDENGRQLKALLDYLLDGDVEAKAIYDALGISSSTYYRRIKEQDYPD
AEELRRVADRFELSYPDLQIRFGLMSRQEVWHYVESAPFTVATVADAAPT
TRRRPKLSELAPRPDAPPL
108800066YP_640263.1 isoleucyl-tRNA synthetase [Mycobacterium sp. MCS]MTAYPKPAGGAPNFPELEADVLDYWAGDDTFRASIAGRDGAPEYVFYDGP
PFANGLPHYGHLLTGYVKDIVPRYRTMRGYKVERRFGWDTHGLPAELEVQ
RQLGITDKADIDAMGIEKFNDACRASVLKYTDEWRSYVTRQARWVDFDND
YKTLDLSFMESVIWAFKQLWDKGLAYQGVRVLPYCWNDETPLSSHELRMD
DDVYQSRQDPAITVGVQAVDGPLAGSHLLVWTTTPWTLPSNQAVAVNPDV
TYVQVAVGDRRYVLAEARLAAYAREIGEEPEVLATMTGSELLGTRYLPPF
PYFTDKPEAQNAWQVLRGDFVTTEDGTGIVHMAPAYGEDDKATTDTVGIT
PVTPVDSKGRFDASVPDYQGQHVFDANPQIIRDLKNGTGSAGANGAVLVR
HETYEHSYPHCWRCRNPLIYRAVSSWFIKVTEFRDRMVELNQEITWYPEH
VKDGQFGKWLQGARDWSISRNRYWGTPIPVWMSDDPAHPRIDVYGSLDEL
ERDFGVRPTNLHRPFIDELTRPNPDDPTGKSTMRRIEDVLDVWFDSGSMP
YAQVHYPFENRDWFDGGPDEDAHFPGDFIVEYIGQTRGWFYTLHVLATAL
FDRPAFKTCVSHGIVLGNDGQKMSKSLRNYPDVTEVFDRDGSDAMRWFLM
ASPILRGGNLIVTEQGIREGVRQVLLPLWNAYTFLALYAPKKGTWRTDSS
HVLDRYILAKLAQLRDDLTESLDVCDISGACDELRQFTEALTNWYVRRSR
SRFWDEDPDAIDTLHTVLEVTGRLAAPLLPLVTEVIWRGVTGGRSVHLTD
WPSADELPKDPALVAAMDQVRAVCSTASSLRKAKKLRVRLPLPKLTVAVT
DPAQLEPFADLIADELNVKAVELTDDIDTYGRFELTVNARVAGPRLGKDV
QAAIKAVKAGEGVVNADGTLTAGPAVLQPGEYTARLVAADAEFTAALPDG
AGLVVLDGTVTPELEAEGWAKDRIRELQELRKSSGLDVSDRISVVMSVPQ
THEEWARTHRDLIAGEILATAFEFGEPADGSEIGDGVRVAIAKA
108800064YP_640261.1 carotenoid oxygenase [Mycobacterium sp. MCS]MRVERLQTFASTLPADDDHPYRTGPWRPQVTEWRADDLEVVAGEVPADLD
GMYLRNTENPLHPAATAYHPFDGDGMIHIVEFGGGKAAYRNRFVRTDGFL
AENEAGGPLWAGFIEMPSAAKRADGWGARTRMKDASSTDVVVHRGTALTS
FYMCGDLYQVDPYTADTLGKETWHGDFPDWGVSAHPKIDPVTGELLFFSY
SKEAPHLRYGVVDKDANLVHHTDVALPGPRMPHDMAFTENYVILNDFPLF
WEPSLLKQDIHAPVFHRDMPSRFAVLPRRGDQSQVRWFETDPTYALHFVN
AYEDGDEIVLDGFFQDNPSPSTKGAKSLEDAAFRYLALDGFESHLHRWRF
NLATGAATEERLSDSLTEFGMMNGDYQTRRHRYVYAATGKPGWFLFDGLV
KHDLRDGTEERITFGDGVFGSETAMAPRQDGTAEDDGYLVTLTTDMNDDA
SYCLVFDAARIADGPVCKLRLPERICSGTHSTWVSGAELRRWHSPR
108800062YP_640259.1 RNA-binding S4 [Mycobacterium sp. MCS]MAAHEVPIGDDTIRLGQFLKLASLIDSGADAKSVIADGAVTVNGEVELRR
GRQLHPGDTVTLGGESARVTRG
108800059YP_640256.1 lipoprotein signal peptidase [Mycobacterium sp. MCS]MVTDETPGKASGKVEPTTGAAEPPDVPVDPAPRPRRRLGLLLSVAAVVLV
LDVVTKVLAVRLLTPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTL
VATGVVIGIIWMGRRLVSPWWALGLGLILGGAMGNLIDRFFRSPGPLRGH
VVDFLSIGWWPVFNVADPSVVGGAILLVVLSLFGFDFDTVGRRQPGDESD
PVGRRQPGDESDPGGRRGAEPVARPEADPS
108800057YP_640254.1 rarD protein [Mycobacterium sp. MCS]MTETRRNGLLFGIGAYVWWGLCPGFFLLLLPAGSLEILAHRIVWSVVFLL
LVLAVARRLGDLLRLSWRTWLQLLAASALVSANWGVYIYAATHSHVVDAA
LGYFINPLLSVALGVLVFRERINRSQQVALVLAVAAVVLLTVEIGAPPYI
ALALAVSFALYGLVKKVVTADPRVSVAVETLIALPFAGGYVLALELTDRG
HFLSEGLAHTGLLLLAGPVTAIPLLLFGAAAQRLPLVTLGLLFYINPGLQ
MAWGVVIGHEPMPVGRWIGFALIWLALALLAADAVRRRTPRERTSTTPAE
HVDRDESKSSSH
108800055YP_640252.1 RNA polymerase ECF-subfamily sigma factor [Mycobacterium sp. MCS]MLAALAAPTGDIAAAEDALADAFERALRRWPVDGIPAEPAAWVITVARNR
LRDRWRSAGHRRAARLDENLDVTAESVDWPAIPDKRLELMLVCAHPSVAV
NVRTPLMLQVVMGVDAAAIAEAFAVEPATMAQRLVRAKRRIRDTGVPFTL
PERDDLAERLPAVLESVYGVYAIDWQRGPPDDPGDSLAAEALHLTALLTE
LLPADPEVLGLAALVCFGEARRPARRGVEGAFVGLDDQDSGRWDHELIAR
AEDLLRRAHTHRRPGRFQYEAAIHSAHCHRPVDRRALRKLYLALLRVAPS
LGAAVALAALDGEIDGPDAGLRALAAIDDPALDRFQPAWTTRAHLLERAG
RTAEANIAYQRALAITSNPALRAHLRQRLR
108800053YP_640250.1 DNA polymerase III subunit alpha [Mycobacterium sp. MCS]MSGSDGRSSGSFVHLHNHTEYSMLDGAAKVKPMLAEAQRLEMPAIGMTDH
GNMFGASEFYNAATDAGIKPIIGIEAYIAPASRFETKRVLWGDPSQKSDD
VSGSGSYTHMTMVAENATGLRNLFKLSSLASFEGQLGKWSRMDAEIIAEH
AEGIIATTGCPSGEVQTRLRLGHQREALEAAAKWREIFGPQNFFLELMDH
GLDIERRVREGLLEIGQKLGIPPLATNDCHYVTRDASQNHEALLCIQTGK
TLSDPTRFKFDGDGYYLKSAAEMRALWDSQVPGACDSTLLIAERVQSYAD
VWAPRDRMPIFPVPEGHDQASWLHHEVMAGLKRRFSAVSGGVVPNDYIER
AEYEIKVICDKGFPSYFLIVADLINYAKSVDIRVGPGRGSAAGSLVAYAL
GITNIDPIPHGLLFERFLNPERPSAPDIDIDFDDRRRGEMLRYAANKWGS
DRVAQVITFGTIKTKAALKDSARVHYGQPGFAIADRITKALPPPIMAKDI
PVSGITDPTHERYKEAAEVRALIDTDPDVRTIYETARGLEGLVRNAGVHA
CAVIMSSEPLIDAIPLWRRPQDGAVITGWDYPSCEAIGLLKMDFLGLRNL
TIIGDCIENIKANRGVDLDLESLALDDPKAYELLGRGDTLGVFQLDGGPM
RDLLRRMQPTEFNDIVAVLALYRPGPMGMNAHNDYADRKNGRQPIKPIHP
ELEEPLKEILAETYGLIVYQEQIMFIAQKVASYTMGKADALRKAMGKKKL
EVLEAEYQGFREGMTANGFSEAAVKALWDTILPFAGYAFNKSHAAGYGLV
SYWTAYLKANYPAEYMAGLLTSVGDDKDKAAVYLADCRRLGITVLPPDVN
ESVQNFASVGDDIRFGLGAVRNVGANVVASLVNTRAEKGKYSDFSDYLNK
IDIAACNKKVTESLIKAGAFDSLGHPRKGLFLIHTDAVDSVLGTKKAEAM
GQFDLFGSGDGSGADAGDSAFSIKVPDEEWEDKHKLALEREMLGLYVSGH
PLNGVAHLLANQVDTQIPAILDGDVANDAQVLVGGILASVNRRVNKNGLP
WASAQLEDLTGGIEVLFFPQTYSVFGAEIADDVVVLVKAKVAARDDRIAL
IAHELVVPDFSSAQADRPLAVSLPTRQCTVDKVTALKQVLANHPGTSQVH
LRLISGERITTLELDQSLRVTPSSALMGDLKALLGPGCLGG
108800051YP_640248.1 hypothetical protein Mmcs_3085 [Mycobacterium sp. MCS]MTTAGNFRSTVARAACDVSVAGVPWPAYKVIALLVGLVAFLVVGVVTMSA
APAVLSGAAAATVSWVGFGLVCNGRR
108800049YP_640246.1 threonine dehydratase [Mycobacterium sp. MCS]MSAELSQTPRTSPITAADIDEAAQRIVDVVVRTPLQFSERLSEVTGAQVY
LKREDLQAVRSYKLRGAFNLISQLTEEEIAAGVVCSSAGNHAQGFAMACR
TMGIKGRVYIPAKTPKQKRDRIRYHGREFIELIAVGTTYDLAAAAAIDDV
ARTGATLVPPYDDVRTMAGQGTIAAEILDDLDAEPDLVIVPVGGGGCIAG
ITTYLAERTSGTAVLGVEPAGAASMIAALSAGEPVTLDHVDQFVDGAAVN
RAGRLPFAALQAAGDMVSLTTVDEGAVCSAMLDLYQNEGIIAEPAGALSV
AGLLENNVEPGSTVVCLISGGNNDVSRYGEILERSLVHLGLKHYFLVDFP
QEPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIELGSAADFDG
LLTRMRSSDMHVEALEPDSPAYRYLL
108800047YP_640244.1 malto-oligosyltrehalose synthase [Mycobacterium sp. MCS]MAADRPVLSTYRLQMRGDAFTLADAEALVDYLDELGVSHLYLSPILTAVE
GSTHGYDVTDPTTVSAALGGADALASLSSAAGARGMGLVVDIVPNHVGVD
DPRQNRWWWDLLTHGRDSAYADYFDVDWTADPDGRILLPVLGSNGDVADL
TVDGDTLRLGDLVFPIAPGTADGAGPDVHDRQHYRLIGWKPRASEAPGNP
SGICGYRRFFSITSLAGLRQEDPAVFEATHTEVKRWFTDGLVDGIRIDHP
DGLSDPPGYLVRLRELVGPQAWIVIEKILAVDEPLDPTLPVAGTTGYDAL
REAGGVFVDPAGAEALGTLYESTGVDYSAMPRAARALKVKAVTTTLGSEL
ARLCRTIVAATGQDHDDLPDAVAAVISHLGVYRSDYSVLATVLPVAIAET
LSQQPRFAPALQIVSTALSSSRETAVRFQQLCGAATAKAMEDCLFYRDAR
LVSLNEVGGEPEWFGVSIAEFHQRATARAAMWPHAMTTLTTHDTKRGEDV
RARIGVLSQVPSLWAQYVEAWAERTPPPDSGTGLFLLQNMFGVWPVDGVV
TDELRDRLHAYAEKAIREAATHTTWNDPDSEFESGVHAWLDSVIDGPVGT
ELGRLVEQLDPHARNDSLGQKLLALTGPGVPDVYQGTELWEDSLVDPDNR
RPVDYTQRRAELEALRHPKMRVVHAALRARRDRPASFLDGGYTPVLARGA
AADHVVAFLRGDDVLTAVSRHTVRLRDTGWGDTELTLPEGNWTDRITGGR
FTGTVTAADLFAELPAVLLERDHA
108800045YP_640242.1 acyltransferase 3 [Mycobacterium sp. MCS]MMTLAPHRPAAGTDPGPVRPTATGTRSSGFYRHDLDGLRGVAIALVAVFH
VWFGRVSGGVDVFLALSGFFFGGRLLRMLLTQGAPLRPYPEVTRLVRRLL
PALVVVLAASAVLTILIQPETRWETFADQSLASLGYYQNWELAITASDYL
RAGETVSPLQHIWSMSVQGQFYLAFLALIFVVGLPLRRVVRRHLRAILVV
LLSALTIASFVYAVIAHNDDQATAYYNSFARAWELLLGALAGALVPYIRW
PMWLRSIVATVALAAILSCGWFIDGVKEFPGPWALVPVGATIAFILSASN
RAPGGRLPAPNRLLATRPFVTLGSMAYSLYLWHWPLLIFWLSYSGRSRVD
FWQGAAVLAVSAVLAWLTMRYIEEPLRYRPPAPAVAAAPLRTRLRRPTIA
LGSVVALLGVALTATSFTWREHVTVQRANGAELAGLSQRDYPGATALLDR
VRVPKLPMRPSVLEAKKDLPASTIDGCISDFDNVGVINCTYGDKTAPRTI
ALAGGSHAEHWITALDLLGRMHHFKVVTYLKMGCPLTTEEMPLVMGDNRP
YPKCHEWNSRVMPKLLADKPDYVFTTSTRPWNIKDGDVMPSTYLGIWETL
SRNKIPILAMRDTPWLVRDGEPYIPADCLADGGDAVSCGIDRSKVLSDDN
PTLAYVSRFPMLKPLDMTDAVCREDYCRVVEGNVLVYHDAHHISTTYMRT
MTAELGRQIAAATGWW
108800043YP_640240.1 8-amino-7-oxononanoate synthase [Mycobacterium sp. MCS]MTRAGLSPLAWLDEVADQRRAAGLRRALRTRPAGGTAVDLASNDYLGLST
HPRVVEGAVRAVREWGAGSTGSRLVTGNTELHEGFERALAAFTGAESALV
FSSGYTANLGAVVALSGPGSLLVSDALTHASLVDACRLSRARVVVTPHRD
VTAIETALATRDEQRAIVVTDSVFSADGVLAPLRDMHDVCRRHGALLIVD
EAHGLGVRGTGGRGLLDEVGLAGAPDVVMTTTLSKALGSQGGVVLGPLAV
RDHLIDAARPFIFDTGLAPAAVGAAWAALEVLVDEPSRARAVLDNAAALA
QACDVPARPDSAVVSVILGEPEVALAAAIACLEQGLRVGCFRPPTVPAGT
SRLRLTARASLTDDDLDTARRVLADVLTAARR
108800041YP_640238.1 hypothetical protein Mmcs_3075 [Mycobacterium sp. MCS]MVHSVELLFDPDTDAAVRRIWDDLSAAGVRSQAANRSPSNRPHVTLTVAE
DMADGVDEALRPLLGMLPFDGLIGAPMLFGTRALVLVRLLVPSAHLLDLH
REVDRVCRPFVDGAPLPHTAAGQWTPHVTLARRVPPEQLPAAVAVPGLGR
DLRCRIVGLRHWDGNNRVEYPIT
108800039YP_640236.1 biotin synthase [Mycobacterium sp. MCS]MSDILAVAREQVLERGVGLNQDQTLQVLQLPDDRLDDLLALAHEVRMAWC
GPDVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDVPSLVEAAKQ
TAKTGATEFCIVAAVRGPDERLLAQVAAGIEAIRNEVDIQIACSLGMLTA
EQVERLSEMGVHRYNHNLETARSFFTNVVTTHTWEERWDTLRMVREAGME
VCCGGILGMGETLEQRAEFAANLAELDPHEVPLNFLNPRPGTPFGDLEVL
PAAEALKAVAAFRLALPRTMLRFAGGREITLGDLGAKKGILGGINAVIVG
NYLTTLGRPAEADLELLDDLQMPIKALNASL
108800037YP_640234.1 hypothetical protein Mmcs_3071 [Mycobacterium sp. MCS]MNDVAAPRISRRKAALTVVAGLVGAGAVTGALWSVLAPPVHGVVALTRAG
DRVRAYLGGEADHFFTSASLFVGLLSVVGVVAAVLLWQWRAHRGPVLVAA
LAAGGAAAATVAAGVGAALMHVRYGTIDVAGAPVTPERRVHYVVEAPAVF
FGHTPLQIACSLVFPAAVGALVYAMCAVATSRDDLGGWPPQEYQPVSGRT
ETVDGALPVGPQSPSH
108800035YP_640232.1 NUDIX hydrolase [Mycobacterium sp. MCS]MLAVVFQVRGVDPGEGHPALHVLLWQRALDPERGRWSLPGGRLGHDEDLT
TSVRRQLAEKVDLREVAHLEQLAVFSDPARVPGARTIASTFLGLVPSAAT
PALPSDTRWHPVSELPDMAFDHRPMVEHAHTRLAAKLSYTNIGFALTPTE
FAISTLRDIYGAALGYQVDATNLQRVLERRNVITRTGSTARSGRAGGRPP
ALYRFTESRYRVTDEFAALRPPG
108800033YP_640230.1 L-aspartate oxidase [Mycobacterium sp. MCS]MTGPGGRSAATGGKAVRRGCGGTTHWQQRADVVVIGTGVAGLVAGLAAHR
RGRRVIVLSKAPEQAGSTATGYAQGGIAVVLPGGRCDDADSVDAHVADTL
TAGGGLCDPEAVRSIVADGYRGVRDLVDDGARFDEATPGRWALTREGGHS
RRRIIHAGGDATGAEVQRALDHAARVLDIRHNHVAVRVLHDDAAVTGVLV
LSEDGPGIVHAPAVILATGGLGHLYAATTNPEASTGDGIALALWAGVPVS
DIEFVQFHPTMLFDGFTNGRRPLITEALRGEGARLVDAHGDPVTAGVHPL
GDLAPRDVVAGAIDARLKATGDPCVYLDARHLAGIAHRFPTVTAACRQAG
IDPARQPIPVVPGAHYSCGGVVTDVDGRTALPGLYAAGEVARTGMHGANR
LASNSLLEGLVVGARAGRGAAEHAAAAGPTRAVAPERLVGETLDRRELQA
AMSRDASVVRDAEGLMRLGDVLAKARARPLRSRADVEDAALTLTARAVSV
AALQRAESRGCHHRADHPDTDPVQAVSGAVDLDEHGHLRLKMRADACC
108800031YP_640228.1 methionine aminopeptidase [Mycobacterium sp. MCS]MLELKTPREIEAMRTTGAFIAGLLDDLQTRARVGVNLLDLEQRARQLIDE
RGAVSCYWDYAPSFGRGPFRNVICLSVNDAVLHGLPHDYTLRDGDLLSMD
IAVSIDGWVADSARSIIVGTPQAEDQRLIEATEQALVAGIDAARPGNRLG
DISAAIGSVAADYGYPVNTDFGGHGLGRTMHEDPHVPNRGRPGRGLVLRP
GLTLALEPWFARGTDRIVYDPDGWTIRSADGSRTAHSEHTIAVTDGDPLV
LTRRAA
108800029YP_640226.1 histidinol dehydrogenase [Mycobacterium sp. MCS]MNVSPVTMARIDLRGRTLSTAQLRSALPRGGVDVDAVVPKVRPIVEAVAE
RGAEAALEYGEAFDGVRPASVRVPAERLASALAELDPDVRAALQVAIDRA
RAVHADQRRTDTTTTLAPGATVTERWVPLERVGLYVPGGNAVYPSSVVMN
VVPAQTAGVDSLVIASPPQADHGGLPHPTILAAAALLGVDEVWAVGGAQA
VALLAYGGTDIDGTGASGAPGDGTGASGAPGDGTGASGAPGDGTELAPVD
MITGPGNIYVTAAKRICRSQVGIDAEAGPTEIAVLADHTADPVHVAADLI
SQAEHDEMAASVLVTTSPDLADAIDRELRRQLETTVHRERVSTALTGEQS
AIVLVDDLDAGVRVVNAYAAEHLEIQTVDAAEVAGRIRSAGAIFVGPYAP
VSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVDYTEAALKDVSG
YVITLAQAENLPAHGEAVRRRFES
108800027YP_640224.1 imidazoleglycerol-phosphate dehydratase [Mycobacterium sp. MCS]MTDMLTGTRRARVERKTKESDIVVDLDLDGTGIVDIRTGVPFFDHMLTSL
GSHASFDLTVHATGDIEIEGHHTVEDTAIVLGQALGQALGDKKGIRRFGD
AFIPMDETLAHAAVDVSGRPYFVHTGEPDYMVEFTIAGSSAPYHTVINRH
VFESLAFNARIALHVRTIYGRDPHHITEAQYKAVARALRQAVELDPRVTG
VPSTKGSL
108800025YP_640222.1 phosphoribosyl isomerase A [Mycobacterium sp. MCS]MSVVPEKSVSEKRPLILLPAVDVVEGRAVRLVQGKAGSETEYGSALDAAL
GWQRDGAEWIHLVDLDAAFGRGSNRELLADVVGRLDVAVELSGGIRDDES
LEAALATGCARVNIGTAALENPQWCAKVVAEFGDKVAVGLDVKIVDDQHR
LRGRGWETDGGDLWEVLDRLDSEGCSRYVVTDVTKDGTLQGPNLDLLGRV
ADRTDAPVIASGGVSSLDDLRAIATLTDRGVEGAIVGKALYAGRFTLPEA
LAAMGQ
108800023YP_640220.1 imidazole glycerol phosphate synthase subunit HisF [Mycobacterium sp. MAADRGLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAVYDAEGAD
ELTFLDVTASSSGRSTMLDVVRRTAEQVFIPLTVGGGVRAVADVDALLRA
GADKVSVNTAAIARPELLAELARQFGSQCIVLSVDARTVPQGEQPTPSGW
EVTTHGGRRGTGIDAVEWATRGAELGVGEILLNSMDFDGTKAGFDLPMLR
AVRGAVTVPVIASGGAGAVEHFAPAVHAGADAVLAASVFHFKELTIGQVK
AAMAAEGITVR
108800021YP_640218.1 alpha/beta hydrolase fold-3 [Mycobacterium sp. MCS]MKRSAAAVIGGATAAVAAGRYLLAREALSAVARDLRSPVLPYVAAPSSRR
SMLVTRAFTRLPTPAGDGVTVTESRVGETAVRVVITAPAGGGTSRPAVMW
IHSGGFVVGSPQLERFITGQIARELGATVVSPDYRLAPEHAVPAALDDCM
ATLRWMRTNADRLGIDADRIVVGGASAGGGLAATVAQRSLDEGCPLRGQA
LAYPMLDDRSVLRADHGGRGRFVWTPASNRFGWTAYLGHPPDTSEAPAYA
AAARRSELSGLAPAWIGVGQLDLLHDDCVSYAERLESSGVPCELITVPGM
YHAADAIAARALSMQTFCASMLNFMRARLS
108800019YP_640216.1 anthranilate synthase component I [Mycobacterium sp. MCS]MQTTAASAFDSSRERSSLATTTSREDFRALAAEHRVVPVVRKVLADSETP
LSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPSALTVRDGEAVWL
GVTPKDAPSGGDPLQALRSTLALLETAPLPGLPPLSSGLVGFFAYDMVRQ
LERLPSLAVDDLGLPDMLLLLATDIAAVDHHEGTITLIANAVNWNGTDEN
VDGAYDDAVARLDVMTKALGQSLPSSVATFARPAPTHRAQRTVEEYTAIV
EKLVGDIEAGEAFQVVPSQRFEMDTVADPLDVYRMLRVTNPSPYMYLLNV
PDETGGLDFSVVGSSPEALVTVADGKATTHPIAGTRWRGDTEEEDLLLEK
ELLADEKERAEHLMLVDLGRNDLGRVCEPGTVRVEDYSHIERYSHVMHLV
STVTGRLAEGMTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYG
GVLGYLDFAGNADFAIAIRTALMRDGVAYVQAGGGVVADSNGPYEFNEAT
NKAKAVLAAVAAAETLREP
108800017YP_640214.1 indole-3-glycerol-phosphate synthase [Mycobacterium sp. MCS]MSSATVLDSIIEGVRADVAAREAVVSLTEIKERAQRAKPPLDVMAALREP
GIGVIAEVKRASPSRGALAQIGDPADLARAYQDGGARVISVLTEQRRFNG
SLDDLDAVRAAVSIPVLRKDFIVRPYQIHEARAHGADMLLLIVAALEQPV
LESLLERTESLGMTALVEVHTEAEADRALQAGARVIGVNARNLKTLEVDR
DCFARIAPGLPSNVIRIAESGVRGPADLLAYAGAGADAVLVGEGLVTSRD
PRSAVADLVTAGTHPSCPKPSR
108800015YP_640212.1 tryptophan synthase subunit alpha [Mycobacterium sp. MCS]MSRLGGLFDACRAERRAALIGYLPTGFPDVPASISAMTALVESGCDIIEV
GIPYSDPGMDGPVIAAATEAALQGGVRVRDTLTAVEAISNAGGRAVVMTY
WNPVLRWGIDAFARDLAAAGGLGLITPDLIPEEADEWMAASDAHDLDRIF
LVAPASTPERLAKTVQATRGFVYAASTMGVTGARDAVSSAAPELVARVKE
VSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKDGVPAVRALTE
ELAEGVRQRVTA
108800013YP_640210.1 hypothetical protein Mmcs_3047 [Mycobacterium sp. MCS]MFEGSQTAARSLVDRIAGSSRAANQATARMLVAVGDLYRLRLREVGDSAY
AACDTVDSVSAEVAAALTISTGLAASHLRHALAMEERLPQVGAAFVAGDL
DYFMFQTIVSRTKLVIDPEALRSVDGQVAAGVARWRGLTQKQLAARVDRI
VNRVDPDAVRRRKEAAARREVSVADRIDGLSEICATVFTTTAHAFDRRLS
ALAATVCANDPRTTEQRRADAIDAMVAGADRMACRCDSPDCAAGGLSASP
TVIHMVADRSTLDGVGDREGSLIGADGLIPAEVVAELAHTAKLRPLILPG
DAAPEPHYTPSRALAEYVRCRDLTCRFPGCDRPAMRTDVDHTVPYAGGGP
TQAANLKCLCRLHHLLKTFGGWKDQQLPDGTVIWTSPSGHTYITTPGSAL
LFPGLCAPTTPAAAAPTTGTVTGDRNAKMPQRRRTRAQNRAAAIAAERAH
NRAMRQVRRQELHAYLFGNEPDPSDEPPPF
108800011YP_640208.1 hypothetical protein Mmcs_3045 [Mycobacterium sp. MCS]MEPDAPAPSRTPVYLTLGAGALFAGALTYIGVADPHRPGFLAPLCPFKAL
TGWACPACGGLRMTHDLLHGDLAAAVADNVFLLVGIPLLALWVFFRRRHH
QAVLPVTAIVVIAVATITWTVVRNLPGFPLVPTLLDG
108800009YP_640206.1 glutamate synthase (NADH) small subunit [Mycobacterium sp. MCS]MADPTGFLKVPKVEAAKRPVDERVGDWHEVYERQSLPERAEEVSQQARRC
MDCGIPFCHSGSAGCPLGNLIPEWNDLVRRGRWDAASERLHATNNFPEFT
GRLCPAPCEAACVLSISEDHTGGSVTIKRIENTIADQAWALGLVDPQPAS
IRTGRRVAVVGSGPAGLAAAQQLTRAGHDVTVFERDDRIGGLMRYGIPEY
KLEKRTLDQRLAQMRAEGTRFVTECEVGVDLTVEQLRERHDAVVLAVGAL
RARDNDVEGRHLDGVHLAMEHLVPANKECGGDGPSTLSARDKHVVIIGGG
DTGADCLGTAHRQGAASVTQLDYNPEPPETRDDTRTPWPMWPLVLRTRLS
PAHAEGGQRRYQVAVQRFLGDEQGRVRGMEIAEVKVERDAEGRRQIVPVG
ETLEIPCDMALLAIGFEGVEHMPLLDGLGLSLNNRGALPCGSDWQTDAPG
VFVCGDAHRGASLIVWAIAEGRSAAHAVDAYLMGESDLPAPVRPGALPLA
VV
108800007YP_640204.1 acyl-CoA thioesterase [Mycobacterium sp. MCS]MSAADFDELLALLDLRRVDDDTFAGSHPSKNPVRTFGGQMMAQAFVAASR
AVDHRISPSALSVHFVAGGDPARELEFRVTRLRDERRFANRRVDVCQGQD
LLATAMVSYMNGGRGLEHGVAAPDVPGPEELPKIGELLRGYEETVPHFVN
ALRPIEWRYTNDPAWVMRDKGQRLDHNRVWLKTEGAMPDDPVLHTAALVY
SSDTTVLDSIITTHGLSWGFDRIFAATMNHSVWFHRPVRFDEWVLYSTSS
PVAAESRGLGTGHFFDRSGALLATVASDAVVKYFPGR
108800005YP_640202.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSTTDPLLRLTLDLLRPRLGRLLLAIGLGVLSLGSALALAAVAAWLITRA
WQMPPVLDLSVAAVAVRALGISRGLLGYCQRLAAHDTALRAAGNARTGLY
RTLAEAPQEVAMRLPGGQLVARIGASVDDLADVLVRAVLPIAVAAVLSVA
AVAVLAVISPASAVLLAACLIVAGVVAPALSARAVTAAESAAVTHHADRD
VAAMLALDHAAELRVSGRLDGVVAEAQRRQRDWGDASDRAAAPAALAAAV
PGAAMGVSVLGAAVAGIALAGSVAPTTVAILMLLPLSAFEATTALPAAAV
QLTRSRIAARRLLDLTEPAATDRRRPVVAPVPLRAGDRVAVTGPSGSGKT
TLLMAMAENADATDDFTGARGFFAEDAHLFSTTVRDNLLVARGDATDDEL
RSALTKVGLRRWLDGLPDGLSTVLVGGAAAVSAGQRRRLLLARALISPFP
VVLLDEPTEHLDADDAARLLTELLTPGSLFPADRTVVVATHQLPGDDVAC
LRLNLAASR
108800003YP_640200.1 cytochrome d ubiquinol oxidase subunit II [Mycobacterium sp. MCS]MGLQELWFILIAALFLGFLVLEGFDFGVGMLMAPMGIVGEGTPETRRRAV
LNTIGPVWDANEVWLITAGASMFAAFPVWYATVFSALYLPLLAILFGMIL
RIVGIEWRGKIDDPTWRRRADWGIALGSWLPAILWGVAFAVLVRGLPVDA
EQQVVGLTFGDVVNAYTLLGGLATCSLFLFYGSTFLALKTSGPVRDDAFR
FVRILSAPVIVLAGGFGLWTQLAYGKPWTWAALAAAVVALLVAVALMWTG
GREGWAFVSTVVVVAAVATLIFGTLYPYLLNSTLNPEWGVTIFNGSSTPY
TLKIMSWASLTLLPLVLIYQGWTYWVFRQRISADRIPESVGLSKQAP
108800001YP_640198.1 hypothetical protein Mmcs_3035 [Mycobacterium sp. MCS]MQTTAAPSMLRHLWIYTVVSGLLAVLLGVLIFVRPGAAILVTAIFFGAYL
LVTGVAQLVLAFSVRSSLGGRVLLFIGGAAALVLAVLCFLNLSESIDLLA
IWIGVGFIFRGVATAMSAFSDHSLPGRIWEIILGVISVLAGIIMFVAPLE
GLVALTQVTGIILVVIGIVEVIAGIRIRREAPATGARTSDPVT
108799999YP_640196.1 amino acid ABC transporter permease [Mycobacterium sp. MCS]MTDADSSPRTDAAPIDAVPLRHPWRWVAAVVIVVLVGLFLYGAATNEAYS
WSTYRKYLFDQRISEAAWNTLQLTILSMVLALVLGVLLAVMRLSPNPVFK
SVAWVYLWIFRGTPVYVQLVFWGLFPTLYQNIRIGIPFGPSFFEMNLQGL
SISFTLAIIGLGLNEAAYMAEIIRAGISSVPEGQSEASTALGMSWTMTMR
RTVLPQAMRVIIPPTGNEIISMLKTTSLVTAVPYSMELYGRARDIAGVIF
QPIPLLMVAATWYLAITSVLMVGQYYLERYFSRGASRKLTTKQLEALAKA
QRVGEHP
108799997YP_640194.1 putative signal transduction histidine kinase [Mycobacterium sp. MCS]MPQRADPATPLWRAAQVFRLLSWVYALGFQLSVNDDLDRRAVAWALFAVL
TVFSVVWAVAYLRGFGRTPVWVAAEVGVVAALMLSTGLVADAQWVADNQS
WPTTLWATNAVISAAILRGPVAGMATGLVVMAAYAVLKGHVSINVFRNAT
IVIELAVGLVVGMAAQTARRAHAELERATRLAAALEERERLSRHVHDGAI
QVLALVARRGREIGGPTAQLAELAGEQERALRRLVSDADTADALGADADI
GAMLRRRASDRVSVSLPPEPVLLDADVAAELCAAAVNALDNVAAHAGPKA
RAFVLVEDLGDAVTVSVRDDGVGIPPGRLAEAAAEGRMGVAKSIVGRIDS
LGGTAELYTEPGRGTEWELTVPRRRQDGGRG
108799995YP_640192.1 hypothetical protein Mmcs_3029 [Mycobacterium sp. MCS]MTESPHAVIARLSADFAAISRQLARVSSDLTELDRLLAGRSPAPQPAPQP
APQPAPQPFYLPPPPPPPRPVVPPPPPPAPRVPRERSEGWIGKVLAVAGV
AVTLIGVVLLLVLAAQAGILRPEIRVGAGALLAAALVAVGCRINSRDGGR
VGGIALAATGIAAAYFDVLAVTTIYEWIAAPVGLVLAAAVGGGGLTLARR
WDSEHLGLLVLVPLIALAPVLTEGVALLLVSFMLALSAATLPVQLGKDWL
WLHAARTAAVTLPLLAALAGAAFDGDHDLLLAGACGVAALLSLAGALLVL
PQTTRRAAMALLTAAGVAPVLCVSATADRVVASLMIAALAAALLAIVLSG
QWLPAVSGAVRQIWSALSAVSALIAVTVAFDGEVAAPLLLAMAAVVAVAG
RHDDVARWSALGFAVFGGGLYIAYAPPSMLVRAVAISGPDAVGVLVSSLL
SIAAAAAIARSWSGGTGLGDDTVRALWAGAAAVATYAVTVFSVTAGVMIG
GIGGGFFGGHVAATVCWIGAAAALFGYAARRPKAERTPFLGAGLALVSAA
MAKLFLFDLGTLDGIFRVTVFLVAGLILLGIGAGYARLLAVQDRRPV
108799993YP_640190.1 hypothetical protein Mmcs_3027 [Mycobacterium sp. MCS]MTVTRDIAAPRQRVWDVIADGWTYSQWVVGNSRMRAVDPDWPASGSTIHH
SIGVWPVLLNDETVVEEATEPERLVLHAKGRPFGGARIILELSDIPDGCR
ISMQEFPVSGIGKLMPERISDAAVWPRNNETLRRLAFLAERRDDRDAG
108799991YP_640188.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MAVRDASRAVCVPDVALQSRMPARTRHYAEAVVRRLRVLTIATWIASAVS
ALFGLFQLVLGGSGWWIGLFNIVCATLFLGIPLLYRLGELIAPLTFFVLA
YLSVTFICYSIGTDSGLQFYYLVSASLVVLVLGIERIVMSALIVTVGLSA
CVAMELTVPQDRGLGPPWVLTVGFILSAVSATLMVFATVWYALRETDRAE
RAMEDEYQRSETLLSNILPASVAERLKDPAHDIIADRYDDASILFADIAG
YTKRASDTSPTDLVRFLDRLFTDLDALVDRHGLEKVKTSGDSYMVVSGVP
RPRADHVEALACLALDMAEAVADLKDPLGRAVPVRIGLASGPVVAGVVGA
RKFFYDVWGDAVNVAARMETTDEEGRIQVPHNVYERIKHSFVLEERGDVD
VKGKGLIHTWYLVGRRNDTAVRRAVELPTNGRAATSPAD
108799989YP_640186.1 hypothetical protein Mmcs_3023 [Mycobacterium sp. MCS]MSVRLPARLRAINMRIPAGVGSPGSRGAGQIASKGIKMRKSARGVAASLP
LAVAAAAAWGLATAAPAVADPGDSADTSPAIADSTALPLMRAVDPVITRV
DGIWAEFVPPNANVPSPVAAFDQFVEPIIPTTAQIGDLGRFVEQFRPTAM
ITLPAG
108799987YP_640184.1 response regulator receiver/ANTAR domain-containing protein [MycobacteMTSMTGSPTDAPTPRRVLIAEDEALIRMDLAEMLRDEGYEIVGEAGDGQE
AVELAEQLRPDLVIMDVKMPRRDGIDAASEIASKRIAPIVILTAFSQRDL
VERARDAGAMAYLVKPFNVNDLIPAIEVAVSRFSEIHALEQEVATLSDRL
ETRKLVERAKGLLQANQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETL
DTPKSEPSAG
108799985YP_640182.1 inner-membrane translocator [Mycobacterium sp. MCS]MIAECVDQYGCLAANISFNLEGLRNGFWQLTIDGLSWGAIYALVAVGYTL
VFGVLRLINFAHSEIFMLGMFGAYFCLDFILGFTPSGNAYNKGIALTVLY
LVIAMLFAMLVSGSAAVGLEAVAYRPLRRRGARPLTFLITAIGMSFVLQE
FVHFILPKIIKGYGGSNAQQPITLVQPKTQFEIFGASVSNITLVIIGAAL
LFALLTDIAINRTKFGRGIRAVAQDPNTATLMGVSRERVIMLTFMIGGLL
AGAAALLYTLKVPQGIIYSGGFLLGIKAFSAAVLGGIGNLRGALLGGLIL
GVMENYGQAVFGTQWRDVVAFVLLVLVLLFRPTGILGESLGKARV
108799983YP_640180.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTIEDLAGVHREIVAAEGETLLQTHDLTVKFGGLTALDSVTFGIRRGEIL
GLIGPNGAGKTTCFNAITGVYRPSSGSVTFDGKPLGRIKRHQITRRGIAR
TFQNIRLFGEMTALENVMVGTDARHLTSVPGALVRTPRHRREEKSAIERS
AALLHFVGIAHRGEEKAKNLPYGDQRRLEIARALATEPKLLCLDEPAAGF
NPAEKAALIDLIRKIRDDGYTVLLIEHDMRLVMGVTDRIVVLEFGRKIAD
GLPAEIREDPKVIAAYLGVPDDEID
108799981YP_640178.1 lipid-transfer protein [Mycobacterium sp. MCS]MSPEPVYILGAGMHPWGKWGRDFTEYGVVAARAALAEAGLDWRQIQLVAG
ADTIRNGYPGFVAGSTFAQKLGWNGVPVTSSYAACASGSQALQSARAQIL
AGFCDVALVIGADTTPKGFFAPVGGERKNDPDWQRFHLIGATNTVYFAML
ARRRMDLYGATLEDFAQVKVKNARHGMDNPNARYRKESSVEDVLASPVVS
DPLRLLDICATSDGAAALIVASRSFAEKHLGSVEGVPSVRAVSLQTPQYP
QHLPELPDIATDSTAVVPAPERVFKDQILDAAYAEAGIGPEDLSVAEVYD
LSTALELDWYEHLGLCPKGEAEALLRSGATTIGGRIPVNPSGGLACFGEA
IPAQAIAQVCELTWQLKGQATGRQVEGAKVGVTANQGLFGHGSSVVVAR
108799979YP_640176.1 hypothetical protein Mmcs_3013 [Mycobacterium sp. MCS]MATFVLIPGACHGAWCFDALVGALRNRGHRADAHTLTGVAERAHLAHAGV
NLDTHITDMCEAVAAMTDDDLVLVGHSYGGMVITAVADRIPDRVDALVYL
DALVPRDGESCWDLVNDAERQWYLGVDDTGYGVPPLPFFDDRASSHPLAS
LLQPIRLAGGAAGVRRRDYAYALDWPGESPLRRSYERVRDDPAWTVHELD
GKHNLMRDNADDLLRILLAAAAH
108799977YP_640174.1 DNA polymerase I [Mycobacterium sp. MCS]MSAGVHRVEPVSPASTSTDKKTATSQKADDKPTLMLLDGNSLAYRAFYAL
PAENFKTQGGLTTNAVYGFTAMLINLLRDEQPSHVAAAFDVSRQTFRVDK
YPEYKAGRSSTPDEFRGQIDIAKEVLVALGIAVLAEPGFEADDIIATLAT
QAEGEGYRVLVVTGDRDALQLVSDDVTVLYPRKGVSDLTRFTPDAVQEKY
GLTPQQYPDFAALRGDPSDNLPGIPGVGEKTATKWIAEYGSLQALVDNVD
QVKGKVGDALRANLSHVVLNRELTDLVKDVPLPHTPDTLRVQPWDRDQLH
RLFDDLEFRVLRDRLFETLAAVEPEVEHGFDVRGKALERGELAAWLSEHS
LGNRFGLAVVGTHLAYDADATALAIVAADGDGRYIDTTSLDPDDEAALAS
WLADPGPPKALHEAKLAMHDLAGRGWKLAGVTSDTALAAYLVRPGQRSFS
LDDLSLRYLRRELRADNPAQQQLSLLDDSDGGDDQAVQTLILRAVAVLDL
ADALDEELARIDSSSLLGRMELPVQRVLAEMEHTGIAVDIDQLRQLQSEF
ADLIRDAAEAAYAVIGKQINLGSPKQLQAVLFDELEMPKTKRTKTGYTTD
ADALQSLFDKTGHPFLQHLLAHRDATRLKVTVDGLLNSVASDGRIHTTFN
QTIAATGRLSSTEPNLQNIPIRTEAGRRIRDAFVVGDGYTEVMTADYSQI
EMRIMAHLSQDAGLIEAFNTGEDLHSFVASRAFDVPIDEVTPDLRRRVKA
MSYGLAYGLSAYGLAAQLKISTEEAKVQMDQYFARFGGIRDYLRDVVDQA
RKDGYTSTVFGRRRYLPELDSSNRNVREAAERAALNAPIQGSAADIIKVA
MIDVDQAIKDAGLSSRMLLQVHDELLFEVADGERDTLEKLVRDKMGSAYA
LDVPLEVSVGYGRSWDAAAH
108799975YP_640172.1 hypothetical protein Mmcs_3009 [Mycobacterium sp. MCS]MSRVGTPPPSHLPVSPWARQVRKVGAPLGLLIALGTLAGLLVILLTAVNP
VGTAVGFVLSSIAMAVVVLAYLWLDRWEPEPPRLLVFAFIWGTSAAVVIS
AVLQLFLEVWLNPAVGTADTGTSPVTLVLGAPLTEEAAKGLFLLIMMTGA
RRNEMNSLTDCLVYAGLVGAGFAWLEDILYIANGESLADSLLTAALRLIM
APFAHSLFTTVFAIGVWFALHRRDTAARAGFLLLGYAGAVLLHAMWNGSS
LLGVGAYFGLYVFWMMPIFGLAIVLAVRSRRREQHIVAAKLPGMVAAGVL
TPAEAAWLGSLRTRNLAIAEARRFGGKQAGDAVKKFAHQVVELAFVRDRI
DRGFGDPRVIGLLHEETYALYAARAASPALHGLGEYRAPRPL
108799973YP_640170.1 NmrA-like protein [Mycobacterium sp. MCS]MSGAVLVLGATGNTGGAVVDALRRFPGRPVRTATRKSNAPTGHDHRRFDW
ADPATWDDVLDGVERMYLVAPIGHPAPITVVAPFLHRAVEAGVRRVVTLS
SSAVALGDPGLGAVAAAVRDMFPEWEVLRPSWFMQNFTGAHPVAESIRGT
GEFMTATGTGRLPFIDARDIGRTAAHLLSATDARCGEHLLTGPEALTYDE
AAAIMSEVTGRTVRHRAVEPDDFADYLVASGYDATFAAVLAALDVLVRDG
TQSAVSDTVERLTGARPRGFAAYLRATVSE
108799971YP_640168.1 30S ribosomal protein S1 [Mycobacterium sp. MCS]MPSPVATSPQVAVNDIGSAEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNQLQKGAIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVTVGDEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELSERHVEVPDQVVQVGDDAMVKVID
IDLERRRISLSLKQANEDYTEEFDPSKYGMADSYDEQGNYIFPEGFDSET
NEWLEGFEKQREEWESRYAEAERRHKMHTAQMEKFAAAEAEEAARPVSNG
SSRSEESTGGTLASDAQLAALREKLAGNA
108799969YP_640166.1 hypothetical protein Mmcs_3003 [Mycobacterium sp. MCS]MNSVMRGLTAGAVVMTVVGGYQLSPAVALAEPDVQPQPAAQESPQVLRNI
VYRTRIDGVSRGATITYSAEGDQTQTANPTMVPGRVFEVNTVLPESDVAM
MKVSVQWPYSANLHCEILIDDQIVAQADDFVAPRFLPQDPDYAALTCEAP
VATPAAAPAQPPVPADPAAPPADAVPAPPGV
108799967YP_640164.1 excinuclease ABC subunit B [Mycobacterium sp. MCS]MAFATEHPVLAHSEYRPVEAMVRTGNRFEVVSPYQPAGDQPAAIDELERR
IRAGERDVVLLGATGTGKSATTAWLIERLQRPTLLMAPNKTLAAQLANEL
REMLPHNAVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSAT
SSLLSRRDVVVVASVSCIYGLGTPQSYMDRSVELKVGDEVPRDALLRLLV
DVQYARNDMAFTRGTFRVRGDTVEIIPSYEELAVRIEYFGDEVEALYYMH
PLTGDVVRRVDSLRVFPATHYVAGPERMAQAISSIEKELEDRLAELEGQG
KLLEAQRLRMRTNYDIEMMRQVGFCSGIENYSRHIDGRGPGTAPATLIDY
FPEDFLLVIDESHVTVPQIGGMYEGDMSRKRNLVDFGFRLPSAVDNRPLT
WEEFASRIGQTVYLSATPGPYEMSQSGGEFVEQVIRPTGLVDPQVIVKPT
KGQIDDLIGEIRKRTELDERVLVTTLTKKMAEDLTDYLLELGIRVRYLHS
EVDTLRRVELLRQLRLGEYDVLVGINLLREGLDLPEVSLVAILDADKEGF
LRSTRSLIQTIGRAARNVSGEVHMYADKITDSMREAIDETERRRAKQIAY
NEERGIDPKPLRKKIADILDQVYREADDSETVEVGGSGRNASRGRRAQGE
PGRAVSAGIVEGRDTANMPRAELADLIKDLTEQMMTAARDLQFELAARIR
DEIQDLKKELRGMDAAGLK
108799965YP_640162.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MYVNKVWQNVCMPKTLPVVDISAPVCCSPVAAGPIGDEAALEIALRLKAL
ADPVRVKLVSLLFSSADGEECSRDLAMAVDLAESTVSHHLSQLRRAGLIQ
SERRGMNVYHRPRRESLLALCAVLDPNCCR
108799963YP_640160.1 hypothetical protein Mmcs_2997 [Mycobacterium sp. MCS]MIGPDEWGCPLSLWLVSHLPSWLLLLVLITVTSGTAVAVQAIVRRRFATH
LRSDEHNDVTKFAFGVIGFVFAFFIGFVVSATWGQINSADGRARAEGAAG
AQLARDLQVFDEPDRDRIRQSLLAYHQAAITEWNEATEGRSLPAADDALN
RVYLAYEQVEARTDAQKALLSASFSNLSDMNKARSERVLQARTDTGPPWS
LWAVILLTSSLLLGCAIIYGVESAASHYTMVAILGVLVGAQLFLVLELSH
PFVGEVATSSEPLKQVVRVLQSNPG
108799961YP_640158.1 sensor signal transduction histidine kinase [Mycobacterium sp. MCS]MRVDERLRRVMPMPIVSLRTIVIVAALSVVVLVLTLGTWVWIGVTNEQYS
QLDRQLDSVTSLGDFGTLLNAASTGDDPADPPVDRTLVRTARIGGVTVSV
PKDIVLPQLDIGYANTTIDGVEYRVRTFAAGPATIALGSPLSETQRRIDQ
LHLRVVLICGGVIAGTVVVGWVMWLIMINPFRLLAQQARAINAQSKPEEV
QVGGVWEAAEIAEAVEGMLARIGEEQQRTKAALESARDFAAVASHELRTP
LTAMRTNLEVLSTLDMTDEQRKEVINDVVRTQTRIEATLTALERLAQGEL
TTAEDHVPVDITELLDRAAHDALRSYPGLDVSLVPSAPVRILGLPAGLRL
VIDNAIANAVKHGDATQIRLSAIRSGEDVEIAVDDNGSGVPEQERKLVFE
RFSRGSTASRSGSGLGLALVAQQAELHGGTASLETSPMGGARLLLRLPAT
R
108799959YP_640156.1 phage SPO1 DNA polymerase-like protein [Mycobacterium sp. MCS]MPTKVPGAEDFVPDTRDVSILADAVQACRGCELYRDATQGVFGQGSANAT
VMFVGEQPGDQEDRAGEPFVGPAGRLLDKALVSAGIDRDGVYVTNAVKHF
KFTLPERGKRRIHKTPSRTEVVACRPWLLAELDAVRPEVVVLLGATAAKA
LLGNDFRLTAHRGEVLALPPVTEPADLHVDPAVVVTAHPSSVLRGPAENR
QQAFDALVEDLRVVARLMRGDRRQRRSRPK
108799957YP_640154.1 linalool 8-monooxygenase [Mycobacterium sp. MCS]MTTTLHPTGIAPRENGTPPPHVPLGDIDLGTLDFWEWDDDRRDGAFATLR
KESPITFFEVPEYAGFAGGRGHWALTRYDGVHHASRHPEVFSSIPTSTAL
NDVPVEIAEYVGSMISLDDPRHLRLRSIVNRAFTPKMLTRIEQSVRDRAR
RLVTGLVADHPDGHADFVQAVAGPFPLQIICDMMGIPEEDEEKVFHWTSI
ILGGADEEVAPDHETIVGAVLGLGEYGLALAEDRRAHPTDDLTTNLVRAE
VDGERLTSAEIGSFFILLSAAGNETTRNAISHGLVALSRYPEQRQRWWDD
FDTVAPTAVEEIVRWASPIIFMRRNLTEDIEMRGVRMKAGDKVSMWYNSA
NRDERRFDNPWLFDVTRDPNPQIGFGAGGAHFCLGANLARREIRVLYSEL
RRQVPDIVAVEEPAILRSAFVHGIKRLPVAWTG
108799955YP_640152.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MTVVDDNYTGHVEPRTAARRTLPGATIVKVSVGPMDNNAYLVTCSRTGET
LLIDAANDADVLLDLVRELAPTVTLILTSHQHFDHWQALEALVEATGAPT
AAHELDAEPLPVTPDRYLAGGDTLGIGELTFDVIHLRGHTPGSIALALHG
PAAGDAVHLFTGDCLFPGGVGKTWQEGDFEKLLTDVTTRVFDVYPDSTVV
YPGHGDDTTLGAERPHLGEWRDRGW
108799953YP_640150.1 FAD dependent oxidoreductase [Mycobacterium sp. MCS]MKIAIIGSGFSGLGAAIRLQEAGHRDFVVLERGPDVGGTWRDNTYPGAAC
DVPSHLYSYSFALNPDWTRSFSTQPEIEDYLRKVAQRYDVLDRHRFGCTV
SRAAWNPTQSQWELSTDSGPVTADVLITAFGSLAEPSLPGIPGIESFTAA
GGEMFHSARWNHDADLTGKRVAVIGTGASAIQIVPEIADRVAHLDVYQRT
APWLLPRFDRPFTRAEKWAFRNVPGFLRLARAGIYTSREVQVVGLAKNPN
LMKGFELLSRAKIRTEIKDPELRRKVTPNFRIGCKRMLISNDWYPTLDRG
HVDLITDGIHEIDGNRIIATDGTAREVDALVVATGFHVTDSPMFDTVCGA
DGASLTQRFADKGMRAYKGTTIAGYPNMFVLVGPNTGLGHSSMVYMIESQ
LNYVVDAVSTMREEGLRTVEVKQDALDAYNERLQQALSGSVWMTGKCASW
YLDAHGNNTTLWPDFTFRFRNQTRRFDLDAYEVTRAEESVLTR
108799951YP_640148.1 hypothetical protein Mmcs_2985 [Mycobacterium sp. MCS]MPTFESVREKIEGRYGSAIGAAELAAETPEGRTADEQYEERQRAAAERLA
QIRAQMHEKD
108799949YP_640146.1 lysyl-tRNA synthetase [Mycobacterium sp. MCS]MTLTSPPRTRADSRYSWVPAAAGWTVGVIATLSLIASVSPLVRWIIRVPR
EFVDDYIFNFPDTSFAWAFVLALLAGALAARKRIAWWILLLYMVAAAGWN
VADLLTGDESVVDEMGEVIGLAFHLAAVAFLLLARPLFWARVRRGALFKA
AGVLAAGMAVGVLVGWGLLELFPGDLERDYRLAYAANRVFAFAGVDPDAF
DGQHPHVVVNALLGLFGALALMAAAIVLFQSQRSENALTGEDESAIRGLL
ELYGKNDSLGYFATRRDKSVVFAPNGRAAITYRVEVGVCLASGDPVGDPK
AWPQAIDAWLALCGTYGWAPGVMGASVGGAEAFRAAGLSAIQLGDEAILL
PDSFRLSGPDMRAVRQAVTRARRAGVTVRIRRHRELSPEQMAEVIAHADA
WRDTETERGFSMALGRLGDPADSDCLLVEAVQGGNGGQERSDPGDGTVVA
MLSLVPWGSNGASLDVMRRSPQSPNGTIELMVSELCMQAEDIGVTRISLN
FAMFRSAFEQGAQLGAGPVARLWRWLLVFFSRWWQLETLYRSNMKYQPQW
VPRYACYEDARLIPRVGVASVIAEGFLVLPFSRRNKQHTGHHTSAPQDLV
ASGVLHHDGTAPDMSGLRTDTADDEPPRLPEQVRVRMAKLKALQADGVDA
YPVGRPPSHTAAAAVDSPDDVELDVAGRVLRIRDYGGVLFAQLRDWSGEV
QLLLDNSTLEQGSTADFTAAIDLGDLIAATGTMGYSKNGTRSLLVRHWRL
TGKCLRPLPDKWKGLTDQEARVRARYVDLAVNTEARDLIRARSGVLHAIR
DTLYHKGFLEVETPILQQIHGGANARPFLTHINAYDLDLYLRIAPELYLK
RLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYHVWIDGCR
ELIQNAAMAANGEHVFLRPRDDGVLEPVDISGPWTVKTVHEAVSEALGEH
IDAATELPTLRKLADAAGIPYLTHWDEGAVVLEMYEHLVEDRTQKPTFYK
DFPTSVSPLTRPHRSIAGVAERWDLVAWGVELGTAYSELTDPVEQRRRLQ
AQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGVDRVVMLITGRSI
RETLPFPLARPR
108799947YP_640144.1 translation initiation factor 3 [Mycobacterium sp. MCS]MLLARAAEAVIGRQRALQCRAFLLSRAGAEWASGLPGEHNIGGPISTETR
VNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPDAKPPV
CKIMDYGKFKYETAQKARESRKNQQQTVVKEQKLRPKIDPHDYETKKGHV
IRFLEAGSKVKVTIMFRGREQSRPELGFRLLQRLGADVAEYGFVETSAKQ
DGRNMTMVLAPHRGAKTRAKAAEQAERPRESAPGPDAT
108799945YP_640142.1 50S ribosomal protein L20 [Mycobacterium sp. MCS]MARVKRAVNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAEIAV
SDAAAFTALVEVAKAALPEDVNAPSGEAA
108799943YP_640140.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MLEWSDVDLAVRDAVREFVDKEIRPHVDALESGEMEPYPVIRKLFSTFGI
DAMAKESLEKRLARLREGGSSSGGRSSGGMVGGDGGSGMGFVVVSELCRV
CMGVVTGMGVSLGLTVPTIMGRGTLAQQERWLPGLVTYEKVGAWAITEPD
SGSDAFGGMKSYVVRDGDDYILNGQKTFITNGPDADVVVVYAKLDEGDGV
DKRDRKVLTFVLDRGMEGFVQSKPFRKMGIHSSRTGELFFNNVRLGRDRL
LGETEDNEAGDGRESARSSFSAERIGVAAMALGVIEECLKLSVDYAKSRT
LWGKEIGQFQLIQLKLASMEVARMNVRNMLFRVIEASQTGTPISLAEASA
IKWYCSQAATDVAMEAVQLFGGNGYMTEYRVEQLARDAKSLMIYAGSNEV
QITHVAKGLLSG
108799941YP_640138.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MTRAARHRGVMPRRRGCVRPVDRGRSLAASEAAAYAGDVEVKPFDERSGG
TEDEERAPVRGSAGPLGWFYSANHSPSVVEFLRRARRALPGDPDFGDPLS
ADGVGGPRAAARVADRLLDREAVSREVSLGALQLWQAVTERVSGKPANPE
VTLVFSDLVGFSSWALTAGDDATLRLLRRVAQAYEPPLLEAGGRIVKRMG
DGSMAVFTDPGTAVRAVLNAMAAVRSVEIDGYSPRMRVGVHTGRPQRIGS
DWLGVDVNTAARVMERATRGGLIVSQATLDRIPAEELAALNVTVKRQRRQ
VFSLKPDGVPPELGMYRVRRNRPSGEDSTDDDS
108799939YP_640136.1 phenylalanyl-tRNA synthetase subunit beta [Mycobacterium sp. MCS]MRLPYSWLREVVAAGAPGWDVSAEELEQTLIRIGHEVEDVLPVGPVTGPL
IVGRVAEIEELTEFKKPIRAVKVDVGEPENRDIVCGATNFAVGDLVVVAL
PGATLPGDFTIATRKTYGRTSDGMICSTAELNLGADHSGILVLPPGTAAP
GTPAAEVLGLDDTVFDLAITPDRGYCLSVRGMAREIACAYDLDYVDPAFD
PERVPALPVEGEALPVAIDPGTGVLRFGLRPVTGIDPAAVSPWWMQRRLL
LSGIRAISPAVDVTNYVMLEFGHPMHAHDRSLITGGFRVRFAEPGETVVT
LDDIERRLDPADVLIVDDEATAAIGGVMGAGTTEVRETTTDVLLEAAVWD
PAAVSRTQRRLRLASEAGRRYERTVDPAISVAALDRCAALLADIAGGAVE
PRLTDWRGDPPREDWSPPPVSMALDRPDRTAGVDYPPGTTERRLTQIGAV
VRVDGDRVTAVPPSWRPDIRQPADLVEEVLRLEGLEQIPSVLPAAPAGRG
LTAVQKRRRAIGKSLALSGYVEILPTPFLPAGVFDVWGLADDDPRRATTQ
VLNPLEADRPHLATTLLPGLLEALARNVSRGAADAALFAIAQVVEPTEDT
RAVERIPNDRRPTDDEIATLDASLPRQPQHVGAVLTGLREPAGPWGRGRP
VEAADAFEMVRIVGRAAEVEFTLRSAQRLPWHPGRCAEVLIGDTVVGHAG
QLHPAMVERAGLPKGTCAVELDLDAVPITERLPAPRVSPFPAVFQDVSLI
VDDDVAAQSVVEAVRSGAGELLEDVRLFDVYTGPQIGEGRKSLALALRFR
AADRTLTEDEASTAREAAVQAAAEQVGAQQRR
108799937YP_640134.1 bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [MMTGSAPLIRTQGVTAPAGFRAAGIAAGIKASGALDLALVLNEGPDHTAAG
VFTRNQVQAAPVLWSRQVLTTGRLRAVVLNSGGANACTGPLGFQDTHATA
EAVAAALSDWGSETGAIEVAVCSTGLIGDRLPMDKVLAGVTEVVHEMAGG
LSGGEEAARAIMTTDTVPKQVALHHPDNWTVGGMAKGAGMMAPSLATMLC
VLTTDAVAGSEALDTALRRAAKRTFDRLDIDGSCSTNDTVLLLASGASEI
TPSQEELDEAVLRVCDDLCAQLQADAEGVTKRIAITVTGAPTEDDALVAA
RLLARDSLVKTALFGSDPNWGRVLAAVGMVPFTIDPNRITVSFNGSPTFA
NGAGTPGAREVDLTGSDIDVAVDLGLGAGQATVRTTDLSHAYVEENSAYS
S
108799935YP_640132.1 acetylornithine aminotransferase [Mycobacterium sp. MCS]MTLQQRWSAVMMNNYGTPALALASGDGAVVTDTDGRSYVDLLGGIAVNIL
GHRHPAVIEAVTRQLNTLGHTSNLYATEPGIALAEALVGHLGAPARVFFC
NSGTEANEVAFKITRLTGRTKIVAAQGAFHGRTMGSLALTGQPSKQAPFE
PLPGYVTHVPFGDIDELARAVTSETAAVFLEPIMGEGGVVVPPAGYLAAA
REITTRHGALLIVDEVQTGVGRTGVFYAHQHDGITPDVVTLAKGLGGGLP
IGACLAVGPVGDLLTPGLHGSTFGGNPVCTAAALAVLKVLADDDLVTRAG
VLGKTLSHGIEELNHPLVDHVRGRGLLIGIALRAAAAKPAETAARAAGFL
VNAAAPDVIRLAPPLVVTEAQIDDFLGALPGVLDAAAAGGGESTPAAEVA
DT
108799933YP_640130.1 arginine repressor [Mycobacterium sp. MCS]MTSAVTRAGRQARIVAILSSHSVRSQGELAAKLADEGIEVTQATLSRDLE
ELGAVKLRGADGGVGVYVVPEDGSPVRGVAGGTDRLTRLLGDLLVSTDAS
GNLAVLRTPPGAAHYLASALDRAALPYVVGTIAGDDTIMVVAREPMTGVE
LAATLENLK
108799931YP_640128.1 argininosuccinate lyase [Mycobacterium sp. MCS]MSTNEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDIAASKAHARVLF
SAGLLTEDQRDGLLAGLDSLASDVADGSFAPLVTDEDVHGALERGLIDRV
GAELGGRLRAGRSRNDQVATLFRAWLRDAIRRVADGVLGVVSALATQAAA
HPTAIMPGKTHLQSAQPVLLAHHLLAHAHPLLRDVDRLADFDKRAAVSPY
GAGALAGSSLGLDPDAIAAELGFDSAADNSIDATAARDFAAEAAFVLAMI
GVDLSRLAEDIILWSTTEFGYVTLHDAWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAVAGL
VSTLSFDVDRMAELAPLGYTLATDVAEWLVRRGVPFRVAHEAAGAAVRAA
EARGVGLEDLEDAELTGIHPELTGDVREVLTIEGSVNSRDARGGTAPVQV
AKQLNVVRDTADRLRLRLRT
108799929YP_640126.1 ABC transporter-like protein [Mycobacterium sp. MCS]MPRHHGTAATYHRRLMANLINVEKVTVGYGTRTLLDAVSMGVDDGDAIGV
VGRNGDGKTTLLQILTGTRPPDSGRVTHTSGLSVGYLRQGDDFAAGATVR
EVIVGGRPDHIWAAEADTRAVVENLLAGVGLDTAVGDLSGGERRRVALAE
VLIAGHDVLVLDEPTNHLDVEVIGWLASHLSTKRPRALVVVSHDRWFLDA
VCTRTWEVHGGAVDAYDGGYAAYVLARAERSRVAAGAESRRQNMMRKELA
WLRRGPPARTSKPKFRIQAANELIANEPPPRDSLTLQRFATTRLGKDVFD
LHRVRLEVGDPPRVILDRIDWSIGPGARIGLVGVNGTGKTSVLRLLAGEL
EPAAGTIKRGATLRIGYLSQALAELDGTARVLDAVEDRRRITELAGGREI
SAATLLEDFGFTGDKLTTRLADLSGGERRRLQFLRMLLDEPNVLLLDEPT
NDLDIDTLNVLEDYLDGWPGTLIVVTHDRYFLERVSDVTYALTGNGRCDL
LPGGIEQYLEGRVSAASGSAPKPAAARGESDAARERRTAKELTRIENQLT
KLDGQITKLHEAMAEAAADHVRAGELNRELSELESRKDELEEAWLAAAED
108799927YP_640124.1 hypothetical protein Mmcs_2961 [Mycobacterium sp. MCS]MNSQSRKNRSGWRRALTGTLASGALAAAMLVTAPASQADVLDQIGAKYMQ
GAGGGQISVFAEQSINLRAQGFRPSQENLAALQEGWDFLPNQTRLLDALK
STVAYQRKVQMQSQLSGGGGPAVKAPAWVPPGDENPWVGPEYDINPYD
108799925YP_640122.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MRTNAERKRPGRPPGTSDNRDRILQTARALFARNGIDKTSIRAIAAGAGV
DPALVHHYFGTKQQLFVAAIQAPIDPMTVIGPLRDVPVERLGYVLPTILL
PIWDSELGHGFIATLRSLLAGSEVGLLRTFFQEIIAAEIGPRVDDPPGSG
RVRVQFVASQLLGVVMARYILELEPFASLPVEQIAETIGPNLQRYLTGDV
PGPA
108799923YP_640120.1 ABC transporter-like protein [Mycobacterium sp. MCS]MMTSSDDELIDAAAVDIRDLRVVRGNRVALDRVSVQVARGAITGILGPSG
CGKTTLMRSVVGTQIIAAGSVTVLGRPAGSAELRHRVGYVTQDATIYNDL
RVIDNVRYFAALYGTGGQAADEAVDAVGLADHRSEFGANLSGGQRTRASL
ACALVAHPELLVLDEPTVGLDPVLRVDLWHQFDELARGGTTLLVSSHVMD
EADHCGDLILLREGRLLAHSTPEQLRKDTGCTSLEEAFLSVIRRSTAAGV
ATG
108799921YP_640118.1 tyrosyl-tRNA synthetase [Mycobacterium sp. MCS]MSSILDELDWRGLIAQSTDRDALAAELAAGPMTLYSGFDPTAPSLHAGHL
VPLLTLRRFQQAGHRPIVLAGGATGMIGDPRDTGERTLQTADTVADWADR
IRGQLERFVEFDESPTGAIVENNLSWTGALSTIEFLRDVGKYFSVNVMLD
RDTVRRRLEGEGISYTEFSYMLLQANDYVQLRKRHGCALQIGGSDQWGNI
VAGVRLVRQKLGDTVHAMTTPLVTDSEGKKFGKSTGGGNLWLDPEMTTPY
AWYQYFINTADADVVNYLRWFTFLEAGELAELEEATRDRPHQRTAQRRLA
RELTTLVHGEDATRSVEHASQALFGRGELAALDEPTLAAALREASVAELT
PSGPDLITDLLVATGLSASKGAARRTIAEGGVSVNNMKIDSDEWTPQASD
FLHGRWLVLRRGKRNIAGVQRVG
108799919YP_640116.1 HAD family hydrolase [Mycobacterium sp. MCS]MQQHDCLLLDLDGTVFRGHEPTTGAVESLAGLSARVLYVTNNASRSPGDV
AGHLVELGFHADAADVVTSAQSAAHLLAAQLPAGARVLVVGTEALAAEVD
LVGLQPVRQFADDPAAVVQGHNPETAWADLAEAALALRAGALWVAANVDL
TLPSERGLLPGNGSMVAALQAATAREPQVAGKPQPTLMRDALSRGDFHTP
LVVGDRLDTDIAGANAASLPSLMVLSGVSTADEVLRAVPQERPDYIAEDL
RSLDAPADDLRVGPHPGWRIEVDGADVTVHADGVDRGDDLSVLRATAHVV
WQSDLAGTPFAVRAGDDTAAAALQRWSLLTAAID
108799917YP_640114.1 hemolysin A [Mycobacterium sp. MCS]MTRRARVDAELVRRGLARSRQQAAELIGAGRVTVDGMPAAKPATAVAVTA
HIAVDTADERSWVSRGAHKLIGALDAFDIDVADRRGLDAGASTGGFTEVL
LDRGAREVVAVDVGYGQLAWSLRSDERVVVVERTNVRELTPEMIGGPVDL
VVADLSFISLATVLPALTACASPDADIVPMVKPQFEVGKDRVGAGGVVSE
PELRAESVLSVAAKAAGLGWETVGATASPLPGPSGNVEYFLWLRARTDRG
LRGDDLEQAVRRAVTEGPQ
108799915YP_640112.1 DNA repair protein RecN [Mycobacterium sp. MCS]MLSEIRIESLGAISAATAEFDRGLTVLTGETGAGKTMVVTGLHLLGGARA
DPNRVRSGSERAVVEGRFLTSDLGDGVARRVDDLLESSGAERDDDGSIIA
ARSVSKDGPSRAYLGGRSVPAKSLSNFTTELLTLHGQNDQLRLMRPDEQR
AALDRFAAVDKPLRRYRAARDEWLAARRDLTDRRRRERELAQEADRLKFG
LTEIDNVDPSPGEDDALVDDIRRLSELDALREAALTARAALTGADDDPTG
DAMSAANLAAQAKSALDGTDDATLRSLGAQLADAVAVIGDVAGELGDYLG
ALPTDASTLETKLARQAELRTLTRKYAADIDGVLAWARESRERLDQLDVS
EEALAGLERRVGELQAQVVVAAADLTKARLKAAKGLAKAVTAELSGLAMA
GAEFTVGVAPLAARADDSAPLTLPDGVVVHAGHDGVDAVDFGFAAHRGTD
VLPLSKSASGGELSRVMLAIEVVLAASAEGTTMVFDEVDAGVGGRAAVQI
GRRLARLARTHQVIVVTHLPQVAAYADAHLVVDGSGQGKAGKASGVRRID
DDDRVAELARMLAGLGESDSGRAHARELLDAARAEAAETD
108799913YP_640110.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MSTIRVRYIVDDVNRAVDFYSRHFDFDVLMKPGPGFAMVARDNLRLLLNS
PGGGGGAGQSPAADQSPEPGGWNRFQIQVDDLDAVVDDLRRQGVGFRGGI
ITGRGGRQALALDPSGNIVELFENG
108799911YP_640108.1 hypothetical protein Mmcs_2945 [Mycobacterium sp. MCS]MISLRAHAISLAAVFLALAIGVALGSGLLSNTVLSGLQDDKQDLQNQINS
LTDEKNGLNQRLSAAGEFDAQIAPRVLRDTLGGKSVVLFRTPDAADDDVD
ALTRSVGQAGGTVSGTVTLTQEFVDANSAEKLLSVVNSPIVPAGKQLSTA
AVDQGSQAGDLLGIALLLNKDPAAPVVSDAERDTVLTALRDTGFLTFGTD
PVGAANTALIVTGGALGDDAGNRGATVARFAAGLAKHGSGTVLVGRDGSA
SGTGAVAVTRSDPALTGAVSTVDDVDTESGRITSVLALADLIGGARPGQY
GVGQGAGAVTIAQ
108799909YP_640106.1 NUDIX hydrolase [Mycobacterium sp. MCS]MAEHDFETVTSETVYVGNIFALRADEVRMPGGGTARREVVEHYGAVAIAA
LDDDGNIALVYQYRHPLGRRLWELPAGLLDMGGEPPQVTAARELQEEAGL
SAAQWRVLVDLDSAPGFSDESVRVFLATGISEIDRPDAHDEEADLIVKRV
PLSEAVRMVLSGEIVNSIAVAGILAVHALDVSAHGVESLRPVDAEWTDRP
RAFARRKGH
108799907YP_640104.1 hydroxyneurosporene-O-methyltransferase [Mycobacterium sp. MCS]MTSRMNGISSLDAGVMVGALIGGDGVESRPGPGHAPLTKPVRLPPARLAR
IVETLRTALHRVRFKVVPPFAGILDLTMGFAVAQAIYAAARLGVADVLRD
GPMTAADVADRVHADPSAVHRLMRVLAAHQIFRERRDGPFEMTALSQALC
SDAAVSIRPLLLMLSHPFYWQHFGRLTDVVRTGRTSLETEYGKGLFECLD
EDPEVARVFNDAMSCVTAMSIPPVLAAYDFSRFRTIIDVGGGDGHMLTAI
LEVATASRGVLFELPALAEQARETVRSVGLTDRATIESGSFFDHVPRGGD
LYVLKHVIHDWRDDRAREILRHVRDAMSPRAVLLLVETVIPPGNGMHFGK
LLDLDMLIFAGGRERTRAEFSSLLFETGFHLDRIVPTVTHLSLIEATAC
108799905YP_640102.1 hypothetical protein Mmcs_2939 [Mycobacterium sp. MCS]MGKHQTPDSVHPIEFRRNNPAPNVVPWRRAVGHPQQHHMPAGRRYHRRGG
SRHATTEARWAASQRAVSRRASRGRPAFVTTITVDYLT
108799903YP_640100.1 hypothetical protein Mmcs_2937 [Mycobacterium sp. MCS]MSLPALDDIATHTGSTNPIDGVIRIETSPREKATPIIMDMMRSVYPHDEV
FGEFCTVNSYVDCPPDELFDYLSDTRSLEEWTYSLRGFERTEEDGLWLAW
DRLGSETEIYTRTVFNREAGTVDYHCAWDQGKHLWMIYLMRVVDARVVLD
KPGSVVLWTNCHHPFYDNNPYPETAPPERPVWVGDFWDMFGAGHLLELKN
LKAIAEFRHRNGLPIKPAWMD
108799901YP_640098.1 aminotransferase [Mycobacterium sp. MCS]MTIVAEPGPATSPPGPVQPRISSLPTAVDPMALSLNENPFPPLPAVQTAM
IESIQAANRYPEFLPESLRHLIADHVAVPDEQVVVGAGATGVLVQVMHAF
TSPGDRIVLPVPTFEGYTIASAMTRLQVEAVPLLADGHHDLDAMADAASG
ARLVVVCRPHNPTGTVESAATLEAFLARLSSDTIVILDEAYVEFVAPQWR
IDAVDLIQRFPNVLVLRTFSKAYGLAGLRIGYAIGSWGLTAELWAMQLPF
GMGSTGLVAVAASYQAESQLRQRIRLITSERRHLRMRLRAMGVPSIDGHA
NFVYLPVGDRPWREVFDGADGVRVKHCADGGVRITVGGRSSTGAVLAALR
GRG
108799899YP_640096.1 MMPL [Mycobacterium sp. MCS]MLQAVTRLAIAAPKRVIAAAVAVLIGCAIFGVPVAGSLSGGGFRDPESDS
ARASAILADTFDRPEMHLLLTVTAPDGALTGPGAAVGADIVRALRESPSV
GYVESPWGAPPGTADELVSTDGTTALVIAGLDGDESDAAAHAEDLSAALT
GDRDGVIVRAGGVAAVNAQINAQTEKDLMAMEAIAFPLSFLVLVWVFGGL
FAAMLPMAVGALAIVGSMAVLRGITMVTDVSVFALNLAVAMGLALAIDYT
LLILSRYRDEIATGAPREDALMRTMAAAGRTVVFSAVIVGLSMLPMAVFP
MYFLRSFAYAGVAVVGFASVAALVVTPAVITLCGDRLDSLDVRRFVRRIL
RRPPPTPRPVERSFWYRAARAVTRRGGALSVAVVALLLVLGAPFLDARWG
FPDDRVLPATADAHRVGDLLRTEFTADSATTVTVVLPDIAGVQPAALGEF
AAELSRVPDVPWVSSPAGTFAGGRQTGPPSAPTGTADGSAFLTVASSAPL
DSAESEAQLDALQAVPGPDGREVLLTGTTPSNRDIVAAVLSRMPLVLGII
GLTSLVLLFLLTGSVVLPLKAIVLNVLSLTAAFGALVWIFQQGHLAALGT
TSTGTIGVTIPVLLFCIAFGLSMDYEVFLMARIREYWLAPRDVPAGTRAA
NDEAVALGLARTGRVITAAAVIMSISFAALIAAEVSFMRMLGVGLTVAVL
MDATLVRLILVPAFMHVMGPANWWAPAPLARLHRRFGIGEAAPAGRHRGG
EDGKSSAGLPVSAVPRR
108799897YP_640094.1 condensin subunit ScpA [Mycobacterium sp. MCS]MSGGDAEQPDKSGFQVRLNNFEGPFDLLLQLIFAHRLDVTEVALHQVTDD
FIAYTKAIGRQLELDETTAFLVIAATLLDLKAARLLPAGEVHDEEDLALL
EVRDLLFARLLQYRAFKHVAVMFAELEAAALRSYPRAVSLEPRYSELLPE
VMLGVDADRFAEIAASAFTPRPVPSVRTDHLHAPSVSVPEQAKRLLALLE
QRGVGQWATFTDLVADCQGGIEIVGRFLALLELYRARTVAFDQAEPLGVL
QVSWTGDRPTNEQLATVDAGEQREQ
108799895YP_640092.1 ribosomal large subunit pseudouridine synthase B [Mycobacterium sp. MCMTEPDGVRLQKVLSQAGIASRRVAEKMILDGRVEVDGHIVTELGTRVDPT
AADIRVDGTRVLLDDTLVHLAINKPRGMHSTMSDDRGRPCIGDLVEHRVR
GNKGLFHVGRLDADTEGLMLLTNDGELAHRLMHPSYEVPKTYVATVLGTV
PRGLGKKLRAGVELDDGPARVDDFAVVDAMPGRSMVRVTLHEGRKRIVRR
LLAAVGFPVQELVRTDIGAVSLGEQRPGSIRVLTRKEIGELYKAVGM
108799893YP_640090.1 GTP-binding protein EngA [Mycobacterium sp. MCS]MTSPEDDGTWVDERDWELGAEEVAEAIEEASAPPPVVAVVGRPNVGKSTL
VNRILGRREAVVQDIPGVTRDRVSYDATWSGRRFVVQDTGGWEPDAKGLQ
QLVADQATVAMRTADAIILVVDAVVGATAADEAAARMLRKSGKPVFLAAN
KVDTERGEADAAALWSLGIGQPHSVSAIHGRGVADLLDHVLEKLPEVSEV
GGGSGGPRRVALVGKPNVGKSSLLNRLAGDERSVVHDVAGTTVDPVDSLI
ELGGKTWRFVDTAGLRRKVGQASGHEFYASVRTHGAIDAAEVVLVLIDAS
QPLTEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYLLDREIDRELAQV
QWAPRVNISAMTGRAVQKLVPALETALQSWDARIPTGRLNTFFKEIVAAT
PPPVRGGKQPRILFATQATARPPTFVLFTSGFLEAGYRRFLERRLRETFG
FEGSPIRINVRVREKRGSRSR
108799891YP_640088.1 hypothetical protein Mmcs_2925 [Mycobacterium sp. MCS]MPVVDMVLIALAGVGAGAINAIVGSGTLITFPTLVALGYPPVTATMSNAV
GLVAGGVSGTWGYRRELRGQWHRLRWQIPGSLLGAMAGAWLLLHLPEKVF
IAIVPVLLIAALILVIVGPRIQAWARQRSESAGRSLDHISRGRMAALVIG
TFLVGVYGGYFTAAQGILLIAVMGALLPEDMQRMNAAKNLLSLIVNVVAA
VAYTLVAFDRISWAAAGLIAVGSLLGGFLGAHYGRRLSPNALRAVIVVVG
LIGLWRLVTV
108799889YP_640086.1 phage integrase [Mycobacterium sp. MCS]MRKRANGEGNIRQRANGRWEGRVSYVDPVTDGRKSVSVYAATAAECRKEL
KKVRDRIEGGAPAKDAPNTVSSWLKQWRASSLAASDRKETTKSLYATLSR
KHLEGARIGDKRLDRLKPSDVELLIVQLRGKNLSDSTVRQVYTVLRQALD
VAVRDGLLAANPASKVKRPGVARKEAKYLPAADVARLLDAAKGLRYYLGV
VLMATTGLRRGEVAGLLWSDVDLEKGELTVRHTLSRVDGKLVLTEPKTDR
SRRRVPLHAGVVAQLKMHRTQQLQERLAAGDQWRDTGAVLATEFGTLLDP
RNLLRTVEIAAAKVGIEDVGAHTMRHSAAVAWLESGVHIKAAADLLGHSS
IAITGDLYGHTSDETARAAVDGLGTALGL
108799887YP_640084.1 hypothetical protein Mmcs_2921 [Mycobacterium sp. MCS]MQLALHSVNSSPAPRRARLDRSEQMAELVNRLVSIQEAREKWLGGIGRTT
LYELIKRGELTQVHVGRRAFITAESLAGYMNRLQEAATA
108799885YP_640082.1 hypothetical protein Mmcs_2919 [Mycobacterium sp. MCS]MTEPIELIRNIHGEPMLTSDALALLFGVTPEDIVAHSTDPSTDFPNAWIR
AGRRRSREAQAATGKDDILAVLAYWARKDRDMVITVEDGDQ
108799883YP_640080.1 hypothetical protein Mmcs_2917 [Mycobacterium sp. MCS]MDKRRSRSRLCKHCRAARTGHSTRLCVLCRPSAPIAERILAAYQLKDTMN
IRILRVIGRRSHSPAVVALADDHLVKWSPRDDWTCSCDEATFPDCPHIPA
IEEVLDPRVTGEPR
108799881YP_640078.1 HNH endonuclease [Mycobacterium sp. MCS]MCVNCAWTGCNRPIHSRGYCGSHYNKARASGLLPSRPFWVEDTNTGCWLW
NRKRRKDGYGRKSIDHSREIPAHRWVYEQHVGPIPDGLEIDHLCNNPPCV
NPGHLEPVTHVENMLRQWRRRRAA
108799879YP_640076.1 hypothetical protein Mmcs_2913 [Mycobacterium sp. MCS]MNDLLQKLLQKLDEPIARYSDLERYYTGTQPLAFLSPEAKEALGTRFGRM
ASNLPRLAVTSLTERLRVTGFTGADVWDDWLRNDMDQESATAHREALLLG
SSYVIVWADRFGRPLVTVESAKQMACVRDPGTRRITAAVKRWETDTTTEA
VLYGPEEIVRYRANQTGATVDGFKAVESIANPLGVVPVVRLLNSDRILDE
GVSEIEDLKPLCDGLAKVLTDMMVSSEYVGRPRRTATGIELVEEPVLDAN
GNPTGETVAVNPFPEGNRMMVSENHEAKFGQLDAADLGGYEAAVRVLLGQ
VMAVSALPAHYVGQLSDTPASADALRAAEASLTARAEARQQQFGRSWEDV
ARLVVAVRDGVDPLGVDVRVKWADASTRSVAAEADAVTKLFAAGLLPASY
ALQRLGYSDDEILEIRAARRAETLDGQGVNLAALPREVA
108799877YP_640074.1 hypothetical protein Mmcs_2911 [Mycobacterium sp. MCS]MMNDANSTDEPIDETAEGTQEPSTPELSDSESGNPEGSDSESDPDTFPRD
YVEKLREENKRYRHRAQRADTYAQRLHTELVRATGRLADPTDLAFDEAHV
EDADALAAAVDALLARKPHLAARRPAGDIGQGASPSADTVNLAALLRQRA
Q
108799875YP_640072.1 hypothetical protein Mmcs_2909 [Mycobacterium sp. MCS]MAVEADQVAAFLGRPEDAAILATAEQAIPIVTTMVKAYIRGNGFDWEPND
ELEAVIVTASARMVSNPGGLPVDTAAGPFTQSLRGAFQGWTLAELFVLNR
YRRRAV
108799873YP_640070.1 serine/threonine protein kinase [Mycobacterium sp. MCS]MVAPPAVTANERGNAVDSTGHDLFAGRYVLRGLLGAGGMAEVRDAWDTRL
DRPVAIKILHPAMNAQPETLNRFRDEARSAAMLSHPNIVAVHDYGEQDGT
PFIVMERLPGRTLHDVMADGSMAPDQVRSMLDDVLAALSVAHSAGVLHRD
IKPANILLSVTGDSVKVADFGIAKAGGAAHTMTGQIIGTMAYMSPERVTG
APASVADDLYAVGVVGYEAIVGHRAFPQDTPVAVARAIMDDPPPPLREVR
PDLDPVLAGTIDRAMTRDPAHRFGDAAQMRAAVNGDRQALLAGAAPATAT
PPRPATKVLDQPLPPSAHYVLPPPPPSRWRQLPGRTRKAIFAAAILVCLT
VSALALAAEPFSTAPSPQPSSTSTPAPAPTSTPSSAIEQPQDGSGDKEQK
KEEKKREGRGNGNG
108799871YP_640068.1 two component transcriptional regulator [Mycobacterium sp. MCS]MRAGVPPAATPAGTMGFMEQSTGSTTRTHGYRALVVDDETALAEVVASYL
EREQFEASVVGSGAEAIAVARGLDPDVVILDIGLPGIDGLEVCRQLRTFS
DAYVVMLTARNTELDTVLGLTVGADDYVTKPFSPRELVARIRAMLRRPRM
RPVAGADTEDLPPPRVFGPLSIDVAAREVGLDGESILLTRTEFDILEALS
ARPGVVLSRRQLLDIVREGPWVGNEHLVDVHIGHLRRKLGDDAANPRFIM
TVRGVGYRMGSSR
108799869YP_640066.1 hypothetical protein Mmcs_2903 [Mycobacterium sp. MCS]MAELDTRPIHDKVRRRDRAVDVARLTALVVVMFGHCALLLATIDSGGVRI
GNLLGAVPAIAPVTWVVQVMPLFFLAGGAAGAYGWHAGTPWGAWLFTRAQ
RLCRPVFWYLAAWAAGLLVVRLLLGAESADALGRESVALLWFLGVYLIAL
AFVPALTRLRTGGAVALLIIALLTVAWAVDGIRSAVGTPEVGVVNFLVVW
LIPVVLGVAYARGLIRPLAAIAAAVAAFAAQCALAFTGAYEVALVVTGVE
RVSNTSPPTLLLALHCTWMSCAFVVVAGRLRRWAARPRVWHAVAVGNAGA
MTLYLWHIPAIAIAAFSLHAVGLDAFDVDAPDFWALLALRAVVFAVVMAL
LFKLLAPLEHRPLPWWDDPAAATGVRSALAGGLICVAGVASVLMAKQGLA
GVGGWTALGGFLLAAVAARVCAGWR
108799867YP_640064.1 hypothetical protein Mmcs_2901 [Mycobacterium sp. MCS]MSETLATLPSAVRSTVSGALGDPLRLFAEPGPVYEADVAFDDDARMPGLT
QLLRPGRRYTTFVRIAPTSTDAVVRTVCVKFPDAYGPGTDQDFLFASSGD
GAPLHHFTFPRTRADDQLYSSLWLYLAGVRPIVFGVSAAAGLQTGVLGRG
DRLEFLIGGVIGRFHRVGDIQLGSEIPQASVSFAASNSGGGLRPLPPAMF
YRG
108799865YP_640062.1 hypothetical protein Mmcs_2899 [Mycobacterium sp. MCS]MTKVTNWSRSSTRPREVLGRRPFARDTFRMRVEETMWDVLLPKDVDDRCG
YSPRAALAELVAKQLPSYKRLLRVVTWSPDAGHLFRPTPNFRRYAVCYEV
ELAT
108799863YP_640060.1 RNA polymerase sigma factor SigF [Mycobacterium sp. MCS]MTIIDDTLQVTAKRPSTRTQDDYTDVPDMFRLLSVLSPGTPDHDRQRERI
VTRCLPLADHIAFRYHRKGENLDDLVQIARVGLMHAVNRFDPENGANFLS
FAVPTMLGEIRRHFRDNGWAMHVPRRLKDLHVQITRATPRLTQSLGRPPT
PTDLAAELGADRQEVVECLVAGDAYSLRSIDSPISSSDDTTRSLADTLGE
VDGEMEHITDRESLRPLLAALTERERTVISLRFFASMTQTQIAERIGVSQ
MQVSRILAKTLQQLRDGMS
108799861YP_640058.1 hypothetical protein Mmcs_2895 [Mycobacterium sp. MCS]MNATSVWVTSGLARDHFWEQRSRTPRREAGNRKDQHMADDNSGNSGPEEA
VKGAVEGVKGKAKEVAGAVLGRDDLYREGQAQQDKADAQRDAAKKEAEAE
AARGSAKVAEERQKSEQTDN
108799859YP_640056.1 putative PAS/PAC sensor protein [Mycobacterium sp. MCS]MNSAEGAAPAPECSVEDLYEHAPCGQLATAPDRRIISVNETLVRWLGRSR
DELIGTPFTDLLTVGSRIHFETHFAPLLHLTGELQGVAVDLIASGGARLP
ALIAANVKTNTGGAPATIRFVLQDASDRRAYERELLAERERAEQERTRAT
ALARTLKRSLLPPALSPPAGLEACAHLHAASHDEVGGDFYDLFALAPGRS
AFFLGDSCGKGISAATVASLTRYTLRAAAVFDDDPVAVLHNLDTVLINEF
GADRSHFCTVIYGVLARHNGGFDVHLASGGHPPALLLRADGGVHKITTEG
GQAVGIFTNARFASARVHLGAGDTLVLYTDGVTEARIGSGAERFDDHDAL
MELARAHAPTTATAIVETLRNLLADLGDGVEDDAAVLALGVPR
108799857YP_640054.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MVMAMSDGGVSFDLSTVFKTVAEAVPDNTFLVWRDRRLSYAESDARVDGV
AHYLTSVGLGCHTKRDRLQGHESGQDHLGIYLRNGNEYLEAMIGSYRARV
APFNVNYRYVDEELTYLLTDADAKALVYAAEFAPQVAAVRDRLPNLRVLI
QVADDSGNELLPGAVDYESIVTTPAPAGGMPTPTGDDLYILYTGGTTGMP
KGVLWRQHDIFLSSMGGRPFGSDTFLSSYEELAERARAGAGAMGLLMIPP
FMHGAAQWAAYNAVTMGGRLAIPDHVDRLHADDALRVAARERVLSIPMVG
DAVARPLLDEIERGDYDLSGLVTLTNGGAPLSPTVRDRILAALPHVIVMD
AVGSSESGAQMSTYASAGAEVEAATFTPQSDTAVVSADFTRVLQPGEGPG
WLARRDLVPLGYLGDAAKTAKTFPTIDGVRWSVPGDRANVLADGRIELLG
RDSVTINSGGEKIFAEEVERAVAAHPAVYDVVVVGRPSERWGSEVVAVVQ
LAEGASATDEELAEVCSRSIARYKVPKVFLRAEKVVRSPAGKADYRWAKA
VATESVSS
108799855YP_640052.1 hypothetical protein Mmcs_2889 [Mycobacterium sp. MCS]MSNNGPFGFDPDDLDRVAREALEGVGRFFTTSGERAGWGALIDELGRFGR
PRTEPETTGETGDGVWAIYTVDADGDAHIEQVFPTELDALRANKNNTDPT
RKVRFLPYGIAVSVLDANTPGDSAE
108799853YP_640050.1 hypothetical protein Mmcs_2887 [Mycobacterium sp. MCS]MSTPSDEAGKNESDVGDDQKVASSRAGKEGDEEAGTYVGRTGSDDALDDE
QTGAEARSQQQGS
108799851YP_640048.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. MCS]MPDTPDDPDEMKPHFDDVQAHYDLSDEFFALFLDATRTYSCAYFERDDMT
LEEAQFAKIDLALGKLGLQPGMTLLDVGCGWGSTMMRAIERHDVDVIGLT
LSENQRAHVQSRFAADQSPRSKSILLQGWEQFDQPVDRIVSIGAFEHFGH
ERYDAFFAMAHRVLPDDGVMLLHTITGLHPDEMAERGMPLSFQFARFVRF
IVTEIFPGGRLPSIPMVEERAAAGGFTVSRVQSLQPHYAKTLDIWAAALE
ARRDEAIAIQSEEVYDRYMKYLTGCADMFRVGYIDVNQFTLEK
108799849YP_640046.1 alpha/beta hydrolase [Mycobacterium sp. MCS]MYLPVRDGVARCQLYRPRAAPADEQLPVIVYYHGGGFTVGVSEDCDFLAR
KLAFTNSALVVSANYRSAPEFMFPTPLDDAFDVYRWVTVNAELVGGDATR
VAVAGDSAGSNFAAALALRARDEHARVPDAVVMLGAMPDFHFERWDSFRA
QAPRGIVYDMAFAGFIRGAYVGPTPWDHPWVSPIEGDLTGYPLTVITAGT
HDPIVDSARAFGERIRAAGGQTVEYFPAGMPHGYYFFPGVHAEEDVAYEI
VAEVLAKPFRR
108799847YP_640044.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMTSVVIVGSGFTGFECARHLARKLRKSEGTGSEPVEITIISPVDYMLYTP
LLPDVAGGLVDARFVTIPLANSLRGVRAVRGRVDDVDFDQRTVTFTDPEQ
RVRSMPWDRLVLTPGSVTRLFDVPGLAEHARGLKSTAEALYLRDHVLEQL
ELADIDEDPTLAAARRTIVVVGASYSGTELAVQLRALADAAAQQMGFDPD
SVRFVLLDLAEQVMPEVGEKLGAAAQRVLRGRGVDVRLGVTLKEVHDDHV
LLTDDTRIDTRTVAWVTGVTGAPLIEKLGLPTEKGRLKVDADLQVPGHPH
VFAAGDAAAVPDLTQSGAITPPTAQHATRQGKVLARNVAASLGHGTKKLY
KHRNMGLVVDLGPRYAVANPLGVRLSGLPAKAVTRAYHLYAIPRFVNRWA
VSLAYLTDVFFARSVVSIGLSSADDARFSASEGIPMPKGD
108799845YP_640042.1 NUDIX hydrolase [Mycobacterium sp. MCS]MPKLSAGLLLYRVTDGVVEVLLGHPGGPFWARRDEGAWSIPKGEYAPDED
PWTAAQREFTEELGAPVPPGEPLRLEPVKQAGGKIVTVFAVRGDLDPGAA
TSNTFTLEWPRGSGTLREFPEIDRVAWFPVEEARAKLLAGQRPVLDQLTA
AVAAGRG
108799843YP_640040.1 luciferase-like protein [Mycobacterium sp. MCS]MKYAVVAPVHAGVTADPAWMAAFARHLEACGFESIVAVEHTVLMTQYTSV
YPYDPSGRVELAADTPVPDPLDLLTFLAAHTERLGLATGVLVLPNHHPVV
LAKRVATVDALSRGRVRLAVGTGWLAEEINACGADFTTRGRRADEQIQVL
RTLWADSPLGASFHGEFVEFDHAMCFPKPAARVPIHIGGHSRAAARRAGR
LGDGFQPLGVAGADLSDLVEVMRSAAVESGRDPDAVELSLGHAVAKIDAA
RAERLAEVGADRLVLAMPPVTTLDEATDVVSACAQRLGLTS
108799841YP_640038.1 ferredoxin [Mycobacterium sp. MCS]MPLLDRFRQAPPSAFGRLRHDVSIGVADAAISALWALSGRVRDISEPRPR
EHLITLTVTDRRMVAHDEDVVALTFTASDGATLPPWHPGAHLDLHLPSGR
IRQYSLCGDPSVRDSYRIAVRRIADGGGGSVEVHEKLHPGVAVGTLGPRN
AFPLTLPGYGSPARLLHFVAGGIGITPILPMLALAQRFEVPWTMSYAGRS
RASLPFLDEVAAYGERVRLHTDDVAGVPAAGDLLGECPDGTTVYACGPAP
MLTAVRSALAGRAGVELHFERFAAPPVVDGAPFSVSITSTGAVVPVAADE
TLLSALDRSGVHAAYSCRQGFCGTCRTRVLAGTVDHRDTLLTEPERAGGM
MLTCVSRAPAGQRLTLDL
108799839YP_640036.1 phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS]MAGINDVLDWAKHQVSSKVPKADLDQRDSDYIREQLPGTWLLASLYFRAD
VRGLDRIPSEGPVLLVGNHSGGNLPPDTFVFTLAFCSYFGVERPFYQLAH
NLVVSAPGLGWLRKFGTVAANHDNARMALESGAALLVYPGGDYEVFRPSW
ERHQVDFGGRKGYVKLAREAGVPIVPVASVGGQEAALFLDRGQWLARLLM
VDKLARLKSVPILLAPPWGLVVSDLIPRLPLPTKIVIEVQEPISAADIAD
TDDDVINDKVVASLQGGVDRLAAERRFPVLG
108799837YP_640034.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MIAADEAQIHVAAQELSRIGRAVTPVQVDLRTEAGVSALYQKATADGRRL
DAVAINAGIGRAGRFVDGDLHEDLAIVDLNVRSTVHLARLVLGDMVDRGS
GRVLFTSSTVAAMPGSHQSIYNASKSFVQSFAEALHDEIRDTGVTVTALM
PGPVDTAFFTRAKMRNTPVGGPLPKDDPADVARQGYEAMMRGDRKVVASS
LMSKALGAVNTVLPDGVKARMNRLIARPMGR
108799835YP_640032.1 4-alpha-glucanotransferase [Mycobacterium sp. MCS]MTELSPSLVELAARHGVATRYEDWSGTQVAVPESTLIAVLAALGVAAADD
EQRAAALIQHDRNYWQRSLPPTILARTGSTSSFWVHVTHGDPVEVWVALE
DGSIRQSLHQLRNDTPPFDLDGRLVGEASFELPADLPLGYHRVHMRTGTV
EADAPLIVSPATLPVPPRLGARRSWGLATQLYSVRSHRSWGVGDLTDLTD
LAVWSATRHGAGFILVNPLHAAAPAAPMEPSPYLPTSRRFVNPLYLRPEA
IPEYAELRHRGRLRRSRTEVQARARRRELIDRDSAWRAKRAALATIYRVE
RSAGRELAYAGYRAREGRALDDFAVWCALAEKYGNDWHGWPAELQHPRNV
AVAAFAAEHADEVDFHRWLQWQLDEQLTAAHATAIGAGMDIGVMHDLAVG
VNPDGADAWALQEVLALGVTAGAPPDEFNQLGQDWSQPPWRPDQLVEQAY
EPFRALVNGVLRHAGGVRIDHIIGLFRLWWIPRGAAPTEGTYVRYDHEAM
IGIVALEAHRTGAVVVGEDLGTVEPWVRDYLHDRGLFGTSILWFEQDRDG
QDATGGPLPAERWREYCLSAVTTHDLPPTAGYLAGEHVRLRDELGLLTRP
AAEELADDRAAQAAWLAELRRVGLLAHPDNGEEPESDAVILALHRYLGRT
PSKLLSLSLADAVGDLKTQNQPGTSDEYPNWRVPLRGPDGRQRLVEDVFT
DPRAAALGAVMGSLVHPVL
108799833YP_640030.1 small multidrug resistance protein [Mycobacterium sp. MCS]MYLALAAAIALEVLATLCLRASDGFRKKVWMAPVVIGYLASFYLLWLTLS
LGLPVGIAYGVWTACGVALVAVLARVLFGERLTPTMGAGIALIVAGVLTI
ELAGLSH
108799831YP_640028.1 type B carboxylesterase [Mycobacterium sp. MCS]MTTESTGASGPTAVSEPVVDTEYGPVRGTDDGVVKVWKGVRYAAAPAGEL
RWRAPQPPQPWRDVADARRIGPVCPQATDPRIPLDLGGVQDEDSLRLNVW
APSGSAAGDGKPVMVWVHGGAYVLGSANQPLYHGKALASGGDVVVVTVNY
RVGAFGFLDLSAFTTSRTRFDTNPGLRDVLAALRWVQNNIAAFGGDPARV
TLFGESAGGGIVTTLLTSPAAAGLFSAAIAQSSPATSVYSAERGRRTAEQ
FLDKLGVSPADAHRLVDAPLPAVLSASKRLFDEVPVRTPGTLAFAPIVDG
DLVPDLPVRVARAGGSLPVPLIIGTNKHEAALFRWMKSPLMPITPQAISS
MFAEIAAEQPGLQIPSEADLVGAYSGLRGKARGMGVARDIGFRMPSVWFA
EGHNAVAPVYLYRFDFATPMLRLLRLGAAHATELPYVWGNLVAGPRDPTF
KLGGLKAGTAVSERVRGRWTGFAASGEPGGTPPWRPYRSDDRATLVIDGQ
DRVVDDLDGEIRAAWGDEVLSFR
108799829YP_640026.1 hypothetical protein Mmcs_2863 [Mycobacterium sp. MCS]MNAMDVKEVLLPGVGLRFEFDNRDGDRIGVVARRTGDFEVVVYPKEDPDQ
AQQVFRLTDEEAEALAQILGAPRIAERFADLTREVPGLSAGQVSVRAGSP
FVDRPLGDTRARTRTGASIVAIVRDEEVLASPGPSDLLRAGDVLVVIGTH
EGLAGVEVIVSQGHGGEAHQPGPPGQG
108799827YP_640024.1 FAD dependent oxidoreductase [Mycobacterium sp. MCS]MQTVFDAHVDATLVDAALAPSVPGSMWLDVPRPRFERLTGAVTADLVVVG
AGYTGLWTALHAAERRPGTRVVVVESDRVAWAASGRNGGFVDASLTHGLE
NGKSRWPNEIELLERLGMDNLDGMQADIDRLGLDVDWQRTGMLTVATEPH
QVPWLQEAAGAGEGRFLDEQAVREEVHSPTYRAGLFSPDTCAIVHPAKLA
LELARACTEAGVQIHEQTPATSLETRGSTVCVHTAAGRVTARQAVLATNV
FPSLLRRNRLHTVPVYDYVLATEPLTEEQLARIGWRNRQGVGDSANQFHY
YRLSADNRIVWGGYDAVYHFGRKVESAYEDRPQTYRRLAAHFFLTFPQLH
DVRFDYRWAGAIDTNTRFCAHWGLARGGRVAYVNGFTGLGVAAARFAADV
CLDLLDGADTPRTRLEMVRDKPLPFPPEPLASIGINATRWSLDRADHSAG
RRNLLLRTLDALGLGFDS
108799825YP_640022.1 hypothetical protein Mmcs_2859 [Mycobacterium sp. MCS]MTIRYDQPGALARAGNEVIRWLAEAGISIAGSHALRVRGRKTGMPRSVVV
NVLSVDGRRYVVSPRGNTQWARNARAAGEVEAGPRWRRRRVRIAEIPDTD
KPELLKRYLDRWYWEVKGHVGGLTPQSSDDEMRAVAPSIPVFELLG
108799823YP_640020.1 hypothetical protein Mmcs_2857 [Mycobacterium sp. MCS]MGQSGDILAAMANQTPVQIAWVTRDMDATEQALSALLGARRWVRMPGVHF
GPDSCRFRGRPADFVADVALSYAGDTQLEIIAPVRGESLYTEFLERCGPG
LHHVCREATDPADFDAAVRDAERHGATVVADGVMPGGMRFAYVTAEDAGV
PYIEIACLTDDIRTFFDYVKQEQQP
108799821YP_640018.1 hypothetical protein Mmcs_2855 [Mycobacterium sp. MCS]MSDPSARIEDMFDGSLPGIGDFSALSDAELVAASAGWARAENAATARKLA
AMAELFRRRTGCDTATDRHNWFVDPDANAVSELAAAHNITERLAMFQTHR
AVALTDRLPQVAALFTAGLITDLLVRAIVTRTALITDPTLMAAVDTDLAA
QITNWGPQSEKKTLAAIDAIVETHDPGALRRVKDAENDRGLQFGFISDAA
GFMTVWARMYAPDGAAFEQRVTDMAHTVCDEDPRTADERRNDALAAVATG
THLRCECPNPDCPGHRDTQPTKDVVVHIVTTEETLDAARTQTETQPEPEA
EPHAETEPQHEPEAEDEAQPEPEAEPQAEPEPEPEAEAGPTPEAEAEATP
EPEAGPEAEAAPLAEAATQPPPTPQQSACRAPAFVIGAGVTNPTVLAAFL
HRARLRTIQHPGNAPSEPHYRPSAALQDFVRCRDLTCRFPGCDAPATRCD
IDHTVPWPAGPTCAANLKCLCRKHHLLKTFWTGENGWRDQQFTDGTIVWT
SPSGQTYTTRPGSALLFPTLCTPTAEAPIQPTKNTKDTTTDRGLKMPKRR
RTRAQNRARRIQEERRLNDDLVAERNKPPPF
108799819YP_640016.1 ABC transporter-like protein [Mycobacterium sp. MCS]MFRPSIDWGSELANSTVWVLGCFLITAPCLLLVLAAVGRFTEWGRQFRRI
TGRYFTGTQSVPVWAGLAALLLSSIVLVRISVLLSYYANDLFTSLQVAFQ
GGRDDGSGEQGFWATMLVFVVLAGCFVARLLADLYITQRFIMRWRIWLSR
NLIDDWLDHHAYYRGRFSRQPVDNPDQRIQQDIDVFTTGVGRQTNNPAYT
SDRVLLFGAVQAALSAGAFSVILWQLSGPLTLFGLTLPRALFWIVIAYVV
VVTYVAVVVGRPLIRLSYLDEVRNAGFRYALVRLRDAGTAVGMYRGERAE
AALLDNRLSAVMTNYRRWLNRTLLFIGWNVSMSQAINPLPFVVQAQRLFA
GQISLGGVMQSATAFGVIHDSLSFFRNAYDEFAGYRAATIRLDGLVTENA
RARSLSRITTDASVTGALCIDGLDVRAPDGRALVEGLDLELPAGETLVIR
GESGVGKTVLLQTLAGLWPFATGRVELPVGDAAMFVPQLPYLPLGDLRTV
VSYPRHEVRVDDREIQRALAAVALSHLVIICRFQAERSGAGESAAPLVAA
AAAAEKSCRTSIRRVTRRSRCTARLGEVRDWSQVLSVGEQQRIAFARILL
ARPTAVFLDESTSALDEGLEAMLYTLLRGELPSATVVSVSHRATVERFHG
HELRLLGDGDWRLARLARAG
108799817YP_640014.1 N-acetyltransferase GCN5 [Mycobacterium sp. MCS]MTLRFHSDVDDFVSTATAWYARRPMVHTIELSLLREGVPSEETPVLMTVW
DGDGAVLLGAAIRTPPLPLLCGGLFAAPTAEVVGDMAGAGMTLPGVRGPR
EVADGFARQWCTVTGAARADTTAERLYRLAALTAPAGVPGTHRVARRSDE
PVLIKYQSEFAAEAFGYQPDPSLARATLATAREAGNAYLLWTAGGAPVSM
AGVRRPAAGVSRIGPVYTAPEVRGHGYGAAVTAAACRWALAAGAEQVVLF
ADLANPTSNRVYQRLGFVPVGDSITVEFRVP
108799815YP_640012.1 CDP-diacylglycerol-phosphatidylglycerol phosphatidyltransferase [MycobMDASASGERDRVLTVPNALSVLRLVLVPVFLWLLFGAHANAWAVGVLMFS
GFSDWADGKIARLVDNQSSRLGELLDPLVDRIYMVTVPLALAVHGTVPWW
FVVTLLGRDVVLAATLPLLRSRGLAALPVTYLGKAATFALMSGFPLVLLG
QWDALWSRVVLACGWGFLGWGMALYLWSGVLYLVQVVMVAQRLPKVRTGG
108799813YP_640010.1 hypothetical protein Mmcs_2847 [Mycobacterium sp. MCS]MIGIAALLAGIVLGLVFRPSVPDFVEPYLPIAVVAALDAVFGGLRAYLEQ
IFDSKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNA
AALRRRLFGA
108799811YP_640008.1 glycine cleavage system protein H [Mycobacterium sp. MCS]MSEIPAELYYTDEHEWVLRTGDDTLRVGITDYAQAALGDVVFVQLPDVGA
ELTSGESFGEVESTKSVSDLYAPVSAKVLAVNGNLEASPDLVNSDPYGEG
WLVDLQLDADDMEAALGGLLDADGYRGVVTE
108799809YP_640006.1 MerR family transcriptional regulator [Mycobacterium sp. MCS]MSQPDSAPLAGMSIGAVLDLLRPDFPDVTISKIRFLEAEGLVTPERTASG
YRRFTAYDCARLRFILTAQRDQYLPLKVIKAQLDAQPDGALPPSAQPYST
PYPAPRLVPVGTGDGAAAAAGVGPTQVRLSREDLLERSGVGDDLLAALVK
AGVITPSAKAGGGIFFDEHSVVIAQCAGALADYGVEPRHLRAFRSAADRQ
SDLIAQIAGPVGKAGTTGARDRADDLAREVAALAITLHTSLIKSAVRDVL
DR
108799807YP_640004.1 MerR family transcriptional regulator [Mycobacterium sp. MCS]MGDTPRQGELDLSTENTPEPAARVPSEPVQAGLFPDDSVPDELVGYRGPS
ACQIAGITYRQLDYWARTSLVVPSIRGAAGSGSQRLYSFKDILVLKIVKR
LLDTGISLHNIRVAVDHLRQRGVSDLANITLFSDGTTVYECTSAEEVVDL
LQGGQGVFGIAVSGAMRELTGAIADFPGERADGGESIAAPEDELASRRKH
RDRKIG
108799805YP_640002.1 hypothetical protein Mmcs_2839 [Mycobacterium sp. MCS]MVMSRDAEKDLGLVLSYLTGRKLTLDEVLAAVGMSRSTYYDRQGKGTLTT
TDTLLRAARNLDLNPVDLLIRYGRIAPTDVADYLEGEEGDHPFGLTAATS
PNTANPPERTRRRRRRSSLSDLAPRPDAPPL
108799803YP_640000.1 hypothetical protein Mmcs_2837 [Mycobacterium sp. MCS]MFVRLCNRHKPIPDTIGMALRGVRAGRAERRRSRPVPNTQETAHLHEYPP
DRPVTARGILSLATDSRAATVGLAARCGCVGRFGANPRGPPIGGRIFSSG
SQVAPASAILRAAEGKSGIPELTIAAKAPAAACDPIGQQPPRRSAEIAGP
RRAAHRGRS
108799801YP_639998.1 beta-ketoacyl synthase [Mycobacterium sp. MCS]MTPATLDDARLRDWLVTYLTTHVECSPESIDFDASMADLGVGSRDAVVLS
GELAELLGRPVSPVDFWQHPTINSLIEFLSAPVTEVETQAVVEGPRISGT
EPIAVIGLGCRMPGGISDPDALWDLLADGRCAVGKVPPERWQPFDDGSPE
VASALAGTTRWGSFLDDIAGFDADFFDISSREAVKMDPQQRLLLEVAWEA
LEHAGIPAASLRRSQTGVFAGACFSEYGYLASTDLPRVDAWSNTGGALSI
IANRLSYFLDLRGPSITVDTACSSSLVAVHLACQSLRSGDSNLALAAGVN
LLLSPAVFHGFDQAGALSPTGMCHSFDAAADGFVRGEGCGVVVLKRLPDA
LRDGDRVLAVVRGSAINQDGRSNGLMAPNPAAQMAVLRSACANAGIEPQD
MDYVEAHGTGTFLGDPIEARALGSVMGRGRPATSPLLVGAVKSNLGHLEA
AAGVAGFIKTVMALQRGRIPGNAGYESPNPHIPFDQLRLKVVDHEQEWPS
VSRARRAGVSSFGFGGTNAHVILEQAPDAIAAEPHPAAAVSTLIVSGKSP
ERIEAAAAAVAEWMSGPGAGVALGDVAHTLNHHRAHHQSFATVCARDGVD
AVAGLQALAARLPADGVVKPHEGPCGSGTVFVFSGQGSQWAGMGRRLLAD
EPVFAAAVAELEPVFVEQVGFSLAQVLADGEAVTGDARVQPVIMGLQLAL
TELWRSYGVTPDAVIGHSMGEVTAAVVAGALSPTEGLRVIAVRSRLMSRL
AGQGAVALLTLGADAAEALIADHPDVAVAGYVSPGQTVVAGPPAEVDAVI
AAVQSQNRFARRVNMEVASHTALMDPILDELRSELADLTPNTTAIPFIST
VEDSATPLLDADYWVANVRRPVRLSQALATAAESHTTFVEISAHPMLTTA
VTETLGDLHHHALGTLSRDTDDTVTFHTNLNTTHTTHPPVTPHPPEPHPV
LPATPWQHNRYWMDLTPLRRTATDAAPQGDSSAGVLPAEWNCELTWPSRP
VAGGERVAGSWLVVGNAALAAQIRRDLGAGAEVAVLDEDTPDTRLEDALA
AADHVVYAPAVPAVFDAAQGRRLFDVARRIAVAMARMTDPGRLILLTRNA
QPVTEGDRANPAHAVLWGLGRTLALEHPEIWDAVIDLDELVPDRLAARYL
LAEATAEGGEDQVVYRDGTRRVARLRRTPLSQASGDGLDPAGSHLVVGAT
GNIGPHLIQQLADMGAKTVVAVSRNPGDRLRELGDTLAARGVTLVTVAAD
AADEESMRAVFDRFGADLPPLAGIYLAAFGGGPVMLAEMTDDDITAMFAP
KLDAVAVLHRLSLTTDVQQFVLFSSISGILGSRWLAHYTATTTYLDAFAY
ARRAAGLPATAVNWGLWKSLADNYSEHERQITVESGLEPMPDEVAIQALW
SITAPGTPARSTVVAADWPRLAAAYRTRAALRIVDELLPVESTDDERADT
PTSVPETEFRRELRACPADERGYLLSTHIRALVASSMGLSSAQLVDPSAG
FFQCGMDSLMSVTLKRELGESLGESLPASVIFDYPTVDGLTEYLATVLPE
MLEIADESDVDDYDEFSDDELLQQLSERLS
108799799YP_639996.1 beta-ketoacyl synthase [Mycobacterium sp. MCS]MAAATPDRRAIITEALRKIDDLTARLEVAERGQYEPIAVVGMGCRLPGGV
SDPDGFWQLLQDGRSGIVRVPPKRWDADEYYSADTSVPGTICTREGGFLT
GWEPDEFDAEFFGISPREAAAMDPQQRLLLEVAWEALEHAGITPDRIRGS
QTSVFVGMTGYDYMLKLSDGLDREEYDAYVPFGNAANFAAGRLSYFLGVR
GPAVVVDTACSSSLVSVHLACQSLRRRESDTALAAGVNLMLKAEANVALS
RWGMLAPDGQCKTFDAGADGYVRSEGCGVVVLKRLGDALADGDRVLALVR
GSAVNQDGASSGQTVPNGPAQQALMRQALAASQLGPADIDYIEAHGTGTA
LGDPIELDALSAVFGDRGDAAPLVLGSVKTNLGHLESGAGITGFIKTVLS
LRYGYIPKHLNFTQLTPHAGPGASQFTIATDGMEWPAVTRARRAGVSSFG
VSGTNAHIILEQAPDVVAAEPAPDPAVCTLVLSGKTEKRIATTAEALAEW
MTGPGSAVGLAEVAHTLNHHRARHAKFATVCARDQGQAVAGLRALAAGQA
APGVVNPHDGPCGSGTVFVFSGQGSQWAGMGRRLLADEPVFAAAVAELEP
VFVEQVGFSLAQVLADGEAVTGDARVQPVIVGLQLALTELWRSYGVTPDA
VIGHSMGEVTAAVVAGALSVRDGLRVIAIRSRLMSRLAGQGAVALLELDA
PAAEAVIRSHPQVEIAGFVSPTQTVVAGPPAAVAAVIDEVTDAGKFARRV
NMEVASHTALMDPILGELHDELADLTPQTPDIPFFSTVADSISAPLLDAN
YWVANVRRPVRLHQAVSAAADAGHTTFVEISPHPILAHAVAETLGENHHH
AIGTLARDTDDTHTFRTNLNSAHTIRPPATPHAPEPHPQLPTTPWHHTRH
WFDSARPQRTTQHSGRRSTAPAAGDVIPAEWRCELVWHAEPPTTPADTTA
HHWLVIGSADLAAPLTGAGHSATVLAEGALDDHGALADALAGATHVLYAP
ATTSGVFDAAPGRRLFDAARTLVDHLAQAPTPAKLWILTRNAQPIDEGDR
ANPGHAVLWGLGRTLALEHPELWGKVVDVDELVPAELVARYLVGEAAAGD
EDQIVYRAGVRRVPRLHRHGNTAGSQASIDPDAAHLVVGATGNIGPHLVQ
QLADMGARTIVAVSRNPGTRLQHLTQTLADRGVTLTTVAADASDEPSMTP
LFQRFGTDLPPLGGIYLAAFGGGPVTLLDLTDDDVTTMFTAKLDAAAVLH
RLSLAHPVRQFVLFTSISGLIGSRWLAHYTATTTFLDTFAYARRAAGLPA
TAINWGFWKSLADNESDEYRQVTINSGLEPMPDEVAIQALWSTIGPDSPV
RSTVVAADWTRLGAAYRTRAPMHILDDLTTTDVDDGATGEGWVGVESVRE
MDAADARRVIADRTLTRLAGVLGYADSSALNPAVPLIEFGMDSLMAVRIR
QATRNDFGVEPPVSLLLQGGSLDDVTADVLSQLGIAEPGTTAVDGVRERA
NQRAAARRGAAVRRKKGQLL
108799797YP_639994.1 daunorubicin resistance ABC transporter ATP-binding subunit [MycobacteMQDSRTANSDKSVVVKGISKSFGDVHAVRDVSFDVGRGEVVALLGPNGAG
KTTTVDILSTLTKPDSGKATIAGFDVVSEASSVRRSIMLTGQQVALDDML
TGRENLVLFGRLQGLAKKAAEARADELLTAFDLQHAANRRLSTYSGGMRR
RIDIACGLVVRPEVVFLDEPTTGLDPRSRQTIWDLVSGFKDVGIATLLTT
QYLEEADALSDRIIVIDHGGIVAEGTADELKERTGGSYCEIVPRDLNDLP
AIVDALGSLIPEQNRAALTAASDRIAMPAPDGPNTLVEALSRLNSASIQL
TDIALRRPSLDDVFLALTADSESAAADDSDTADDGKSKELVGSSAGGSGR
HRRNGRGSLTTSDLAS
108799795YP_639992.1 daunorubicin resistance protein C [Mycobacterium sp. MCS]MTMTHNGTRPADSTILQEDSFPKINRPRRENSPRTLFPHAWVQTKRLLMR
FLRDPMTFFFGVVFPIFMLLVLDIVLGDAISAVTGNSAVYGSVPLMTVIG
AMNGASVGAVGIIAEQNDGMLARLWVTPIHRASGLLARITAEALRVVINS
VLLLAVGFALGLRFEQGIPAAVAWVCVPVLFGVAFAILVLTVALYWPSPT
MVNAIVLVNSLCLFFSSGFVPLNQYPSWVQPAVEHQPVSYAIETMRGLSL
GGPVLEPGIGILAWSGGIILACLIPMVIGYRKASMRG
108799793YP_639990.1 O-methyltransferase-like protein [Mycobacterium sp. MCS]MSSTSWLARRRATDLGPGAADTVHVELSGPPQTMLDMVFAKALDAESPHP
VLGDNYARDLINRVDYDRRRNPITKQRRRQVSSITVRAAQFDIWVHQFLA
VHERAVVLHLGCGLDSRVFRIDPGPGVEWFDVDFPDVIALRERFYPTRDH
YHLVAASVTDPAWLRDLPTDRPVLVLAEGVSMYLLEQDGIALMRRVVEHF
PAGEMQLDFWSRFGSRAQQKNNTVVRWSGSELGWSVDEPDDVLTKVPGTR
LVTAISLFDAETAQRLPKGLRRFSRVASRTPVLRKIVQLHRYAF
108799791YP_639988.1 PE-PPE-like protein [Mycobacterium sp. MCS]MRTASYLTTGAALQIVTLFGLAYATDSHLPGISPMAAVSIFIDGTKDILP
TTDSQDPDRMKGALDGAFDQCATSPCSGKNVFINYPREFGIMTGLGSHTY
DDSKSIAAEETIKAIKAAKSDPTYQAGDPIYVVGFSQGANAASDVIDQLR
KDGYDASGVTFVLLGNGARNDGGLWARLPAGVYVPLIGLSFGASTNPSLD
PKAPQVIQISKQYDGASDVPKYVMNPLAWANAALGFIYVHNGYYNDVEIP
DVNNNGFDQADIDALEDNPDYIVTKTGNVTDILIKNPVGQLPLTRPLLDL
GVPPEIVRALDPLLRAIIETGYDRPTDGKYAATPVHLELMPDPHQWVEDF
HAIAAGMEETQENLAELNHANLMQNNIPEPQTQTITASGTEEKSVVATTT
TGVVTTPKTGGETARTGPVGGQTWYKPFTPAPVTQAPPTATVPPTTQPVT
PVVNQDPAPTGGEVTTPSTSKPQVNINKSLQQINKAITGTVNTVVGALTP
KRSGGTTTTQDPSPSTQDPGPTDTEPSGGGTGTESNNETPAA
108799789YP_639986.1 hypothetical protein Mmcs_2823 [Mycobacterium sp. MCS]MGNKLRSVEGSSPCSAPAETVWEVWTDPSAWPGDVIEMGTVDGDFAVGAR
VGVKVKGGVKTYSTLTRVERPAIWTSETTFPGLKFTYEHTIENHGAGTLL
TERVIMSGVLASVAHRLLRSRLEETFTAVTGYIGRLAEARLPR
108799787YP_639984.1 X-Pro dipeptidyl-peptidase-like protein [Mycobacterium sp. MCS]MADSESDAGWFSPPPSPRRLRGVRSFSRYITMRDGVRIAVSVYLPADTAR
QTRVPTVVNQTRYYRAMELRQPLRAAFAGRPFHHIPSTARCRRRFLANGY
AWVDVDVRGSGASFGHRLCEWSPDEIRDGAQIVDWIVGQPWSDGSVGALG
SSYSGAAAELLSVAAHPAVRAVAPRFSPFDAYTDIAFPGGIHAVWFTETW
GRYNAALDRNAPHEVAGWWVRMLVTGVQPVDGDRRRRLRRSALAAHLDNY
DIDSQARSLTFRDDVAPSDPYHSDEGEAPELVGHPIDESGSINLFSPHNY
WRDVEKSGVAVYSYSGWFDGAYSHSAAKRFLTLGSAGNRLILGPWSHGGH
WHIEPHRDPVKSRFDHEGELLRFFDHHLRDRDSGIGAEDRVHYYTMGEGR
WKSSRSWPPPAEPRTYYLATERMLSTEPPETDSSVDEYDVDPTVGTGEHS
RWRTQVAVGEAVRYPDRNAVDRRLLTYTSAPLNRAVEVTGHPVVTLFLSV
TGDDATVFVYLEDVDAGGRVAPVTEGQLRALHRQVADAPAPYRQTVPYRT
FKRGDARPLSSGEIATLIFDLIPTSHLFRPGHRIRLALAGADASHFAVLP
GTPPTFGVHRSRLRASRIDLPVVTAN
108799785YP_639982.1 hypothetical protein Mmcs_2819 [Mycobacterium sp. MCS]MAGQARNDVIVEDAARGDGTRAGAAVRAYARAGGSRRLITAAIVGFVAFN
AGSTWLFGIAGKCGILHFASQFSGGSERFDWLVQGCTVPASVQQILLPDF
LVMAGYWLMFTAILIGGWWRITVPALQRAGWVLWLPSIAFACDAVEYVLL
SALMYKRPDGQFAYRGDGGLLNFVQMAVSSAKWLAVAAMVVAGLVSAAAW
FTRRDAVFPPAASPHPDPAPTDTEDDRTTGRGRGVLERLTTVLLVALTTY
VVAWVLGLFMTHCAIDSGQLGPAYCAPPPIPPDHFYAPSVVFAVVGLTCL
ALGAVAGRRGTAVRAVGAVLVGVSLFLALWLVWAPALFRSLDDVGTPALI
AAAVIAVSVAAGVAVGRPGTRWLALALRAVAVAGTALWALVVMYAVATSA
EWAAPWGSLRLSATSRWSVIIAATILVVVYVMHTAARRRRLHPAGDQTES
108799783YP_639980.1 malate synthase G [Mycobacterium sp. MCS]MTDRVTVGNLRVARALYDFITDEALAGTDLDPDSFWSGVDKVVADLTPRN
QELLARRDDLQAQIDKWHRQRAIGPHDADEYKQFLTEIGYLEPDPGDFTI
TTAGVDDEITTTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDVISE
EDGAEKGTSYNRVRGDKVIAYAREFLDGAAPLASGSYADATGFRIEDGQV
QVELGDDQWVGLADPDQFVGYTGELGSPQWSILLRNNGLHIEILIDPDSP
VGSTDKAGVKDVVLESAVTTIMDFEDSVAAVDAEDKVLGYRNWLGLNRGD
LSEEVSKGDKTFTRVLNPDRTYTTPDGSGELTLPGRSLLFVRNVGHLMTN
DAITDAEGNEVFEGIQDALFTGLIAMHGLKESDANGPLRNSRTGSVYIVK
PKMHGPAEVAYTVDLFSRVEDVLGLPQNTLKVGIMDEERRTTLNLKACIK
AAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKSQPWIKAYEDQNV
DVGLATGFSGRAQIGKGMWAMTDLMADMVEQKIGQPKAGATTAWVPSPTA
ATLHAMHYHQVDVYAVHKELEGKQRASLDDLLTIPLAKELAWAPEEIREE
VDNNCQSILGYVVRWIDAGVGCSKVPDIHDIALMEDRATLRISSQLLANW
LRHGVITEEDVKTSLRRMAAVVDEQNAKDPDFKPMATDPDSSIAFQAAQE
LILAGGTQPSGYTEPILHRRRREYKASVAGA
108799781YP_639978.1 hypothetical protein Mmcs_2815 [Mycobacterium sp. MCS]MGGDLFGVLLTVLLLGANAFFVASEFALISARRDRLEALAEQGKNSAVTV
IRAGENLSLMLAGSQLGITICSILLGRVGEPAVAHLLEKPFGLLGIPDAV
LHTVSFVVALSVVVTLHVLLGEMVPKNIAIAGPESAAMLLIPVYLVYIRA
ARPLIAFYNWCANATLRAFGVEPKDELDVNVSTVELSEMIAESVSEGLLD
PEEHTRLTRALQIRNRAVRDVAMPLDTIHAIPASAPGQGPTVAAVERALA
ETGYSRFPVTAPSGQYLGYLHIKDVLPLVDDPDAVLDRSMVRPLPQLPAS
LPLPDALSRLRRTNSHLALVTSADGAVTAMVALEDLVEDLVGTVRDGTHR
R
108799779YP_639976.1 inosine 5-monophosphate dehydrogenase [Mycobacterium sp. MCS]MRFLDGHHPVFDLTYDDVFVVPQRSDVTSRFDVDLSTVDGSGTTIPVVVA
NMTAVAGRRMAETVARRGGLVVLPQDLPISAVQQTVDFVKSRDLVVDTPV
TLAPDDSVSDAIALIHKRAHGAAVVVFEGRPIGLVTESTCADVDRFTRVR
DVAITDFVTAPVGTDPRKVFDLLEHAPVDVAVLTEPDGTLSGVLTRTAAI
RAGIYSPAVDRHGRLRIAAAVGINGDVGAKARALAEVGVDLLVIDTAHGH
QTKMLEAIRAVASLDLGVPIAAGNVVSAEGTRDLVAAGASIIKVGVGPGA
MCTTRMMTGVGRPQFSSVVECAAAAKDLGAHVWADGGVRHPRDVALALAA
GAANVMIGSWFAGTYESPGDLMHDRDNQPYKESYGMASKRAVAARTAGDS
AFDRARKALFEEGISRSRMSLDPTKGGVEDLLDHITSGVRSTCTYVGATT
LPELHDKVVLGVQSAAGFAEGRPLPTGW
108799777YP_639974.1 peptidase M48- Ste24p [Mycobacterium sp. MCS]MSALAFTLVALLLVGPVPALLARASWPMRAPRAAVVLWQSIALAGVLSAF
SAGIAIASRLFVPGPDGRPTATITSEIEVLGWPLWLLYVVVFALTLLIGV
RLIVSVLQVAVATRRRRAHHRMMVDLLGVSRDSVPTDVRRQATGLRVLDV
KQPLAYCLPGVRSRVVLSDGALKTMTRDEIAAILTHERAHLRARHDLVLE
MFTAVHAAFPRFVRSASALDAVRLLVELLADDAAVRTAGPTPLARALVAC
AAGRAPSGALAAGGPSTVIRVRRLGGLPNSLAIAAVAYLAAAVVLVGPTV
AVAVPWLTELHRLFIR
108799775YP_639972.1 hypothetical protein Mmcs_2809 [Mycobacterium sp. MCS]MTVLIEDPLIAGMAIKQTLPLHESSRRLRELYPECPRVYGVAVMGDLSRR
RWWPLTEALTGERLQAMFDVASAETDNRAAVAHQLAATLAHVVLGRVVPL
LVLEGRAWDTGLENLWVHVDSEGAIDWVGVVDPTVRALPDDPHFGDRRRL
RLGAPQGIVALPSEAALTTWIAHRSHRALAPLFAKLAAISDGAMSVPAMW
HLAGGAVVGAATQVPLLAGSSEWTSMRRAQAVLDALVGFGLPVRGAARGT
GGKVLLN
108799773YP_639970.1 urease subunit gamma [Mycobacterium sp. MCS]MRLTPHEQDRLLISYAADLARRRRARGLRLNHPEAVAVITDHLLEGARDG
RTVAELMVSGRDVLGRDDVMEGVPEMLHDVQVEATFPDGTKLVTVHHPIP
108799771YP_639968.1 urease subunit alpha [Mycobacterium sp. MCS]MTGLSRERYAALYGPTTGDRIRLADTDLVIEITEDRSGGTGLAGDEAVFG
GGKVLRESMGQSRATRADGAPDTVITGAVILDHWGIIKADIGIRDGRIVA
IGKAGNPDIMDGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHLICPQIM
EEALGGGITTIVAGGTGPAEGSKATTVTPGAWHLARMLEALDTWPLNVVL
LGKGNTVSAEAMWEQLRGGAAGFKLHEDWGTTPAAIDACLTVADAAGVQV
NIHTDTLNEMAFVEDTLAAIKGRSIHAYHTEGAGGGHAPDIITVASHPNV
LPSSTNPTRPHTVNTLDEHLDMLMVCHHLNPSVPEDLAFAESRIRPSTIA
AEDLLHDIGAISMIGSDAQAMGRIGEVVLRTWQTAHVMKRRRGALEGDGR
ADNNRARRYVAKYTICPAVAHGLDGEIGSVEVGKLADLVLWEPAFFGVRP
HAVIKGGMIAWAAMGDANASIPTPQPVLPRPMFGAAPAAAAATSVHFVSP
QAIEDGLADRIDVRRSLIAVADCRHVGKAQMPLNDAMPRIEVDPDTFTVR
IDGDVWQEQPAAELPMAQRYFLF
108799769YP_639966.1 urease accessory protein UreG [Mycobacterium sp. MCS]MPPHFLSADSTGQPHRHADRPKRVRTPGEPLRIGVGGPVGSGKTALVAAL
CRQLRDELSLAVLTNDIYTTEDADFLRRHAVLPDDRIAAVQTGGCPHTAI
RDDITANLDAIDDLVAGHDHLDLILVESGGDNLTATFSSGLVDVQIFVVD
VAGGDKVPRKGGPGVTFSDLLVINKTDLAPMVGADLDVMRRDSTKVRGER
PFVLISLTADPTAGPVLDWVRAQLRVPVQG
108799767YP_639964.1 NADH dehydrogenase [Mycobacterium sp. MCS]MSHPGATPTDRHKVVIIGSGFGGLSAAKTLKRADVDIKLIARTTHHLFQP
LLYQVATGIISEGEIAPATRVVLRKQKNVQVLLGDVTHVDLQNRLVHSEL
LGHDYATPYDSLVIAAGAGQSYFGNDHFAEWAPGMKSIDDALELRGRILG
AFEQAERSSDPKRREKLLTFVVVGAGPTGVEMAGQIAELADYTLKGTFRH
IDPTSARVILLDAAPAVLPPMGEKLGKKAAARLEKMGVEIQLNAMVTDVD
RNGITVKDPDGKLRRIESACKVWSAGVSASPLGRDLANQCDVEVDRAGRV
KVLPDLSIPGHPNVFVVGDMAAVEGVPGQAQGAIQGARYAAKLIKNEVKG
ANPAFRQPFEYFDKGSMATVSRFSAVAKVGPLEFGGFIAWLAWLALHLVY
LVGFKTKIVTLISWTVTFLSTKRGQLTITEQQAYARTRIEELEEIAAAVT
DTEREREQAAS
108799765YP_639962.1 short chain dehydrogenase [Mycobacterium sp. MCS]MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIV
FDNTDPAGVEEARSLFPHHLDTLVNVPAPQYPPADPRTFSLADHALAWRR
ALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENVVIAQAREGSVDAAIKA
ALSDWTAGQATHFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARM
ALFLSTPAARHITGQTMHVSRGALANFG
108799763YP_639960.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTGLAVRARVERRGVDVEFAVGRGEVLAVLGPNGAGKSTALHVVAGVVRP
DDGVVRVGDRVLTDTAAGVQVPTHRRRVGLLLQDPLLFPHLQVAANVAFG
ARSTGRSRANAVASARHWLDEVGAADLAGRMPRQLSGGQAQRVALARALA
AEPEVLLLDEPLAGLDVAVAGAMRRVLREVLTRDGRSAVLVTHDLVDVAT
LADRVIVIDGGRVAEEGPAASVLAAPRSPFGARFAGVNLVTGIAGHRGVV
RADGVDWHGVPADDVVSGEPAVAIFRPAAVAVYRQRPHGSPRNTVEVTVV
EVDSSGPAVRVRAGESASGAPGLAADITAESAAELRLTPGDRIHMAVKAQ
EVALYPAP
108799761YP_639958.1 hypothetical protein Mmcs_2795 [Mycobacterium sp. MCS]MKGNVRRCAVIGLAAIAPFASVALISPAVGNATECGFGTVYDAPSNTCVG
LPPPPAPPPPPPPPAWNGDITPYFSVGACVPIPIPFVPSICAGI
108799759YP_639956.1 putative phosphoketolase [Mycobacterium sp. MCS]MSETTLAPTLSDEELRLIDAYWRAANYLSVGQIYLLDNPLLREELRAEHV
KPRLLGHWGTTPGLNLVYAHLNRIIRERDADVIYITGPGHGGPGLVANAY
LEGTYSEVYSNIGEDADGLRKLFRQFSFPGGIPSHVASETPGSIHEGGEL
GYALVHAYGAAFDNPDLVVACVVGDGEAETGPLAASWHSNKFLDPVTDGA
VLPILHLNSYKIANPTVLARIPQEELESLFYGYGYRPITVAGDDPDNVHQ
QMAAALDECFDQIAAIQRAARLDSEPGRPLWPMIILRTPKGWTGPREVDG
KKVEGTWRSHQVPLSETHTNADHMAQLEQWLRSYRPEELFDDDGRLILEV
KALAPEGTRRMSDNPHANGGLLLRDLDLPDFRDYAVPVEEPGSQSAEATR
VLGTFLRDVIVRNQDRFRIMGPDETASNRLSPVFEATGKAWMAEISPDDE
NLEPSGRVMEVLSEHLCQGWLEGYLLTGRHGLFNCYEAFVHIVDSMLNQH
AKWLSSSAHLSWRRPIASLNYLLTSHVWRQDHNGASHQDPGFIDHVANKR
PEVVRVYLPPDANTLLSVADHCLRSRQYVNVIVAGKQPALTYLTMDEAVA
HCTRGLGIWEWASTTTGEPDVVLACAGDIPTLETVAAADILRRRLPDLKV
RVVNVVDIMRLQPESEHPHGLSDREFDSIFTTDKPVIFAYHGYPWLIHRL
AYRHANHEQLHVRGFKERGTTTTPFDMVMLNDLDRFHLVMDVIDRVESLG
TKAAGLRQEMADARLAARAYTREHGEDDPAISEWSWDSGYRADGTQSMAQ
DTGDNE
108799757YP_639954.1 short chain dehydrogenase [Mycobacterium sp. MCS]MTDAEMTVDLDFSLTGKVALVTGGASGIGAAIASAFAAKGARVAVADLNE
PGAQAHAAALATESSGFRCDVSDPASVAATVDAVAGTFGRIDILVNSAGV
ARLAPAEDLTLTDWESTIDINLKGTFLMCQAVGRRMLADGGGSIVNLASQ
AASVALDQHVAYCASKFGVVGVSKVLAAEWGGRGIRVNTISPTVVLTELG
HKAWDGPRGDALKKLIPIGRFAYPPEIAAAAVYLASDAAAMVTGADLVVD
GGYTVK
108799755YP_639952.1 sugar isomerase (SIS) [Mycobacterium sp. MCS]MRVGPEDAGLTALAGEVLAREADAVSALAGTVEGGVVAVARRLLDVTGKV
VTTGSGTSGIMAERLAHLLSVCGTPAVYLPAMDALHGGMGAVTAHDLVLA
ISKTGRSAELTRLTERLVDRGVDVVAITEDAQSPFALAATQVQALPRTPG
DADPGGMIALASTLVVGAWGDALAVVSMALRGHTLHDVVHSHPAGGVGAR
GHRPGDESAPVVRT
108799753YP_639950.1 ribulose-phosphate 3-epimerase [Mycobacterium sp. MCS]MNAAALLAPWHREFPGRLAGSVYAAPPAARASAARAMYEAGLGVHVDIMA
EGEGLPAGVGFTELEEIARAVPSGFDVHLIGSPAFVDAALPQVLTYAPAK
VFLPWAAFSEERSAAIRAAGGSAWVALWQEWDALSEPEPRWPAAPDGVLV
MLIEPGSRDRCRVERLAIVAACAAGLPVIVDGGVTEDVAPLCVTAGAEAM
VVGRALLAGTAYREEA
108799751YP_639948.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MTQKNPFDLTGRTALVTGGNQGLGRAFAFGLAQAGATVAISGRSAERNAK
VVEEAAAEGFALHPITADITRRDDVDRMTAEAISALGHLDILVNNAGTCY
HAESWDVTEEQWDSVFDLNVKALWACSLAAGAHMRERGSGSIVNIGSMSG
LIVNRPQMQPAYNASKAAVHHLTKSLAAEWGPLGIRVNALAPGYCKTEMA
PVDKPEFKQHWIDDTPMLRYAMPEEIAPSVVFLASDAASFITGSVLVADG
GYTAW
108799749YP_639946.1 ABC transporter-like protein [Mycobacterium sp. MCS]MAQALLECTDIEKSFHGVPVLKGITLNLQPGTVTALAGENGAGKSTLMKI
ISGQYTADHGTVTVKGNELTSGNTKDAVKHGVAIVPQELASIEDMTVYEN
LFVGRELTVGPFLNRRAMIAEAGDALAVFGVNIPPTARMGSLPVGLRQIV
EIVKAARTGAQVVMLDEPTSAISEREVEGLYSIVRRLREQGVAMVYTTHK
MAEIRAIADRVVVLRDGGLILDEAIDKVSDDDIVTAMIGRELEALFPERP
KPTDETVLEVKGLQVEGASEPVSFTVRAGEIVGLAGLVGAGRTELLEAVF
GARHSTAGEILVRGRLVKRNAPAAAIAEGMAMVPEDRKLSGVVLSMSVLD
NGSLPRLSAFSVAGWLRAKARTTAVSDVMKSVRLRSRNLSQEVGTLSGGN
QQKVVLARWLTGKVNVLLLDEPTRGVDVGARSEIYRIITEFAGQGMAVLM
ASSDMPEVVGLSHRAFVMRDGAVVGELDRDALDHPEVQESVFRLATALEA
RPDSMRTNQEAAS
108799747YP_639944.1 periplasmic binding protein/LacI transcriptional regulator [MycobacterMKLGTKTFAIASAAALGLGLTACGAGDTAANGDSTRIGVTVYDMSSFITA
GKEGMEAYAKDNNIELVWNSANLDVSTQASQVDSMINQGVDAIIVVPVQA
DSLGPQVASAKAKGIPLVPVNAALNSPDVAASVQPDDVAAGEQEMQMMAD
RLGGRGNIVILQGPLGQSGEIDRTKGINNVLSRYPDIKVLAIDTANWKRD
EAVNKMKNWISGFGPQINGVVAENDDMGLGALQALKEAGRTDVPIVGIDG
IEDGLNAVKSGEFIGTSLQNGTVELSAGLAVANKLAKGEQVDTKPVYVMP
AITKDNVDVAIEHVVTGRQQFLDGLTDLTDKNLETGDIAYEGIPGQKQP
108799745YP_639942.1 hypothetical protein Mmcs_2779 [Mycobacterium sp. MCS]MDTDMRTSTVIPAALALVALAACTGPAVVTTDDAGPAVSASSTATPPPLN
SANLVNAFHFGAPVDGFTQYFFTTPSGRWECAVVPRVQAGCQAADGAALG
IEGAPETVTDTAGEQTAPNAIVITRDGEPAFVALEGAPFRPDSATAGVLQ
FNQILAVAGFRCNVQEASGVSCVSERSRRGFTFSAEGFAPQYTDVPAGAV
VAPPTTTTR
108799743YP_639940.1 hypothetical protein Mmcs_2777 [Mycobacterium sp. MCS]MSTTPGRCRPSSRFAGAARGYESAMGASRDIVSRLHDQAGQTYAAEAGIR
LADKPMPLFQLLVLCMLASKPIDATVAMRAARELFAEGLRTPQAVLDANR
KTMIDAFGRAGYARYDESSATRLVEMAHAVNNDYGGDLRRLAEARDVAAA
RRKLKQFKGIGDTGSDIFLREVQDTWTWLRPYFDERATATAARLGLPDDP
VKLQRLAPDGTAALAAALVRVALDDDLFERVRGE
108799741YP_639938.1 ATP-dependent protease La [Mycobacterium sp. MCS]MAQATSVPVLFSNETIVLPGMVVPIELDDAARAAVEAAKVAAAPGESGEL
LIAPRLDDRYPTYGVLATIVQIGRIPSGAAAVVRGTRRAHIGAGVDGPGT
AMWVSVDEVPEPEITDQTRALAADYKKLLLAMLQRREAWQIIDFVNQLTD
PSALADTAGYASYLTPVQKRQLLETPDVEERLRALIDWTGDHLAEVEVTD
KIAEDVRSGMEKQQKEFLLRQQLAAIRKELGELGPDGEEGSDDYRSRIEA
ADLPEKVREAALREAGKLERASDQSPEGGWIRTWLDTVLDLPWNVRTEDS
TDLTAAREILDADHHGLEDVKDRIVEYLAVRARRAQRGLQVVGGRGSGAV
MVLAGPPGVGKTSLGESVARALGREFVRVALGGVRDEAEIRGHRRTYVGA
LPGRIVRAIAEAGSMNPVVLLDEIDKVGSDYRGDPAAALLEVLDPAQNHT
FRDHYLDLDLDLSDVVFLATANVIENIPQALLDRMELVQIDGYTSDDKVA
IARDFLLPRQRERAALTTDEVEVTDAALRKIAADYTREPGVRQFERLLAK
AMRKATTKLATSDEPITIDEPDLVEYLGRPRFMPESAERTAVPGVATGLA
VTGLGGDVLYIEAGATDGEPGLQLTGQLGDVMKESAQIALSYVRAHAAEL
GVDPKALDRRIHVHVPAGAVPKDGPSAGVTMVTALVSMATGRQVRSDVGM
TGEVTLNGRVLPIGGVKQKLLAAQRAGLSTVFIPQRNEPDLDDVPAEVLA
ELEVRPMTDVADIVAQALEPAAQESTPAVTRAA
108799739YP_639936.1 putative esterase [Mycobacterium sp. MCS]MKFVGKFRDTARRTWRRMAVVAVAAITLPGLIGFAGGSATAGAFSRPGLP
VEYLDVFSQSMNRNIRIQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFE
WYHQSGLSVVMPVGGQSSFYTDWYQPSRGNGQDYTYKWETFLTQELPAWL
EANRGVSPSGNAVVGISMAGSTALTYSIYYPQKFVYAASLSGFLNPSEGW
WPMLIGLAMQDSGKYNAESMWGPASDPAWRRNDPMVNINQLVANNTRVWI
YCGTGTPSELDAGTSGGNLMAAQFLEGFTLRTNVTFRDNYIAAGGTNGVF
NFPSNGTHAWGYWGQQLQQMKPDIQRVLGAQGAI
108799737YP_639934.1 alpha amylase [Mycobacterium sp. MCS]MTEPAWVEHVIWWQIYPLGFVGAFPADPPPTPDEHRLRRIVDWLDHAIAL
GASGLALGPVFASRTHGYDTTDHYSIDPRLGDDGDFDELVDQAHRRGLRV
LLDGVFNHVGTDFPRYREALDGGPEHPSSAWFRRRRNGFDTFEGHGELIA
LNHREPAVVDYTVEVMSHWLARGADGWRLDAAYAVPDGFWSQVLPRVREA
HPDAWFVGEVIHGDYAGRVAAGFDSVTQYELWKAVWSSLNDGNFHELDHA
LARHDEFLATFVPLTFVGNHDVTRIASRMDDPRHLEQALVLLFTIGGVPS
VYAGDELGYRGVKEDRAGGDDAVRPEFGSPPTEDSDIFRLHKYLIGLRRR
HPWLHWATTSAVQLTNRQYVYETRHGDDALVVALNVDDAPLTISVGDTAL
RRGRVVAGSGAPPAEELDRLTVPPHGWVVVAPA
108799735YP_639932.1 hypothetical protein Mmcs_2769 [Mycobacterium sp. MCS]MTVSLGRDVEPYYDLGSYHRAVETPSPQAQTWFDRGLIWAYAFNHEEAIR
CFERALELDPDLAVARWGIAYSVGPNYNKPWEAFDPVDLGASLARARMEL
RLALNGRASAVERGLIEALQARFPVDDPGAPEALQDGHRVYADAMVELAA
AYPDDVDVQALAADALVNITAWALWDTRTGEPAPGSRVVEAKGILDAALA
TDAGRRHPGVLHLYLHTMEMSAAPEDALPAADLLRGLVPDAGHLQHMPSH
IDVLCGQYRASVTANLAAVEADRRFVERAGPLNFYSLYRAHDLHFVVYSA
MFEGSSEVALRAADELAGQLTPELLAIESPPMADWLEAFVPLRVHVLVRF
GRWDDLIAEPLPDDQVLHCTTTATIHYGRGVAHAAKGNLDQARAERDGFA
SAYVRIPESRYLFNNTSRDILAVAEAMLDGEIAYRAGRFEEAFEHLRRAI
ERDDSLPYDEPWGWMQPTRHAYGALLLEQGRVEDAAAVYAADLGLDPQLA
RSSQHPGNVWSLHGYHECLQRLGRTAEAAIVGQQLKLARARADVPITASC
ACRLDVADDCCSD
108799733YP_639930.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAARTHSADPRAERVRARLRDAALTLVGQRPVDDLTVADLVACAGVSRQA
FYQHFDDRDDAIATAFTAAFAAAASDLDGDARTRILRLFDFAADHRAMYR
NVVGSTVTQRVVSAFRAELLPACADIAEEAAPALGPVAALSPEPVSRFLV
GGLLEVLRSWMEDPDSDDLHTRVTAALDTVYALLKL
108799731YP_639928.1 isochorismatase hydrolase [Mycobacterium sp. MCS]MSETIDVPAEPTPFRLVAGKTALIVIDMQRDFLLPGGFGESLGNDVGQLL
KVVPPLAALVAAARAAGVTVIHTREGHRSDLSDCPPAKLSRGAPSKRIGD
QGRYGRILIRGEYGHDIVDELSPLPGEVVIDKPGKGAFYATGLQEILTAA
GITQLLVTGVTTEVCVHTTTREANDRGYECLVVSDCVGSYFPEFQRIGLE
MIKAQGGIFGWVAGSAAVIPALNAMTPTAA
108799729YP_639926.1 thioesterase superfamily protein [Mycobacterium sp. MCS]MSIVLGRRTEDSTPAAGTCSSAEVLEYTHIEGLSSADVVRLRETYEPLTE
SVRALIDATIRTQADAGTVAAARAEIDAVTARLRSRQLDGAFGVQFTSDG
DQMPWGNPVVGIRNPVAPPLVIHRDENDRVSTDFDLGAAYEGPPGHVHGG
VAALVLDHVLGEAASDRRTPRLTGTITMRYLRTTRLGRLHAEAQIARVEG
IKAFVVGHLADEDGVTVEAEGVFIKPRWAREEA
108799727YP_639924.1 hypothetical protein Mmcs_2761 [Mycobacterium sp. MCS]MEKVMLLLRSSGADEDWCTRLRTEVTPRLLDLGVPGLTLNVRDAPVRDSL
MTLTTLDPPVVAVLSLWTQQSYGGDVRGAVEVVTPECDAVAAYLVTESVP
MPGPVTSPGERTDGLANIALLRRPEHLDEPTWRTRWQIDHTPVAIATQAT
FGYVQNTVVRALTDDAPVIAAIVEELFPLAAVSDLHAFFGAADDADLADR
MQKMLASTEAFGANRDIDTVPTSRYVMRSPFVAG
108799725YP_639922.1 BFD-like (2Fe-2S)-binding protein [Mycobacterium sp. MCS]MFVCLCMGVTSHVVNDVVAAGASTSKEIAEACGAGSECGRCRRTLRAIIE
AHNVNGCPANYNGCPSRLPAN
108799723YP_639920.1 bacterioferritin [Mycobacterium sp. MCS]MQGDPDVLKLLNEQLTSELTAINQYFLHSKMQENWGFTELASHTRDESFD
EMRHAEAITDRILLLDGLPNYQRLFSLRVGQTLREQFEADLAIEYEVVGR
LKPGIIMCREKGDATSANLFETILADEEKHIDYLETQLELMDKLGEQLYA
AQCVSRPPH
108799721YP_639918.1 carboxymuconolactone decarboxylase [Mycobacterium sp. MCS]MSRIGDAARDFADDDVTAFAVRSPDLGAAMAAFSQAVYTKGRLPLRVREL
ARVVIANANECVVCQNTRDSDGEAAGVDEDLYRYSDQWRTWPGYSPAERI
AAEFAHRFATDHIGLREDDDFWARAAEHFDADLITDLALSCAMWVGMGRV
LRTLDIGQSCKITL
108799719YP_639916.1 limonene-1-2-epoxide hydrolase [Mycobacterium sp. MCS]MSVDDTVLGLWKALSARDWDAVKTHLSDDCIYADMPLGPALAARGPEDIV
KRLKVGLEPLAGYENHDGLLVTNCADVMYEHSETWEWPTGETAVLRFVTV
HRVENGKITLWKDYWDMSGLTATAPPTWLEDLATADTSWVFDATGMI
108799717YP_639914.1 short chain dehydrogenase [Mycobacterium sp. MCS]MTWRPDPDALRDRIAVVAGATRGAGRGIAAALGEAGATVICTGRNSRTGP
GGSDYDRPETIEETAELVTALGGRGIAYRVDHLDAEQVRTLADRLGSEHG
RIDILVNDIWGAEVLKGPPPTWGRPMWEHDLADGLRIVRLGLETHLITSH
ALLPLLTARAGGLLVEITDGTTEYNAAHYRISVFYDLVKCAVNRLAFSHG
HELAPFGAAAVAVSPGWLRSEMMLDNYGVTEADWRTALNADRADGRPTAP
PGFAESETPRYVGRAVAAIAADSDRQRWNQRSLTSAELAREYGFTDMDQR
QPDSWTE
108799715YP_639912.1 hypothetical protein Mmcs_2749 [Mycobacterium sp. MCS]MVSAVTSPAVLSVVRTSVRRMDGLSGAVDHLVASIAALQNASIDDLSYEQ
IVAELDRIKAAVWAVPSVEHRLTARLMDADPHELGATSIKEVLANHLRIS
RKAAGDRLADARQLGPRYTLTGERVQTELAHTANAVARGDIGTAHVRIIQ
EFVKKLPAWVSWERRDHYERDLVGHASALRPEDFGKVADTLLGFIDQDGT
EPDHHTHQRRCEFTVGRQQADGMSRVTGWLTPEARAHWDLIAAKYAAPGT
NLPHDDTHTGRDDRTTGQRHHDALTRAMRDHVQSGSLGQVAGVPASIVAT
MTLSELERAAGWAHTGGGNKIPIRDLIRMAAHSRHYLAVFDDHTEEILYF
GRAKRCATTAQRLALFARDRGCTHPGCTVPFYWTEAHHTHDYSRGGRTDI
NDLTLACQPANLLIEKTGWTTHRPGNGRTQWTPPADHDTGQPRINNHFHP
HRYLTDKSDGKDDDGKDDDDQST
108799713YP_639910.1 hypothetical protein Mmcs_2747 [Mycobacterium sp. MCS]MDTSTIVWIIVAVVVALLIIAALAMMARKRRNEKRHLEAQQIRQEVQEHH
QHVEQRDLVAQQSEAEARAAAAEAEAKAAEAARLRDVASTHREAVDTSRQ
ELDERRRFADELDPHTPKAEDMQADGQDAGRQGGLGGGRHEDTRHGGPQQ
GATQYPGGAQQSGYNQQPGYSQQPGGTQQPGYPQQPGAGPDNGRTATDRP
TR
108799711YP_639908.1 hypothetical protein Mmcs_2745 [Mycobacterium sp. MCS]MQFERFRTLAESKGPYASVYFDDSHNTEDAAAQRELRWRAVRDDLEEQAA
PAELIEALQPAVLDAPPAVGRSGRGLIVGADGVLLNEHLIRPIEIPVVRV
SSLPYLVPVVEHGDQHSTYVIVAVDHAGADIALHRDRSVVSDTVDGGGYP
VHKADSAETPGYGDPQRRSTEAGRKNLRAVAERLATLVDEASPEVVFVVG
EVQSRSDLAPMLDERVADRVVELDVGARHSGFADADLRHAVDQEFLRRRL
ATIEHAAEQFSQAIGQGSGLATQGLHGVCAALRAGAVETLIIGDIGDATV
VAGDDLLTLAPNEKLLSELGTAPAQTLRADEALPLAAVRTGAALVRTDER
IDPDDGIAAVLRYALA
108799709YP_639906.1 FAD dependent oxidoreductase [Mycobacterium sp. MCS]MRVVIVGAGPTGLFCAVALARRGHEVAVVDRDPGPPPVGRWRRRGVMQFD
HAHTFRMPVVDALRAEMPDVVDALTVAGAGIATDSKGSGTALLCRRSTFE
RVLHRIAALQDGITRHVGTVQRPHRVDGRVTGVVVGDRVLGGDLVLDASG
RAARYLRGLRPDAVGGDCGAVYATREYRLRTGAAAGPVNSPIGLSLSMSG
YAAIAFLHDGGTFSVTITHDGSDPRLRRLREDAVFEAVVGAIPQLADWID
PHRSEPLASVLPGGRLYNSYRPQVGTDGAPFLPGLISVGDAVCTTTPLAG
RGVTLGLMQSRALLDVLDSEREIETAAGVFDAWCEHHVRPWFDDHRRVDG
DRVRRWSGGEVDLTRPLPSDLIVAAADADPALGPLVGPYATMASLPASLA
PAEPRAREIFAGGWRPAVPPGPTRSELGDLCEVTPAIGAVSRSPAAV
108799707YP_639904.1 hypothetical protein Mmcs_2741 [Mycobacterium sp. MCS]MTEPSDKPADYDRQLPDDTSDDTVEAVGSVSEALEWVERARGHLYSFHQL
MGRADLLLGEACDKLRDAGHDEVADRLAAELVGRNVLYGRWTFQIVEDFD
DNYWSVFRDHERRVRDELQQGHRHVFEARMKEDRRSKGRPGHEGRPEG
108799705YP_639902.1 cyclase/dehydrase [Mycobacterium sp. MCS]MTMNAPAERIWDLVADVRNTGRFSPEVMEAEWLDGAAGPALGARFRGHVR
RNEIGPVYWTTCRVTACEPGREFGFEVLVGDRAVNNWHYRFTPVDGGTEV
TESFHLEDSALMRVFAVAGGQLRRRRNLRDMRKTLERIRSVVEGAEG
108799703YP_639900.1 chorismate mutase [Mycobacterium sp. MCS]MLRRLLAGLTVLGACSGAFAGIAPAHADPGGPLTALVDAAAERLSTAEPV
AANKWNTKAPIEDPARVEQVLVTVATDASARGVDPDRVRRMFRDQISATE
SIQYTRFAQWKLDPAVAPATAPDLASSRGVIDGLNRTMVDQMVAQWPLLQ
SPDCGQRVREATDAVAASRGLDELYRHALSFATRSYCG
108799701YP_639898.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium sp. MCS]MPETSSDAQGLTPHFEDVQAHYDLSDEFFRLFLDPTQTYSCAYFERDDMT
LEEAQLAKIDLSLGKLGLQPGMTLLDVGCGWGATINRALEKYDVNVVGLT
LSRNQQAHVQRLLDNQGSPRSKRVLLQGWEQFDEKVDRIVSIGAFEHFGR
DRYTDFFKMAYDALPDDGVMMLHTIIKPSDEEFAERGLPLTMNKLRFFKF
IMDEIFPGGDLPQARAVTDHATKAGFEVKLVQPLRLHYAKTLDIWAAALE
SRKDEALALQGQEVYDRYMKYLTGCADLFREGYTDVAQFTLTKG
108799699YP_639896.1 thioesterase superfamily protein [Mycobacterium sp. MCS]MSAAAFSMPVVPRYAEIDQQGVVFNGHYLTWFDEACTAFFDHIGVAYPDL
IATGLDFQVVHSEIDYAASVRWRDDVRVAVHCERVGSTSFTLGFAVSRLD
ASGGRQTAVTGRNVYVVVSTSDWAKRAIPDWLRSALTAG
108799697YP_639894.1 pyridoxal-5'-phosphate-dependent enzyme subunit beta [Mycobacterium spMQLVSIDDIRAAAARIRDDVLRTPLIPAAWAGTLWLKPENLQAIGAFKVR
GAFNAIARLDPAVRARGVVAYSSGNHAQAVAYAAARYGISAHIVMPEETP
RIKVDATRAHGAEVVLCAAGRREAVAAEVVERTGAVLVPPFDHPDIIAGQ
GTAGLEIAEDLPDVEHVFIPVSGGGLASGIGTAIKALCPGARVYGVEPEL
AGDTAEGLRCGHRVDWSIEDRNRTIADGLRSQPSDLTFAHLQRVLDDTVT
VTEGEIRSAVFDLALRAHLVSEPSGAVALAGYRRVAPTGRAVAVVSGGNI
ESALLREILAG
108799695YP_639892.1 ErfK/YbiS/YcfS/YnhG [Mycobacterium sp. MCS]MGTSRNRKGAVEARGRRRSGGPIRRPTYTGHMLRMFTRSVLVIAGSVAIA
MTGSVATGSAAISTPPAVTSIAPGTGDVVGVAMPLTVRFAAPVDNRFAAQ
RSLRITSPNTPDGEFTWLSDSVMQWTPTGFWPAHSPISVGAGDFMTEFRT
GASVVSVADIDAYTFTVSIDDEVVREMPASMGKAKFPTPQGTFRVLGKES
VVVMDSRTIGIPLDDPEGYKLTVYDAVRITWGGVYVHGAPWSTGSQGYAN
VSHGCINLSPDNADWYFNTVGMGDPVIVQA
108799693YP_639890.1 GntR family transcriptional regulator [Mycobacterium sp. MCS]MALQPVNRRSVPEDVFDQIVTEVLSGQMQPGQTLPSERRLAEVLGVSRPA
IREALKRLAGAGLIEVRQGDATTVRDFRRTAGLDLLPRLLIRGGELDLTV
VRSILETRLHNGPKVAELAAERGGPGLAERLDETVDALEAETDPVAAQQL
ALTFWDHVVDGADSIAFRLMYNTLRATYEPALPALATMMAEEVGRPDAYR
AVTAAIVARDPAGAADAARRLLEPATTALLDALGELEAR
108799691YP_639888.1 XRE family transcriptional regulator [Mycobacterium sp. MCS]MTLEPVTATHTAVTFGDVLRTWRQRRRLSQLDLAIEADVSARHLSFLETG
RSTPSRAMVLRLAEVLDVPLRERNHLLMTAGLAPVYPERGLDHPEMAAVR
DGVQKVLSAYDPYPCVAVDRHWNILSANAAAAVLLDGVAPSLLERPNALR
VALHPEGLAPRIKNLGQWRHHLIDRLRREVAASGSGELTALLAELETYPG
PSADSPDPSTVAVPLELCTASGDLLTFISTVTTFGTALDLTAAELSIEAF
LPADQATAAALVCRSASQGSPQ
108799689YP_639886.1 cytochrome P450 [Mycobacterium sp. MCS]MSSDRLRPNLPPGFDFTDPDIYAERLPVEELAEMRRVAPIWWNEQPIGAG
GFDDGGFWVVTKHKDVKEVSRRSDVFSSLEKTALPRYRDGTVGEQIERGK
YVLLNQDAPHHTHLRQIVSRAFTPRAVERLRAELDARAQQIARTAREQGS
GDFVEQVSCELPLQAIAGLMGVPQEDRKKLFDWSNQMVGDQDPEFAGNDA
IGASVELIMYGMQMAADRVANPGDDLVTKLVQADVEGHKLSDDEFGFFVI
LLAVAGNETTRNSITQGMMAFTDFPDQWELFKRERPATAADEIVRWATPV
TSFQRTALCDTELSGVTIKKGQRVVMFYRSANFDEDVFTDPYSFDILRDP
NPHVGFGGTGAHYCIGANLARMTIDLMFNAIADHMPDLTPVGKPERLRSG
WLNGIKHWQVDYTGSAAKPPAAQ
108799687YP_639884.1 formate dehydrogenase [Mycobacterium sp. MCS]MTTTPLKGDWQPTACILCECNCGIVVEVEGRSLARIRGDKNHPASQGYTC
NKALRLDHYQNNRGRLTSPMRRRPDGSYEEIDWDTAISEIATGFRRIADT
HGGDKIFYYGGGGQGNHLGGAYSGAFLKALGSYYRSNALAQEKTGEHWVD
AHLYGGHTRGEFEHAEVSVFVGKNPWMSQSFPRARVVLNEIAKDPSRSMI
VIDPVITDTAKMADFHLRVRPGTDAWCLAAMAAVLVQEDLCDETFLAAHV
NGADAVREVLREVPVAEFARRCGVSEDLLRAAVRRIAAAESVSVFEDLGI
QQSPNSTVCSYLNKLLWILTGNFAKRGAQHLHSTFAPLFRAGGVGRTPVT
GAPVIGGLVPSNVVPQEILTDHPDRFRAMVVESSNPAHSLADSAACREAF
SALELLVVVDVAMTETARLAHYVLPAATQFEKAEATFFNLEFPHNTFHLR
HRLFEPLEGTLPEPEIWARLTRALGVVDDAELAPLRAAARDGLAAYSTAF
LTALGANPGLNKVLPYVLYETLGPALPEGLAGAAALWGLAQKTAMTYPEA
VRRAGHADGNALFEAILNQRSGVTFTVHEYPDDFDLITHDDHRIALDMPD
MLGEVRALTAEREALTSAEFPIVLSAGERRAYTANDILRDPGWRKRDADG
ALRISVEDAAALNLRTGDRARITTAAGSAEAGVEVSEAMLPGHASLPNGF
GLDYLDADGTTRVPGVAPNSLTSSDWRDAYAGTPWHKHVPARIETVSSAV
GG
108799685YP_639882.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MTYVIGSACVDVVDKSCVPECPVDCIYEGDRVMYINPDECVDCGACRVIC
KMDAIFYETDLPEDQQRHLADNAAFFTEVLPGRDAPLGAPGGSATVGRIG
VDTPLIAGLARRDG
108799683YP_639880.1 2-nitropropane dioxygenase [Mycobacterium sp. MCS]MHTAICDELGIEFPIFAFTHCRDVVVAVSKAGGFGVLGAVGFTPEQLEIE
LNWIDEHIGDHPYGVDIVIPNKYEGMDANMSADELKGMLQSLVPQEHLDF
AKKILKDHGVPTDDSDDNALQLLGWTEATATPQVEIALRHPKMTLIANAL
GTPPADMIKNIHEAGRKVAALCGSPSQARKHADAGVDIIIAQGGEAGGHS
GEVGSIVLWPQVVKEVAPVPVLAAGGIGSGQQIAAALALGAAGAWTGSQW
LMVEEAENTPVQQAAYAKASSRDTVRSRSFTGKPARMLRNDWTEAWEQPE
NPKPLGMPLQYMVSGMAVAATHKYPNETVDVAFNPVGQVVGQFDKVEKTS
AVIERWVQEYLDATTTLNTLNEAAGV
108799681YP_639878.1 hypothetical protein Mmcs_2715 [Mycobacterium sp. MCS]MTVRRLAMVVGAIILVVGIAGLLVPVSVSGDDGKSVGCGNALISDTSGAE
AANNQGVANVPVLNQIVPHTDYVALCESAVGSRRAWAIPVAVVGALIAVG
AAVVGGRRTRNV
108799679YP_639876.1 putative anti-sigma regulatory factor [Mycobacterium sp. MCS]MIDSVSAANVSNAERFTRIGIAADGEAASQVREEFGHWLDAHFALDPVRS
SDLILATNEALANAAEFAYASADRPGTMDVEAEFDAQAGVLTVTIADQGT
WRDRATVPPSKARGRGIPLMEALTDSTSIDRSQGGTRVLLQWTGVAARPA
PSHDLSRG
108799677YP_639874.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MGRVDGKVALISGGARGMGAEHARALVAEGAKVVIGDILDDEGKALADEL
GDAARYVTLDVTQADQWEAAVATAVNDFGLLNVLVNNAGIVALGQIGKFD
MTKFQKVIDVNLTGTFLGMQASVEAMKSAGGGSIINVSSIEGMRGAVMVH
PYVASKWAVRGLTKSAALELGPHQIRVNSIHPGFIRTPMTKHFPDNMLTI
PLGRPGQSDEVATFVVFLASDESRYATGAEFVMDGGLVNDVPHKI
108799675YP_639872.1 hypothetical protein Mmcs_2709 [Mycobacterium sp. MCS]MTSVDERRELQQLAEQAGWRRNDLGRTDLYLRGDTRVRVIWRGTDAISGA
TLMQDDVMMTYTRELPTVNSWLKR
108799673YP_639870.1 competence damage-inducible protein A [Mycobacterium sp. MCS]MSARAGIVVTGTEVLTGRVQDRNGPWIADRLLELGVELAHITICGDRPAD
IEAQLRFLAAEGVDLIVTSGGLGPTADDLTVATVARFCGRELILDTELEQ
RIADILRRLMGRRTDVDFDALRAANRKQAMVPDGATVLEPVGTAPGVVVP
GSPTVLVLPGPPRELQPMWRTAVQTEALRSAIAGRTEYRQDMVRMFGLPE
SGLAETLRDAERDLAGFDRLEITTCLRRGELEIVTRYEPDAEPVYRNLLT
LLRDRHGSAIFSEDGSLVDDQVAALLAGHTIATAESCTGGMLSARLTDRA
GSSAYVAGAAVCYADAAKVELLGVPADLIADHGAVSEPVAEAMADGALRR
FGADVAVAITGIAGPGGGTELKPVGTVCFCVRRADGRVVTRTVRLPGDRS
DVRERSTTVAMHLLRRALQDG
108799671YP_639868.1 amidase [Mycobacterium sp. MCS]MDAVDNNSAFDLAGVDAIGQAQLIASGELTATELLDAALIRLSAARGLNA
VVHELFDRGREQAAALDASGRLRSGDAGPVAGVPFLLKDLGAAVGGAPES
MGSRALRTRIAPQNAWIVDRYLANDLVVFGKTNTPEWGNHCTTEPSLFGP
TVNPWSPDVTPGGSSGGSAAAVAAGVVPAASGGDGTGSIRVPASCCGLVG
LKPRRARTSFAPAGHLLEGLAVEHALTRTVRDSAALLDAVTGSDPGDPYN
AAPPAMPFLQALAQPPAPQRIALSTGSPFPGPATDPEIVAAVEATARLLA
DLGHRVEPAATAVNADAVADAIAVLHNVSNAQLHELASAHLGRPPADDEF
EASTWVMVREGFTTTGVQYAGAIETVHAETRRFVTGMAGHDVLLAPTLLT
PPPPYALLDQPRGTTRAFFDVEFATTGWTSLANVTGWAAISLPLGTTSTG
LPIGVQLMAPEETVLLQLAAQLEVAAPWADRRPAGWVAP
108799669YP_639866.1 hypothetical protein Mmcs_2703 [Mycobacterium sp. MCS]MPALTSFASVAAAVALTAAPLASVTAGVGPAPTAAAESGGTFLPFSSILR
RCDFSTRPYYDSAGSARATATVRTAGSQVTADVQLLLAKPNSYYEVRLVQ
APRASSAGCHAGAPGTAVAALHTDGLGGGAVTLSSPIMSGATGSWLAIDR
PQPHSQLPAEFYTTDYIVGI
108799667YP_639864.1 hypothetical protein Mmcs_2701 [Mycobacterium sp. MCS]MSASDLHLRPVTEADWPLMVRLDATNFGQVVPESALGAWRSLIPDGAALV
VADGDDVVGQAFFLDLQLTVPGGAVLPVAGITWVSVAPTHRRRGVLRSMF
TELHDRIAAAGRPIAALTASEGGIYGRFGYGPATTAHEWSVDRRTAQFRS
TTADPGGVRIVTPGEHLDDFAAVYDRWRKVTPGGLVRPRALWDDLLADRD
DDRAGGSALFAFLHADGYALYRVHGSGPRHVRVVELTAATAEAHAALWRA
LCGLDLMERIEIATHPADPLPYLLADARRVRTTAVVDDLWLRLMDVPAAL
QSRTYDRDLSLVLEVDDGFRCDGGRFALDIRDGRAVCTPTDAAPDVALDI
DVLGSLYLGGHRATAFTAANRLRGNDSDLITQLDRAFAADVPAELGFPF
108799665YP_639862.1 amidohydrolase 2 [Mycobacterium sp. MCS]MNVDDLILVSIDDHVVEPPDMFLRHVPAKYKEEAPIVVTDDKGVDQWMYQ
GRPQGVSGLNAVVSWPAEEWGRDPAGFAEMRPGVYDVHERVRDMNRNGIL
ASMCFPTFTGFSARHLNMHREESTLVMVSAYNDWHIDEWAGSYPGRFIPI
AIMPTWNPEAMCAEIRRVAAKGCRAVTMPELPHLEGLPSYHDEDYWGPVF
RTLSEENVVMCLHIGTGFGAISMAPNAPIDNLIILATQVSAMCAQDLLWG
PAMRNYPDLKFAFSEGGIGWIPFYLDRSDRHYTNQKWLRRDFGDKLPSDV
FREHSLACYVTDKTSLKLRHEIGIDIIAWECDYPHSDCFWPDAPEQVLAE
LNAAGASDSDINKITWENSCRFFGWDPFALTPKDQATVKALRAEGADVDV
SIRPRKEWARLYEQKQLAKA
108799663YP_639860.1 hypothetical protein Mmcs_2697 [Mycobacterium sp. MCS]MVDVAAFDRDGHLKIAQPELRGAAEAARAALWRQIGLSPDDPASWTQPVV
WAADMTGAGPFGELTRSTRLAETLDALCGVGGWQPRGALGNIPVRFPVSP
PGDDRGWHIDLSTPLPDGGWAVSGRPHTLLLLTLLSDVGPDDAPTRIRVG
SHRDVAAVLDATPVDFLEAGALVDRVSAGRPVAYATGSAGDMYLLHPFTA
HAADEHRGRTPRFMAQTPVVLSAPLGPASPSVPARVWSGGPA
108799661YP_639858.1 hypothetical protein Mmcs_2695 [Mycobacterium sp. MCS]MQTFLPCEDFDASAEVLDVRRLGKQRVEVIQVLRALTVPGYGWRHHPAAA
MWAGYEEALVRYGLQICAHWCRSGRADTCAATLVTDLGATVGAAAVRSQA
ELGAAGELPPWLGDEAFHRSHRAALVKKDPAHYRPLFPDVPDDLPYVWPA
SDRERRIPL
108799659YP_639856.1 hypothetical protein Mmcs_2693 [Mycobacterium sp. MCS]MAQAIQLPKREGAHRFWTARYALLASGGMFALVTLMSLVNSVSGTPYVSG
GDSPAGTDCSGLASWVSNAATGRPVYGDRFTTANMESELLARGFKHGSEP
GALVIGWNSGHAAVTLPDGTPVSSGEGGRGVKVGGGGAHQPQFTNRMFLP
APPEATVPAQPPINVPFPPPPPGAPLPPPPPGAPLPPPPPGAPLPPPPVA
A
108799657YP_639854.1 hypothetical protein Mmcs_2691 [Mycobacterium sp. MCS]MQTRDYAPGRSLDLYGAAGDPVVLLWHGMQTDARAAVRPLAERIAGHGFA
VVAPDWNSHADDDGRSDLLRSARFAADQTGAADGLIVVGWSLGGAAAVGL
TFGAAEYGLRIARTVCLAGAFMAPDPLSGEPLTPGAAAGPRVPVTLVHGS
GDDVVPVSASRDFSAELSGAGWRVQYVELAADHANIVGARYDAAADRYEP
SDDPASLNVAAEVAEIIAAPAG
108799655YP_639852.1 multi-sensor signal transduction histidine kinase [Mycobacterium sp. MMTAPARRRGGQLTVQGWLNVVLAVMGILVLAGAFAGAILMNRTDAVSREL
IEEIQPSRVAAYRLQAALRDQETAVRGYAIAADEQFLEPYYEGQQTEREA
AEEIREHVGDHANLIADLDAVEQATAEWRANYAEPFIRSVGPGAPVDNDL
VQRGKERFDNIRALFHVQNVDLAAARTAGVKELDEVRGWRDRVLAGIIVT
FFVTALALAILARSALVRPLSALAASCRRITEGHFDERIVAQGPRDVRSM
ASDVEDMRQRIVEELEASRAAREQLDEQAVELRRSNAELEQFAYVASHDL
QEPLRKVASFCQLLEKRYGDKLDERGVEYIKYAVDGAKRMQVLINDLLTF
SRVGRLSAAHTDVELDEALDAAVSNLETSIEESGAEIVRPEEPLPQVLGD
PTLLTMLWQNLIGNAVKFRKPDTTPRIVIECQRGTDDRDGQWVFTVSDNG
IGIAEEFSQKVFVIFQRLHGREAYSGTGIGLALCKKIVEYHGGSIWIDNT
YTEGTRFRMTLPVAVHEQPEVVLEGAQ
108799653YP_639850.1 hypothetical protein Mmcs_2687 [Mycobacterium sp. MCS]MTAVPSAPVMVVSLIRIRRSIGRRPATALAVAAAAIALVGCGADAPPQAP
PSPSSSTSQKSTATRPSATRTPTSTRTTSAAPQPAAVTPVTAADLGSTWR
PGCPLGPERLRRVELDHLGFDGRTHRGALVVHEDLVAQVIEVFGQLQRLG
YPIAKMRTVDAYPGADDELSMRDNNTSAFNCRGIPGSQAWSYHAYGRAID
LNPLLNPYIGGSGAVEPANAGPYVDRTRTDPGILHAGDPAVLVFTDRGWR
WGGDWRTPKDYQHFELR
108799651YP_639848.1 G-D-S-L family lipolytic protein [Mycobacterium sp. MCS]MSRLVTLVLSVALLVGLVVARPQPVRDDEMVTLQFAGSRVAVVGDSYTTG
SNEGGEGAKGWTTRAWQLLAAQGLPVRADVAAEGGAGYGTRGNRGSVFED
LTARAVKADDHLVVFYGSRNDERVEPTLFTIMVYGVFQLARRTAPEARLL
VIGPPWPTADPPPAILRIRDTLRYQSGLANATFVDPIAERWFVDAPGLIG
ADGVHPTDAGHVYMADKIAPLIATQLTRRV
108799649YP_639846.1 catalase/peroxidase HPI [Mycobacterium sp. MCS]MSSDTSDTRPPHSDSGTQSNSESENPIIDSPEPKAHAPLTNKDWWPEQVD
VSVLHKQNDKGNPLGEDFNYAEAFAQLDLEAFKRDVIEVIQTSQDWWPAD
YGNYAGLFIRMSWHAAGTYRIFDGRGGAGQGSQRFAPLNSWPDNANLDKA
RRLLWPIKQKYGNKISWADLIAYAGNAALEQSGFKTAGFAFGREDIWEPE
EMLWGQEDTWLGTDKRYGGTNEDKRELAEPFGATTMGLIYVNPEGPEGKP
DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGAADVNVGPEPEG
APIEEQGLGWKCPFGTGNANDTVTSGLEVIWTGTNSEWSNRYLEILYGNE
WELTKSPAGAWQFEAKNAEATIPDPFGGPPRKPTMLVTDVSMREDPIYGQ
ITRRWLDHPEEMDEAFAKAWYKLMHRDMGPISRYLGPWVAEPEIWQDPVP
DVDHELVDESDIASLKSKVLESGLTVQQLVKTAWASASSFRGTDKRGGAN
GARVRLEPQRSWEGNEPAELAKVLPTLEQIQQDFNASASGGKKISLADLI
VLAGSAAVEKAAKDAGYEIDVHFAPGRTDASQEQTDVESFAVLETKADGF
RNYIRPGQKTSVEKLLVEKAYLLDLTAPEMTALLGGLRVLNVNHGGSKHG
VFTNSPGALSNDFFVNLLDMNTAWKPSENTENVFEGRDRATGEIKWTATA
NDLVFGSNSVLRGIAEVYAQDDSKDKFVEDFVAAWVKVMNNDRFDLEKF
108799647YP_639844.1 hypothetical protein Mmcs_2680 [Mycobacterium sp. MCS]MVAKLELTRELSLDPDDAWTHASNLAELGDWLVMHEGWRSELPDELTVGT
TIVGVAGAKGMRNRVTWTIKQVDPPTLLQVDGKGVGGTKYGMKMAVRPTS
SGCAFTVTLELGGAPLFGPIGAAAARAVKGDIERSISRFEELYV
108799645YP_639842.1 hypothetical protein Mmcs_2678 [Mycobacterium sp. MCS]MHDMTIDGLTPEELSAESAIALPDKEVVSILDLNADVDVAIDAASPIDLA
AAANLNVAAPIDAAAGANVLSYGSGAQAVVDQGAMIDQNLEADAYASSTQ
VSGIDQGGMDTDADEVPPTDGTGTGTDTGTDGTGTTVDTSPAALLDGNLL
NVNVNVDLDADLAAPISGAVAANANVAAPINAGVAANIGSVDSDAISVAE
QDAIITQNLEGSATAISNQDSEISQGDSDAGDTTGGTADAGTDSGTGGTS
SADSGGSSDSGGSGSTGSSGDGGGSTAG
108799643YP_639840.1 hypothetical protein Mmcs_2676 [Mycobacterium sp. MCS]MGASCASGGVQRRVMRYLLIALYLGGWLLTTVLLLRRQFGDDERGRRDRL
VFNTVSVLCAVALAAVWPLSGWFLPLIRAALGRRDEE
108799641YP_639838.1 MOSC domain-containing protein [Mycobacterium sp. MCS]MIVVALHTAKARRLPVRSVDEVVAEAGLGLVGDRYHGTRHRHVSIQSAEL
LDLAARDLGRDFDYGATRRNITVDAGDIPTRPGTRVRIGEVELEVVRILA
PCRLLDDDIGAGAAAALRRRAGSACRILTSGTIRIGDAVTITEPPAEG
108799639YP_639836.1 NLP/P60 [Mycobacterium sp. MCS]MRRIYAVVICLALSLATAGTASAELFPLPTRNQQAVDLVIARALSQRGVA
FAYGGGNTAGPTLGNPGGSSAPAPAAPPPGAIPVDGTNGAIPIAGLPAAA
PALVLPEPPRPQVVGFDASGLMVYAFAGAGLKIPRTSGDQYLVGRKVLPS
QALPGDLIFYGPNGTQSVAMFIGGGQMVEATDPVVQVSPVRTNNMAPYLV
RYID
108799637YP_639834.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAVPKGVETDADASVAPPRGRRRDPRTQQDILSATRRLLVRDGYDQVSVD
AVAREAGVSRPTVYRRWPSKAHVVFDAAFQVNGSSEIAAGTGDFTADLRR
FLRSVVEFWREPVVYAATLGILAERHRSPELRIRAQQLLDEATRTRFTAL
VRDGIAQGAVAADMDADSLYDTVIGSTFYAVYVRDVTDGADLQAYLTHLC
SLATQGAADRDENR
108799635YP_639832.1 hypothetical protein Mmcs_2668 [Mycobacterium sp. MCS]MTARVARPAPIAFDDLAAPVYPEAARPLRDGLAAYGATLDLSPQALMSTA
VDRAGLTDFGEDGFRDRLGVLCDALDTEAALSDAGRAVAFEQLTQHLVNR
LRLQDLITRHPEILTVPIERPIIICGLPRTGTTHLHNMIAADPAIRYLPY
WESLEPVPAPGEDDPQGRRERCAAGLDLVHTVMPEFRRMHDMTVDHAHEE
IQLLANDIGGMLFETTFHVPRFADHYKAHDQSASYAYLKRTLQALQWQGG
GTRWVLKSPQHLEQFPALASTFPDATFVLTHRNPAEVIQSMATMISYAAR
MSCEHPDPIERTRYWVERSADLLTACVRDRDVLPADRSIDIRFEDFMADE
EATLAAIYAVAGQPFDDRARSAMAEFRADHPRGRHGGVIHRPADLGLDVD
QVAARLSDYQRRFVAS
108799633YP_639830.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MDQPPARPRGGRCDPVGEDRQVIPPRPTIPALLARSAREFGDQAYVISPT
ERLTYGDAERRSAEVARWLLGRGVGKGVRVGLFFPNGVDWIVWWLAVSRI
GALAVPLSTMYTPAELAKVVRLADVALVVGPSAVLGIDVAQRFEEAFPGL
ADQPAGRLALTQAPYLRSVVLTGGADRPWVTPHDSSEATVSREVLAAVED
EVSPADLAVMVHTSGSTADPKGVLHTHGTVVRQTSGWPAAVRAVTGSAGP
VRILCAMPFFWIGGLLAATGALHEPVTVLVLPRLDAQTALDLIERERATG
LVGWPAFTQRLRDHPSFAARDLSSAPMLRDGPLDIAMTDVPDGYPVHRTM
SETAGGFAFTEMAIVDDEGQAVPEGTVGELLVRGIGVMAGYNKRERAETF
DADGWYHTGDRVYRREGDPRLFYVGRTSELIKAAGANVSPLEVEAVVEQF
PDVVQCVVVGVEDPERGEQVCAAVVPARGEIDVTDLSARARTQLSAYKVP
TRWAVVGADQLPVLASGKLDRKAVKKMIADGVLPSVAPT
108799631YP_639828.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. MCS]MTLVTYELADHVATITLNRPEARNAINGALREDLNAAWNRFREDEDAWVG
ILTATGDVFCAGGDLKDGAGSVGTFAGTFWEKPTINSFESGMELFKPTIA
AVHGPCVGYGLTGVLFCDFVIASTAATFSFPEVSLGVPTIVGAIRLPERV
RWADAMELLLTGKPMTAQRAKEVGLVWRLVEPENLQAEAQAWARTLTEAA
PLAQRATKEVAWRTANMGWIESVRFGETMRKVAAATDDVVEGIQAWRDKR
KPQWKGR
108799629YP_639826.1 aldo/keto reductase [Mycobacterium sp. MCS]MSGDLLIGDAPFSHDPWVARRERYDSMPYRRVGDSGLLLPAISLGLWYNF
GDNRPFDVQREVLRYAFDRGITHFDLANNYGPPYGSAEENFGRMLRRDFK
PYRNELIVSTKAGWDMWPGPYGQLGGRAYLLASLDESLDRLGLDYVDIFY
SHRIDPTTPLEETVGALDTAVRAGKTRYVGVSSYSAAKTAEAAAIARRLG
TPLVIHQPSYSLLNRWIEGDLTTELRNAGMGAIAFTALAQGLLTDRYLQS
DPSEIDRATARPTFNDEHITDRVREQLRGLAGIAERRGQSLAQLALAWVL
RDPTVASTLVGASSVAQLEENLGALDNLDFTADELAEIDRYATESGIDLW
RESSDV
108799627YP_639824.1 hypothetical protein Mmcs_2660 [Mycobacterium sp. MCS]MRRLDLVIGPNGAGKSTFVAFTLAPLLPGSPFVNADEIARQRWPDDAEQH
SYEAARIAAATRSALIRSGRSFIAETVFSHPSKLDLIAEAHGRDYTVVVH
VLLVPEDLSVERVRHRVLAGGHRVSEDKIRERYRRLWDLAAQAIESCDSA
TVYDNSRRRGPRIVAQFTGGEPIGAPAWPEWTPAPLVQHWPA
108799625YP_639822.1 hypothetical protein Mmcs_2658 [Mycobacterium sp. MCS]MQRDQLDAVVTADRARSGVLMAITAQVSVQMGMAVAVGLIDRIGSDGTAW
LRLAWAGVLLLVVVRPRPSAFTWRTFGMCVVLGCVSAAITLLFMASLDRI
ALGTATALEFLGPLAVAVVHGSGRHRVVWPGLAAVGVVLLCRPFDGGIDV
KGALLAIAAGVCWAIYILLTQRVGDQVSGVNGLAVSMPVAGVVSSLFVST
AVFERMTPQLLLIGLGMAVLLPVAPYVLELLALRRLTTAAFGTLMSLEPA
FAMVVGFVLLDQAPGVAGILGIAAVVVAGIGAARGGGREMAVPLEVG
108799623YP_639820.1 acetamidase/formamidase [Mycobacterium sp. MCS]MATVTFPCSGLAPGAETLQQRRARVRMTAMDHVRFVPSPEQFAYTFGGAA
PVMRITPPTVLTLWTEDAYGGRITSTSDVATRALDTLDLNPQTGPFWIDG
AEPGDTLAIHLVDLTPARTWGASTLIPFFGGLTSVPVSPTLQDPLPERTY
IYEYDSAAETLAFSAQGSDFELALPANPMLGTVGVAPGRREVRTSLVPDV
FGGNMDTPEMAAGATCFLRVNVPGALFSLGDGHYRQGEGESCGTAVEGAM
HVTVIVDLIKGGGPAWPRLETDTHLACIGSGRPLEEAWRAGQVEMITWLG
ELHGLDRIDAYQLLTQISLAPIANVVDTNYSSVTKIDKRLLPTVAVYDGI
HAELRSAAASFGTITY
108799621YP_639818.1 FKBP-type peptidylprolyl isomerase [Mycobacterium sp. MCS]MADLLPPSAPVTSAAASTCPTAAPADGEPEWTFSGATGSVSVTGSTDAAA
PAVEVQAPFSVTETQVHTLKAGDGPVVAETAAVTVCYMGVNGRDGSVFDS
SYERGEPVDFPLDGVVPGFQKAIAGQKVGSTVAVAMTSADGYPEGQPAAG
IQPGDSLVFAIKILDASG
108799619YP_639816.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTKSDGVDTAARPRGAVVTGSILSAARDLIDQHGLESLTAEAVAAHAGVG
KTTVYRRWPNVWALVVDAFLEDVSAVAPITEGDTVRESFRTSMRSLIKAY
RGPTGTLLRAVIGRAQVDDVLREEVRNRWVEPRRESARELVRRGMDHGEL
RSDLDIDVVLDTLYGPIYHRILVPYRDADLTEGFVDRIVDHVFTGIERAR
108799617YP_639814.1 hypothetical protein Mmcs_2650 [Mycobacterium sp. MCS]MTSVGRRLVATSSVAAVAVFLAACGQDNSEAAPPSPSAIATGPAPISGPP
EALVVEMVIKGGTVTPANARMQGTVGEPIVLRVDSDTTDELHVHSVPEHS
FTVEPRSGQEFQFRTEVPGNVEIELHDLNQVVATVQVGPGS
108799615YP_639812.1 hypothetical protein Mmcs_2648 [Mycobacterium sp. MCS]MLSRAGVAEAVRSRLWPLPMFALAAALACGIAMPEVDAALDTRLPGAVER
ILFGGGADAAREVLSAIAGSLITVTSLTFSLTLITLQLASSQYSPRLLRT
FAADQVVQRTLALFLATFVYALTVLRTIRSNDESADFVPQLSVTIAYVLA
VVSVGALVMFLAHLVRQIRVESLLDQVCGDTVATAARMLRRREDGDAGTG
DPQAVTPPGRGVVIESGTSGFLVEIDEADLLATAVRHDVVLRMDRPVGSP
LTAGVPAARCWPGPGTQLDDQALRDIRQHVSAALRTGPERTSAQDPEYGL
RQLVDVVIRALSPGINDPTTAVHGLHSCTVALSELLGYHLGPHMVTDEHG
DVRVVIIRSSFAELLALVCAQPRLYGADDPAVRYAMLTLLHDLAWKATLP
DHRAAIAEQLTHLRRVAPQDVGTVDAQRTELLYREVLSVLDRQRDEDQER
S
108799613YP_639810.1 hypothetical protein Mmcs_2646 [Mycobacterium sp. MCS]MSAHNRTARARRFAVLAAAVAAASAATGCSDGYSALGTHTAEVLINGVDI
GERPRIRCEQVEWVWYVETLRETPGFGAQVKTGATVEPRAVRIDDLGNFT
GSFWEGTIGAASASIVEGTLILTGTAEGYFHDAPKEKATARFAIRTDC
108799611YP_639808.1 hypothetical protein Mmcs_2644 [Mycobacterium sp. MCS]MGLTPTHHFNTSLVIITAVALATSGCGEDPPLGSSNRGSGSETERTSVEN
AFIVPTFLPGRCAIQLDAGAEMRFTVANGDPTESERLLSVSTSASSDGDI
ASGVEIPAESTVSFGQPTTAAVDGGGTVSAVQLGRLAPNLTPGMSASVTF
HFDRAGDIEMPVPVEACPTQQK
108799609YP_639806.1 RNA polymerase subunit sigma 28 [Mycobacterium sp. MCS]MTVHAHPEATSTPGIDTPYDGNDVDVDRLFDRLAESADDSERERWRRHII
TACVPIADHIAYRFVGRGEPSEDVIQVARIGLIKTVDRYDPDKGHFLAFA
VPTIRGEIRRHFRDNTWTVRVPRKVQETQLRMRDAVNTLSQRLNRTPTGV
ELADELDVGSEELGDCQAATTAYRPVSLDAPLLTAQNDGDTVGSMQGGDD
PGYGRVEDLILLQEAISDLDPRRRAIVGMIFFDCLTQREVARRLHVSQVQ
ISRLLNDALARIRQRVNLDAAAALCVVGPFIGTV
108799607YP_639804.1 hypothetical protein Mmcs_2640 [Mycobacterium sp. MCS]MIGLGLWTALIPFIGPGVGFAYAPDDESVWTALRGWLQVLPGVVTVAGGV
LLLLSRNRATALFGAWLGVVAGAWLVVGRAAAEPLGLGSVDAPVATGGAR
EFWLEMTHFTGVGALIMFLAALSMGRLSVRSLRDIRYEHASAGTLDTTDE
HRHDPHTDPVRASKSAETEQRPMRKRLEHLIGTNTSTAR
108799605YP_639802.1 bifunctional deaminase-reductase-like protein [Mycobacterium sp. MCS]MGLIDIELFATLDLVGQSPGSPEEDPVGFSFGGWQAPLLDEVSGAQVDTA
YEGTDALLLGRRTYDIFAAYWPHQQGGEDGAIAALFNSIPKYVASRGRPD
LSWDGTTQLGPDLVGEVRRIRDRHERIKVVGSLNLVQTLLREKLFDRLDL
WVHPIVLGVGKKVFDGGAVPTNLRLLQPPAASPTGTVYLRYGVADGIPAT
GDMSAPDRGVGDQPATA
108799603YP_639800.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAIEDRRERERAARRRLIVTTARRLAEAEGWDAVTTRRLSTEIEYSQPVL
YKHFTGMDAIADAVATDGFGELAEAIRAVRSQASTPSDALARIARAYLDF
ARENNAVYDAMFTRATALRFAAEDTPSQLASAFGELREAVALVAGEEDAD
TLTELFWAALHGLVTLGRAGRLRADHGTERLRLLVDQFTGRQRTNL
108799601YP_639798.1 NIPSNAP domain-containing protein [Mycobacterium sp. MCS]MFQLRIYTLRSPESLYRYASVHWARHSATFDAFGVTTHGVWAERGGGANR
LVALIRYPHGADPEQVTREVMASPEFAADMTGFDVDEIVDVESILLDPAA
FSPIR
108799599YP_639796.1 hypothetical protein Mmcs_2632 [Mycobacterium sp. MCS]MAKRKWSDLSPKQQRAVVVLGGVETLATTAMLVDLARRPASKVRGPKLLW
RTLSVVQPVGPLAYFTVGRLS
108799597YP_639794.1 hypothetical protein Mmcs_2630 [Mycobacterium sp. MCS]MLSRGVTEYDQDRFVSDAGYVNELNQNIIAEFRANAGVVAAYGGSAVLLL
HTTGAKSGQPRLSPLAYSLVGGRMLVTGSYAGAPRDPAWVHNLRAIPRAR
IEVGTEAYDIDARELLGEERDTAFREITDQAPVFADYQARTARTIPVFEL
HRV
108799595YP_639792.1 glucose-methanol-choline oxidoreductase [Mycobacterium sp. MCS]MPDMSPVAEFDFVIVGAGSAGCLLANRLSANPDHRVLLIEAGGTDNWFWI
KVPVGYLYTIANPRTDWCFTTEADPGLAGRSIHYARGRVIGGSSSINAMI
HMRGQASDYELWAQATGDERWLWGGPDGAGETLSIYKDLEDYFGGADEWH
GAGGEIPVERPRVRWKILDAWQAAAAQVGIAPIEEFNRGDNAGSAYFHVN
QRRGRRWSMADAFLHPVSHRPNLTVYTQTQALQLLMDGQVHDAQRRGAWT
TAAHRATGVRLLKDGRTIDVRARREVILSAGAIGSPHLMQASGLGPASLL
TQHQVPVAVDLPGVGENLQDHLQLRTVYRVRGARTVNTLYRNWITRAGMG
LQYLLLRSGPMTMPPSTLGAFAKSDPALASPDLEWHVQPLSLAKFGEPLH
KFGAITPSVCNLRPSSRGHVRITSADPMTYPKIVCNYLSTDDDRRIAVRG
LRMTRQIMAAPSLARYCPEEMLPGPQLVSDDDLQQAARELGTTIFHPVGT
CAMGAFDTRGLPRSATTVLDTECRVYRVAGLRVVDASAMPTITSGNTNAP
VMMIAERAARAILG
108799593YP_639790.1 type 11 helix-turn-helix protein [Mycobacterium sp. MCS]MRRAERLYALVDLLRGSRRPLSAARLADEFEVSKRTIERDIQSLQLAGVP
IYADHGVSGGYSILREHSLPPLNLTVPESLAVLAGLGLLENSPYGAAARR
ARAKVVAISREDQLAPVDEALASMFVIDSQAPSEAAISLIPEAIAARRVV
RLDYTSEDGATHTTRDVEAMGLLRGGDSWMFVGWCRLREGIRGFHLDRIR
HLEITGEVFPERDSAVLDADLSRWRTRRLG
108799591YP_639788.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MARDAEATRARILAAATAEFSAHGYAGGRVERIAAQAQCNVRMIYAYYGG
KSGLFDATVADALRRMAENVPPRPEDLAGWAGDVFDHHQRFPEVLRLCMW
AQLERPEATDEPREAYRDKALAVATAAARPLSGVDVLVFVYAIAQAWQLS
PKGLTGLEENRAGSHGDAARRQSVVTAVERMLQAQS
108799589YP_639786.1 XRE family transcriptional regulator [Mycobacterium sp. MCS]MRAYGGWMDSTLDLRTEIREFLRSRRARIAPEMTGLPAYGGRRRVKGLRR
EEVALLAGVSVEYYVRIERGSLAGTSDGVLDALATALQLDEAERDHLFHL
ARQSGTPTGRRHPKPPATVRPALQEVLDAITGAPALIRNGRHDVLAMNGL
GRALYSPVLADPRRPANTARFVYLHPDEAEEFFVDYDQVARNAAAVLRME
VGRNPHDEELIALVGELSTCSELFRQQWASQDVRLHGYGSKRVNHPVVGR
LDLNFESMDLPTDPGLHLNVYTAPARGPAADNMALLASWASQETLAMELH
APGR
108799587YP_639784.1 MerR family transcriptional regulator [Mycobacterium sp. MCS]MSTDDLMTKALASLGEIDGPMSIEVIHRLAATTEVRASMSIAEVAELLDV
SAHTLRYYERVGLVEVDRDSSGHRSYRPAAVRRLVFLTRMRLSGMAIRDL
QHYIALVDSGDQTVPERLDMLLEHRDTIRRQIRELTLSLAATEYKITTYG
GTTGDTGAR
108799585YP_639782.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MTHFRPNVRDIEFNLFEVLGVDRLLDDGCYGDLDTETVRHIFEEVVRLAE
GPLAESYVQADRHPIRFDAASHEVVVTDPLRKSVLALKEAGWWRLGIPED
IGGTLAPMPMVWAVREILHSANLSAAFFNLGPEMAAALWEVGTPEQRRWA
AVAMERGWAGTMVLTEPDAGSDVGAGVTKAVEQSDGTWHITGVKRFISGG
DVGDTAENIFHLVLARPQGAGPGTKGLSMFFVPKHLFDPATMQITSRNGV
YVTGVEHKMGIKSSPTCEITFGRDQPAIGWLVGDVHNGIAQMFKVMENAR
MGTGVMSTGMLSTGYLSALDYAKTRIQGPDLTRTSDKTAPRVPIIRHPEV
RRSLLTQKSYAEGLRALYLFTAVHQDAVPQLARSVSHAEPELAAKINDLL
LPVVKAVSSERAYDTLKLSLQMFGGSGYLQDYPMEQYVRDCLINTLYEGT
TAIQAQDLLFRKIIRDDGQTLDHVLGLIVKFTESAGGSTFQQERALLATA
IEDIRSMVHTLRGHFDAAREEPTEVYRTGLGSVPLLFALGDLVIGWLLLW
QAKVANDALLQAHSDQGRQFYNGKITSARFFARTALPGISAIRAAVEAED
YGVMELAEEAF
108799583YP_639780.1 flavin reductase-like- FMN-binding protein [Mycobacterium sp. MCS]MTPQSQQCSAFPPGSALYRPPQHHFRGSLGRFATGVAVVTLDSPSGRHGL
TVNSFTSVSMEPPLVQISLQRTVRSHDLIRGVPFTVNVLGAEQEPLAWQF
AGRPAVDPVWIDGEFAPRLAGTLSYFECTPWAEYDAGDHTLFLGEVRNFD
YRQGDALGFINGRFTTIPESAVGHELLF
108799581YP_639778.1 dihydrodipicolinate synthase [Mycobacterium sp. MCS]MTARRDPHSIRGSITPLMTPFTDDGAVDHRSLANLVNWQLASGSHGISIG
GSTGEPGAQSVAERLAAIATVMKSVSGRAPVVAGTGTAQLDETIELTGRA
AELGIDAALVITPYYARPTQEALYRWYKTVAEEYPDLPILAYNVPVRTAV
DLAPETIARLYRDVENFVGVKETTKDFEHFSRVMHLCGPDIIVWSGIELL
CLPLLALGGTGFLSATANIAPAAHARMYELWIAGAHEEARAIHYGLHPLV
DLLFVETNPAPGKWLLKDLGLIASDHVRPPLITPTPGALERIAVLRRAGE
KFLTPVGDFALEGAFA
108799579YP_639776.1 3-4-dihydroxyphenylacetate 2-3-dioxygenase [Mycobacterium sp. MCS]MASVSPPDIVRCAYMELVVTDLERSRDFYVDILGLVVTEETSDAIYLRAF
EEFIHHNLVLRRGPVAAVAAFAFRVRSPEDVDRAEAYYKSLGVRTERRAS
GFTRGVGDSVRVEDPLGFPYEFFYDVVHVERMAWRYDVQGAGALVRLDHF
NQVIPDVPRGRKYLEELGFRATEDIRDDAGITYAAWFRRKDTVHDTALTG
GDGPRMHHIAFATHEKHNILYICDKLGALRRSDIIERGPGRHGVSNAFYL
YLRDPDGHRVEIYTQDYYTGDPDNPLVSWDVHDNQRRDW
108799577YP_639774.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSAEELVDGRRLRGSVTRAKAIEAAAELFAAQGYSATSMGSIASAAGIHS
ASIYHAFGSKEGLLGAVVEHASDEFYHLLREQSVSSGSLRDGLRGVGVVF
EKRPLFLKLLLMLVLERGDGDPGVLRIAADVRLKGRALIRDLLSRQVPAG
TGTDLDAASRLIMVALDGAFIARQVDMDASEFTTLMDLIAETAERLLTDT
RTRPNRG
108799575YP_639772.1 phenylacetic acid degradation-like protein [Mycobacterium sp. MCS]MDETMPDLLTDDRMSAHLGIQVKHREPGHAVVTMTVTSGMANGHGITHGG
AVFALADTAFALACNRSAGVMGVTVSATIDFIAASGVGDVLVARACERVE
RGRSGLYDVTVYRGDEVIAEFRARSRTVAAPSSRVTAVGHRESSSRQS
108799573YP_639770.1 fumarylacetoacetate (FAA) hydrolase [Mycobacterium sp. MCS]MKIATVLAAGRPVVTALGPAEQLVNVARLLSLPDLTVATLIADADRLLPK
LAAALSEPVAAEAVLDSADISWLAPQPHPSKIVGVAVNNSGIARFAYRQH
VEPAYFLKPPSALTGHREPIVVPPDYGLTHPEPELAAIIGRRIKAAQPEQ
ALEAIFGYTIINDITSPALKDRDSMELRLPSPVGADLTWRETHGEKDSSL
YLTYHARSKGSDTFAPMGPWITTRDEVVDPNALAVDCWLDDELVVSDSTS
KLTFPIQDVIAHLSNYMTLEPGDVVHFGTAVQPGANPKFPTLRHLDMSSL
DGTLSVEITGLGRLDNPIAHE
108799571YP_639768.1 hypothetical protein Mmcs_2604 [Mycobacterium sp. MCS]MSHDEALMAIRPSIETLVAEFAWLIDHESGRGVAELFTHDGEYEMGPVSL
SGRSEIEEFYRRRHAAGPRTSRHLFTNLRLRDVDGDSVRGTCVLSLHAAN
GVPPHPLSPVIVADYDDEYVRGEDGSWLFRRRTVTVLFGEPPKLPTGRH
108799569YP_639766.1 YaeQ protein [Mycobacterium sp. MCS]MALSATVFKVELGVSDVDHGYYADHALTVARHPSETDERMVVRLLAFGLR
AHRLGDVDGELAFGAGLSTPGVPDLRLADYTGRTLEWINVGQPDGRALGK
AASQADQVVLFPFAAGVATWWRTVGPKVAGLPNLSVVQIPHEPVQQLAQT
VDRRVAAQVMVMEGQVTMTLGGVDVTFTPEPLK
108799567YP_639764.1 phage integrase [Mycobacterium sp. MCS]MAAEELPGFVPRILRADDVSLLRADETVFDAMLDGWRAQMLARGLEIDTI
KARCRVIARFVEFTNEYPWRWRANDVDQFLAELRSQATPIALSTLRSYSN
AISMFCSYVSDSRYGWVDFCERQFRDVPSQIVFEWNTPQHTTDDAVPPGR
RAFTKAELQHLFDVVDDFVDDAHRKGSKRWLTALRDSTAFKIGYAFGLRR
RELVMLDLTDFGPNPHVPRYGNFGAMTVRWAKGTKGSGPRRRTVLTSPEF
PWVVDLLQYWCFEGRELFATADRSPALWPSERGDRLTLGALGRSFTAFRR
LAGLPPELSLHALRHSYTTHLLEAGYDPLFVQQQLGHSYASTTSLYTSVS
SDFKQKVIQQMITRRLQMGETNG
108799565YP_639762.1 hypothetical protein Mmcs_2598 [Mycobacterium sp. MCS]MARPRKPEDPQRWPVPCDRCGRHYQLVANWPNESVCGYCYQAAKRITGIC
ACGHQGVLPGIIDNRPACRRCSGVAINVDCVSCGVEAELYSGGRCQRCVL
GATAQRLLTSPDTGAIAPPLQVIVDALTTMERPNSGLTWIRQAHVQAVLR
DLARHHTLTHEILDGMPAGRTSDYVRSLLVEHGALPSRDERLARFQTWAA
TALERITRADHRKIISRFLRWNLEKRLQSMSPVTDSAFLRAKQSLTVTIE
FCNWLVAEHNTGMDQLTQSHIDLWQSTGPTTREHIARFIRWAIKSRLIPA
DLEVTPHRRGTAPRMPITEQNAVIEKVAHQQTLHPRDRLAAILVIVFAQQ
MEDVAALTWDRVTITAEAATITLADTPIELPPPLDEPLRALAASNYNKQT
AAHPKSPWIFRGYRPGMHLAPTHLRNHLRPVLASLEARLGTLNELTQTTP
IAILAETLGYSPQTLEAHAKASASTYSRYIATRLD
108799563YP_639760.1 hypothetical protein Mmcs_2596 [Mycobacterium sp. MCS]MGPCPLARCARPTKVDGKLLGQSRPRTRWRWRAIVTDLAAPQRVDPRNLL
SEWANASDEWVRFIVRHVLQGGGPLGNEEEADAYALFRQEKAFDTRELAE
ELPLATFESEDEAIEPLTLTSLSGVTGVNALVEGGLIEPHEGLTILFGEN
GTGKTGYSRIFKALAASRTADEILGNIEETSPQTKSAVVSYTLGSESKTF
TWTGQHGVAPFTRISIFDSPCVSFHVDVDLEYVYVPTVLALFNHVIAGIK
AVQAQLEQSVRDLRSGSTSILSRFPRGATVYPLIETLGAATDLEQLRAAA
DTDPDVDTRIAGLRRTVAALEADTIGAQIKLQQRVELILTQACTAANVVA
TFDVDAYNRELATLAGLESDYRTFRTTLFEAADLPAEPDDTWSAFIEAGE
TYQAHLVGLEAHDPARCLYCRQPLGDDARALVSKYSEFLEDKITVEIGAS
KSRLDSLIEPVISTQAGDAYTFASEYADTDEKPSFHAELDRVLATTRKLT
EQCRSAAIIEPSLTAPASEDSGLLTAALTGVTQTLTELRKQAASRAETLT
EKKKELVELEASAELTKSWTQIEALVRDAKQADRLTLLAKPMPGLLRAVT
GLAKTASDQMINESFDALFNEECIALRAPALRVEFVGRQGRAQRRKVLNG
KHKPSTVLSEGEQKVLAMADFLAEARLAGITAPVIFDDPVSSLDHRRINE
VAQRIAALAETTQVIVFTHDIFFATTLLTLMEETKRCSYFQVTDEDGKGQ
ITRATGPRWDSLNNLKRNINETIQAAKSQQGDARAALIRTGYDWIRAWCE
VFTETELLQGVTQRYQPNVRMTNLPKIKSVALPVAIETVNRIFEEACRYI
DGHSQPLPSLGVGPTLAGLEAHWLELTQARSAYNAAE
108799561YP_639758.1 integrase catalytic subunit [Mycobacterium sp. MCS]MAPSTYYDAKTRPPSARAQRDAVLGPALRQLWKDNYCVYGAHKLWKTARR
AGYDVGRDQVARLMRAAGIQGVRRGKRVRTTKPDPVAARHPDLVKRKFTA
TAPNQLWVTDLTFVPTWAGVAYVCFIVDAHSRMIVGWRVASHMRTSMVLD
ALEMARWSRGTTLQNLICHSDAGSQFTSIRYGERLAEIGGVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARSGPWKTVEDVELATLSWVYWHNTSRLH
SYLGDLPPAEFEAAFYDASRSGQPLVEIQ
108799559YP_639756.1 hypothetical protein Mmcs_2592 [Mycobacterium sp. MCS]MFRLWSRDQSIETTLKQIEHRVLDDVYLPLWVRRVAWVATIVLLMTGITA
WVVGVGLPLAASALGAGAAICSIMSLRRRRFRWCVAAAYLSGVSTVAGVG
AFWWSRTSSAGPVLASSTAVATVAAATLTAVWVSVTITPVTDSHPDMRQP
SKRKWGVRESGATITWPPPCAGPHHPNPK
108799557YP_639754.1 hypothetical protein Mmcs_2590 [Mycobacterium sp. MCS]MLAQPDLCTFVAIDCFAGRSVQAKQDIYPEIVNELIRLGIPAVHVTIVLR
ESALENWGIRGGQAACDVDLGFTVNV
108799555YP_639752.1 hypothetical protein Mmcs_2588 [Mycobacterium sp. MCS]MLIDEDDSRYDKGLRIRRAVIGDAYVDKALNEADDFSGPL
108799553YP_639750.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MDIGFIGLGHMGFEMAGRLIDAGYAVTVYDTRREPIDELVGRGAAAASSP
KDTAARAETVMASLPSLQASIEVATGPDGVIQGHRVKRFVDLSTVGAPTA
ERTAALLAERGVAQIDCPVSGGVGGARNGTLAMMVSGPHDHVDSVRPALD
VFGRVFFIGEKAGSAQTMKLANNLLAATTLAATAEAVVLGVKAGLDPAVM
IDVFNAGSGATHASRDKFPRAVLPRTFDFGFATGLMVKDVRLCLEQVAEL
GLSLDIAQAVALVWEATIDATGPDSDFTSVIKPIEEAAGVIVGDPGGP
108799551YP_639748.1 nitrate/sulfonate/bicarbonate ABC transporter periplasmic component-liMLRHLARTALTLAVLASAVACSSTDDNSGGYTLRIGATSPTGTPAGSLGW
GDKQGILAEQLKDAGVDNIEYSFFQSGSDVASALFAGAIDVAAIGDNPAL
RARSRDPKVVLLALDSISSDAWLVGAKGGPTDIQGLVGKTVTAPQGTIRD
RAAKQLIDAAGLTGKIQVRDVPTPESIAGLSSGQIDATVVTGASAIELQH
KGFPIIDSLSRHGLGSTGTNIALTTFTDEHPEFADAWRQAVTAVNSDIQK
NFDEYATWVAQTDGTDVEFVKESTRPDEFNTEPFPAQGVDQLEAAYDFLN
ADGSLENQYSVREWAGAQS
108799549YP_639746.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSAAVVTVRGLRRAFGAQQVLDALDLDIADGEFVAMLGLSGSGKSTLLRI
LAGLDHQADGSVVVPRSRAVVFQNPRLLPWRRALANVTFALADAGPDAPS
RTARGRAALDEVGLADKADAWPLSLSGGEAQRVSLARALVREPDLLLLDE
PFGALDALTRLKMYRLLHDLWARRHMAVLHVTHDVDEAILLADRVVVLSD
GRVSLDRRVDLPFPRSRGDEGFDDLRRVLLAELGVREEVGHDRGR
108799547YP_639744.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MIEIVHTAACVACDVCVKVCPTDVFERGEDGVPVIARQSDCQTCFMCEAY
CPVDALYVSPVSAPVGADSPHADVDAVLRNGLFGGYREMVGWGRGRTPGA
LLDRNPVLKAVPPLPESRLPPPSTMAGSPWNHPAD
108799545YP_639742.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MSSSTATDLDPLTLERQVCFALAVANRAVLGVYRPLLEPLGLTHPQYLVM
LVLWDHRKSADSPLSVKQIAKALQLDSATLSPMLKRLETLGLITRTRSTV
DERAMNVELTEAGIALRERALAIPPAVVARLGGDLAELEELHRALTRINS
AAQAAGALDL
108799543YP_639740.1 hypothetical protein Mmcs_2576 [Mycobacterium sp. MCS]MPATIRSSHGCRRRTTSRGARRRTLPPMAGQAFEIVVTRDATGWSVTVPE
LSAVTHRADRAEAEMAARELISRHTGIPHGYVAIWSRD
108799541YP_639738.1 anion transporter [Mycobacterium sp. MCS]MTADNPVKRTDVDKALLGSATYRSLGEQRLTPAEERFEKGRRTVGLFLAP
ALTVVFLLLPLDLPPQQQTLAAVLLGVIVLWVTEAVPIPIGGLLGVAVVV
FLGVAPADDVLAPFGSSTIFTFIGAFILAQAMLKHGLARRFAFRILALPR
AGQSTTGVILAFGAITCLLSAFVSNTATVAMLLPTAIGILGVIAKLLQKQ
GKVADDFDPLRLRVGAALMLMLAYSASVGGLLTPVGSPPNLIGRGLIEEA
TGERISFGQWMVMAAPICLLMFAILAVVLLLLNKPELKHIDGVADYVARE
REEMGRLSRAEKNTLIAFGVTVFLWILPGIIALAFGNDSDIYSSVSDRLD
EGTVAVFGAALLFLLPTEWEQREFTLRWRDAAAIDWGTIVLFGTGIIFGS
LLADSGLAETIGNSVADALGLSSVVAITIFAVLLAIVVSETTSNTASAAV
VVPIVIPVAIAAGVNPFVPALAATFAASFGFMLPVSTPQNAIVYGSGAVP
ITTMIRSGVTFDVAGAILIILFLPLMIALLGLGA
108799539YP_639736.1 3-isopropylmalate dehydrogenase [Mycobacterium sp. MCS]MATEDPLRLGVVAGDGIGPEIVSAAVQISERALAAVSVPVDWRRLRMGAE
AITAEGTPLPEATLAELDRLDAWLLGPHDNAGYPAPFRDALSPGGTIRKR
YGLYANIRPARRLSGAIPAVCPTLDVVVVRENTEGFYSDRNMYDGPGEFM
PTADVAMAVAVFTREACERIAHQAFRLARTRRRSVTVAHKANVLSKTTGL
FRDSCVRVAEQYPDVTVRLEHIDALAALLVARPAEFDVIVAENMFGDILS
DLTGQLAGSLGMAPSVNLSDTKAMAQAAHGSAPDIAGHNIANPVAMILST
AMLLEWLAERHHRGALAGAATRIRDAVCRSLDDGVHTPDLGGAATTTGFT
EHVLSVLASA
108799537YP_639734.1 TspO and MBR like proteins [Mycobacterium sp. MCS]MRASTLAKTAGTVFATGALGGLASRPGQSLWYVKLKKPSFQPPSQAFGIV
WPMLYADIAAVSAATIDHYNDTGQPEKARAYTTVLAANLILNGSWSWLFF
NRHKLAVSAMAAGALAASSADLTRRAVEAKGAQAAPLALYPLWCGFATAL
SSRIWWLNR
108799535YP_639732.1 hypothetical protein Mmcs_2568 [Mycobacterium sp. MCS]MASVDVAVSSDLTPEKAWELASNLRRFDEWLTIFGGWRSEVPAEIEVGTC
VSSLIKVKGFRNTIHWRVTRYDEPKEIELIGTGFPAICIALSLHVEEEPD
KGSNFRVVADLSGGLLNTRVGSLVARVIESDVRKSVSNLASLR
108799533YP_639730.1 twin-arginine translocation pathway signal [Mycobacterium sp. MCS]MPRSSEFDPQLAARLAATRASRRRFLGGGAAAAAALALGPSVLAACGSDS
GGSEATTTDDGGPAGGTLRVSNWPLYMADGFVAAFQTASGITVDYKEDFN
DNEEWFAKVKEPLSRKQDIGADLVIPTEFMAARINGLGWLNEIRADRVPN
KKNLRPDLLNSAIDPGRNKTAPYMTGMVGLAYNKAATGREITRIEDLWDP
AFKGRVSLLSDTQDGLGMLMLSQGASPERPSTEAVQKAVDLVREQKDKGQ
IRRFTGNDYADDLAAGNVAIAQAYSGDVVQLKADNPDLEFIVPQSGGTWF
IDTMVIPYTTQNQAAAEAWIDYVYDRANYAKLIAFTQFVPVLSEMTDELN
KIDPGVAANPLINPPESTVNNLKSWAALTDEQTQEYNTMYAAVTGG
108799531YP_639728.1 binding-protein-dependent transport system inner membrane protein [MycMTTQAGAAVAAAAEQPPRPKTVRGTPKWGDWSLRIVAGLVLLYLFIPIFV
IVLFSFNDPKGKFNYSWQGFTLDNWLDPFKYPALTNAMKLSLNVAGVSTL
IALVLGTLVAIALVRQRWRGQRAVDTFLVLPLTAPEVVMGASLLVLFLDL
GWATGYVTIVLAHIAFEVSFIAMTVRARVRGFDWTLEDASMDLGASPTRT
FFKVTLPLIVPGIVAAAMLSFALSLDDFIITYFVSGSTVTYPLYVNAAVK
AAVPPQINVIATAILVVSLILLAAGTLYRRKRIDV
108799529YP_639726.1 hypothetical protein Mmcs_2562 [Mycobacterium sp. MCS]MNIGKASVVVAVTMLSVSGCGYRLAAYPTDDAAAQPVEPRTMAASAAPEV
QHNASVSAANHGVPPNADGDPACPPSQAWGRQPEGRGVLVTVLTQEATAV
TVLVRTSTGVDVAKRAILDRDDLHLFEFPKIDADAVDEVLIMTSTQRCFA
VADPLTFN
108799527YP_639724.1 dihydroxyacetone kinase [Mycobacterium sp. MCS]MTKLFNDPARFTEDMLVGFLDANSRYVAGVPGGVVRAHETRPGKVAVVIG
GGSGHYPAFCGTVGPGFADGAVVGNIFTSPSTEEAASVARAAHGDAGVLL
ITGNYAGDVMNFGLAVTALRGEGVDAHYFAVTDDIASAPKGEEAKRRGIA
GDFTVFKCASAAAEEGLDLAGVVRVAEASNAATRTLGVAFDGCTLPGADH
PLFTVPEGQMGVGLGIHGEPGVAEKAMPTAAGLAGTLVDGVLGDAPADAA
SKRIAVILNGLGRTKYEELFVVWGEVARLLRDRGYEIVEPEVGELVTSLD
MAGCSLTVMWLDDELERYWRAPADTPAYRKGGAAVDNSGERRSDADIRTA
TAAPAVGERSDDAGRDGGRTVARIFEALAAMLADAEDELGRIDAIAGDGD
HGRGMVKGSAAARAAAAEAVEQGAGQGSVLAAAGKEWAAKAGGTSGVLWG
ALLSALGTRLGDTGRPDAATVAAGMRDGYDALVQLGGAAPGDKTMLDALW
PFVEELERRVSDGERWQQAWAVAAQTAEDAARATADLRPRVGRARPLAER
SIGTPDAGATSLAMCARTVAESLSVKGDSRQ
108799525YP_639722.1 ABC transporter-like protein [Mycobacterium sp. MCS]MATVSVADLHKSFGKTRAVDGVTVDIANGEFFVILGPSGAGKTTTLKSIA
GLVDIDGGTVHIGGRDVTHVEPYHRNVAMAFESYALYPQKTVSENLASPL
KSGRTGRYSEAERTERIDQVTTTLGINHLLKRYPRELSNGQRQRVALGRV
LVRPADIYLLDEPLSHLDAKLRAAMRAELKQLGAMSNTTTLYVTHDYQEA
LALGDRIAVMREGRLVQIGTPEDIWRRPADTFVARALGQPEINLLDGVVD
DDRIRLGDGSLDVAIPAGAVADRGDRVRVGLRPSDIHVTDGEGTLRGRVL
LAERLGRNIELTVDCGGTQLIVLTSGRHGVGEGDNVTMRVADSDVHVFAV
GDGDTPRLGPADHTSTLEAAQ
108799523YP_639720.1 binding-protein-dependent transport system inner membrane protein [MycMTTQTPKAPEASPEQRAQDPGRPLPEVPTWRRKLRPYLLSIPALIIVIGI
LYPFFVGAYYAFLNYAAVNPDPHFVWFENFASVLGDQIFWESVKVTGIFA
VVATTIETVLGVGLALLLNRSSIIGKIFEKVLILPLMIAPVIAGVIWKLM
FNPQFGILNHVLGLGNTFDWLSAGNALWSVILVDLWIFTPFVAILVLAGI
RSLPKEPFEASEVDGANWFYMFRKLMLPMLWPYILVAVIFRFMDNLKVFD
HIYVLTAGGPGVATRTLQIGAFEDSIINLDYSRGSTYMLLLWIIVFITAR
YLVSVLGKAQRRAAGAES
108799521YP_639718.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MSDQIPEKMQAVVCHGPRDYRLEEIAVPQRGPGEALIRVEAVGICASDLK
CYHGAAKFWGDENRPAWAETMVIPGHEFVGTVVELDDDAAQRWGIAVGDR
VVSEQIVPCWECRFCKRGQYHMCQPHDLYGFKRRTPGAMASYMVYPAEAL
VHKVSKDIKPHHAAFAEPLSCSLHAVERAQITFEDTVVVAGCGPIGLGMI
AGARAKNPMHVIALDLAPDKLELAEKCGADITINIAEQDAVAIVKELTDG
YGADVYLEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDK
ELDVLGAHLGPYCWPAAIKMIESGILPMDEICTHQLPLTDFQKGLDLVAS
GKESVKVSLIPA
108799519YP_639716.1 cytochrome P450 [Mycobacterium sp. MCS]MTGDPAVELYYDPFDFVIDDDPYPVWKRMRAEAPLYRNSRYGFYALSRYD
DVVRALPDWQTYRSGRGTTADILFSGIEVPPGILLWEDPPLHDLHRRLLS
RVFTPRRMLAVEDLVRGFCSRALDPLRDAEGFDFVTDLGAIMPMRTIGYL
LGIPEEGQQQIRDLNDKSITVGSQGSGTGEVSQTIFEESLGVFAEYIEWR
STHPSDDLMTELHNAEVEEPDGTRRQLERTEVLAYTAMIAGAGNETTARL
IGFMGQLLGEHPDQRRELVADPSLIPSAVEETLRYEPPSPVQARYVARDV
ELYGRTVGEGSYMLLLNGSANRDETRFTDPDRYDIHRKAGHLSFGQGLHF
CLGSALARLEARVAFEEVLARWTDWDVDYANATRARTSSVRGWAKLPVRT
R
108799517YP_639714.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPQRDSSDQPTSVAARAGRRPRGEARRLLLDAARDLFARKDYRATTTREI
AEAADVSEYLLFRHFGSKAGLFREALVVPFTTFLDDFAQTWQAVVPEETD
EEQLARQFVGRLYDVLVEHQGLLLTLVASDGLDDEEIEAAGIADIRRALS
MLGRISAEGMRLRGKRSRQPDLPAHSTVAMIVGMVALRSTFFGSSPPSRE
AIVDELVQAILHGFLHRP
108799515YP_639712.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTGDRCFTRQEAVSGLSYLIPFTKDWVSGTSPRREPLAVGGVVECRTVTN
KRNAAKRTSDNGSVAGSSYDDGTRRTEILQTAARMIATSGLRTSLQEIAD
AAGILPGSLYHHFESKESILVELLRRYHADLDRIAEHAQATLDDPSSHSA
FDRVLELSVAIAQCAVTHRAALQMSFYEGRSSNPELATLAQRRPTAVLQA
MLQTLRAARWSGYIRSDVDLPVLADRMVQTMLQAGLDVIRQNTPVEKVAT
LLTRIELEGLAAEPPTDQMLDQSAAFSAADAVVQSWIDDSETEADDKAAH
VRAVARTEFGRRGYEVTTIRDIASAAGMGTGTVYRLIGSKDELLVSIMRS
FGEKVAMGWTEVLSADATTIEKLDALSWINTNALDRFGDEFRIQLAWMRQ
SPPGTPNPGWLFSKRVRQMRSLLAEGIRSGEVRVDSPPNDLLARGVIGIG
WIPENILRDLGTRRALIHVRDTTLRGVVERNA
108799513YP_639710.1 integrase catalytic subunit [Mycobacterium sp. MCS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGLIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALGGLPPISRLTPTS
108799511YP_639708.1 cytochrome P450 [Mycobacterium sp. MCS]MSDFESVDYFTDMSLVPDPYPYFDYLRAKCPVQRATPYGVMAVTGHQEAL
AAYKDPAMSSCVAVAGPFPPLPFTPEGDDITAQIEEHRTAIPMAEHVVTM
DAEQHARTRGLLSKLITPKRLAENQDFMWRLVDRQIDKFLERGSCEFMTD
FAKPLSMLVIADLLGVPLEDHDEFRRALGDEVVGDIGAEDTVAHNPLMWL
DEKFASYVIDRRREPREDVLTELAAATYPDGSVPDVDEVVKLATFLFAAG
METTTKLLSTAMRVMGERPDIQQVLRDERTRIPTFLEECLRTESPVKSHF
RLARTTTTLGDADIPAGTIVMLLPGASNRDPRKFENPHEFRPDRSNVREH
VAFGRGPHSCPGAPLARAEARISMNRLLDRMANIRISEEMHGPAGERKYE
YDPTFIMRGLSALHIEFEPLPDP
108799509YP_639706.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MPDVNVTSESRMLIDGKLVDGEAGTFINVNPANEEVLGEVADASRADMQR
AIDAARRAFDETDWSTNGELRKRCVLQLHEAIEGELAELREELILEAGAP
RAVTHGPQLDAPLEDGLKYPARLIDEFTWETDLGDKVVSVTGVNTRRKVW
HEPVGVVGAIVPWNFPFEVTVNKLGPALAAGNTVVLKPAPNTPFNATRLG
RLIAEKTDFPAGVVNVVTASDHFVGEELTISPKVDMISFTGSTVVGKRIM
EKGAATMKRLFLELGGKSATIVLEDADFNTACLIGIGPLMHAGQGCAAPT
RMLLPRSRYDEGVALLKALYENMRAADPQDPGTICGPVISGRQQARILGY
IQRGVDEGATLLVGSTEAPEEFDKGFWVSPTLFTDVDNSMTIAQEEIFGP
VLVVIPYEDEDDAIRIANDSVYGLAGNVMSSSLDRSLAVARRLRAGFIGL
NGTAGYGADTPFGGYKDSGVGRQNGIVGFSQYTEVKSVAYPADERLREEQ
108799507YP_639704.1 hypothetical protein Mmcs_2540 [Mycobacterium sp. MCS]MTTKDPLVSDGQTREKPTEKRNWGGWIGFLALVAFLSFFALSSRRNLDPR
VANPDVEGRPRPVEFIFGWDDWIYLHEVGTVLALIALVVVFIVGWKRNPG
SPVMLMFLCTTLIVWQDPIMNWAPFAVYNPELLHWPESWPLVSLSPTVEP
FLVFGYVMFYFAPYFPSVWILRKLQAKKGPQSFFSRHPLISLGSLALVIG
FIFDACLEIFLVRTGMYIYSQVIPFGSVFAGTTFQFPLIWESFAVCFVMV
PAAILCYRDDTGKSVAEKLSARAKLFRSKPALGTFLVMFVIINVSYFAYG
AWFAVIKASGAATSVACPWPYPEAKVYDPQGYYEKAGAEGPFSVGIWSTW
MSGQPDGRPDVEPPPPGEGACAVENQNG
108799505YP_639702.1 ATPase [Mycobacterium sp. MCS]MAAEIGLAYQNHAMPQTESPRPYYQAVGNEETVFKAAYRQGLSLVLKGPT
GCGKTRFVEAMAHDLGRELITVACHDDLTTADLVGRFLLKGDETVWVDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLGDHRRQLPIERLGITLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGFPAPEVEEGIVAREAGV
DHATAAELVRFGQAIRRLETGGLREVASTRVLIAAGRLVREGLTMQEAAR
AAIAGPLTDDMQVARGLHEMIDIYLGQQAGSDD
108799503YP_639700.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MESVDFSYPQEAEQFRKDLRTWLSAHLTRNVIDSDSRRGADDDAFQTLRA
WNATMADAGWAAVSWPSDYGGRDATPVEQLIYAEETTRARVPLPLNIIGM
NNIAPAIMQYGTEPQKATLLSATRSAPTSSPSRPRCRPSRSRRFRESMRA
ARCFGCVSTMRPGRSWESPTGRRSGRSSTIFSHRTRV
108799501YP_639698.1 amidohydrolase 2 [Mycobacterium sp. MCS]MDMNDFVLVSVDDHMVEPPDMFDGHIPAKYKDDVPKLIQRADGTDAWVFE
GQEATNVGLNAVAGRPPDEYGAEPTKLSEIREGCYNIHERIRDMNANGVA
AALCFPSYPQFCGQYFARARDKDLVLAVLRAYNDWNIDEWCGTYPGRMIP
QALPPIWDPNLMAEEVRRVAKKGCHAVSFSENPTKIDYPSLHDPHWDPFW
QACSETNTVVNLHIGSSSSVVITSIDAPVDTMITLQPMSIVQAAADLIWS
PMLRRFPDLKFALSEGGIGWVPYFLERIDRTYKMHRAWTHQDFGDKMPSE
VFLDRVALCFIDDEFGVENRHKLNLDMVTWECDYPHSDSTWPLSPETLAI
YFNGVPDDEIDKITHLNAMRLYSFDMFSHIPKEQLTVGALRAQATDVDLG
FRSSERLKKTGTDTVTVLDLASKLST
108799499YP_639696.1 cytochrome P450 [Mycobacterium sp. MCS]MTGASTDLYYDPFDFDIDDDPYPIWKRMRDEAPLYHNDKYDFYALSRYED
VADGLHDWDTYRSGRGTTIDVIMSGVEVPPGVILFEDPPLHDLHRRVLSK
VFTPRRMGAIEPLTRRFCVRALDSIADASRFDFITDFGALIPMRTIGYLL
GIPEQGQQQIRDNTDSAIGLRDGSFQSVSAATFENAYQLFADYIEWRADH
PSDDLMTQLLNAEIEENGRLRPLTRVEVLTYTSMIAGAGNETTTRLIGFI
GQLLAEHPDQRRELVDDFSLIPRAIEEVLRYQAPSPVQARHVARDTRCHG
QLIAEGSIMLLLNGSANRDERQYPDGETFDIHRTGAHLSFGQGLHFCLGS
SLARMQARVALEEVLLRWTDWEVDYDNAAMAHTSSVRGWGRLPVMVG
108799497YP_639694.1 luciferase-like protein [Mycobacterium sp. MCS]MFTLRFDMRAPTGGAPVTDLYAAAIEMCAWSETRGAVVAVLSEHHGAHDN
HLPAPLLLASAIAARTTQLAILLAAVPITFWDPVRLAEEISVLDIISKGR
VSYAFGIGHRAEEYRHFGVDMKTRGALAEESLALLRLLLRGDPIDLGGRL
VHVTPPPITPGGPHMVVAGGSRAAARRAARHGLGFLSQVASPGLREFYEA
ECRAHGFEPGAVVFPIEGAPTTVFVADDVDAAWGELGPYLLHDAVTAASY
RHGDSVASISSARSVSELREAGGPYRIFTVEEAATYVRDGRPLPLLPLCG
GVPTDVAWPYLERAALASERA
108799495YP_639692.1 hypothetical protein Mmcs_2528 [Mycobacterium sp. MCS]MSESPAHFESADDGAYLPTRFAQSHWGEDHLNGPAVVGLAARVLESEYGR
DGFLPTRLTVDLFKAARGVPTTTKTNLVRDGRRVRNSECELVQDGVTVAR
ATLVQYRRAEAPRGTEWIAPGDFEVPPAVDPSRMIHLGSDGPGWTNAIVD
HQNTARKRTWSRSIQVVAGSENSPFVRAVVAAEGTSLVTNLGTAGVGYIN
GDLTVALARLPVGEWIGVQADSHWVADGISVGTATLYDGVGAFGSGMVTA
VSNPAAQIDFGNDPFPSRTH
108799493YP_639690.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTAVEYRGTQISYRTRTGRRLAVDRADLTVASGEFLALVGPSGCGKSTLL
KAAAGLVEPTAGQVLVGGAPVGESPARVGMVFQNDALLPWRSVIENVRLP
LQIDGGRRGEQDERIAELLDLVGLSEFGGYLPRQLSGGMRKRVALARTLA
SDPTVFLMDEPFGPLDALTRREISADFLQLWERLRTTVIFVTHDVDEALL
LADRVAVMSPSPGRIVEEFEVPLQRPRDIRELRFTADYHRLYDAISDALG
VA
108799491YP_639688.1 binding-protein-dependent transport system inner membrane protein [MycMTETRGRARTRLSRGTAKTDDALTRSDRRDAQRLRRIVTLGRIAIAVLFV
GGWQLSSERLIPAFYVSSPAAVLERLGSLIRTGELWPHLTQTLLEVALGL
LIGVPLGAVLGVALGFSTILGGWLLPYMMALYSLPRVVLAPLFIIWFGVG
LISKVTMVVTMVVFVVFYNVYQGVQEIDRDLLDVAKSLRANRLQTLRWIV
VPSLVPWLITGLRLSIGIALIGAVIAELIAASQGLGYYIKYSSNLLDVTG
VFAGLAVITVVAIALEQLLKRIERRVAPR
108799489YP_639686.1 xenobiotic compound monooxygenase A subunit [Mycobacterium sp. MCS]MRHMTDSRRMHLGLTIWPTGFHPAAWRVPGAFSNGNSNPALLADAARTAE
RGVFDFFFIGDRLVGLPSSQFANPNEVLRPEALTLASFIAASTTRIGLIT
TVNTTYSDPYNVARATATIDHLSGGRVGLNIVTGKNVEAARNFGRDQHWD
NERRYDWASEYIQVLQLLWDSWEDDARVADAGTGQFVDPGRVHRIDFRGE
FFSVDGPLNVERPVQGQLPIVNAGASERSRELGAQFSDLRFTNSSTLGLE
GARAYYADLKSRLPRYGRRPQDQLIIPGVAVYVEETKAAAHQAYSDLQRR
LNTGPGGRAQLSEALGVDLSAVPADAALADVVDMAALDAAARAVVDSAAE
LYGHDRASVAEVTASLLRGGMFKEAVGSPAEVADVLEEWFTTGAADGFMI
FPPRVPYGIGAFVDLVVPELQRRGLHRREYTGTTLRDHLGLARPSNRFAA
EESHAVGVAR
108799487YP_639684.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MEPTFSLELPDDVVSVRDWVHEFARDVVRPAAAEWDEREETPWPIIEEAA
KVGLYTPELFAQMAGESSGIGLITVFEELFWGDAGIALSILATGLAAAAL
ASNGTPQQIGDWLPAMFGTPGDTKVAAFCSSEPGAGSDVGAVRTRAVYDE
AADEWVLNGTKTWATNGGIANVHVVVASVYPDLGTRGQASFIVPPGTRGL
SQGQKFKKHGIRASHTAEVVLDNVRIPGELVLGGREKFEQRMARAKEGQR
TASQAAMATFERTRPFVGAMALGVARAAYEYALDYACQREQFGRKIGEFQ
AVAFKLADMKARIDATRMLVWRAGWMHRNNKAFTSAEGSMAKLYASETAV
YVTDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVIGRALT
GLPIR
108799485YP_639682.1 hypothetical protein Mmcs_2518 [Mycobacterium sp. MCS]MTGESTGRQRWDPGRHETETERLDRNWFSLLQELRVAQTGVQVLTGFLLI
LPFQDRFGALDDGARLVYLLTVACSIGSTVLLVAPVSMHRVLFRRHRLDA
LVASSHMLAMVGLLLLAMALTGVAAIIFDAVLGAAAAWTAAGVTLLALAS
SWFWLPVRQRRDK
108799483YP_639680.1 RDD domain-containing protein [Mycobacterium sp. MCS]MTTGDYPPQPGQPQYGQQPQYGQPQYGQQPQYGQPGGYPPPFGGQVPGTL
GMRFLARLIDGIIVGLVGGLVLALVDAMSNVWITGLFTGALSFLYYVVFE
VTQGWTPGKKLLGMSVRGPGGAAKPTASQSAIRNLFTLLPIIPFIGGLLG
VIAIVVIAVTINNSPTKQGKHDEMAGGTQVVKG
108799481YP_639678.1 hypothetical protein Mmcs_2514 [Mycobacterium sp. MCS]MSDQEFKKGDKVTWQSHGSTAEGEVVEKITSETEAAGRKVKASKDEPQYR
VVSDKSGNDAVHKPGALDKK
108799479YP_639676.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MAHTADLVIERPADLTADWLTTVLGAGTVTQFGFDRIGTGQMSECYRVSL
TYADAATAGPESVVLKVAATDVNSRQTGLALGLYEREVRFYTDIAPGLPG
PVAPCYHAAYNAETGAFDLLLGDAAPAVVGDEIRGATVEQATLALAELGR
VHGPLLGNATLADADWLNRESPMNQVLLGQLWAGFADRYGDAIAPEHRAV
CERLVAVFDAYLDAESAADRPHGLIHGDYRLDNMLFGQAGADRPLTVVDW
QTVTWGPAFTDVAYFLGCALPVEDRRAHYDALLRAYHEALGAQAPVDLDT
VRDGVRRQSFFGVMMAIVSSMLVARTERGDEMFMTMLRRHCEHVLDTDAL
AALPEPGDDEPLQPAAADEGSHQPGDEELWNESWYFDFADGAQDVGGWVR
LGLYPNRNAAWINALVCGPGMPTIGIVDFDAPLPADYTETTTDTAHLGLE
PVEPLRTYRVTVRGRGEAHDDPAALLRGEAGRPVDLTMDLTWTTVGTPYR
YRITTRYEIACTVSGTVTADGREYRFDAAPGQRDHSWGVRDWWAMDWVWN
ALHLDDGTHLHGVDLRIPEIGPMSIGYVQPPDAALTETTQMTAAATFADT
GLPVTTSLTVQPGDLTVDVDIRGFAPVMLTAADGRVSHFPRAWAAVTTGD
GRTGIGWVEWNRNIARS
108799477YP_639674.1 protein LppI [Mycobacterium sp. MCS]MLAASVLVAGCSQAVDGQARQTVPTLSAPSGTTRTSPSSTAKPPPTSAPA
ARAPIGEVIRWIEAAPPAAPEDFHTVSREGAGTDLGDGVAFTTPTGTSKC
MTDRRAEGALTCLVDLREPPARPADVYGEWKGGWVDFPGGTLDVGSAHAD
PGPFSDGFGAELPYGQALNFGDYRCRTDPSGLFCVNYAHQSAVRFSDAGI
EPFGCLRQVSPPPEIGARFSC
108799475YP_639672.1 hypothetical protein Mmcs_2508 [Mycobacterium sp. MCS]MTQHTRTLLLGVSAIFALGTLSACSGGESSTETTTSAPAPTSAQAFPPSA
KYIADMEKDGRPMTIGIAVDGDRVAAYACNGTDDEAWFFGDQTDGTIDLT
SKFRDTLDASFEGGDVEGDLTMDGVTYTFTAAEVPAPAGMYTAALGGVRE
SWVLRPNGSAVGVQFGGLGGDFGQDDDLNIFEKQQQLKDAQFRAEVRNRR
LLRQAGQLEQRPDGKWGATINGQPVEAVIVDGNFRIPPS
108799473YP_639670.1 ATP-dependent DNA helicase RecQ [Mycobacterium sp. MCS]MVAVGERAAELCRMARRVFGWDELHPEQLEAMMAVLAGRDVVAVLPTGSG
KSAIYQVPAVLLDGATVVVSPLIALQEDQIAGLADTRAPEAVAINSRQRA
SQTDDNWAAVHSHEAEYIFVSPEQLANDAVVGRLAEAAVSLIVVDEAHCV
SAWGHDFRPDYLRLADAFAQFGNGAPVVALTATASVVVRREIVERLGLRD
PLMVVGNFDRPNLTLEVEQFVRDADKRAAVVDTVAGLEVPGLVYTATRKD
AARYADALGERGVRAAVYHAGLVAAERERVHESFREDAVDVVVATSAFGM
GIDKPNVRFVVHASVPDSLDSYYQQIGRAGRDGGDARVLLFYRAEDLGLA
RFFTTHRPDADLIEAVYRALDTDKPMRTKALRERLDAQGRRLTNAINLLE
SADAIRSTRKGFYSNGIPPRVAVEAAIEVVEARERVDRSRVEMMRGYAES
RHCRRQFLLTYFGQPLPGPCGNCDRCRDGEGATDADAGGQPAIPVDTAVS
HREWGDGVVIGGDTDRVTVLFDDYGYRTLAMAAVTGKNLLTTR
108799471YP_639668.1 hypothetical protein Mmcs_2504 [Mycobacterium sp. MCS]MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEI
PGTWLCRNGLEGTLIEGDVPEPKKVKPPRTHWDMLLERRSVEELEELLKE
RLDLIKTKRRGS
108799469YP_639666.1 apolipoprotein N-acyltransferase [Mycobacterium sp. MCS]MADAPSGRLAAVVPRLRGVPRAVVDRMWQLVAAIGGGMLLCVSFPPFGWW
YCAFISAALLAWVLRQDSTTRAGGFGYGFLYGLAFYVPLLPWISGLVGAV
PWLALAAVEALFPALFALAAVTVRRLPGWPLWFAALWVAQEWLKSSVPFG
GFPWGVVAFGQTDGPMLSLVRLGGAPLLSFAVMLTGFALAALTEEIVRWT
RRHDISVAAPPAVVLPGAVIAVVLLGTAVVWPQVRHSATGAVDDQPVTVA
AVQGNVPRLGLEFNAQRRAVLDNHVEETLRLAQDVRAGRAPQPMFVVWPE
NSSDIDPLANPDAGAQISTAAAAINAPILVGAVVRTPEHTPDNPVSTNTV
LVWNPGTGPADRHDKRIVQPFGEYLPWRGFFSKLSPYAERAGYFVPGDGT
GVVNAAGVPVGITTCWEVIFDRAARESVRNGAQVLAVPTNNATFDEAMSR
QQLAFGRLRAVEHDRYVVVAGTTGISAVIAPDGRDLARTAFFEPAYLDTQ
IRLKTDITPATRWGPLVQALLVIAGVGAVIAAILHNGNFVPTRIAARSRR
RRPAARDRDDRSGARSSSNEGAS
108799467YP_639664.1 FxsA protein [Mycobacterium sp. MCS]MRLFLLYVVIEVAVIVALVSTVGLGWALLISLATFVLGLALAGSQLKKQL
RRLRSGLTATAAQGAVTDGALVALGTVLVVLPGLASSVVGALLLLPPTRT
AARPIVTALAARRLGRGVPIVVLGSAAASRRRDYIDGEVVDVVTVDPPAV
ERRVD
108799465YP_639662.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. MCS]MAPTFKDVYGEKYLLLTTFTKDGRPKPTPVWGVPDGDKLLIITDDGSWKT
KRINNTPRVTIQKCGVLGKPKGAPVEAVARNLPSSETRRVWNMVTKRYWW
HAWWWVPHAIIRGGVDKLHSAIEVTSPA
108799463YP_639660.1 cobaltochelatase subunit CobN [Mycobacterium sp. MCS]MTPPHPAPTVLLLSTSDTDLITARSSGARYRWANPSRLVSGELDDLLDGA
DIVVIRILGGYRAWQDGIDTVSARGLPTVVVSGEQAPDAELMRHSTVPQG
AALQAHVYLAQGGVENLRQLHAFLCDTLLMTGFGFAPPAATPTWGVLDRA
VRATDGPTIAVLYYRAQQLAGNTAYIEALCDAIEAQGGRPLPVYCASLRN
AEPELLAQLESADALITTVLAAGAATPAAVGAGGDDDSWNVAHLAALDVP
ILQGLCLTSSWSDWSSNDDGLSPLDVATQVAVPEFDGRIITVPFSFKEID
SEGLISYVADPERCARVAGIALRHARLRRIPVQDKRIAVVFSAYPTKHAR
IGNAVGLDTPASAVALLRAMREAGYDIGDVPGVEAQDGDALIHALIERGG
QDPDWLTDGQFTGNPIRMSADDYRKWFATLPAELTDAVVEHWGPPPGELF
VDRSRNPDGEIVIAALQSGNVVLMVQPPRGFGENPVAIYHDPDLPPSHHY
LAAYRWIDSGYPTGFGAHAVVHLGKHGNLEWLPGKTLGMSAACGTDAALG
DLPLIYPFLVNDPGEGTQAKRRAHATLVDHLIPPMARAETYGDIARLEQL
LDEHANVSALDPNKLPAVRQQIWTLMRAAKMDHDLGLDERPDEDSFDDML
LHVDGWLCEIKDVQIRDGLHILGAPPAGEAELDLVLAILRARQLFGGEQT
LPGLRQALGLAEDGHDERTSVDAVEARARHLVAALQAADWDVAAVDTITD
DPQVAAILRFAAAEVVPRLAGTAAEIRQVLRALDGRYIAAGPSGSPLRGL
VNVLPTGRNFYSVDPKAVPSRLAWETGVAMADSLLDRYRDDYGTWPRSVG
LSVWGTSAMRTSGDDIAEVLALLGVRPVWDDASRRVVDLEPIPLAELGRP
RIDVTVRISGFFRDAFPHVVAMLDDAVTLVAELDESDEDNFVRAHTRADL
AQHGDRRRATTRIFGSKPGTYGAGLLQLIDSRNWRDDADLAEVYTAWGGF
AYGRGLDGRPAADDMNRSYRRIAVAAKNTDTREHDIADSDDYFQYHGGMV
ATVRALTGKAPAAYIGDNTRPDAVRTRTLSEETNRVFRARVVNPRWITAM
RRHGYKGAFEMAATVDYLFGYDATAHVMADWMYDRLSQEYVLDAENRKFM
EESNPWALHGMAERLLEAAGRGMWAEPDPATLDGLRQVLLETEGELEK
108799461YP_639658.1 binding-protein-dependent transport system inner membrane protein [MycMTTVADRNAPKATAGERLRLLIQPGLVLVVGAAVVFWAFNRDLTATQQEN
INPGNVATLIWQHLLITAAVTAIVLAVGVPLGVLVTRPGAKALRPLFIGI
ANIGQAAPAIGLLVLLFLLTARTGFWIGVLPIALYSLLPVLASTILGLDQ
VDRSLIDAGLGQGMSRMGLLARVELPLAVPYILAGMRTSLVLAVGTATLS
FLVNAGGLGILIDTGYKLQDNVTLVLGSVLAVCLALLVDWLGGLAEFFLN
PKGLR
108799459YP_639656.1 binding-protein-dependent transport system inner membrane protein [MycMVVRELWDYLRTHQAQLIFDSYQHVSAVVQSVLIAAVVGVAIGVLTYRNA
TAANLATATSSVILTVPAFALLGLLIPLFGLGVVPSVAALVLYSLLPIIR
NTIVGLNAVDPALTDAARGIGMSRLATLGRVELRLVWPSILSAMRIGTQM
SMGVLAIAAYVKGPGLGNLIFAGLARVGSPTAVPMALTGTLLIVILALVL
DAVLVLIGRLTTSKGIR
108799457YP_639654.1 cyclic nucleotide-binding protein [Mycobacterium sp. MCS]MKARAKQDEEDVRRLREFAEFADFSDDDLRRLVRAAHRTSTSAPWPLIHE
QTPSDACFILLSGSASVYLGRDRVAELSPGEVIGESALRQGKLRSATVTT
TGPAEVLRIGREDFAQLLDEIPALRGTVDDTVARHTSGTPATE
108799455YP_639652.1 precorrin-8X methylmutase [Mycobacterium sp. MCS]MLDYIRDAAEIYRQSFATIRDEADLARFPDDVARVVVRLIHTCGQVDVAD
HVAFSDDVVSRAQAALAAGAPVLCDSSMVAAGITRSRLPADNEVVSLVAD
PRAPELAARLGFTRSAAAVDLWADRLGGAVLAIGNAPTALFRLLELIDQG
APVPAAVLGGPVGFVGSAQSKDELIARPRGMAYLVVTGRRGGSAMAAAAV
NAIASERE
108799453YP_639650.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MQALIPAKPADVTPEWLGAALTRDGSPVEVRAVDTVAIGTGQTGATYRVS
VTYADPQPDLPTSFAIKLPSQDDAVRDRVAIGYRSEHAFYTNLAEQVQIP
IPPCYHCEIAGEGVDFVLLLGDMAPAVQGDQIAGCSAEEARLAVEALADL
HGPTWCDPQWADFPGIAMPKPEPASAQGFGEVATMAAGITLDRLGDRMRP
EDRETLSTAMSVVTPWLLSEPDRFAVLHGDYRLDNMLFDPDRSRITVVDW
QTLGSGLPARDLSYFTATSLQPETRAAVERDLVDAYHRRLLSHGVTGYDS
ETCWRDYRLGMLQAPLITVLGCAFATSTERGDEMMLVMAARGCQAIRDLG
TLDLIAPAT
108799451YP_639648.1 precorrin-4 C(11)-methyltransferase [Mycobacterium sp. MCS]MTVYFIGAGPGAADLITVRGQRLLGRCPVCLYAGSIMPEDLLALCPPDAR
IVDTGPLTLDQIVDELAQAHADGKDVARLHSGDPSIYSALAEQCRRLDAL
GVDYEIVPGVPAFAAAAAALGHELTVPGVSQTVTLSRVATLSTAMPPGED
LRTLSASGGTLVLHLAAAHIDNIVPELLAGGYGPETPCAVVAFASWPEEI
VLRGTLADIAAQMHDAAVTRTAVIVIGDVLAAGGTESYLYSSGRVRRGRH
108799449YP_639646.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MKDTDSGLVVIFGGRSEIGVEVATRLAPGATVVLAARGADRLDEQVSAVQ
SAGAAAVHTVEFDADDLGSHAPLVAKLVAEHGPIATAVLAFGILGDQARA
ERDPAHAAAIVHTDFVAQVSLLTVLATTMREAGRGPLVGERPARRSSIVV
FSSVAGARVRRANYVYGSAKAGLDGFANGLADALHGSGVHLLLVRPGFVI
GRMTAGMDPAPLSSTPAQVAEATVKALAKGRREVWIPRSLGAAVVVMRLM
PRFVWRRMPR
108799447YP_639644.1 peptidase M24 [Mycobacterium sp. MCS]MTGSRFDTDVYARRLQSAAAAARDTGLAGLVITPGYDLRYLVGSRAQTFE
RLTALVLPADGDPTIVVPRLELAALKESAIPELGVAVRDWVDGDNPYDLV
AEALGGGTLRTAVTDSMPALHLLPLAGVLGEVPVLATDVLRRLRMRKDAA
EIDALRKAGAAIDRVHARVPEFLVAGRTEADVAADIAEAIVAEGHSEVAF
IIVGSGPHGADPHHECSDRELRAGDVVVVDIGGPYEPGYNSDSTRTYSLG
EPDPEVARRYAVLQRAQLAAVEAVRPGVTAEQIDAAARDVLAAEGLAEAF
VHRTGHGIGLSVHEEPYIVAGNDLPLEVGMAFSVEPGIYFPGQWGARIED
IVIVTEDGAESVNNRPHDLVVVPAGPAAAG
108799445YP_639642.1 5'-3' exonuclease [Mycobacterium sp. MCS]MSAPLLLLDGASMWFRSYFALPSSITAPDGRPVNAVRGFLDTVAMLIGRE
RPSRLVVCRDDDWRPQWRVDLVPSYKAHRVAEPQAAGTDVEVVPDELTPQ
VDMIMEMLDAFGIPHAGAPGYEADDVLGTLAVAEERDRVIVVSGDRDMLQ
VVRDDPVEVRVLYLGRGMSKATLFGPAEVADQYAVPKERAGAAYAELALM
RGDPSDGLPGVPGVGEKTAATLLAQFGSLEAIVAAANDPKSKMSKAYRKK
MLAAADYIEAAEPVVRVATDAPVTMSTKTDELPLAAAHPRKVAQLAGDLG
VTSSVGRLQKALDALD
108799443YP_639640.1 DEAD/DEAH box helicase [Mycobacterium sp. MCS]MTNPPDTQLAAFAAGMPFALDPFQIRACEALESGHGVLVCAPTGAGKTVV
GEFAVHLALAAGGKCFYTTPIKALSNQKHADLVRRYGPEKIGLLTGDQSI
NGDADIVVMTTEVLRNMLYADSPALHGLSHVVMDEVHFLADRMRGAVWEE
VILHLPDEVRLVSLSATVSNAEEFGGWIQTVRGDTTVVVDEHRPVPLWQH
VLVGKRLFDLFDYRAHSPARSGRELVVDPELLRHIAHRREADRLADWQPR
GRGRSAHRSRPTIYRPPARPDVIAALDREGLLPAITFVFSRAGCDAAVKQ
CLRSPLRLTTNEERQRIAEVIDRRCADLAEADLIVLDYHEWREGLLRGLA
AHHAGMLPVFRHTVEELFTAGLVKAVFATETLALGINMPARTVVLEKLVK
FNGEQHMPLTPGEYTQLTGRAGRRGIDVEGHAVVLWTPDVEPVEVAGLAS
TRTFPLRSSFAPSYNMTINLVHQMGPAQARQLLEQSFAQYQADRSVVGLR
RGVERGERMLDEIAAELGGRDAPILDYVRLRAKISERERAQSRSSRLQRR
AAANDALSALRRGDIISITNGRRGGLAVVLESARDTDDPRPLVLTEHRWA
GRISSADYTGATPRVGTMTLPKRIEHRNPRVRRDLASALLSAAAGLATPE
SRGRRRGAQQDDDTDPELVSLREQMRRHPAHHLPDREDKVRIAERYLRIE
RDNAQIQQKVAAATNSLARTFDRIVVLLGERGFIDTTGDDPKVTDDGRLL
ARIYSESDLLVAECLRAGTWEGLDAAELAAVLSAVLFESRGDTPGVPAGS
EAPTTKVRRALSQTRRLSAELRADERRHRLNPGREPDEGFVAAIYRWATT
GDLTTALAASDASGGGSPLSAGDFVRWCRQVLDLLDQVRNAAPTPALRTA
AKRAINDIRRGVVAVDAG
108799441YP_639638.1 twin arginine translocase protein A [Mycobacterium sp. MCS]MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQSEG
KSDNPPATPITSERVDTNPTAEQPDKRSA
108799439YP_639636.1 hypothetical protein Mmcs_2472 [Mycobacterium sp. MCS]MATSKVERLMNLVIALLSTRTFITADRIRQVVAGYADSPSDEAFSRMFER
DKNELRDLGIPLETGRVSQFDPTEGYRINRDAYALPAVELTADEAAAVAV
ATQLWESPELITATQGALLKLRAAGVDVDAADGVAISTATLPGVRGNEET
LRAILQAIDDGRAVQFGHRRDRSEPYTTRTVEPWGVVTHRGRWYLVGHDR
DRDAPRTFRLSRIADDVTTIGPPGAVHKPDDIDLREVVRRAVAEWPTGTQ
ARVWVADGRATALRRQAVVEGPMTRGGRTGEVITVEIGMFDQLAREIASY
GADAVALEPQTLRDDIIARLKAQATA
108799437YP_639634.1 hypothetical protein Mmcs_2470 [Mycobacterium sp. MCS]MTGAGAWPETDESLFTDRASSLGGVLSQAAKAREGWQTNQASIFNGVHVW
AGEGASKAGAVVEKHASEMISHEQRMRDAISWCEKAAESITTAKDVICDN
VAKGQEEIRQLEREAANQDIDATNAIQSVVNRKYFENFDTVNKLAVGLGG
KPGVPQAPFEEPDELDTDGSRVPDGQRPSFFVRPTSSEVPQAPVVGEPVA
PPIGTPSIQPGASKGVRAAGTPDMGGPVVGQPAANPVVKPDVVRPAGRPN
IDAPSASPSPGRSPAGPQSQPSPVMASGGSGMPPITSSSPGSPLGSGGSS
GGGAPSLGGGSGSGGGGASGVGSSGGSSGGGTSSSPISDGPSSIGDQSSV
DPSNGASGPSSGAGGQPPIQSPPIADRLSNIGPAMQPASAPMAAPAAPTE
VAPPAAPAPSNPTTSTAAHAPVAPVSPPATGGGVPMAGGPAMPPPPMPLG
PPPTPSPAAPVVPTSAVPPPVAAPTSSAGSVVGAPAPVPVSAARAERDAI
AGSMRRQSAGDPVQVARRVAAALNAVESMDFGFFWATGVTKDGTILVANS
YGIGYIPDGVKLPDGVRMVSADESIPIDERAKWATFPMLALHGWAQHHDV
PLRAVVATAEQFDGFDPGAARVILTPDDIPERGDMAGRSRLEVIAPGAAR
QLASVDDTRLGDLLPPAPADTTPPADNSLMLWFEVMKPLMSTSAERGAAH
LEAMVSYANHAQELALHRAQTATDAATQRAAIADWVYWQHVSVMSNDAIV
IRQ
108799435YP_639632.1 hypothetical protein Mmcs_2468 [Mycobacterium sp. MCS]MAVTELRVNTGELANGGKGLVSGAQAIPEPLQPLVTSGTDALSLALQSKT
QEIELPLIEGMPKTKAEALATAENIIRAAALYEQSDQQIADQLRKALAEL
DGAGAGGGAGAVGAATGAAGGGAAGAAGAAGAGQEMGQMGQMMGMPMQLA
QQAAQIPMQLAGMAMQIPQGIMQGVQSGMQQVGQMTSQFGDMGGAEKDEK
AKLEDELREKKDEPSEEKEPEGAAPGEATGERAPEVGPRHAAPEAPQTGP
APEPQPPAPKPAPTRPADSSILL
108799433YP_639630.1 IclR family transcriptional regulator [Mycobacterium sp. MCS]MPRDDDRPAAAVQSVDRALVVLEILAKAGQAGVTEIAAALDVHKSTVSRL
IAVLESRGYVEQVSGRGKYRLGFAIARLARASSGHLDLGRLSQDVCDGLT
DDLGETTNVAILDENRIVNIVESIGPGEITLRTWVGQSCPAHATSSGKVL
LAGLDPAEVRTRLTDPLVSFTPATIATVGQLLAELAEVRDHGWASVTEEL
EVGLNAVAAPVRDANSQVIAALSVSGPSYRLAEGKFGEVAEQTIAAADAI
SRRLGWIGPDTV
108799431YP_639628.1 glucose-methanol-choline oxidoreductase [Mycobacterium sp. MCS]MGDTGTFDYVIAGGGTAGCVLAARLSEDPDVTVCLIEAGPTDVGDDKILV
LADWMHLLDSGYDWDYPVEPQERGNSFMRHARARVLGGCSSHNSCIAFWP
PAEALDEWVTMGADGWSAAEILPLTERLTKTVQLRDVPPHDPCGSAVLEA
AALVGMPTVAFNRGETVRNGAGWFQINAGEDGIRNSTSHAFLHPILDTRR
NLEVRTDCWIAEILFDESNAATGVRYQRPDLTGYDTVSARREVIVCAGAI
DTPKLLMLSGIGPTAHLREMGIPVRVDSPGVGANLDDHVEGLVFWEAAKP
MVTTSTQWWEIGLFTTLDEGVTQPDLMMHYGSVPFDMNTLRRGYPTTDNG
FCLTPNVTQGRSRGTVRLRSRDFRDRARVDPRYFTDPDGYDERIMLTGVK
LARSIAEQAPLAPWVQRELAPGPDATTDDELLDYIHQCHNTVYHPAATAR
MGALSDPMAVLDPQLRVKGVSRLRVVDASAMPKLPAVNPNITVMTMAEKC
ADLIRES
108799429YP_639626.1 betaine-aldehyde dehydrogenase [Mycobacterium sp. MCS]MDGGPDLYIGGSWRRAGDGGTRQIINPADGSVAATVDEATPDDARAAVAA
ARQAFDDGAWPATAVTERAALLDLIADLLVRDKEDLALLETRDTGKTLPE
SRIDIDDVTSVFRYYARLIAVQSDRVVDVGDPSVISRVVHEPIGVCVLIA
PWNYPLLQMSWKVAPALAAGCTMVMKPSEVTPLSTIAFTRLLEEAGVPAG
VVNLVQGSGATLGSALTDTADVDFISFTGGVATGRTIAEAAAKHVTKVAL
ELGGKNPHIVFADIGTGDGWDSAVDHVLTGVFLHSGQVCSAGTRLIVEES
IADDFVADLAARAAEIRVGDGMDPASETGPLVSEQHRAKVESYVALGISE
GAQLVCGGSRPGDPALAKGSYYLPTIFDRCDRSMRIVTDETFGPILTVER
FTDESEAIRLGNDTQYGLAAGVRTSDTARGERVVRALRHGTVWLNDFGYY
TAAAEWGGYGKSGNGRELGPAGLAEYQETKHIWHNVAPQKAGWFKG
108799427YP_639624.1 N-methyltryptophan oxidase [Mycobacterium sp. MCS]MAHSSHADVIVIGLGGMGSAAAYHLASRGQRVLGLERFTPAHDKGSSHGG
SRIIRQSYFEDPAYVPLLLRAYDLWDRLATDSAREVYRMTGGLFIGPPNC
LTVAGSLRASRQWGLPHEVLDADEIRRRYPNFTPREGDVALYEANAGFAR
PEMTVQAHLDLAEHAGATLRFGEEVTGWTATADGVRVTTPAGTYRAGQLV
ICPGAWAPQLLAEFGIPITVERQVLYWLDPVGGTEPFVDHPIFIAENERA
EQIYGFPAIDGPHGGVKVAFFRKGVECTPDTIDRVVHEREIREMRDEAAR
LLPALDGPCVHSATCMYSNTPDQHFVIARHPDSVNVTVACGFSGHGFKFV
PVVGEILADLATTGATDHPIGLFDPRRLVHA
108799425YP_639622.1 ferrochelatase [Mycobacterium sp. MCS]MLFDALLVLSFGGPEGPDQVMPFLENVTRGRGIPRERLASVAEHYLHFGG
VSPINGINRALIAEIEAELGDRGETLPVYFGNRNWDPYVEDAVTAMRDDG
VRRAAVFATSAWGGYSSCTQYNEDIARGRAAAGDGAPQLVKLRHYFDHPL
LVEMFAESISVAAQSLPADVRDEARLVFTAHSIPVAADDRHGPNLYSRQV
AYATRLVAAAAGYSEFDQVWQSRSGPPRIPWLEPDIGDHVTALAERGTKA
VIICPIGFVADHIEVVWDLDSEVREQAADLGIAMARARTPNADRRYARLA
LDLVDELRGDRDPLRVAGVDPAPGCGYSVDGTTCADSPRCVARITG
108799423YP_639620.1 3-oxoacyl-ACP reductase [Mycobacterium sp. MCS]MTDSAVAETESQSTGGRPPFVSRSVLVTGGNRGIGLAIAQRLAADGHRVA
VTHRGSGAPEGLFGVVCDVTDNEAVDRAFKEVEEHQGPVEVLVSNAGISK
DAFLMRMTEERFEEVINANLTGAFRVVQRASRSMQRKRFGRIILIGSVSG
MWGIGNQANYAAAKAGLIGMARSISRELAKANVTANVVAPGYIDTEMTRA
LDERIQAGALDFIPAKRVGTAEEVAGAVSFLASEDANYIAGAVIPVDGGM
GMGH
108799421YP_639618.1 hypothetical protein Mmcs_2454 [Mycobacterium sp. MCS]MTESDGRSVDLPSLQRGQIRDPALSAALRKLELTVRRKLDGVLHGDHLGL
IPGPGSEPGESRIYQPGDDVRRMDWSVTARTTVPHVREMIADRELETWLV
VDMSASLDFGTAGCEKRDLAVAAAAAIAFLNSGGGNRLGAVISNGQTMRR
VPALSGRMHEQEVLRTIATTPKAPPGVRGNLAEAIDALRRPERRRGMAVV
ISDFLGPIDWMRPLRAIAGRHEVLGIEVLDPRDVELPEVGDVVLQDAETG
VTREFTIDHQLREDFERAAAEHRAEVARTLRRCGAPLLSLRTDRDWIADV
VRFVASRRRGAMAGR
108799419YP_639616.1 NLP/P60 [Mycobacterium sp. MCS]MVRLLESLRRTLFHGVKSFVVAAAAVAMLVGVTGPASAAPDDGQWDPTLP
KLLSAGAPGDPLAIANASLAATAQATQVTMDLGRKFLSSMGIGGSSASAG
VAPGRVRGPQAIEYVIRRGASQMGTPYSWGGGKPNGPSRGVDSGANIVGY
DCSGFTQFSYAGVGVLIPKYSGDQYNTGRKVPTSQAKRGDLLFWGPGGSQ
HVAMYLGNGQMLESSGSAGKVTVSPVRQAGLQPYVARIIES
108799417YP_639614.1 hypothetical protein Mmcs_2450 [Mycobacterium sp. MCS]MNMVIADVGDDGVSAPGADVAALRQVVSEARSDGIDLKIVVIDTNPHIDT
PLRDIATEVGQAYPGSTVLALSPSYAGTYSSTFDRVTLEAGQDLAKTGDP
VQSSKNFVGQLTTPDFPWTALTIVLVIGVAAATAATRWLQIRGKRAAAAE
AGPTPADQR
108799415YP_639612.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPRVTDDHLAARRRQILDGARRCFARYGYDKATVRRLEDTIGLSRGAIFH
HFRDKDTLFFELAREDAERMADVASREGLIQVMRDLLAAPDQFDWLATRL
EIARKLRNDPVFHKGWEERSAELSAATTARLHRQKEAGRLRDDVPSEVLQ
TYLDLVLDGLVARLASGDDPKKLGAVLDLVEASVRQQGSSVS
108799413YP_639610.1 ABC transporter-like protein [Mycobacterium sp. MCS]MITATDLEVRAGARTLLSIDGAALRVQPGDRIGLVGRNGAGKTTTMRILA
GEGEPYAGTVTRSGEVGYLPQDPREGDLDMLARDRVLSARGLDTLLSDLE
KQQALMAEVADDAARDKAVRRYGELEERFAALGGYAAESEAGRICASLGL
AERVLTQPLRTLSGGQRRRVELARILFAASDTGSGSDTTLLLDEPTNHLD
ADSIGWLRTFLQNHSGGLVVISHDVELLAAVVNRVWFLDAVRGEADVYNM
GWQKYLDARATDEQRRRRERANAEKKASALRTQAAKMGAKATKAVAAQNM
LRRAERMISELDEERVADKVAKIRFPTPAVCGRTPLVGKGLTKTYGSLEI
FTGVDLAIDKGSRVVVLGLNGAGKTTLLRILAGVEKADAGDIEPGHGLKL
GYFAQEHDTIDGNASVWENIRHAAPDTGEQDLRGLLGAFMFTGPQLDQPA
GTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRSYQG
AVVLVTHDPGAAEALEPQRVVLLPDGTEDYWSEEYRELIELA
108799411YP_639608.1 thioredoxin [Mycobacterium sp. MCS]MTTRDLTADQFNETITDNEIVLVDFWASWCGPCRAFAPTFAASSEKHPDV
VHAKVDTEAEQQLAAAADIRSIPTLMAFKKGKLVFNQAGALPPAALEDLV
QKVKEFDIDAAMAQQENAQSE
108799409YP_639606.1 hypothetical protein Mmcs_2442 [Mycobacterium sp. MCS]MMTVPATGWRGGPVARGLWIGAAAGVFFGALALLDSGVPIVGAIVFVATG
LFLGVWTTRRMDRYWPGARELSPADRVTVVRAARRGYPIRDERLARGVVD
YDAGLRAAAERLYPYRWVVAVVLVVAIATAVVDAVTGSVRETVASCVYLA
LLAIELTWWPARRRELLLNSALAAALAQQSLDKRSP
108799407YP_639604.1 SUF system FeS assembly protein [Mycobacterium sp. MCS]MRLEQIYQEVILDHYKHPHHRGLREPFGAEVKHVNPTCGDEVTLRVALSD
DGDTVADVSYDGQGCSISQASTSVLTDLVIGESVGDALKTVAAFTEMVSS
RGTIEGDEDVIGDGIAFAGVSKYPARVKCALLGWMAFKDAVAQASHDSEE
ERR
108799405YP_639602.1 FeS assembly ATPase SufC [Mycobacterium sp. MCS]MTTLEIKDLHVTVAAGADASGADGGAKEILKGVNLTVNSGETHALMGPNG
SGKSTLSYAVAGHPKYTVTSGSITLDGQDVLEMTVDERARAGLFLAMQYP
VEVPGVSMSNFLRTAATAVRGEAPKLRHWIKEVKGAMTDLDIDPSFSERS
VNEGFSGGEKKRHEILQLSLLKPKIAILDETDSGLDVDALKVVSEGVNRY
AKENDGGVLVITHYTRILRYIQPQFVHVFVGGRIVESGGPELADELEAKG
YERFTAQAASTGV
108799403YP_639600.1 FeS assembly protein SufB [Mycobacterium sp. MCS]MTATPDTTSVTPEHTIGEPLSQEEAIASLGRYGYGWADSDVAGASAQRGL
SEAVVRDISAKKNEPEWMLDIRLRALRTFDKKPMPNWGSNLEGIDFDNIK
YFVRSSEKQAATWDDLPADIKNTYDKLGIPEAEKQRLVSGVAAQYESEVV
YHSIREDLEAQGVIFLDTDTALKEHPDLFKQYFGTVIPAGDNKFSALNTA
VWSGGSFIYVPPGVHVDIPLQAYFRINTENMGQFERTLIIVDEGAYVHYV
EGCTAPIYKSDSLHSAVVEIIVKPGGRCRYTTIQNWSNNVYNLVTKRARA
EAGATMEWVDGNIGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEGQHQDTG
AKMLHLAPQTSSNIVSKSVARGGGRASYRGLVQVNKGAHGSRSSVKCDAL
LVDTISRSDTYPYVDIREDDVTMGHEATVSKVSEDQLFYLMSRGMTEDEA
MAMVVRGFVEPIAKELPMEYALELNRLIELQMEGAVG
108799401YP_639598.1 hypothetical protein Mmcs_2434 [Mycobacterium sp. MCS]MARMAGRLQSFSSSIARWHGDERTVGSPLTEADLVSLRRTRLFGATGTVL
MAIGALGAGARPVVQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWL
MLGRFALGSRRMSRSQTDRTLLLWAIPLLIAPPMYSKDVYSYLAQSEIAL
QGLDPYKVGPATGLGLDHVFTLSVPSLWRETPAPYGPLFLWIGQTISSIT
GENIVWAVLFHRLVVLAGVGLIVWATPRLARRCGVAEVSALWLGPCNPLL
FMHLVAGIHNEALMLGLMLAGTEFALRGVDAVRPLVPRPLHWPSGGAQWA
RWYPMAMLLAGTVLIAMSSQVKLPSLLALGFVAMALACRWGGTVKAFLIA
GGSLTAVAVTVMALIGWASGLGFGWLFTLGTANVVRSWMSPPTLIALGTG
QVGILLGLGDHTTAILGLTRAIGVSIIAVLVSGLLLAVLRGRLHPVGGLG
VALGATVLLFPVVQPWYLLWAIIPLATWATRPGFRGATIAVTLIVGIFGP
TANGDRFALFQIVMATLASTVVVAVLMALTWRRLPWQPLPDGDPPAMPGL
PPPSPESAESDPRPPQPRSAAPGAYADSP
108799399YP_639596.1 ABC transporter efflux protein DrrB [Mycobacterium sp. MCS]MTTNQFAPGTFTPDPRPAAVPKMLAAQFGLELRLLLRNGEQLLLTMFIPI
TLLVGLILLPLGDFGDDRAGTFVPAIMALAVISTAFTGQAIAVAFDRRYG
ALKRLGATALPVWGIIAGKSLAVVAVVFLQSVLLGAIGIALGWRPEVVGL
ALGGAIIALGTAGFAALGLLLGGTLRAEIVLAVANLLWFVFAGLGALTLE
GQAVPGALAWAARLTPSGALTEALTQAMALSVDWLGLAVLAAWGGVAALC
ALRWFRFT
108799397YP_639594.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MARRHGAELDAAIRAAVLKLLADHGPGAVTMESVAAAARTSKPVLYRRWP
DRASLLRDTLMQIATAAIPHDDTGSFRGDMLAVLRGWAVLFTGPDAAVMK
AAVAAAAHDPELTAALRNDVIGWRKQEMAALLRRGIDRGDVRRDVPVEIA
RELGQSVLWHRLLVTGDPITDDLVVALVDDVLVPFVAPR
108799395YP_639592.1 hypothetical protein Mmcs_2428 [Mycobacterium sp. MCS]MLDADLVILRATWDYIDRLDEFKVWTRQVRNLLNSPDVVAWNTDKRYLVE
LAQRGVPTVPTRHFGSGDRVVVPDGEVVVKPAVGGGSVGAQRFTDPVPAA
AHAAHLQAQGRAVLVQPYDARVEYGETALVFLGGAQSHAFTKAAILPPEG
PPVFDESGTYALETLAPAEPDFELWELGHAALGAAAAALGMEAAEFLYAR
VDVIGDRAHARVLEVELVEPSLGWRQLDATTRTDRERDFALAVEVALERL
GLGPLSHRRP
108799393YP_639590.1 peptidyl-tRNA hydrolase domain-containing protein [Mycobacterium sp. MMVSTTLVIAGSELSERFSRSSGPGGQGVNTADSRVELSLDLLRSRSIPQH
LRHRMLSHLRRRLTHGVLTVTASEHRAQLQNRAAARERMARLLRDAAAAP
PPTRRPTRPTRGSKERRITEKKRRGTIKEGRRGGWGPN
108799391YP_639588.1 inositol-1(or 4)-monophosphatase [Mycobacterium sp. MCS]MSTSSGELEDLAVAAAQTGADLCLRRLGEPLIVSTKSAAGDVVTPVDRAA
EEAVREILLAARPGDSVLGEELPAHTGVSGLEWVVDPLDGTTNYTRLIPY
FATSVAVRRTTDGVWLAGAVTAPALGATWSAARGGGAQLRSPAQRAVLPL
QLPATSARLIGTGLSYDPGRRRRQVRELGALVADYTDMRRFGAAAVDLCL
VAQGSLHAFVEDDLAVHDWAAGALIAEEAGATVCRPADGDETVSARWG
108799389YP_639586.1 carbohydrate kinase [Mycobacterium sp. MCS]MSQFTIGVDIGTTGTKTVLVDLAAGRIVAQASAESRLFADAPGHAEADPA
QWINNAHSTIRAVLAESGVTPGQVGALSTTGMVPAVVPVDAHGVPVRRAL
LQNDARATAQIERLREALDAADVLAATGSAITQQSVAPTAMWLRENDPDT
WHRTARLVGSYDWVLMALGAGPHVELNWAIESGLGTLDGQRYEPMFAAAD
LGADTMPEVLAPGAQAGTLSAAAAAATGLPEGLPLIVGGADHVLSAYAAG
VNAAGDWLVKLGGAGDVLAASDSPVIDGRLYLDAHPVPGRWLPNGCMATS
GSLIRWFQTLIGGVDLLQLDDEAAGRDAAEILCLPYFLGEKSPLHDPDLR
GAFVGLDLAHTRADMYRSVLEAIAFGFRHHTDVFTSIGVPLQRAMVTNGG
SKSVLWKQILADVLDTPLFPVIGHPGASLGAAVIAAIGVGALDDWDGAAR
FLTLGDAVEPDPRHVDRYAEAYSLWRTLGGVLTPVSHQLARKAK
108799387YP_639584.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MKIPKLGRRPARRKATRWMPALAMTAGLALAGCAGSGGSGDEQSSSGLGD
IPTDTNATVRVLMENVPDTDIVQGMVGQFNEKYPDIKVQIETMTFDQMRD
RLVSSFQSAEPAYDLIVVDNPWMDDFAAAGFLEPLNDRISSTPDYQPDDF
FPSLTDITDVDGTTYGVPFYNYALGYIYNKPDLQAANLQVPTDLDALVST
SQRLKAGDRAGIAMQPQRGYKIFEEWANWLFAAGGSIYDADGKPTLNTEQ
AARALDAYIETYRTAAPANSLNWGFDEAFRSVSGGNAASMIGYNWNLPAL
NDPAGASGARAGQFALAPIPGGKSALGLWSWAIPANSAAPDAAWAFTSWI
TSPAVDAQRVAEGGAVTRKGSLTDPKVLADGYGEEYYRVVGEILADAAPL
SQGRGGEEMIQAVGTELNDAAAGNKSVADALRDAQAAAERIQQ
108799385YP_639582.1 binding-protein-dependent transport systems inner membrane component [MTRPRPLEVLRIAVLTAALVFVLFPIAWVALASFKTPAQMSEPFLIAFGP
TLDNWRAVLDSGIFAAAGRSVVVGVVTVVVSLVVGSMGAYVIAKYRAGGS
LTRFGMLAAQVVPPAVMVFPFLTMAQALRMTDTLVPVIFAHLSFVLPLVT
WFLIGFFEAVPASLEEQARVDGFTRWQAFRLVVLPQVLPGIGAAGIFGFT
LSWNDMFYGLILAPGNAAILPVAISNFNTFRGVQIGTMSAAIMIAIVPVV
VASFFIQRRLVQGISGGAVKY
108799383YP_639580.1 integrase catalytic subunit [Mycobacterium sp. MCS]MSHRNAPLSETGRLRLARCVVEEGWPLRRAAERYQVAVTTAARWASRYRE
LGPAGMVDRSSRPHRSPNQTPTRTERRIIKVRVLRRWGPARIGYLLGIHP
STVHRVLTRYGLAKLCWLDRPTGRVVRRIETSRCGELVHVDVKKLGKIPA
GGGWRMLGRTIGNRNSKADTSSGRRNKYRTPLRGHHFLHTAIDAHSRLAY
SELLADERKETSAGFWLRANAWFAECGITVRKVLTDNGSCYRSHAFRDAL
GGIEHRRTRPYRPQTNGKVERFHRTLADEWAYVRLYTSDSERCEQFPIWL
HTYNHHRGHTALGGQPPASRVPNLSGQYS
108799381YP_639578.1 transketolase [Mycobacterium sp. MCS]MTTVDDIATLTQPHHPDDWSELDSVAVDTVRVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRTMRHDPSDVHWLGRDRFVLSCGHSSLTLYIQLYLGGFG
LELEDIQALRTFKSKTPGHPEFRHTKGVEITTGPLGQGLASAVGMAMAAR
YERGLFDPDAAPGTSPFDHHIYVIASDGDIEEGVTSEASSLAGTQQLGNL
IVFYDQNQISIEHDTNIALSENVADRYRAYGWHVQEVEGGENVVGIEEAI
EAAKAVTDRPSFIAVRTIIGYPAPNKMNTGGVHGSALGDDEVAAVKEVLG
FDPDKTFEVRDEVIEHTRKLVQRGREAHEKWQPEFDAWAEREPERKKLLD
RLLAQELPDGWDADLTYWEPGSKAVATRAAFGQVLNDVAPKLPELWGGSA
DLAGSNNTTIKGVKSFGPPSISTDDFTADWYGRVLHFGIREHAMGSILSG
IVLHGPTRAFGGTFLQFSDYMRPAVRLASLMDIDTIYIWTHDSIGLGEDG
PTHQPIEHLAALRAIPNLSVVRPGDPNETAYAWRSILARGNGSGPVGFIL
TRQGIPVLEGTDSDGVARGGYVLGGGNPSDDADVIIIATGSELQLAVEAK
KLLAEKDLTAYVVSMPCVEWFESQPKEYRDSVLPPNVSARVAVEAAVAQS
WYKLVGDTGEIVSIEHYGESADDKTLFREFGFTAEAVAAAAERTINN
108799379YP_639576.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium sp. MCS]MVAVNRPVPGVPTPAPAGWRNPLRDKRDKRMPRIAGPCGVVIFGVTGDLS
RKKLMPAIYDLANRGLLPASFSLVGFARRDWADEDFGQVVYEAVKKHART
PFRQEVWDRLAEGIRFVQGTFDDEAAFATLAETLEKLDVERGTGGNHAFY
LSIPPKAFPVVCEQLRRSGLARPQEGRWSRVVIEKPFGHDLESAVELNSV
VNSVFPEESVFRIDHYLGKETVQNILALRFANELYEPVWNNNYVDHVQIT
MAEDIGLGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFHPHELQA
EKIKVLSAVRLAQPLDQTTSRGQYTGGWQGGEKVVGLHDEEGFSKTSTTE
TFAAITLDIDTRRWAGVPFYLRTGKRLGRRVTEIALVFRRAPHLPFDATM
TEELGQNALVIRVQPDEGITLRFGSKVPGSAMEVRDVNMDFSYGSAFAED
SPEAYERLILDVLLGEPSLFPVNAEVELSWNILDPVLDYWASHGKPDPYE
SGTWGPESAFEMLRRDGREWRRP
108799377YP_639574.1 6-phosphogluconolactonase [Mycobacterium sp. MCS]MTVSVRRYPDGDALVTAVGDRLADEIVSAVEFRGRANIVLTGGGTGIKLL
ARLGTHDDRIDWSKVHVFFGDERYVPEADDERNDKQAREALLDHIDIPTA
NVHAMPAADGEFGDDLDAAALAYEQVLAGQAEQDEPTPVFDVHLLGMGPE
GHVNSLFPHTQAVRETARMVVGVTDSPKPPPQRITLTLPAVQRSREVWLV
VSGDGKAEAVAAAVGGADPDDWPAAGAVGREATVWFLDEGAASRL
108799375YP_639572.1 phosphoenolpyruvate carboxylase [Mycobacterium sp. MCS]MRRVRRTPILERMADLPEALEPIGSVTRTEVGREASEPMREDIRLLGAIL
GDTVREQNGEDVFDLVERARVESFRVRRSEIDRAELAGLFDGIGVRAAIP
VIRAFTHFALLANVAEDIHRERRRAVHVAAGEPPQDSSLAATYAKLDSAQ
LDSDEVSAALSGALVSPVITAHPTETRRRTVFDTQHRITELMRLRAHGHE
TTDDGRDIELELRRHILTLWQTALIRLSRLKIQDEIETGLRYYRAAFFEV
IPRVNAEVRSALQTRWPDADLLAEPILRPGSWIGGDRDGNPNVTAEVVRQ
ATSRAAYTAFEHYFAELTGLEQELSMSARLVHVSDELAALADACHEAARA
DEPYRRALRVIHGRLTATALEILDNQPEHELDLGLERYATPAELLADLDV
IDASLRGHGSAVLADDRLLRLREAVRVFGFHLSGLDMRQNSDVHEEVVAE
LLAWAGVHDDYASLPESDRIDLLVSELATRRPLTSQKAELSELARKELDI
VRAGARAVRVFGPQAVPNYIISMCESVSDMLEAAILLKEAGLLDVSDDEP
YAPVGIVPLFETIDDLQRGSSILEAALDLPLYRGMVTARGDSQEVMLGYS
DSNKDGGYLAANWALYRAELDLVESSRKTGIRLRLFHGRGGTVGRGGGPS
YDAILAQPPGAVNGSLRITEQGEVIAAKYAEPRIAHRNLETLVAATLEST
LLDVEGLGDEAGPAYEVLDDLAARAQRAYAELVHETPGFVDYFKASTPVS
EIGALNIGSRPASRKPTTSISDLRAIPWVLSWSQSRVMLPGWYGTGSAFE
QYIAEGAAESEDRLGVLQDLYRRWPFFRTVLSNMAQVLAKSDLGLAARYS
ELVEDEDLRRRVFDKIADEHERTIRMHRLITGQDDLLADNPALARSVFNR
FPYLEPLNHLQVELLRRYRSGEDDELVQRGILLTMSGLATALRNSG
108799373YP_639570.1 triosephosphate isomerase [Mycobacterium sp. MCS]MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDL
RSVQTLVDGDKLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGH
SERRTYHHEDDALVAAKAAAAFRHGITPIVCIGEHLKVREAGNHVEHNVE
QLRGSLAGLTSEQIGQAVIAYEPVWAIGTGRVAGAADAQEVCKAIRDELG
KLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGGASLDGEQFAT
LSAIAAGGPLP
108799371YP_639568.1 glyceraldehyde-3-phosphate dehydrogenase [Mycobacterium sp. MCS]MTIRVGVNGFGRIGRNFFRALDAQKAEGKSTDIEIVAVNDLTDNATLAHL
LKFDSILGRLPYEVSLEGDDTIVVGDTKIKALEVKEGPAALPWGDLGVDV
VVESTGIFTKRDKAQGHLDAGAKKVIISAPASDEDITIVLGVNDDKYDGS
QNIISNASCTTNCLGPLAKVLNDEFGIVKGLMTTVHAYTQDQNLQDGPHK
DLRRARAAALNIVPTSTGAAKAIGLVLPELKGKLDGYALRVPIPTGSCTD
LTAELAKPGTAEEINAAMKAAADGPLKGILKYYDAPIVSSDIVTDPHSSI
FDSGLTKVIDNQAKVVSWYDNEWGYSNRLVDLVALVGKSL
108799369YP_639566.1 hypothetical protein Mmcs_2402 [Mycobacterium sp. MCS]MPSSATGFVPSAPRAAQLEACFEELSELAGKRNAIDGRIVEIVAEIDRDG
LWGATGARSIPALVAWKLGLSSKNAKTIAAIAHRLDEFPAAPELSARADC
HWIKSAPSPTGSHGIR
108799367YP_639564.1 major facilitator transporter [Mycobacterium sp. MCS]MKRSFSFVRGRDPLVIAFGTSFIAAMYGLVRLAYGLFLPDIQADLHLGAA
GAGYIFSASSLLYCAAAATGFVLGHRMPRALVVVAAVTACGGVWGMAAAP
GVAVFSVFAVLSSAGAGLASPALVSIVARNVDPRRVDSAQSMVNAGTGPG
LVAAGVLALVLLPQWRVTWVLIGVLTAVCALAVLTVDRRRTGPAQGQHLR
PSKAWVARHTGAIAAAILMGAGSSAVWTYGRSLLVETGASSQRGTITAWI
VLGLGSAALLLTAKPLARLTPVAAWILTCSVMTGAIALLAIVPQVTVAAL
VGCFAFGWGFTAATSSLILWTTAIDPAHAAAGTAMLFIALMFGQAVGATA
LGVIISGAHFAPAFGVAAALSAASIVLAAYQRRRRGIPKSETPVAVS
108799365YP_639562.1 hypothetical protein Mmcs_2398 [Mycobacterium sp. MCS]MTAEVKDELSRLVVNSVSARRAEVASLLRFAGGLHIVSGRVVVEAEVDLG
IIARRLRKDIYDLYGYNAVVHMLSASGIRKGTRYVVRVAKDGEALARQTG
LLDLRGRPVRGLPAQVVGGSVADAEAAWRGAFLAHGSLTEPGRSSALEVS
CPGPEAALALVGAARRLGVSAKAREVRGSDRVVVRDGEAIGALLTRMGAQ
DTRLTWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERALEI
LGDTVPDHLASAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLLSM
ADRKAKQDGIPDTESAVTPDLLEDA
108799363YP_639560.1 hypothetical protein Mmcs_2396 [Mycobacterium sp. MCS]MTESDMSEQLRGDVDHPESGIDVVLVTGLSGAGRGTAAKVLEDLGWYVAD
NLPPELIARMVELGLAAGSRITQLAVVMDVRSRGFTGDLDWVRRDLATRN
ITPRVLFLEASDDILVRRYEQNRRSHPLQGDQTLAEGIARERALLAPVRA
SADLVIDTSKLSVHALRESVERAFGGEVVAETSATVESFGYKYGLPMDAD
IVMDVRFLPNPHWVDALRPHTGQHPDVRDYVLGQPGAEEFLDTYHRLLNV
VIDGYRREGKRYMTVAIGCTGGKHRSVAIAEALAGRLQGGDELTVRVLHR
DLGRE
108799361YP_639558.1 gamma-glutamyltransferase 1 [Mycobacterium sp. MCS]MAGCSDAEQAPPTPPPVPCEMVSNGTPTPKTPAAAPPGQAGEDLANEPEV
GTGYRKDMTAVRTARYSVSTANPLATQAACRVLRNGGTAADAMVTAQATL
GLVEPQSSGVGGGGFLLYYDAASGAVQAYDGREVAPAAATENYLRWVSDT
DRTPPKPDARASGRSIGVPGIVRLLQTAHEAHGKTTWRELFEPAVQLADG
GFDVSPRLAAAISDSRAELSGDTAAGKYFLNADGKPKTAGSRLTNPAYAK
TLSAIASDGADAFYTGAIAEAVVEAAADTSGGRTPSAMTLQDLAAYKVEV
RQPLCRPYRGKEICGMPPPSSGGLAVLATLGMLERFPMADHRPDDIDRNG
GRPDAMGVHLISEAERLAYADRDRYVADTAFVPLPGGTADTLLNSAYLAG
RAALINEQRSMGVAKPGEFGPPAAPTPQPREHGTSQVSIVDSYGNAASLT
TTVESQFGSFHMVDGFLLNNQLTDFAAEPAGPDGVPVANRVQPGKRPRST
MAPTLVFDASTGPPGTRGPLYAVLGSPGGAVIIQFVVKTVVGMLDWGLDP
QQAVGMVDFGADNSPETNVGGEHPNVDIADNGDHDPLVTGLRRLGHRVDL
ADQSSGLSAIVRDDTGWIGGADPRREGMVMGDGR
108799359YP_639556.1 hypothetical protein Mmcs_2392 [Mycobacterium sp. MCS]MSDWEVVIRPHLTPYFAYAAAAVIVAAHVAVGFLLKIGSSGVIFQTADQV
AIALLGVIIGGVVTLFARPRVRVGPRGLAVRNLWAERVLEWPDIVGVSFP
RGARWARVDLPDDEYIPLMAIQAVDKERAVEAMEQLRDALARYRSHTQ
108799357YP_639554.1 bifunctional 3-4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohyMTRLDSVERAIADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMV
RYTSGYLCVPLDGAICDRLGLLPMYAVNQDKHGTAYTVTVDAKHGVGTGI
SASDRATTMRLLADPTSNADEFTKPGHVVPLRAKDGGVLRRPGHTEAAVD
LARLAGLQPAGTICEIVSQKDEGAMAQTDELRIFADEHDLALISIADLIE
WRRKHERHIERIAEARIPTRHGEFRAVGYTSIYDDVEHVALVRGDVAGPH
GDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGIVLYMR
GHEGRGIGLMHKLQAYQLQDAGDDTVDANLKLGLPADARDYGIGAQILVD
LGVRSMRLLTNNPAKRVGLDGYGLHVIERVPLPVRANAENIRYLMTKRDR
MGHDLTGLDEYDEANSMDDYDEGVYLLGERRPTDLGGSR
108799355YP_639552.1 hypothetical protein Mmcs_2388 [Mycobacterium sp. MCS]MPTSPRHAAQALIAVLLAAAMFVAGCSSSSEDADKPLPDAATLLQDSTQT
TRDLQSVHLNLTVQGTIEELPIESLEGDLTNTPAVAASGKANIVFLGQRL
DGVEFVVADGNLYGAISAGSFQDFGPAVDIYDVAAILSPDKGLANVLSNF
SDPKSEGRETVSGVDTVRVTGTVSAEAVNAIAPQIGATGPVPAVAWIEEE
GSHNLAQVKLEPSAGNSVTMTLSDWGKQVTVTKPAV
108799353YP_639550.1 riboflavin biosynthesis protein RibD [Mycobacterium sp. MCS]MTPEAAMALAVEQADRVKGGTYPNPPVGAVILDADGEVAGVGATQPPGGP
HAEVMALRRAGRKAAGGTAVVTLEPCNHHGRTPPCVDALLAAEVSAVVYA
VPDPNPVAAGGAARLGESGVTVTAGVLGDAVAGGVLREWLHKQRTGKPHV
TWKFATSVDGRSAAADGSSQWITSEAARTDVHRRRAVADAIVVGTGTVLV
DDPVLTARLPDGSLAERQPLRVVVGKREISSDSRVLNDDSRTMVIRTRDP
QEVLRALSDRTDVILEGGPTLAGAFLRAGAIDRIVAYVAPILLGGPVTAV
DDVGVLSIAHAQRWRFDGITPIGPDVLLSLVPG
108799351YP_639548.1 hypothetical protein Mmcs_2384 [Mycobacterium sp. MCS]MTRPPHRPQRNRRKPLDPARRVAFDVLRAVSERDAYANLALPALLNERGL
DGRDAAFATELTYGTCRSRGLLDAVIEAAAGRPVDRIDPVLLDLLRLGTY
QLLRTRVEPHAAVSTTVEQAGIEFDTARAGFVNGVLRKIAGRDEQSWVAE
LAPPADTDPVGHIAFTHAHPRWVAQAFTDALGARAGELDALLASDDARPL
VHLAARPGVLSAEELAAAVGGELGRYSPYAVYLPGGDPGRLDPVRDGSAL
VQDEGSQLVARALTLAPVDDDRGRWLDLCAGPGGKTAMLAALAPGPLTAV
EPAPRRAEMVEENTRGLDVTVLRVDGRDPGLEPGFDRVLVDAPCTGLGAL
RRRPEARWRRQPGDVPGLARLQRELLASAIRLTRPGGVVLYATCSPHLAE
TVGVVADAVRRQPVTALDTRALFDPVDDLGDGPYVQLWPHRHGTDAMFAA
ALQVI
108799349YP_639546.1 hypothetical protein Mmcs_2382 [Mycobacterium sp. MCS]MVSFVLVLVLVLAVLALAGFVMGYNKLRAADVRVAEALAGIDVELTRRAS
LIPSLVHTVQTFAAHEKTILDHVSTARAAVASATAGRSVAQRSAAERELD
TAVGQVLALGQAYPKLNSSANFLDLQRNLADTENKLAFARQYYNDAVATL
NRLTTTIPWMFVAGPAGVSEREYYQTPR
108799347YP_639544.1 primosome assembly protein PriA [Mycobacterium sp. MCS]MTKTRQPAEHEPIARVLPMLSVPHLDREFDYLVPAECSDDAQPGVRVRVR
FHGRLVDAFLLERRSETDHPGQLGWLDRVVSPQQVLTPDVRRLVDAVAAR
YAGTRPDVLRLAVPPRHAGAEKKPAAELPAVDVPAIDLTAWRAYPRAEQF
LGAVGEGRAARAVWQALPGERWATRLAEAAALTVGSGRGVLAIVPDQRDV
DALHAAAVTLLADERVVALSAGLGPSQRYRRWLSVLRGGARFVIGTRSAV
FAPVCDLGLVMVWDDGDDSLAEPRAPYPHAREVAMLRAHQLRCAALIGGH
SRTAESQALVRSRWAHDLVAPRPVVRAAAPRVIALEDSGFEQERDPAAHT
ARLPSVALRTARAALQAGRPVLVQVPRRGYLPALACARCRAIARCRHCTG
PLSLLERGGAAMCRWCGREELGLRCGRCGSDSVRAVAVGARRTAEELGRA
FAGTPVVTSSGEAMVGTVADEPALVVATPGAEPEPAAGYGAALLLDGWAL
LGRQDLRAAEDTLRRWMAAAALVRSRADGGVVTVVAESAIPTVQALIRWD
PVGHAESELDSRSEVGLPPAVHIAAVDGDFAAVTALLETADLPDDAETLG
PVDLPVGARRPPGTSPDAAVSRMLVRVPRDRGLALAAALRRGTGVLSARH
DTEPARVQIDPLHIG
108799345YP_639542.1 YjeF-like protein [Mycobacterium sp. MCS]MSSIGGFSSATDTTSPYAHRRTALWWAAAAAVAASYGVFLIVTALRVPSG
AELTGQFVAQPAVKALAAVLLAVAAAGHPIRRERRWLVPALVFSACGDFL
LAIPWWEPSFVLGLASFLVAHLCFLAALVPLAARSAPRSVAVALTVIACG
ALLVWFWPRLLADGMAVPVTAYITVLGAMVCAALLADLPTPWTALGAVCF
AVSDAMIGIGKFVLAPEDTEALAVPIWWAYAASLLLITAGLFFGRTVNRP
ET
108799343YP_639540.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MRIFVTGASGFIGSAVVAELIAAGHSVVGLARSSASADAIAAAGAEVHRG
DLTDPDGIRAGADACDGVIHLAYRHDFDDYANAAELDRRAIQTLGAVLAG
SDRPLVVASGMAGLASPTGFITEQVAAGAGSMRLSEAAALPWADHGVRVS
ILRLPPTVHGEGDHGFVAHLIGIARRQGVSGHPGDGTNRWPAVHRLDAAA
LFRRAVEDAPAGAVLHAVDDEGVPVRDIAEIIGRHLDVPVRSIPGPSTAA
HFGWIGALFALDVPASSDSTRQAFAWKPTHVGLIDDLEQGHYFSGR
108799341YP_639538.1 cyclohexanone monooxygenase [Mycobacterium sp. MCS]MPDHHTLIVGAGFAGIGAAIALDKAGLADYRIVEAGDAPGGTWYWNTYPG
IAVDIPSFSYQFSFEQSPDWSRTYAPGHELRAYAEHCVDKYGLRDRIRFG
TEVLGATFDEGADEWRLRLDSGDELTSRFLINATGVLTVPNMPDIPGVDS
FAGTTMHTARWDAGVDLRGKRVAVIGTGASAVQVIPEIAPLVERLDVFQR
TPIWCFPKFDVPLPRALRGAMRLPGGKAVQRLLSQAFVEFTFPLAAQYFT
INPLAKRMDTMGRSYLRKQVDDPATRDKLTPRYSVGCKRPGFHNTYLATF
NRSNVRLITEPIDKITGSGVCTTDGQSHDVDVLILATGFKVADTDAQTFA
IHGSGGRSLAEFWETNRLQAYEGVSVPGFPNLFSVSGPYGYVGSSYFALI
ETQTRHIVRCLREARQRSADRVEVSRAANDRYFDEMMRKRHRQIFWQDSC
RDARSYYFDRNGDVPLRPASTLEAYWRSRRFPLDDYEYSPRIVVRRRS
108799339YP_639536.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantotheMDRKRIIVGVAGGIAAYKACTLVRQLTEAGHDVRVLPTESALRFVGAATF
EALSGHPVHTGVWDDVHEVPHVRIGQDADLVVVAPATADLLARAVAGRAD
DLLTATLLTARCPVLFAPAMHTEMWFHPATVDNVATLRRRGAVVLEPASG
RLTGADSGAGRLPEAEEIATLAQLLLVRGDALPYDLAGVKALVTAGGTRE
PIDPVRFIGNRSSGKQGYAMARVLAQRGADVTLIAGNTAGLVDPAGVDVV
HIGSAAQLRDAVSKHAPAAHVLVMAAAVADFRPVHAATSKIKKSSDPGED
APTIDLTRTDDILAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHAR
AKFKRKGSDLLVVNAVGDNRAFEVDNNDGWLLAADGTETALEHGSKTLMA
SRIVDAIVAFLQNSNG
108799337YP_639534.1 guanylate kinase [Mycobacterium sp. MCS]MNTGRGVGRVVVLSGPSAVGKSTVVRCLRERIPDLYFSVSATTRAPRPGE
VDGVDYSFVTPEAFQQLIDDGALLEWAEIHGGLHRSGTPARPVREATVAG
RPVLIEVDLAGARAVKQAMPEALSVFLAPPSWEVLERRLVGRGTETPDVM
SRRLDTARTELAAQSDFDVVVVNSQLESACSELVSLLVGHTSAGTNPA
108799335YP_639532.1 orotidine 5'-phosphate decarboxylase [Mycobacterium sp. MCS]MFGQRLAEAVASRGPLCPGIDPHPELLTSWGLSVDADGLSRFCEICVEAF
AGFAIVKPQVAFFEAYGSAGFAVLERTIVELRAHGVLVLADAKRGDIGST
MAAYAQAWAGESPLAADAVTASPYLGFGSLQPLLDTATAHGRGVFVLAAT
SNPEGASVQRARVDGRTVAQSIVDAASAVNREAGGPGSVGVVVGATVTEP
PDVSALGGPVLVPGVGAQGGRPEALGGLGGARPGQLLPTVSREVLRAGPD
VDALRGAAERMRDDVAYLAHRV
108799333YP_639530.1 carbamoyl phosphate synthase small subunit [Mycobacterium sp. MCS]MSNTSETRSGSRIDGAVALLVLEDGRVFTGVPYGAVGQTLGEAVFSTGMS
GYQETLTDPSYYGQIVVATAPQIGNTGWNHEDAESRDDRIWVAGYAVRDP
SPRASNWRATGTLDEELVRQGVVGIAGIDTRALVRHLRTRGAMKAGIFSG
DESAAPMSELLERVRSQPGMLGASLADKVSTDDVYIVEPEGAHRFTVAAI
DLGIKTNTPRNFARRGIRSHVLPARATFEQIADLKPDGVFLSNGPGDPAA
ADHVVEVTREVLGAGIPLFGICFGNQILGRALGRGTYKMVFGHRGINVPV
MDHATGRVAITAQNHGFALEGEAGERFDTPFGAAVVSHTCANDGVVEGVK
LVNGRAFSVQYHPEAAAGPHDANYLFDQFVDQMSEEK
108799331YP_639528.1 dihydroorotase [Mycobacterium sp. MCS]MSLLIRGVRPYGEGDPVDVLVEDGQIAEIGERLSAPEGADAVDAHGQILL
PGFVDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTTPVADSPV
VTDHVWHRGQQVGLVDVHPVGAVTMGLQGKQLTEMGMMAAGVGQVRMFSD
DGVCVDDPLIMRRALEYASGLGVLIAQHAEEPRLTVGAVAHEGPNAARLG
LAGWPRAAEESIVIRDALLARDAGARVHICHASTAGTVELLRWAKEQGIA
ITAEVTPHHLLLDDSRLATYDGRNRVNPPLREAGDAEALRRALADGVIDC
VATDHAPHAEHEKMCEFAAARPGMLGLQTALSVVVRTMVEPGLLSWRDVA
RVMSEAPARIVGLPDQGRPIEVGEPANLTVVDPDATWTVSGSALASRSDN
TPFEEMTLPATVTMTMLRGKVTARDGKSPSL
108799329YP_639526.1 bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltMGSPDNPDRELMTAADVTRTISRIAHQIIEKTALDGPDAPRVVLLGIPTR
GVTLAARLAERIETFSGVTVPHGGLDITLYRDDLDTKPPRPLEDTSIPTG
GIDHALVILVDDVLYTGRSVRAALDALRDIGRPNVVQLAVLVDRGHRELP
LRADYVGKNVPTSRSENVKVRLAETDEVEGIWIAPHGGPQR
108799327YP_639524.1 FAD-binding monooxygenase protein [Mycobacterium sp. MCS]MSAPTVLVSGAGIAGPALAFWLTRNGYRVVVVETAADIRPGGQTVDLRGA
GADVVARMGLLEQMERRALFQRGIAWVRSDGSRRAEMPVTAFDGNGPVSK
LEILRGDLVDVLCGATKDVCEYRFGTRIETLAEHDAGVDVTFADGGEMRA
DLVVGADGPHSAVRRLVFGPEERFVTPLGGYNAWFSAPDTVGLDGWYLMF
QAPGGLNASMRPSLDPSTVKASLSFRSEPIVYDRRDLGEQRKILRERFTG
AGWQCDALVEAAERAEDFYFDSFTQVKMATWSSDRVTLVGDAGYCASPLS
GMGTSLALVGGYLLARELGSAGTDLTVDRLRSAFRRYDVEMRPYVDRCQK
LNNTLDRYAPMTEKEISDNATAMKWMQRWPLRPIASRLWFRTADAITLPD
108799325YP_639522.1 elongation factor P [Mycobacterium sp. MCS]MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVV
DKTYNAGVKVETATVDRRDATYLYRDGSDFVFMDSEDYEQHPLPESLVGR
AADFLLESMPVQIAFHDGVPLYLELPVTVELLVASTEPGLQGDRSSAGTK
PATMETGAEIQVPLFINTGDKLKVDSRDGSYLGRVNA
108799323YP_639520.1 hypothetical protein Mmcs_2356 [Mycobacterium sp. MCS]MSKWLLRGLVFAALMVIVRLLQGAMINTWETRAATISIVLVSVYALVAFA
WGFVDGRRDARQNPDPDRRSDLAMTWLLTGLFAGIVSGFVAWLIGVFYKN
LYVEALLNELTTFAAFTALLTFVLAIIGVALGRWLVDRKTPDEPRKRHGE
DDDRADTDVFAAVRPGGQDGRDGHDDSPTTEQQRA
108799321YP_639518.1 3-dehydroquinate synthase [Mycobacterium sp. MCS]MSEPVTVDVLVDPPYPVIIGTGLLGELGRLLEGRHKVAILHQPTLSVTAE
AVRSHLADKGIDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGVGRKDAIVS
LGGGAATDVAGFAAATWLRGVDIVHVPTTLLGMVDAAVGGKTGINTDAGK
NLVGAFHQPAAVLIDLATLETLPRNEIVAGMAEVVKAGFIADPHILDLIE
ADPEAALDPSKDVLPELIRRAVAVKAEVVAADEKESALREILNYGHTLAH
AIERRERYQWRHGAAVSVGLVFAAELGRLAGRLDDQTADRHRSVLEALGL
PVSYDPDALPKLLEYMAGDKKTRSGVLRFVVLDGLAKPGRLEGPDPSLLA
AAYSVVGGTR
108799319YP_639516.1 chorismate synthase [Mycobacterium sp. MCS]MLRWTTAGESHGRALVAVLEGMVAGVSLTTEDIGAQLRRRRLGYGRGARM
KFEQDEITMLGGVRHGVTLGGPIAIQIGNTEWPKWETVMAADPVDPAELA
EIARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTV
ARAFLRQALGVEVVSHVISIGASTPYDGPPPQPADLTAIDDSPVRAFDEA
AEKSMIAEIEAAKRDGDTLGGVVEVVVSGLPVGLGSFTSGDNRLDSQLAA
AVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGPDGVVRSTNRAGGLEG
GMTNGQPLRVRAAMKPISTVPRALATVDMTTGDEAVAIHQRSDVCAVPAA
GVVVETMVALVLARAALQKFGGDSLTETRTNVESYLRAVAAREPATAQRA
QASG
108799317YP_639514.1 peptidase A24A- prepilin type IV [Mycobacterium sp. MCS]MLVWLSALTVYDLRWRRLPNWLTLPGATVILVGAVLAGRGTPAALGAAAL
FTLYAATHLLAPAAMGAGDVKLALGVGGLTGAFGADVWLLAALAAPLLTA
ICALATLTRRDRTVPHGPSMCAASAAAVALVVL
108799315YP_639512.1 aminodeoxychorismate lyase [Mycobacterium sp. MCS]MAEDWRHDRAEPVAVGPPRRGMSRSDRMRLERGRRKRRMAGALSLALLIV
VVVGAVFLGSKLWHNMFGGNSNDFAGEGVNDVVIQVHDGDSTTAIGQTLH
DNNVVATVKAFVEAAEGNSGITAIQPGFYKVRTEIPAANAVERLTDPQSR
VGKLVIPEGRQLDDVSDVKTNAVTEGIFTLISKATCVDLDGERQCVPVDE
LKRVAETAAPSALGVPEWAVQPVTAMGDDHRRLEGLIAPGSWNIDPSATP
QDTLATLIRASANQYAQSGLLETATAMNLSPYQVLTVASLVQRESKPEDF
AKVARVIYNRLAENRTLEFDSTVNYPLDRIEVATTDGDRGQMTPWNTYVR
PGLPATPICSPSQPALVAAEKPAEGDWLYFVTIDLQGTTLFTRDYNEHLA
NIELAQRNGVLDSAR
108799313YP_639510.1 alanyl-tRNA synthetase [Mycobacterium sp. MCS]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPFFLG
QRTPPYQRATSIQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKKGA
IEFAWTLLTNPVDQGGYGFDPEKLWATVYLDDDEAIQLWQEVAGLPLERI
QRRGMADNYWSMGIPGPCGPSSEIYVDRGPEYGIEGGPEANEDRYIEIWN
LVFMQNERGEGTGKSDFEILGPLPRKNIDTGMGIERVACLLQGVDNVYET
DLLRPVIDAVAARAPRGYGRGSHSDDVRYRIIADHSRTAAILIGDGVSPG
NDGRGYVLRRLLRRVIRSAKLLGIDDAVVGDLMATVRDAMGPSYPELVTD
FDRIQRIAVAEETAFNRTLSSGSRLFEEAAQSTKAAGADRLSGRDAFTLH
DTYGFPIELTLEMAAEADLAVDEEGFRSLMAEQRQRAKADAAARKQAHTD
LTAYRELVDAHPTQFTGFDELTTEARILGIFVDGRRVPVVGHDTATAQHR
IELVLDRSPFYAESGGQIADEGTITGTGASQTAKAAVSDVQKIAKTLWVH
RVTVESGEFVEGDTVTAAVDPRWRHGATQGHSGTHMVHAALRQVLGPNAV
QAGSLNRPGYLRFDFNWQGALTDDQRTQIEEVTNEAVEADFEVHSFTTEL
EKAKSMGAMALFGEAYPDEVRVVEIGGPFSLELCGGTHVRSSAQIGPVTI
LGESSVGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSEEVPARV
AGLVERLKAAEKELDRMRLANARAAAVNAVAGAERVGKVRLVAQRMAGGM
SAGDLRTLVGDIRGKLGGDPAVVALIAEGDNDTVPFVVAVNPAAQDLGLR
ANELVKQFGAAVNGRGGGKADLAQGSGKGAAGIDAALAALRAEIDRS
108799311YP_639508.1 hypothetical protein Mmcs_2344 [Mycobacterium sp. MCS]MFARTTTIEARPDAVDAGVAHIRNEVMPVLRDVDGCVGLSLLVDRESSRC
IATTAWESVEAMHAAEERVRPVRERAAEVFGGTPVVDEWEIAVLHREHRA
GAGAGVRATWLRARPEQFDQAVAFYRSEVLPSIEELDGFCSASLMIDRTS
GRAVSSVSFDSMGAMDRTRDQARSLRTARLRDLGADQLDVGEFELVIANL
RVPEMA
108799309YP_639506.1 long-chain-fatty-acid--[acyl-carrier-protein] ligase [Mycobacterium spMTLRTNPLASALSDSMAAADTDLVLLDRESGAWRRHPWSEVLARSMNVAE
RIGDADASAVGVIGEPNVEFVAAIVGSFLAGRGVSVLPGPVRGAAADQWA
HNTLARFAGAGVSHVLTHGSHLGHLRVADGSAAVHDVTTWAGPNRSAPLD
ASLPTGDVAILQGTAGSTGTPRTVRLSPDAVLANLTGLSARIGLERGHDV
GCSWLPLYHDMGLSFLLTGALAGVETWQAPTSAFQASPFRWLNWLSDSRA
TITAAPNMAFGMIGKYARRVTDVDLSNVRFALNGGEPVDCELTALFATAM
SRFGFSAGALAPSYGLAESTCAVTVPEPGDGLRTDEVAVGTDDGVSLRRH
AVLGHAIPGMQVRISPREGDADVSGREVGEVEIRGSSMMSGYVGGASLDA
QTWFATGDLGYLVDGALVVCGRAKELITVAGRNIFPAEIERVAAQVPGVR
EGAVVAVGTGEGSIRPGLVIAAEFRGRDEAGARSELVQQVASQCGVVPSD
VVFVRPGSLPRTSSGKLRRLAVKHSLEAGTEPQPR
108799307YP_639504.1 gas vesicle protein GvpA [Mycobacterium sp. MCS]MSEVLPADNNREIALVDLLDRVLAGGVVISGDITLSIADVDMVVISLRTL
ISSVGTLLGPEDLE
108799305YP_639502.1 gas vesicle protein GvpA [Mycobacterium sp. MCS]MTLAGDDSYSPVPRSSGSPLSSPQGTNLGDILERVLDKGIVIAGDIRVNL
LDIELLTIKLRLVIASLDTAREVGIDWWTHDPWLTGNKSALQLENDELRS
RIAQLEMGNGRRAAVEVDYVEPEDVD
108799303YP_639500.1 hypothetical protein Mmcs_2336 [Mycobacterium sp. MCS]MGLFSAILLAPLLPVRGVISLAEVIQRQVEQEMNDPARTREQLEALAEAR
DSGEISAEEEKAAQREILAERMEPQTPEATPPESG
108799301YP_639498.1 gas vesicle synthesis-like protein [Mycobacterium sp. MCS]MSTAIQPAGTAGGGGSDSNGLADVVDTILDKGLVLDAYVRVSVVGIEILT
VDARVVVASVDTYLRYADAVNRLDIVNEDPKSDLGGLVGDVAESATSGVA
KGKTTGVLEAAGEKLGDMLTSDEPEPRKATRVRSRRADR
108799299YP_639496.1 hypothetical protein Mmcs_2332 [Mycobacterium sp. MCS]MANGSKVALAVGAGYFLGRTRKMRLALMLAAAGITGKFPASPTELVAQGL
KSLGASADVTQLSDQLRGELLGAARAAALAAATNQVNALNDRIGGVTSAV
DTEEVLDDVGGTVGDVGDTVSGTVRGTGKGLRSARRLGRRRPAPEEAVDE
DVYDDEDEDEQDLLESEDDVDDLSDDDEDQAVDEETDEDTDLDEEPEEEP
EPEPPPRRRRAARQPAAAKTAMRRSSRATADDVPATSAARHGRSATKRAP
IRRGR
108799297YP_639494.1 MMPL [Mycobacterium sp. MCS]MPQRGVLARIAAFSIAAPRRIIAAAILAAVAAAVFGVPVAGKLSPGGFEN
PSAESSRATALLAQRFDQGDTQLLITVTSPRGAMADPARAVGTDIVDTLR
RSPHVVSVTSAWTESGPAAERLLSEDGDTGLVVAGVTGGDEAARNAEDLV
EAVGGDRSTRDGVTVRAGGVAMVNSQITTQTQHDLLLMESIAIPFSFLVL
VWVFGGLLAAAVPVGVGLIAIVGSLAVLHVITFLTDVSIFALNLCMAMGL
ALAIDYTLLMVSRYRDELAAGADRDVALTRMMLSAGRTVVFSATTVALPM
LTMVLFPMYFLKSFAYAGVATVVFAAVAALVLTPAAIALLGDRIDALDVR
RLGRRLLRRPEPAPKPVQRQFWYRSTKFVMHRAVPVGLAGIAVLMLLGLP
FLGVRWGLPDDRVLPQSASAHEVGDQLRTEFAADPATAVTVVIPDARGAT
ESELSRYATDLSRVADVSSVSAPTGTYVAGRRVGPPTAATGVRDGSAFLT
VSTDAPLFSDSSAAQLERLHEVTGPAGRPVELAGVAPSNSDSVAAITSRL
PLVLGLIAVSTFCLLFLLTASVVLPLKALLLNVLSLSAAFGAMVWIFQEG
HLGALGTTPTGTLVANIPVLLFCIAFGLSMDYEVFLMSRIREFWLASGRT
AADVTESVALGLARTGRVVTAAALVMSISFAALIAANVSFMRMFGLGLTL
AVLADATLVRMVLVPAFMRVLGRWNWWSPKPLARLHRRIGLAEAPAAG
108799295YP_639492.1 chalcone and stilbene synthases-like protein [Mycobacterium sp. MCS]MEYRNLALPLERYPRLSGFTEANAAYVEVATELGEQAVRSALHEAHIRPD
QVDAIVAVSSTGVAVPTIDATICSRLGFRPDVKRIPLFGLGCVAGAAGMA
RVHDYLRGYPDHVAVLLSVELCSLTLQRDDTSIPALIGLCLFGDGAAAVV
ATGADRAPARGRPAPRVLATRSRLFPDTAEVMGWNVSSSGFQLVMSRDVP
AMAQNHLGDEVDRFLADHGLTTNDVSTWICHPGGPKVLEAIHGAVGMPAD
ALRHSWESMRDNGNISSASVLDVLDRTVAQRPTDGTLGLMLAMGPGFGFE
LLLLSW
108799293YP_639490.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MVGGDGDEQLDRAFMALADPVRRAIVARLSRGPATVNELAAPFDITKQAV
SRHISVLEQAGLVTRTRDAQRRPVHLDAAALERLTGWIDRYRLDAERSYR
RLDAVLAEISDRTTENPEKGRS
108799291YP_639488.1 hypothetical protein Mmcs_2324 [Mycobacterium sp. MCS]MTDRYGRDVLARNPHAPKRVRSTEHPVEPGMVVEDAQSGYVGAVVRVETG
RVELEDRHGKVRTFPLGPGFLLDGRPVILTAPRRASAAPARTASGSVAVA
GARAKVALASRIYVEGRHDAELVEQVWGDDLRIEGVVVEYLGGVDDLTAI
VEEFRPGPGRRLGVLVDHLVTGSKESRIAEAVGRGPYGAHTLVVGHPYID
IWEAVKPARLDIPAWPRVPRGTDWKHGVCAALGWPHDTQADIARAWQRIR
GRVRNWTDLEPELIGRVEELIDFVTAPASP
108799289YP_639486.1 transglutaminase [Mycobacterium sp. MCS]MTAADRPTRTYRITHRTVYRYSDVVTSSYGRGFLTPRDSLRQRCLTHELL
IDPEAADRSTSRDAYGNLSSYFHVTERHQRLSITSRSVVEVDPPPDTVYG
GGSARAPWEIARPVGADGALATEFTLDLQPPEITAAVRDYAAPSFTPGRP
LIEVLRDLTSRIYRDFTYRSGSTTVSTKVSEVLAAREGVCQDFARLAIAC
LRANGLAASYVSGYLATDPPPGKERMVGIDATHAWASVWTPQDQWLGLDP
TNDQMEDERYIRVGIGRDYADVPPLRGIIYTDSESSKIEVSVDVAPVESA
AGGVR
108799287YP_639484.1 transglutaminase [Mycobacterium sp. MCS]MGIKVALEHRTSYTFDRLVEVHPHVIRLRPAPHSRTPIEAYSLTIEPDDH
FVNWQQDAFGNFLARVVFPTRTRQLTITVGLIADLKVINPFDFFIEEYAE
RIGFAYPKALAEDLKPYLKPVDEFGDGSGPGDLVQAWVKNFTVAPGTSTI
EFLVALNRAINADVGYSVRLEPGVHTPDHTLRVGIGSCRDSAWLLVSILR
QLGLAARFVSGYLVQLTSDVQALDGPSGPAADFTDLHAWTEVYIPGAGWI
GLDPTSGLFAGEGHIPLSATPHPDSAAPITGATEPCESTLDFANLVTRVH
EDPRVTLPYTETAWDAVCALGARVDDRLTKGDVRLTVGGEPTFVSVDNRT
DPEWTTAADGPHKRERASALAAGLKTVWAPQGLVQRGQGKWYPGEPLPRW
QIGLYWRADGAPLWTDASLLADPWGAETHTVDDDAARRLLAAVAAGLGLP
GTQVRPAFEDPLSRLAAAARRPAGEPVAPDDDLADDTARARADLLARLDT
SVTEPAAFVLPLHRRDDDSAWASADWRLRRGRIVLLDGDSPAGLRLPLDA
ISWQPPRPGYPADPLARRGALASVADAAEQTDAEVEDADSLPTTAMVTEV
RDRVLYVFLPPTEELEHFVDLVGRIEAAASAIGCPVVIEGYPPPADPRLT
SVTITPDPGVIEVNVAPTASFAEQRTQLETLYEQARLARLTTEQFDVDGT
HGGTGGGNHITLGGPTPADSPLLRRPDLLVSMLTYWQRHPALSYLFAGRF
IGTTSQAPRVDEGRSEALYELEIAFAEIARLCGGSGPKRASAWVTDRALR
HLLTDITGNTHRAEFCIDKLYSPDSARGRLGLLELRGFEMPPHFQMAMVQ
SLLVRALVAWFWDEPLRAPLIRHGANLHGRYLLPHFLIHDIADVAADLRA
HDIHFDTSWLDPFTEFRFPRIGAAVFDGVEIELRGAIEPWNVLGEQATAG
GTARYVDSSVERLQVRLIGADRHRYLVTCNGHPIPMLATDNPDIQVGGVR
YRAWQPPSALHPTITVDGPLRFELVDTAGGVSRGGCTYHVAHPGGRSYDT
PPVNAVEAESRRGRRFEATGFTPGRIDLSDLREKQARQSTDLGAPGILDL
RRVRTVLR
108799285YP_639482.1 HxlR family transcriptional regulator [Mycobacterium sp. MCS]MAVLQGPLADRDAWSAVGQCPIEKTMALLGTKTTMLLMREAFYGTTRFED
FWRRVGVTKAAAAARLSELVDAGLLERRPYQEPGQRRRDEYVLTDTGRDF
MPVVWAMFEWGRRHIDDSRLRLTHLGCGEEATVEIRCAAGHEVPAAELGM
RLVKRSEA
108799283YP_639480.1 hypothetical protein Mmcs_2316 [Mycobacterium sp. MCS]MTKPFEIHESGAYLHGTKADLEVGDRLVPGRPSNFEDGRVSNHVYVTQTL
DAAVWGAELAAGEGRGRIYIVEPEGALEDDPNVTDKKFPGNPTRSYRTRE
PVRVVGELTDWVGHAPEQLQAMQDTLADLRRKGLAVIYD
108799281YP_639478.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MMTWPVKRRTEHAQHRATTVARWLANAAHDSGPGAVTARLLDLDGRVVGR
GHQLAALRSAVEAAERAGGGCVLLSGAPGVGKSTLVQAFGDEITQHGCVF
AYGRCRDGQPAPYAALSDALGGIVRAMESTAAPERDRWRAELLSGMSALS
GVLGDLVPDVARVLGETTKVSDLNAAEARRRLHRAAIRLISDTSSFRPVA
LAIDDLHWADRDSLLLLSELLTTSLRNVLVLGTHRSGEFDPAAAGMASAH
VRTLELAPLTRKDLEELLAVVCGRGLELGDVAAEFHHRTGGNPLQVRQLL
HRAQRDGALITSGTGGRPCWDLRVLSSIEVTATTAEFLGHLLGQLRPIDR
AVLGSLTCFAGEFDLDDATAAAARPADVVAHALWSALELRLIEAVDGGGR
RIANAISRDARYRFSHDRVAEAARVGLSAEDKRRIHLRIGRRLMRQGDDR
LFEAARHLGIGGQGLADEQERLAFVDVLQRAARKAKAQTSFPLALECCRN
ALGLLGEGRWAAHLPLTRQLQLDAANAALLVGDVAGLHALLDEAEVMLVE
PADRARLAYLRLKGCVAQNHLQEALETGLRALDELGEPLPAAAGKPRMAA
AVVRMKLTMSRWSDERLLSLPHCEDRCVIETQRILTELRSLSYIVAPNLF
PLIVRRQLELTLAHGHTSSSPLALVSFGLLLVLTGDRSGSQRFGEVGMRL
ADRDEFLEARPQTIFLYHNFIRHWRHPLRDGLSRLRDAVAEALDQGDHEY
AGFLAAALLSQSFWIGRPLSEIDALARSLVPEIRSQPVPSALCQAVQQIC
LNLMGRSGDPFLLAGESGYDEREALAAARREGDEVALSTVATMKLGLHFW
CGDYTGAAEAAIDTLAHAGGMAGTAIFQLDHMIAALSMIHAAPDDRATRQ
CVHQALELHRKWAADAPENYAAPWELLEGVWARARGRHRKAEIHFDRAMT
LAERNQLPLVGALAHEEAATHYADVGRQSLAEHLLRTAHQRWLRQGMTMR
ATKLARNHPWLLSRELVPAESDGIDPSAAHHVMRALSGARTADRLATVVL
GTVADLTDAGRILLFTGEGEGIAVVAVREGENTRIVDGPWTEVGYDRSVV
RGVTDSGAPLSIPSDPARRVTAVLATPILVQDRVIGVVYAEHSDTGRDFT
PVQQEAVAFVCDQAAAPLWNFQLEQRLRAADEHRRSLIDVQSKFVPNELL
RILDIDDLRRVRSGYRVERTMTVLISDIRGYTTMLEDMSVSEASNLAMGF
MRAVEVPIISCNGMIQDVRGDEIVAVFDSDPDDAVRAGLAMLRSLHDHNQ
DRLAHGSEELRVGIGINTGTVGVGLVGGVNRMVLTIIGDAVNLAARIESA
NKRYGSALLISDATCARLADRGQFDIRRMERVMVVNRRRPVTIYEVYDDD
PAPLRDAKRDAQPAFDRAFALFDAGETGEARTAFQHCRRLLPGDPIAPLH
LAHCDAVTHGEMSPGQGIVLVHK
108799279YP_639476.1 polyprenyl synthetase [Mycobacterium sp. MCS]MTSTVPDTDRAVDPLEDYLALCKETCDREIERLYSSGRPGSGFEALLLDY
PRRGGKALRPALSIAVCLGLGGQLDAILPTAATLELYHNAFLIHDDIEDE
SWWRRGKPTMHIDHGIPIAVNVGDAMLSLSLQPLLDNVERIGLGPALRIL
RAVAHMTRRTVEGQAIELEWVRSNAWRLDDADYLTMVELKTSWYSFITPL
QAGAIAAGVDPDRLEPLESLGRHLGAAFQITDDLLNLRADPEEYGKEIGG
DLWEGKRTLMLLHTLRTAQPQDRIRALQILARRRPAGLEAGLAGLLDRLT
ARGELSPTGRAEIAARFDTAEAKSLDDIQWLYELMHDVGSLGHAREVAAR
HAQQAAAVLAGLDWFPPSRHREALTHLVDYVHGRTR
108799277YP_639474.1 hypothetical protein Mmcs_2310 [Mycobacterium sp. MCS]MAEPVSSLLRRSVDHLADEVPDSYRLLLDRLGPLVVELDVDGEVFSMRGG
HGLEVSDGPAREPGARVGTSRTAINDLLNARTGLDEAVEAGAVRVAGSLE
HVLRAHDTLLAYVHAAVRAPSQPALLAALRTGVS
108799275YP_639472.1 aspartyl-tRNA synthetase [Mycobacterium sp. MCS]MTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGAVLEAAHRLRAEFCV
AVEGVVEVRPEGNENPEIPTGGIEVNATSLTVLGESAPLPFQLDDEAGEE
ARLKYRYLDLRREGPGKALRLRSKVNAAAREVLARHDFVEIETPTMTRST
PEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDE
DFRADRQPEFTQLDMEMSFVDADDVIAVSEEILKALWALIGHDLPTPLPR
ITYAEAMHRFGTDKPDLRFGLELVECKEFFADTTFRVFQAPYVGAVVMPG
GASQPRRTLDGWQEWAKQRGAKGLAYVLVGDDGTLGGPVAKNLTDAERDG
LAAHVGANPGDCIFFAAGPPKSSRALLGAARIEIAKRLDMIDPDAWAFTW
VVDWPLFEMAEDATAAGDVAVGSGAWTAVHHAFTAPQPQSEATFDTDPAG
ALADAYDIVCNGNEIGGGSIRIHRRDVQERVFAMMGIEHDEAQEKFGFLL
DAFTFGAPPHGGIAFGWDRITALLARMDSIREVIAFPKSGGGADPLTGAP
APITPQQRRESGIDAKPKKDGE
108799273YP_639470.1 hypothetical protein Mmcs_2306 [Mycobacterium sp. MCS]MAMHSCERVDLSFVDSAPYRFVSTVDLAITPEQVFEVLADAESWPHWATV
ITKVTWTSPEPRGIGTTRTVHMRGGIVGDEEFLAWEPFRHMAFRFNEAST
GSIAAFAEDYRVVETPGGCHLTWVMAMKPNGAAARIGMSLGRPVMGRLFQ
RFLHNLRRYTDQRFAR
108799271YP_639468.1 hypothetical protein Mmcs_2304 [Mycobacterium sp. MCS]MWEGEHRRWVGAPPRARTECAMTFNEGMQIDTSTTSSSGGGRGGGRGIAV
GGGIGGLLIVVVALFLGVDPGTVLPEQQQIGTEGVQAPGFDLSQCKTGAD
ANEFVQCRVVATGNSLDAVWSQLKPDYTRPQVEIFSGSVDTRCGPATSAV
GPFYCPADQTAYFDTDFFDVLRDQFGSSGGPFAQEYVVAHEFGHHVQQLQ
GSLARAQEDPEGPTGGGVRTELQADCYAGVWAHYAAVTTQESTGVPFLEP
LTDKDIADALSAASAVGDDRIQEAATGRVNPESWTHGSSEQRQKWFTVGY
QTGDPTKCDTFATNDLG
108799269YP_639466.1 hypothetical protein Mmcs_2302 [Mycobacterium sp. MCS]MTRADDPIEPDTKDWTWVLSRPCPDCGFDASAVHHSDVADMIRRDADEWI
RRLETPHAAVRPRPGVWSTLEYGCHVRDVHRIFNERVTLMLTQYEPLFAN
WDQDQTARDDDYAGQNPSVVAGELFDAAVTVADTYASVPPDGWSRSGLRS
NGSEFTVASIALYHLHDVVHHAWDVDEH
108799267YP_639464.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MARTSGRSDTVGEDVASRPERFMRSALAILGETGRTDFTVLEVVERSKTS
LRSFYQRFSTKDELLLALIERIMAESARHWRADTDDLPAPAALRTLIDRI
CVPPGSDTQDRVNKGLTSYNDRLAESMPREYAMVLTPLHTLIADIIRRGI
ADGDFRDDLDVAATSALIMQSVLGSMRLRVLGAELSGAPVDAGHIYDFCA
RALLVAPH
108799265YP_639462.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MTTDVTSPESLLFASTAQSFLEKEASLARVRELHAAGTSFDPQWWQRAAE
LGWASLLVPEELGGGSVSGNGVADLALVAEQIGRTVAPGPLHPVSTVLAG
LVDAEEPERHSALIESLVSGESVASWAVYRPGRGWAPHDPGVTASATGSG
FRLDGVADRVEAGGESAVLLVVTACDGALRQFLVPTDAPGVTVEPQRSID
LVKRYARVEFSSVEVDASAAVGAAEQTRDLIARQSQIAQLLQCAEVVGVL
GAVVDMTVQWAFDRHSFGRPLASYQALKHRFADLRIGLEACRATTRAAVV
SVATRAADADFNVSAAKSYVGEHASPMIQDCVQLHGGIGVTWEHDLHLYL
RRATLYRSLYGTPEDHNLRVYALAEEAATDELEPA
108799263YP_639460.1 radical SAM family protein [Mycobacterium sp. MCS]MVDMRWSGQGVEVDDGALPGLQRIGLVRSVRTPQFEGMTFHEVLCKSALN
KVPNASMLPFQYTVNAYRGCSHACRYCFARPTHEYLDFDIGIDFDTQVVV
KTNVVDVLRRELRRPSWTGETVALGTNTDPYQRAEGRYALMPGIIAALRD
SGTPFSILTKGTLLRRDLPLIAEAARRVPVSVAVSLAVGDPDLHRDVEPG
TPSPQARLALIAAIREAGLDCHVMVAPVLPRLTDSVAHLDALLGEIAAAG
ARSATVFGLHLRGATRGWFMAWLARAHPELVGEYRTLYRRGAYLPADYRE
MLRARAAPLLARHGLAGGPRRTEPLVGSVPAAAGPVQPTLF
108799261YP_639458.1 IclR family transcriptional regulator [Mycobacterium sp. MCS]MARPSPQSDRILLLMELLSEQPRTGRTLAEIARHLGVAKATCYPMLVALT
DAGWLVRHPTRKTFHLGPALVPLGQAAADALDVVDLARPAMHELADTADM
ACLAFVWSGDDLVVTEAVQPRRGRRGTLGLRLGDRIQITPPLGSALAAWF
GPDRLDQWYRTGAADLGVDADDLRAGYREVLALTRQRGYAVECVDQRMRT
IADELARLRGGVGTLGRRQPPVTLRTVSDEHPVDVLVGEVDTEAHYRPIS
INAVTFDADASPALVLCLVDAPEPMTGRRVVELGESVRTAADRLTGLIHG
CRPVSPREEA
108799259YP_639456.1 hypothetical protein Mmcs_2292 [Mycobacterium sp. MCS]MTVSPVVAHADPAAERGSHMVTYTVVAQSELNAQIYYLATEPPSRADFDA
DSSRYLTNVKVPLQPGVPWVFQTTLDDPTQWALVSASGALRVPPNFHCEI
AVDSVVVVQSDGGSGTQCALRAW
108799257YP_639454.1 inner-membrane translocator [Mycobacterium sp. MCS]MDVLIGQLATGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIMAGCYTA
YVVQQVFSSAGASLLISLVVGFFVGGAMGALLEVTLIQRMYHRPLDTLLV
TFGVGLILQQIARDIFGAPAVNVVAPSWLSGGVEILGAVVPKTRIFILVL
AVVCVAVLATVLKTSPMGRRIRAVVQNRDLAETSGISSRKTDITTFFIGS
GLAAVAGVALTLIGSTSPTTGQSFLIDAFLVVVVGGLGQIKGTVIAALAL
GFLNSFIEYNTTASLAKVIVFVIIVIFLQARPQGLFTVRTRSLV
108799255YP_639452.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTTTTDREPVAGGNAGMGAEYLEVRGLTVDFDGFKAVSDVNLTLFQGDLR
FLIGPNGAGKTTVIDAITGLVNASGSVNKSGVELLGKKVHQIAKLGVGRT
FQTASVFEQLTVLQNLDIAAGAHRSAWTLLRRRHGVSPAIEEALETVGLT
EMADKPAGVLAHGQKQWLEIGMLLVQNADVLLLDEPVAGMSTEEREETGN
LLRRIGGQRTVVVVEHDMDFMRAFATSVTVLARGQVIAEGSVAEVQANPK
VQEVYLGTAAAGADGIADDLVVEGD
108799253YP_639450.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MKAVSCERGTLSVVDLPTPRPAKGQLLLEVRRCGICGSDLHAKDHADELT
EVMDRIGYPDFMRGDTPVVLGHEFCGEVADRGKGVGKEFKPGTPVVSFPL
VRAAGGIHLTGLSPLAPGGFAEQVVAEASMSFVIPNGLDLDTAALTEPMA
VALHAVRRSEIRRRDTAIVIGCGPVGLAVICHLKALGVRTIVASDFSATR
RALATRCGAHVVVDPAVDSPYEAGGQRGAITEAPQLYELGVGSMEKLRRV
PGWIHLYRAAEALGAAGPKRPIVFECVGLPGVIDGIIGAAPLQSRVVVVG
VCMGEDRLHPTIANAKEIDLRFVFAYTPLEFRDTLYMLAEGKLDASPLIT
GTVGLDGVANAFDVLGSAEAHAKILIDPRSTAVAP
108799251YP_639448.1 beta-lactamase-like protein [Mycobacterium sp. MCS]MLITGFPAGMLACNCYVLAQRPGSDAIVVDPGQRAMAPLRRVLDEHRLTP
AAVLLTHGHIDHIWSAQKVADTYGCQAYIHPEDRFMLTDPIKGFGPRVGQ
MLMGALFREPRQVVELDRDGQTLDFGGGMAVTVDHTPGHTRGSVVFRLAA
DGSQVALTGDTLFRGSVGRTDLPGGSGRDLLGSILTKLLVLDDDTVVLPG
HGPRSTIGAERRTNPFLEGLRL
108799249YP_639446.1 cyclophilin type peptidyl-prolyl cis-trans isomerase [Mycobacterium spMSYPSWPPYPPPPAYPRTTNAWAVAALVCAFLFAPLGIVFGHLSLSQIKR
TGEDGRGLALAGLIIGYVMTALTVIVVVFSVLFLVAVAQHVGELRVDDGS
TRSAAPPSGDRLPAFVAPRNLGANCQYPKGDLPAGAPVTPPRTGRVPTDP
AKISASVSTSQGNIGLELDNGKSPCTVNNFASLAQQGFFDDTTCHRLTTA
RSLKVLQCGDPTGTGAGGPGYRFPNEYPTSQYRLSDPGLRRPVVYPRGTL
VMANTGPGTNGSQFMLVYGDTLLPPTYTVFGTVDSTGLATLDRIAARGVA
GGADDGKPAAEVKIISARLD
108799247YP_639444.1 (p)ppGpp synthetase I SpoT/RelA [Mycobacterium sp. MCS]MADDTTTSAPITAPLPVVDIPEPEPPKGDASKGDASKTDASKTEAPKTSS
SASRRVRARLARRMTAQRSTVNPVLEPLVAVHREFYPKADLTLLQRAYEV
AEERHADQMRRSGDPYITHPLAVANILAELGMDTTTLIAALLHDTVEDTG
YTLDALTAEFGAEVGHLVDGVTKLDKVALGTAAEGETIRKMIIAMARDPR
VLVIKVADRLHNMRTMRFLPPEKQARKARETLEVIAPLAHRLGMATVKWE
LEDLSFAILHPKKYDEIVRLVADRAPSRDTYLAKVRAEIVNTLTKSKINA
TVEGRPKHYWSIYQKMIVKGRDFDDIHDLVGVRILCDEIRDCYAAVGVVH
SLWQPMAGRFKDYIAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTA
EYGIAAHWRYKESKGRNGSPAGHTAAEIDDMAWMRQLLDWQREAADPGEF
LESLRYDLAVQEIFVFTPKGDVITLPAGSTPVDFAYAVHTEVGHRCIGAR
VNGRLVALERKLENGEVVEIFTSKAQGAGPSRDWQSFVVSPRAKAKIRQW
FAKERREEALEAGKDAIGREVRRGGLPLQRLMNAESMASLARELRYADVS
ALYTAVGEGHISARHVVQRLLAVFGGDDAAEDELAERSTPATMPVRQRST
DDTGVSVPGAPGVLTKLAKCCTPVPGDQIMGFVTRGGGVSVHRTDCTNAS
SLQEQAERIIEVEWAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVN
ILSASVTTSNDRVAISRFTFEMGDPKHLGYLLRVVRNVEGVYDVYRVTSA
A
108799245YP_639442.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MPARIRRAAAAAAAATLTATALSSCGGAAESVDYAVDGALLSYNTNTVAG
AASGGPQAFARVLTGFNYHGPEGQIVGDHDFGTIAVVGRAPLVLDYQIND
KAVYSDGKPVTCDDLVLAWASQSGRFPQFDAANRGGYSDVASVDCAPGQK
RARVSFAPDRGFVDFGQLFSATALMPSHVLADQLGVDVTTALTKGDQPTV
ARIAEAWNTTWELKPGLNDEDLKKFPSSGPYKLESVTDEGAVTLVANDKW
WGAKPVTNRITVWPRGADIQERVNEGAYDVVDIAAGSSGTLNMPEDYVRT
DSPSSGVEQLIFAPRGPLAAPPARRALAFCTPRDVIARNADVPIANSRLN
PADEDAFAAAEATGEVGQFTAANPNAARDALGNRPLTVRIGYQSPNARLA
ATVGTIARACEPAGIRVVDAAGPKVGPLTLRANEIDVLLASTGGAPGSGS
TGSSALDAYALHTGNGNNLSGYSNARVDGIIGSLAVSNDPKELARLIGEG
APILWADMPTLPLYRQQRTLLTSSKMYAVIGNPTRWGAGWNMDRWRLSR
108799243YP_639440.1 preprotein translocase subunit SecD [Mycobacterium sp. MCS]MASSSAPVHPARYLSLFLVLLVGAFLLVFLTGDKKADPKLGIDLQGGTRV
TLTARTPDGSPPSRESLAQAQQIISARVDGLGVSGSEVVVDGDNLVITVP
GNDGNEARNLGQTARLYIRPVVHAMQAQPAAARDGQQPAQPAQPGQPQQA
PGLPGLPGLVPQQPGQPEQAPPPAAPPAETPPAPQPRPYPQQPAPSPTEP
SPAPAPPAPAGPATPAPSPTPGPPNKRADLAQRIADEKQLRQSTDPSIQL
LALQFQATRCGEDDVLAGNDDPNLPLITCSTDGQTVYLLNKSIISGEQIA
NASSGLDNQRGEYIVDLEFKSDAAKIWADFTAANVGTQTAFTLDSQVVSA
PEIQEAIPGGRTQINGRFTADSARELANVLKYGSLPLSFESSEAETVSAT
LGLASLKAGLIAGAVGLAAVLLYSLLYYRLLGVLIALSLVASGAMVFAIL
VLLGRYINYTLDLAGIAGLIIGIGTTADSFVVFFERIKDEIREGRSFRSA
VPRGWARARKTIVSGNAVTFLAAAVLYFLAVGQVKGFAFTLGLTTILDVV
VVFLVTWPLVYLASKTTWAAKPKFNGLGAVQQIARERRAAAHATAGRG
108799241YP_639438.1 4-aminobutyrate aminotransferase [Mycobacterium sp. MCS]MSTLEQSRHLATAIPGPKSQQLIDRKAAAVSRGVGTTMPVYAARAQGGIV
EDVDGNRLIDLGSGIAVTTIGNAAPRVVEAVAAQAGRFTHTCFMVTPYEG
YVAVAEALNRLTPGSGEKRSALFNSGSEAVENAVKIARSYTHKSAVVSFD
HAYHGRTNLTMALTAKVMPYKHGFGPFAPEIYRAPLSYPFRDAEFGKELA
TDGELAARRAIDVMDKQVGADNLAAVIIEPIQGEGGFIVPAEGFLPTLLD
WCRRNDVVFIADEVQTGFARTGRMFACEHEGIEPDLIVTAKGIADGMPLS
AVTGRAEIMDSPHVSGLGGTYGGNPVACAAALATIETIESENLVERAAAI
GALMKDRLGRLQAEDDRIGDVRGRGAMIAVELVKPGTTEPDAALAKALAA
GAHTAGVIVLTCGTYGNVLRFLPPLAISDELLDEGLDVVAGLLRDL
108799239YP_639436.1 hypothetical protein Mmcs_2272 [Mycobacterium sp. MCS]MIGSERADRPRGGRMRIPRSRGAASGFLLILLGLWGALIPFLGPYFDFAF
TPDQPWTWTNARGWLEVLPGAVTVVGGLLMLMSRNRATASLGAWLAVAAG
AWFVVGRALAGLLGLGNAGAPVAGTDTKRVWLELTYFYGLGALIVFLGAL
ALGRLSVRSVRDVEYAQRPLTDHDRTVADRDHTLTDRDHTLTDRDHTGAT
HTGAQPMAAAPAAQTGPQPMAQTGPQPMAQTGPQPMAAPGNAPTEAVQPA
AGQRKRGLLDRIRGGRNRPMAHH
108799237YP_639434.1 hypothetical protein Mmcs_2270 [Mycobacterium sp. MCS]MGSGTIRIGGACGLICAGAALPAYLAGSPERNQTFDAASFVTANGTVPLL
HLLFGVAFLGVLLSLLRSAAGPTGAVYAAVVGGGLFLALTAAGLAAEVAV
PAAVTRSSDTAMVDAMSDHAQPFLTLAVWLYHYSHIGSAALIFATAYVVW
RTGVLPRWSAGLAVFGVLPLLHTWVGLPGAYSMVAWIGLTGLLMLAIPPV
VRVESVVA
108799235YP_639432.1 fatty acid desaturase [Mycobacterium sp. MCS]MTTTVESPLARLTEQELEKLAKELDAIHDEIFSELGDRDRNYIKAVISVQ
RQIVVAGRVLLLASRSRTALVAGTACLGMAKILENMELGHNILHGQWDWM
NDPDIHSSVWDWDTASTAKAWKHSHNYIHHTYTNIRGKDKDLGYEIMRID
PNQKWRPANLGQPLYNFLLTVLFEWGVALHDTDVEALWRGQKTMADLKED
FRGIAGKARLQIIKDYVGWPLISAGAFALAQLALRGRIDQPAESRVARRL
RQISTKGRIGATATVLDRLLPGVESTFLRTLAADALANLIRNVWAHAIIF
CGHFPDQTYTFSEEEVENESRGGWYVRQLIGAANIEGSPLFHVISGNLGY
QVEHHLYPDMPSSRYSEIAPRIKDICERYELPYNSGRFGKQWFSVHRTIF
RLAFPGGKPRPKPGPYRSQDRNPTREAPSEAVRFRDRLPAEHPDAGPEHA
STGVAVQPPPRGND
108799233YP_639430.1 Holliday junction DNA helicase RuvA [Mycobacterium sp. MCS]MIASVRGEVIDIALDHAVIEAAGVGYKVMATPSTLATLRRGTESRLVTAM
IVREDSMTLYGFADADARDLFGTLLGVSGVGPKIALATLAVYDAPTLRQA
LADGDVTALTRVPGIGKRGAERMVLELRDKIGPVTTGAGVTAVGGHAVRG
PVVEALVGLGFAAKQAEEACDKVLAADPDATTSSALRAALSMLGKK
108799231YP_639428.1 hypothetical protein Mmcs_2264 [Mycobacterium sp. MCS]MVGAPAVVAFSRCGRSDLRPVRTCPCAAVSGAVAVLAGDEMAGRAVDDPR
RTRRPGDEPRARARVAAVERTDRRIGVADLTGRPIRPVRALAMAELEDAD
GVRWRVHRRWMPLLDRLEDLNWGSDWFGVLMFALALPFVLAWPFWALGKL
CGVPWKVVVTRDDEDVAEEKIKGWRASGRRIAEIVDGIRVAGVVPDPGSP
PQDLRPYT
108799229YP_639426.1 formamidase [Mycobacterium sp. MCS]MPDVVFPLDSTKKFTDQEKLGHNRWHPDIPAAVTVKKGDSFRVHCREWFD
GAIHNDDSADDILNAPLTTVHVLSGPIAVEGVKPGDLLIVDILDVGPIPQ
EDSGPLAGQGWGYTGIFPTQNGGGFLTEQFPDAYKAIWDFSGQKATSRHI
PGVEFTGIVHPGLMGTAPSRDLLSTWNTREAALIATDPDRVPPLALPPEP
QDAILGGLTGDAFTKAAAEAARTAPPRENGGNQDIKNLTKGSRIFYPVFV
DGANLSVGDLHFSQGDGEITFCGAIEMGGFIDLRVDVIPGGMETYGVSEN
AIFMPGNTDPQYSEWLAFSGTSVTLDGEQRYLDSHLSYQRACLHAIDYLT
KFGYSPEQAYLLLGAAPIEGRLSGVVDIPNACATVYIPTAIFDFPVTPSA
AGPVKIDPGIGAPHSAF
108799227YP_639424.1 purine catabolism PurC-like protein [Mycobacterium sp. MCS]MTVQAAETVADTPHDGTVSLGELLAEPGLHVDTPTPIDALDRPIRYVYPT
ELADPSPYLSGEELILSVGVPVAGRSADEIRSYVTTLTDRGVAALLIGLG
DVLDELPEALVQACREQDLPLLIQRAAVPFRRIVDWAESRRAAEREADAR
ERELGAILRWFVAGTLGVGPVESALTRYGLSGAAVTVCAFTADVHSQVHD
LVDRHRGAVALLDDRIVALCPQTTEFASELAASELVCGVAIGADAQSMAY
AIPEALEALHEAIRWRRTVHIDEIATLDGLLAAVPKVRLVPFVHRLLVPL
VDHDKGNNSYLVSSLEAFLAPGNDLSTAANQLYVHVNTLRNRLAKIAELT
GANPLDETDRINFRIALWAAHNMGMSDGAGSGATVPSTAAKPRPHNSFGA
STRGRRMPPRTN
108799225YP_639422.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MNREALTPEKLREAYQHVWFVVARSQDISTPQSATLLDQNLVVFRDSTGA
ARVTDRRCIHRGANLADGKVVGDSIQCPYHGWQFDGSTGACSRIPSLPAN
GRIPPKAAIKAYPVIERFGHVWTCLGDPVFDLPDPPEIADLELEWRAAEP
IHADCGFMAATENFRDMAHFPFVHEPSMGDVDPVVGDLDVKRDGREVWAS
YFYRQVPGSEFSDVGDAWMHYHSYAPGIATILYDFGPETGKRYLVDFPSP
VSYDKCIIFWGVATDRDFRGGTVDEILETETMVFNEDTPVLEGLEPKEVP
LAGQAFEVSAPADIYTLNYRRATQYAVQTIQQARGLVEAPLEQAGANGHV
HA
108799223YP_639420.1 agmatinase [Mycobacterium sp. MCS]MNLDNGRAIVGPADPQVQPRYAGWTTFARLPRLEDVSHADVVVVGVPFDS
AVTYRPGARFGPNAIRQGSRLIRGYNPELDVKPFEVCQFADAGDLACNPF
DIAEAVDQVAEQLSQLLANGTRAVILGGDHSVALPSLRAAHSVHGPMALV
HFDAHLDTWDRYYGADITHGSPFRRAYEEGLLLDRNMHVGVRGSIYDKQD
LVDDANFGFSVVTCRDIGTLGAEGIVDKIRARVGDAPVYVSVDIDVLDPA
HAPGTGTPEAGGMTSRELLEVVRGLDSVNLVGVDVVEVSPAYDHAEITAI
AAANVTWEFLSVFGRKAQR
108799221YP_639418.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MTAPVAVVTGAGSGIGAEIAQNLQVGGWKVASISREPAPAMDKWLIADVA
EEREIADAVAEIENTFGRIDAAVVCAGHYEETPALEITQAAWERMLRVHV
GGLAHICRAVLPAMRRRGSGRIVGIASERAIGGGSNDAHYAAAKGAALSL
LRSIAVEVAADGILVNAVAPGPCDTPLLPPDSWERAEGFTSGLPARRIAQ
PREVAELVQALLEEDLFLCGEVLSVNSGTVI
108799219YP_639416.1 polyprenyl synthetase [Mycobacterium sp. MCS]MSDDQVRFGRTVAGFATVGIYNVAAAGGRAVCRQASITPYTRGATPSGSE
DVVPDIDQTEFLSDLEEHLHAVVRDTVAEPLRSIDENLGTVAALCQSAVQ
SGGKRLRPRFAYWAWRVGAPADAAPQPLIRLAAALELLHAAILVHDDVID
ASEVRRGQPSVRAALTAGHRRDAGWGDATDFGDNMALLVGDLLWSAAHDT
FDDAVAGLPAGIAQRTSRAFRTMRVEVLAGQLLELRAQAGRDYHADTAEK
ILRYKTSAYTVERPVELGLELAGSASPATAQTLRDYAGAVGQAFQLRDDL
ADLFGTTKTSGKRTGDDIRAGKPTELLGAAYELADDLDRSLLATIVGDAT
ADQAAIAEVQTVVLQCGAADRVGRRIADLVATARRAIADLSASADPTALA
GLSDMLAECTELSFLPAE
108799217YP_639414.1 glutamine amidotransferase subunit PdxT [Mycobacterium sp. MCS]MNAVPDGRSDKPRSVVGVLALQGDTREHLAALTEAGAEAVTVRRLRELEA
VDALVIPGGESTAMSHLLREFELLEPLRARLAEGMPAYGSCAGMILLATE
ILDAGAAGREATPLKGIDMSVRRNAFGRQVDSFEGDIPFVGLDSPVHAVF
IRAPWVERIGDGVEVLARADGHIVAVRQGRMLATAFHPEVTGDRRVHKLF
VDMVSE
108799215YP_639412.1 pyridoxal biosynthesis lyase PdxS [Mycobacterium sp. MCS]MDLWALLHWISSDSEEMTVGFEGQQNGSAHQTGTARVKRGMAEMLKGGVI
MDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIID
AVTIPVMAKARIGHFVEAQILQSLGVDYVDESEVLTPADYTHHIDKWKFT
VPFVCGATNLGEALRRITEGAAMIRSKGEAGTGDVSNATTHMRKIGGEIR
RLTSLSEDELYVAAKELQAPYDLVAEVARAGKLPVTLFTAGGIATPADAA
MMMQLGAEGVFVGSGIFKSGNPAERAAAIVKATTFYDDPDVLAKVSRGLG
EAMVGINVEDIAQPHRLAERGW
108799213YP_639410.1 phosphatidylinositol alpha-mannosyltransferase [Mycobacterium sp. MCS]MRIGMVCPYSFDVPGGVQSHVLQLAEVMRERGHEVSVLAPSSPHVDLPDY
VVSGGRAVPIPYNGSVARLRFGPATHRLVKKWLAQGEFDVLHLHEPNAPS
LSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIVGRIAVSDL
ARRWQMEALGSDAVEIPNGVDVAFFADAPRLDGYPRPGRTVLFLGRYDEP
RKGMNVLLGALPAVVARYPDVEILIVGRGDEDELREQAGPLASHLCFLGQ
VDDAVKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR
VLRDGEAGRLVTVDDSEALAAGLIEVLGDDDARQRYIDAASEAVGRYDWS
VVAAQIMRVYETVAGSGVKVQVAP
108799211YP_639408.1 CDP-diacylglycerol inositol 3-phosphatidyltransferase [Mycobacterium sMSNIYLMTRAAYVKLSRPLARAALRVGFTPDSITILGTAGTVLAALTLFP
IGQLWWGAFAVAVFVLADMLDGAMARERGGGTRFGAVLDAACDRIADGAI
FAGLLWWAAFGMDSPALVVATVICLITSQVISYIKARAEASGLRGDGGFI
ERPERLVIVLTGAGLSGVSFLHIPWLLPVAMWILAVASVVTVLQRLHTVR
TSPGAMDRIEPKGEEKPAADDQ
108799209YP_639406.1 threonyl-tRNA synthetase [Mycobacterium sp. MCS]MSTAASPAPAAPIRVAAGTTAGAAVRDAGLPGRGAPDAIVVVREADGRLR
DLSWTPDADVEVVPVPADSEDGRSVIRHSAAHVLAQAVQDLFPEAKLGIG
PPITDGFYYDFDVPRAFTPEDLEALEKKMRKIVKDGQLFERRVYESEEEA
RRELANEPYKLELVDDKSGDPEVMEVGGDELTAYDNLNPRTRERVWGDLC
RGPHIPTTKYIPAFKLTRSSAAYWRGDQTNASLQRIYGTAWESQEALDRH
LELIEEAQRRDHRKLGVELDLFSFPDELGSGLPVFHPKGGIVRKELEDYS
RAKHLQAGYEFVNTPHITKEQLYVTSGHLEWYADGMFPAMHIDAEYDADG
AVRKPGQNYYLKPMNCPMHHLIYRSRGRSYRELPLRLFEFGSVYRYEKSG
VVHGLTRVRGMTQDDAHIYATREQMRDELTSLLQFVLDLLSDYGLDEYYL
ELSTKDPDKYVGSDEIWDEATETLREVAEASGLDLVPDPGGAAFYGPKIS
VQVKDALGRNWQMSTIQLDFNMPERFELEYTAADGSRQRPVLIHRALFGS
IERFFGVLTEHYAGAFPAWLAPVQVVGIPVADAHIPYLEDVAAQLRSRGV
RVEIDGSDDRMAKKIVNHTNQRVPFMLLAGDKDVAAGAVSFRFGDRTQIN
GVPRDEAVEAIVGWIVERRNTAPTADLVKAGAGT
108799207YP_639404.1 thioesterase superfamily protein [Mycobacterium sp. MCS]MASEPTQAQNGGGFNPPEPTTRGGPDYGRFVEAVRELQDLARAADAPDEV
VTEAAGLIEKVTGLLAPYRADEWTSPSGRRMDLPNRGNILQVPMLLAKTD
DGRIAGEVTFRRFYLGRNGAAHGGAVALLFDSVLGYTTYKLTQSRYQRTA
FLHVNYRNIAPVEKTLRVEAGIDRIEGRKIFVEGRLLDGDTVLADAEALF
VRLNPGQP
108799205YP_639402.1 hypothetical protein Mmcs_2238 [Mycobacterium sp. MCS]MNRTRQHRRGVVTRDATGSGSAEAFVLIAIATILITRLYLELTGYPQIGG
GNLHIAHALWGGALMMLALLTGWLLIGAGARVAAVVMGGVGFGLFLDEVG
KFVTKDNDYFYGPAAEIMYILVVVILVGARVLRDFRPLTGRECLASAAVI
AGDGVARGLADRRRELGLALLVQAEQAGAEPTEVGPVRALLVSAETTSDR
LHRLQQWVPRLIPGFFRSPRWVPVVGWLLVLSAISGLFFGLLGIALGGYF
YEDDDITLRLDGMNPASVILVVNAAVTSMIAVPAMIARRRTDRLWPLRWL
RNAALLFTFLNAFVDFATEGFAALLSMSIGLFTLAVLTYQIDAAVRRTAG
EASESPQVPPGDHALQP
108799203YP_639400.1 hypothetical protein Mmcs_2236 [Mycobacterium sp. MCS]MMSLESKPGADASLGELMSQLSAQTSRLVRDELRLAQKEFQESAKHAGIG
AGLLSVAGLFAVLGLATVIAAAVAALSLVLPVWAAALIVALVLFVIAGIA
ALVSKKQADEVTPAAPRTVETVKADIQEVKDRAS
108799201YP_639398.1 hypothetical protein Mmcs_2234 [Mycobacterium sp. MCS]MSGNSVEGCESEFALSGAAKGRSRRMSGRHRRARTATPTVAVDMTPGVHI
SHAAPTSANSAPRRVRRRRAALRPAITGGLAVLGATALVGTFVTPAPAEA
RATTYAVSAPTPTPLLAALTLPFDAAQLQAAAAAVIDLDFDGVFRFNSDL
VDLLARLGASLRVDVDIDLDAEELAAAFADLINAIAIGIDGGIEAANDVV
DLGAALVSEIALAAAGLGVDLVDAFTGALVSLLASITPEGGVGADLSAAI
GGAIEGIGELISTGFIGAGSAVAWKATLDDVLFDLVATGGIALTNGVAGS
LLAALGIDADLDLPDIDGEDVAVSLGALIEHFTDGINGALLTGGGAVELG
VDLINGLVEAAAEGGVDIRGAITGALLSSLAALVPVGSPGAPFAEAVVEF
VGDISADIDAGIRGMGEAIAWKFTLDDLLVDVGVAGGVSLVNGLTTALFG
GIGLPLPELPEVDFAASVRALINHFAVALGLEIDLEAGGEVEVDPNEEID
PNEEVELLGGEEGDSELVPDGFKTLRVGLTGEETDPDAEQTPLDEQKPAD
DAGDQGLGGDDLGEEELGEEDLGEEDLDEEELPGDDVSGDVTEETAEESE
DGGEEAGEAGDAGDAGGETGGDTGGETANAPSTD
108799199YP_639396.1 hypothetical protein Mmcs_2232 [Mycobacterium sp. MCS]MSDPLPPDGASPAQATAEDPADVVAAAVKAVPGVAGLHGGMFGEVGTYLP
GRRITGVRMADGVTEVHVVLQFGSTVRDTAARIRDVVTAAVGGIVDVYVE
DVTVEDVTVGTRDADAGARQ
108799197YP_639394.1 hypothetical protein Mmcs_2230 [Mycobacterium sp. MCS]MTTTPDTAPETPTDDTIAEEARPATPPPPAAAPVAGYVGSLIALLTLALG
VVALRDSAVFAGWLDGRPWTLNAVEWLDGLTFQWWMYPVGVMAILVGLWS
LYSALRPRRRTGLQLAADSSVWINKTDLARIATSAAERVPGVLDARSAAT
LRKVTVTAVTTAAERGRGGDQVKTAVTAAVEKTLDTVVADRPKVAVRVRT
GGR
108799195YP_639392.1 hypothetical protein Mmcs_2228 [Mycobacterium sp. MCS]MVGRVDVLTGKGRKLAVIGAGALALTGAVLAFGAGTANADVVDIGGKPNP
VFDANPAAEGGVRTTGKGVANAGPSDVRRSRKGAPLPPAGGEVKDSIRAV
PPITGGIGTYIRTGPARNGPGIAGW
108799193YP_639390.1 hypothetical protein Mmcs_2226 [Mycobacterium sp. MCS]MTERIEVQRVIPAPPEAIFEVLCDPQGHVAIDSSGMLQGADGQPVSAVGD
TFVVHMDREALNDFPMGKYEVTVEIREFEPNRRIAWTILGQIRPQIGHVY
GYTLEPTEDGTVVTSFYDWSQIDDKWREAGIFPVISEGALRATLGILERA
VRRGYVRS
108799191YP_639388.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium sp. MCS]MRPFEDVVAEHGPVVLRVCRAVVGPVDAEDAWSETFLSALRAYPDLPADA
NVEAWLVTIAHRRALDVGRANSRRAVPTGTVPDSPAVGGDPADRHPDLWA
ALESLPTKQRQAVAYHHIAGLPFAEIAGLLGNSPDAARRACADGLSRLRS
IYREEPLP
108799189YP_639386.1 hypothetical protein Mmcs_2222 [Mycobacterium sp. MCS]MRRLLMLLTAMIVAAGLTAAPAGAVDSPIGRIGQPLRVQFKGLIADVTVV
SVEPSPIPPGFGYPPRPPRNQVWRANVVVQPVKVPVPYAMAITFQFRGVT
PTGDAYEPRNTDAPDALQAALTKAPPGSTVSGGVWWDCYRDLVSNVVLVD
KITGEHLAQWNL
108799187YP_639384.1 AFG1-like ATPase [Mycobacterium sp. MCS]MPGSSGAPNRPDHLVDRNPSVTPERLVAQLVPPPTFTHVSFDNYRPDPAE
PSQAAAVDACRAFCADAVTRRAGKKKLFGKREVLPGVGVYLDGGFGVGKT
HLLASSYYDLPETPAHPKAFATFGELTQLAGVFGFVESVELLSHYVVVCI
DEFELDDPGNTTLISRLLSQLVERGVSIAATSNTLPEQLGEGRFAAQDFL
REIHTLASIFTTVRIEGPDYRHRDLPPAPEPLTDAEVAERAEQTEGATLD
DFDALCAHLATMHPSRYLSLIEGVTQVFITGVHPLDDQSVALRLVSLTDR
LYDAGIPVVASGSKLDTIFSEEMLAGGFRKKYLRATSRLLALTAAGQRA
108799185YP_639382.1 TAP-like protein [Mycobacterium sp. MCS]MRRHPQLLRVVSLSTVALVLAGCAPGLAANPRFATDNGARPQGQPETTQQ
QAGPPAVEAPKNELSWRECTDQVFGDAAVDPVPGVTLDCATYDADLDPID
GATGTVSIGVVRATSPRTPQDAGPVVMTTGSDLPSSVQLPVWLARSQALV
DKHPIVAVDRRGIGMSGALECRDLYDRQEMIEQAQFAYGDDPVANLGAIT
MTATTSCTDTIAPGDSAYDNAHAAEDLERLRSTWDVPTLALLGIGNGAQV
ALAYAGSHPNKVARLALDSPLPLAIGAEAAAEQRVRGEQAALDAWAAQCV
AIGCPAAPDPKGVVDGLLSAARSGDGPGGASVAAVAAAISTALAYPKGDG
VTATNDLGAALAGARSGDTARLTALIADAEGLRQTDGQFVNSCSDALNRP
TPDRVRELVVAWGKQYPQFGVVGALDLVKCLNWPSGSAPPEPKDLPVPVL
LLGVQNDPIVGNEGVAAVAATVLNAGASNKRVMWQGIGHGASVYSPCALT
PLVGYVDTGAPPATDTYCPA
108799183YP_639380.1 protein-methionine-S-oxide reductase [Mycobacterium sp. MCS]MSAPKVQLTDDEWRQKLSPEEFAVLRRAGTERPFTGEYTDTETKGVYQCR
ACGAELFRSSEKFESHCGWPSFFDPADSDAVILRPDDSLGMRRVEVVCAN
CHSHLGHVFEGEGYPTPTDQRYCINSISLRLVPAGG
108799181YP_639378.1 chlorite dismutase [Mycobacterium sp. MCS]MAKLDFDALNSTIRYLMFSVFSVRPGELGYDEQARAAVVDETATFLKQQE
ERGVVVRGLYDIAGMRADADFMIWTHADTVEALQATYSDFRRATALGRAS
SPVWSNVALHRPAEFNKSHIPAFLAGEDPGNYICVYPFVRSLEWYLLPDD
ERRRMLSEHGMAARGYKDVRANTVPAFALGDYEWILAFEAPELHRIVDLM
RDLRATDARRHVREETPFFTGPRVGVEELVTRLP
108799179YP_639376.1 uroporphyrinogen decarboxylase [Mycobacterium sp. MCS]MVIRASAAPLPVVAALGAMNTRRELPDSPYLAAARGRKPARVPVWFMRQA
GRSLPEYRALRARNTMMQACFDADLITEITLQPVRRHGVDAAILFSDIVV
PLRASGIALDIVPDVGPVIDHPVRTAADVAAIRPLERQTVEPVEQAVRML
TAALGDVPLIGFAGAPFTLASYLVEGGPSKHHEHTKAMMLGAPDTWHALM
SALTDVTIAFLQAQVDAGVDAIQVFDSWAGTLSLADYRAYVLPHSARVFQ
ALAPAGVPMTHFGVGTAELLGAMSEAIATSGAPGVVGVDWRTSLTDAAGR
VERGSALQGNLDPVVLLAGWPVVERAVRAVVEDGRRAVDAGAAGHVFNLG
HGVLPATDPEIVTATVELVHSL
108799177YP_639374.1 3'-5' exonuclease [Mycobacterium sp. MCS]MSETPDTDPEGPDTDIDAEAGTDTGAVPLLTPADGVPDLAVTTDEILAAA
ELLAGGHGPFAIDAERASGFRYSNRAYLVQIRREGAGTVLIDPVNHGEDP
TMVMAPVADVLDTDEWVLHAADQDLPCLAELGMRPPKLYDTELAGRLAGL
ARVNLATMVSELLGLQLMKGHGAADWSKRPLPDDWLNYAALDVEVLLELR
DAVAAVLDDQGKTDWAIQEFEHLRTYEAAPTRRDRWRRTSGIHKVRNPRA
LAAVRELWTTRDHIARRRDIAPGRILPDAAIINAATADPDSVEKLTALPV
FGGTRQRRSAQVWLDALDRARHNTDPPDSAEPPNGPPPPSRWARRKPEAA
ARLEAARAGLSALSERVAVPSENLVTPEVVRRLCWDWQPVTDIAAAVEEF
LVAAGVRPWQRDLVVPVLTAALAPSTAE
108799175YP_639372.1 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium sp. MCS]MLEQIRGPADLQHLSQSALSELAGEIRQFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPLIFDTGHQAYVHKMLTGRSHEFDSLRKKDGLSGYPS
RSESEHDWVESSHASAALSYADGLAKAFELTGHRNRHVVAVVGDGALTGG
MCWEALNNIAAARRPVVIVVNDNGRSYAPTIGGFADHLAALRLQPGYERV
LEEGRKAVRGLPVIGEFCYQCMHSVKAGIKDALSPQVMFTDLGLKYVGPI
DGHDEHAVESALRHARGFNAPVIVHVVTRKGMGYAPAENDEAEQMHACGV
IDVATGRATKVAAPGWTSSFSEALIDYGAKRRDIVAITAAMPGPTGLSAF
RDRFPDRFFDVGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQLMM
DVALHKLPVTLVLDRSGVTGPDGASHNGMWDLSVLGIVPGMRVAAPRDGA
RLREELGEALDVNDAPTAIRFPKGDVGEDIPAVRRHRGVDVLAEPADGLS
DDVLLVAVGPFASMALTVAERLRKQGIGVTVVDPRWVLPVPEVLTEFAAA
HKLVVTVEDNGLHGGIGSSVSAALRHAEVDVPCRDVGLPQQFFDHASRGE
VLADVGVTDRNISRQITGWVAALGATPADADEVSERLD
108799173YP_639370.1 ABC transporter-like protein [Mycobacterium sp. MCS]MHAIPPASARAESPLAIHTGGLGKRFGPVLAVEGLDLSVTPGEVFGFLGP
NGAGKSTTIRMLLGFLRPSEGSAHVFGIDAGDVRRVHRLLAYVPADVALW
PALTGAETLELLGNIGPGVDTDYRAELIRRFDLDLDRPGKAYSTGNRQKV
ALVAAFATRAPLLVLDEPTSGLDPLMEREFRRCIREARDRGQTVFLSSHQ
LAEVEAVCDRVAILRSGRLVEIDNIADLRRLRRTVVEVGYRDAAPQLTGV
AGVSDIERLEGRRLRFTLSGPPTLVLRALSSVDVTALRMHEPTLEEIFLD
YYGETSR
108799171YP_639368.1 putative antibiotic-transport integral membrane leucine and alanine anMATPVVRAWRAFGRNDIRGAYRDPLLVMIVFAPVIWTSAVALLTPRVTEM
LAEKQGFDLVPYYPVILTGFLLLTSIIIAGALAAFLVLDEVDAGTLTALR
VTPVKLSVFFAYRAVTVVVVTTVYVVTTLSLSGILQPGMTGALIPIGLLS
GLSAVVTLLLIVAMAGNKIQGLAAVRGLGMLIAGLPCLPWFIDSAWNLAF
GVLPPYWAAKAFWVAGDHGTWWPYLLAGVVYNGAVAWPLFRRFLAKNG
108799169YP_639366.1 ABC transporter-like protein [Mycobacterium sp. MCS]MVSRCRKAPIVTQSARLHQPPSAGTDEVIRVRGLTYAYLKAAEPAVRGMD
FEVGRGEIFGFLGPSGAGKSTTQKLLIGLLRGHGGDIAVWGREPLDWGPD
YYQRIGVSFELPNHYQKLTGLENLRFFASLYDGPTLDPAELLSAVGLGEH
AGTRVAKYSKGMQMRLTFARSLLNDPDLLFLDEPTSGLDPVNARNVKDMI
LELRARGRTVFLTTHDMATANELCDRVAFVVEGRIVALDTPAELRIARGR
RVVRVEYRSPRGELAEAEFAMDGLADDPAFHDVLRAHHVETIHSREASLD
DVFVDVTGRRLT
108799167YP_639364.1 hypothetical protein Mmcs_2200 [Mycobacterium sp. MCS]MNALRAAWLEFVGEETTPAGTASILGLAALGGYLAPRLAGRRLGAARATL
LVVAAVDLWGGVLANNTVACARWYERPGQTDADHLRFAVAHVHPLALAWL
DGGGRTRWRWAVANYGYLLAATALIRYARRHRRAAGVVTTLGGICVDRAL
GPSNTAPWFGPVFYSKLLLGHAGAALWSDATLAARR
108799165YP_639362.1 amino acid permease-associated protein [Mycobacterium sp. MCS]MSKLSTAARRLVLGRPFRSDRLSHTLLPKRIALPVFASDAMSSVAYAPEE
IFLVLSVAGLTSYTMAPWIGLAVAGVMLIVIASYRQNVHAYPSGGGDYEV
VTTNLGPTAGLTVASALLVDYVLTVAVSMASAMSNIGSAIPFVAQHKVLF
AVIAILLLASANLRGIRESGTAFAIPTYLFMAGMFVMLGWGLFQIYMLGE
PLQAESAGFELHAEHDDIMGFALVFLVARAFSSGCAALTGVEAISNGVPA
FRKPKSRNAATTLALLGVIAITLFMGIIMLAKATGAKVAERPAEQLGGAP
EGYQQKTLITQLADAVFHGSSIGLLLIAGVTALILVLAANTAFNGFPVLG
SILAQDRFLPRQLHTRGDRLAFSNGILMLAFAAVAFIVAFRAEVTALIQL
YIVGVFVSFTLSQIGMVRHWTRLLRTETDPAVRHRMMRSRVINGIGLTCT
GSVLVIVVATKFVAGAWIAILAMGSLFIIMKSIRRHYDTVARELAQQEDE
SDDIVLPSRNHAIVLVSKLHLPTLRALAYARATRPDVLEAITVSVDDAET
RALVHQWEDSDVTVPLKVIASPYREITRPVLDYVKRVTKESPRTVVTVFI
PEYVVGHWWEQVLHNQSALRLKGRLLFMPNVMVTSVPWQLNSSERLKLLE
PQSAPGDARRGFLE
108799163YP_639360.1 hypothetical protein Mmcs_2196 [Mycobacterium sp. MCS]MKVAIAGAGAVGRSIARELLESNHEVTLLERNPDHIDVDAIPAAHWRLGD
ACEISVLESVHLEDFDVVIGATGDDKVNVVVSLLAKTEFGVSRVVARVND
PRNEWLFDENWGVDVAVSTPRMLASLVEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKAVKRLELPRDSALVTILRGPRVIVPEGDEPLEGGDEL
LFVASAEVEDELSRLLLNPKQR
108799161YP_639358.1 nucleic acid binding- OB-fold- tRNA/helicase-type [Mycobacterium sp. MMSAGPRWICERSGEAMATAEGYLRRLTRRLTEDPEQLDVEELSDEAAQTG
AQKAIDCQRGQEVTMVGTLRSVETNSKNCAGGVRAELFDGTDTVMLVWLG
QRRIAGIESGRTLRVHGRVGKLENGTKAIYNPHYEIQK
108799159YP_639356.1 hypothetical protein Mmcs_2192 [Mycobacterium sp. MCS]MAFGKRKSSGKIGEPATQPTPEPVVEPAGEEDLEGPFDIEDFDDPEVAAQ
GRLDLGSVLVPMPAAGQVQVELNEAGVPSAVWVVTPNGRFTIAAYAAPKS
AGLWREVAGELADSLRKDGAAVSIQDGPWGREVVGTATGMVRFIGVDGYR
WMIRCVVNGVAESIEALTREAREALRDTVVRRGDTPLPVRTPLAVQLPEP
MAAQLRAAAAAQQGQQPDQQQAPPPPPPPEPAARRSAQGSAMQQLRTITG
G
108799157YP_639354.1 hypothetical protein Mmcs_2190 [Mycobacterium sp. MCS]MDTTSQITLRPVSDTRATTQTVRYRERLSVPWWWWLPGLGLAGLIAYEVN
LGVEALPDWVPFAVLLPVAAVVLAWFGRAEIRVVGGPAGETELWVGDAHL
PVSVVAKSAEVPRTAKSAALGRQLDPAAYVVHRAWVGPMILLVLDDPEDP
TPYWLVSTRHPDRVLSALGR
108799155YP_639352.1 hypothetical protein Mmcs_2188 [Mycobacterium sp. MCS]MVSSITEGTAFDRHGRPFRRRNYVPGLLTIGALAVVALVVWVIALNQPTD
VREAAVCNPPPPAPAAEPPPPTLGKQVSRVDMTDVTPAKLADTRIRVLNA
SGQGGQAGEIASELRDLGFAQPEAANDPIYVTARLQCQGQIRFGPSGRAA
AAAVWLVAPCTELFEDERPDPTVDLAIGTEFAELTASDDIDAVLASLRPD
ATAPADPELLKRIHTGTC
108799153YP_639350.1 polyphosphate glucokinase [Mycobacterium sp. MCS]MTATDSPVADPDAAGGDARRGFGIDVGGSGVKGGVVDLDTGQLIGERFKL
PTPQPATPDAVAKTIAAVVKEFGWTGKLGVTYPGVVTHGVVHTAANVDKS
WLGVNAQEIYSAALDGQPVTVLNDADAAGLAEERFGAGRDNTGVIVLLTF
GTGIGSAVIHNGILLPNTEFGHLEVGGKEAEHRAASSVKERKDWSYERWT
QEVTKVLVAIENAIWPDLFIAGGGISRKADKWVPLLKNRTPVVAAALQNS
AGIVGAAMAAEVDVTATNR
108799151YP_639348.1 hydroxyneurosporene-O-methyltransferase [Mycobacterium sp. MCS]MPKPPRVPPQRVVRAVDRVRAGLQRLHRTTAPGNIALLELATGAWTTAAL
YTAAKLGIADQLAAGPKHSNDVADRVGADHDGVHRLMRALASCGVLTQHA
DGSFTLTRVGDALRSDAEGSLRDMVLFIGHPIRWADWGNLEHSVRTGKTA
FAELHGRPFFEYLETDPEFAAVFNNAMTASSGVTDEVALGAYDFSGFKLV
VDVGGGHGSVLSTILRSAPQARGVLYDLPEVVADAGPTFEAAGVADRASA
TGGSFMDSVPDGGDLYVMKNIIHDWSDDDAATILRNIRTAMAPGGKLLLI
EMVLPERANAFIGLLLDLEMLVAAGGRERTRGEYANLLSRTGFRLTHVTG
TVTPLSILEAEPV
108799149YP_639346.1 hypothetical protein Mmcs_2182 [Mycobacterium sp. MCS]MCRVSRQAGLPDRQARRMYPHSTPKPPVLLHLCSAAEWQAISAEGEHRPD
SLGSVGFVHLSTPEQVHLPANRLFAGRTDLVLLHIDPARLTDPVRWEPGL
PTDPEAMVFPHLYGPLPAEAVRDVTPYRPGPDGRFAPFDQPT
108799147YP_639344.1 ribonuclease BN [Mycobacterium sp. MCS]MTDQPPPVNTTRHHVRRTLVRTLSKSWDDSIFSESAQAAFWCALSLPPLL
LGMLGSLAYIAPLFGPDVLPTIENQLIRTANSFFSSNVVNEIIAPTVSDI
VKGARGEVVSLGFVISLWAGSSAISAFVDSIVEAHDQTPLRHPVRQRFYA
LGLYVVMLVFAVGTAPLLALGPRKVAALIPDEWDAVLRFGYWPALFLSLL
VAVNILYRVSLPKPLPSHRLILGSILATVVFLVTTLGLRVYLTWITSTGY
TYGALATPIAFLLFAFFLGFAIMIGAELNAAVEEQWPAPSTHARRAKVWL
EERTSPERSAPPVAPDEPATS
108799145YP_639342.1 hypothetical protein Mmcs_2178 [Mycobacterium sp. MCS]MWNSGGMKHGSELSFDDEGRPVLITRAAPAYEEQHRARVRKYLTLMSFRI
PALILAAVAYSIWENGLISLGIVVLSIPLPWMAVLIANDRPPRRAEEPRR
FDNRRIPLFPTAERPALEYPTRPAPQPDITGEEPDAAR
108799143YP_639340.1 DtxR family iron dependent repressor [Mycobacterium sp. MCS]MNDLVDTTEMYLRTIYDLEEEGVVPLRARIAERLDQSGPTVSQTVSRMER
DGLLQVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVQVLDNPTTSPFGNPIPGLSELGLDSLSRAEVVN
LVRLTELPAGMPVAVVVRQLTEHVQGDADLIARLKDAGVVPNARVTVESA
DHGGVNIVIPGHEQVELPHHMAHAVKVEKV
108799141YP_639338.1 hypothetical protein Mmcs_2174 [Mycobacterium sp. MCS]MTAMDGVLVRGASGAVVALAGALLCGCVRVTDGTASLAADAKPVVLADAL
LEPSRFPPAYRAAVLDPQATGEAVAAVEGVPVGATVEPPGCAPPRVGPGP
EHAVAAQGVDSATGAALTVILTRTDTALSARRDQIARCAALTATAGEVVS
TVDTVLLAPPPVDADESLASEATILRSTEPAVRVLTLSAQIDEARLTVAW
LNNDPAVEPDTSALDVLFTDALLTLRRAAR
108799139YP_639336.1 alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]MTDRTPNLRPVRDVTPTLHYRTIHGYRRAFRIAGEGPAILLIHGIGDNST
TWNTVQTKLAQRFTVIAPDLLGHGKSDKPRADYSVAAYANGMRDLLSVLD
IDRVTVVGHSLGGGVAMQFAYQFPQFVDRLILVGAGGVTKDVNIALRVAS
LPMGSEALALLRLPLVLPTLQVAGRLAGTVLGTTKMGRDLAEMMRILADL
PEPTASSAFARTLRAVVDWRGQVVTMLDRCYLTESVPVQLVWGTHDSVIP
VSHARLAHAAMPGSRLEVFEGAGHFPFHDDPDRFVEIVERFIDSTEPANH
DQDILRQLLRTGLSESAISGSVDTRVAVLDAMGSDERSAT
108799137YP_639334.1 transcriptional regulator NrdR [Mycobacterium sp. MCS]MHCPFCRHPDSRVVDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSREKVIKGVRRACQGRQVDDDALNLLAQQVEDAVRATGSPEV
PSHEVGLAILGPLRDLDEVAYLRFASVYRSFESAADFEREIEALRAHQDV
TRSG
108799135YP_639332.1 LexA repressor [Mycobacterium sp. MCS]MSDDSSETRTGGRRGADAGLTERQRTILEVIRASVTSRGYPPSIREIGDA
VGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVDVRLSDEPATPVVTTDVA
GSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGSLFLLKV
VGDSMVDAAICDGDWVVVRQQAVADNGDIVAAMIDGEATVKTFKRSRGQV
WLMPHNPAFEPIPGNDAAVLGKVVTVIRKI
108799133YP_639330.1 molybdopterin guanine dinucleotide-containing S/N-oxide reductase [MycMPARPTSLTHWGGFSAEVSSGDIAAVTPLPGDDDPSPLLGNLPGSVRHRS
RIAGPAIRRGWLDDGPGPSRRRGADEFVAVSWDELTDLLAAELRRVVDTH
GNEAIYGGSYGWASAGRFHHAQSQVHRFLKLLGGYTYSRHSYSLGATGVI
MPRVVGTHDDLFKRSTDWDVIAARTDLLVCFGGLAMKNTGTNHGGTTAHP
ARAALRRFRGRGGRIVSFSPLRDDVDGECDWYAPVPGTDVAIMLGLAYVL
ATERLADRGFLETHCVGYDRFERYLLGADDGVAKSPQWAAAICGLPADEI
TALARRMAAQRTIVTVSWSLQRVRHGEQAPWMGLTLAAMLGQIGLPGGGF
GHGYGSMNEPGLPPLRCGLPRLPQGINPVSTFIPVAAVSDMLLHPGETFD
YNGMRLTYPDIRCVYWAGGNPFHHHQNIPRLRRALARVDTVVVHDPYWTA
MAKHADIVVPSTTAFEREDYSGSKNDPVLMAMPKLVEPYADSRDDYTTFA
ALADRLGFGEQFTEGRTARQWLAHLYEKWSAELDFAVPTFEQFWRDGSLR
LPTEPGLTLLGDFRADPVAHRLGTPSGRIEIFSEDIAGFGYADCAGHPTW
FEPTEWLGGERAATYPLHLVANQPATRLHGQLDGGSTSQSAKVVGREAIR
MHPDDAAARGVADGDVVRVFNDRGACLAGAVIDDRLRRSVVQLPTGAWFD
PADPADYDAMCVHGNPNVLTDDVGTSSLARGSTGAHVLVQVEKFSGPIPP
VRAHEPPVIRQR
108799131YP_639328.1 HSR1-like GTP-binding protein [Mycobacterium sp. MCS]MKSDLRANLDSLMTFPEFPAHQTPSAGELALEDRSALRRVAGLSTELADI
SEVEYRQLRLERVVLVGVWTDGSAADAEASLAELAALAETAGSEVLEGVV
QRRDKPDASTYIGSGKAAELREIVLATGADTVICDGELSPAQLTALEKIV
KVKVIDRTALILDIFAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQ
AGGRAGGAGGGVGTRGPGETKIETDRRRIRERMSKLRREIKDMKKIRDTQ
RSGRRRTEVPSVAIVGYTNAGKSSLLNALTGAGVLVENALFATLEPTTRR
GEFDDGRPFVLTDTVGFVRHLPTQLIEAFRSTLEEVADADLLVHVVDGSD
ANPLAQISAVREVINEVIAEQNAKPAPELLVVNKIDAADGLSLAHLRRAL
PEAVFVSARTGQGLDRLSARMSELVESTDVTVDVTIPYDRGDLVARVHSE
GRIDATEHTTDGTRVKARVPVALAAGLRDFATF
108799129YP_639326.1 tRNA delta(2)-isopentenylpyrophosphate transferase [Mycobacterium sp. MRPLAIIGPTGTGKSALALDVAERLGGEIGVEIVNADAMQLYRGMDIGTA
KLPAAQRRGVPHHQLDVLDVTETASVARYQSEAARDIEAIAARGAVPIIV
GGSMMYVQALLDDWAFPATDPAVRARWEQRLAEVGVAALHGELGKVDPDA
AASILPTDGRRIVRALEVVELTGQPFAASAPTIGAPRWDTAIIGLDWETT
VLDERLAARTDSMFAEGLVAEVAGLLRHGLREGVTASRALGYAQVLADLD
AGGDGSAAREPTFVGTRRYVRRQRSWFRRDHRVCWLDGGSPDNVDRTLRA
WRAVS
108799127YP_639324.1 hypothetical protein Mmcs_2160 [Mycobacterium sp. MCS]MDRSAWPSEPLKAIETGRPGVCAHLRRAGLRDHPPSGHAHARYDDEEIAM
ARADIAALLALGAAFFIAIGDVIHQRSAHEVTDEAVGHLQLFLQLLRDRQ
WWLGSTVAALGFGLQAAALGLGSVLLVQALLVTSLLFALPINARLTGRRV
TRWEWLWAALLAGAVAVIVTVGNPTAGQARASWETWMVVLAVLVPALVVC
VVGARIWSGPPSAVLLALVSGALWGVFAVLTKGVVDRLDDGLWAVLQMPE
LYALAAVAVAGTAWQQASFRSGALTASLPTMTVTEPVVASVLGVAVLGET
MRPGESGWFTLVVAAAAMVLATAALARGEAAGAEAQASVAH
108799125YP_639322.1 hypothetical protein Mmcs_2158 [Mycobacterium sp. MCS]MCAVSTPDGPNGFDSYKGDIEDVERRVAGEFDPGARALVVAVLVFVVLLS
FVLPHAGGARGFDVLTGTDAAAEAGISLPSRVFAILAIVFSVGFSIVALL
TRRWAIAWVALAGSAVASAMGMLAVWSRQTAAEPYPGPGIGLIIGWLAVI
VLTFHWARVVWTRTAVQLAAEEERRRRAAENQGKGLLDFGDEPRDDQDGP
ARPGV
108799123YP_639320.1 ABC transporter-like protein [Mycobacterium sp. MCS]METAGHASQAVPMISMQEVNKHFGDLHVLKDINLRVERGQVVVVLGPSGS
GKSTLCRTINRLETIDSGTIAIDGEVLPDEGRKLAQLRSDVGMVFQSFNL
FAHKTILDNVTLAPMKVRGLGKDAAREAAMALLERVGVANQADKYPAQLS
GGQQQRVAIARSLAMNPKVMLFDEPTSALDPEMINEVLSVMTALASEGMT
MLVVTHEMGFARRASDRVVFMSDGAIVEDAEPAQFFDNPQTDRAKDFLGK
ILHH
108799121YP_639318.1 amino acid ABC transporter permease [Mycobacterium sp. MCS]MEIFTEYRAQIFEAFWTTIQLTVYSAVGALILGTVLAGMRLSPVPMLSWL
GTAYVNVIRNTPLTLIILFCSFGVSQTLGITLVDPQSSTSIEDSNFRLAV
LGLTVYTASFVCETVRSGVNTVPLGQAEAARSLGLTFSQNLRMILLPQAF
RSVVIPLGSVLIALTKNTTIASAIGVAEAALLMKEMIENTAALLVVGSIF
ALGFIILTLPLGLVFGWLGKRLAVAR
108799119YP_639316.1 hypothetical protein Mmcs_2152 [Mycobacterium sp. MCS]MIETVTALDILPESTLRSAVDVMVRLVEACGAVVIVVGAVIAIVKFAVTL
ARRDIGEFSSVRLTLGRFLALGLEFQLASDVLRTAISPSFEEIGKLAAIA
AIRTALNYFLAREIAEEQRAVEEARAARSAPDASPR
108799117YP_639314.1 hypothetical protein Mmcs_2150 [Mycobacterium sp. MCS]MHMLTNIDVRPHHRTAVETSVRIVSTVTPADLGRPTPCAGWDLGDLLVHM
TVQHRGFAAAARGRGADHGVWDPATVADAVRSRPADSYRAAAEDVVAAFA
VDGVLDAPFALPEFGSDATFPGAMAIQFHFVDYVVHGWDVARASGLSFDI
PADVVSVAAPIAFAVPDGEIRSADNSPFAPALPASQDGNELDRMLRHLGR
SPDWRP
108799115YP_639312.1 recombination regulator RecX [Mycobacterium sp. MCS]MTSFPHPSTSESGPDPDSEPNREEQAHAYCLRLLTARARTRAELAGKLTQ
RGYDEPVVARVLDRLVDVGLVDDEDFAEQWVRSRHLYAGKGKRALAAELR
RKGVDDEVISSSLADIDAGAERDRAERLVRDRLRREKLDDEPGSDLKVKR
RLAGMLARRGYSQSMALDVVTVELAGERERRRV
108799113YP_639310.1 hydrogenase nickel incorporation protein HypA [Mycobacterium sp. MCS]MHEMAITQSVVDAVCDHAAGRRVHSVRLEVGALCAVVPDAMRFCFELATE
GTAADGARLDLDVRPGLARCRTCDTDFELTDLILLCPCGSADVEVRAGRD
LRILSMEVS
108799111YP_639308.1 NADH ubiquinone oxidoreductase- 20 kDa subunit [Mycobacterium sp. MCS]MPTEAAVKAEEALIHVLWINAGLSCDGDSVALTAATQPSIEEIALGALPG
LPKIAVHWPLIDFECGPNGGADDFLEWFFRADRGELEPFVLVVEGSIPNE
AIKDEGYWCGFGNNPATGQPMTTSEWLDRLTPKATAVVAVGTCATYGGIH
AMAGNPTGAMGVPDYLGWDWKSKAGIPIVCVPGCPIHPDNLAETLTYLLY
MATDQAPMIPLDDALRPQWLFGQSVHEGCDRAGYYEQGDFATEYGSPKCI
VKLGCWGPVVKCNVPKRGWINGVGGCPNVGGICIGCTMPGFPDKFMPFMD
EPPGGKVSTTASTLYGSVIRSLRHVTGRTVDKEPKWRHPGTKLETGATRT
W
108799109YP_639306.1 nitrogen-fixing NifU-like protein [Mycobacterium sp. MCS]MCPAAPSEHDADADTRWRTAGERIQTLLDASSAGGAAARERAEQLVGEVT
DLYGAALGRMLDLAVSVDPDLVDAVAADPLVASLLLVHGMHPHSVERRIT
DALDTVRPYLGSHGGDVHLLGVDGDTARLRFAGSCKSCPSSAVTLELAVE
DAIRAAAPEIETIEVVAEERDSADTVIPAESLFTRVHGSASWLPVPGLAE
ILPGEVGGFAVAGTPVLVCRLDDTLYAYRDRCGRCDASMAGARLTGEVLR
CPRCDAGFDVVHAGAGLGGLERLEPVPVLRRQGVWAVAIAESVA
108799107YP_639304.1 hypothetical protein Mmcs_2140 [Mycobacterium sp. MCS]MTADVRFTVQDVTPERYAVTPVLTARIEVTATGDDPVHAIALRCQVRIDP
LRRGYTDDEAEGLADLFGPRERWGTTQHTFLWQHSATMVPGFSGGTHVDL
PLECTYDVEVAAAKYMHALRDGVIPLQFLFSGTLFTRGERGFAVTQISWD
REDTYRLPVTVWRDLIALHYPNTGWLRLSHDTIAALTAYRSAHGLLSCDD
AVTALLSQARQEVP
108799105YP_639302.1 peptidase M52- hydrogen uptake protein [Mycobacterium sp. MCS]MLRRAAPLITDPRVRAVDYGIRGMHLAYDLLEPWELLVLVDALPDRGAPG
TLHVFEADHDALCATGGLDAHAMDPAAVFASLTALGGAPPRTVVIGCEAA
DVAEGIGLSTPVAAAVPEAVRAVGAVVSGQTTQPGRV
108799103YP_639300.1 (NiFe) hydrogenase maturation protein HypF [Mycobacterium sp. MCS]MVQGVGFRPFVYTTATALGLTGSVRNDSAGAVVEIEGDPDALTRFVERLH
TRPPPLAVIESVDIEDLPPVGGTGFFIADTSRGRGRTLASPDVAMCAQCA
AEQRDPGDRRYRHPFVNCTDCGPRFTIIASLPYDRAATSMAGFAMCADCA
REYADPTDRRFHAQPVCCPHCGPTLTFRDADGRHTAGEDGLRRARRLLRD
GGVVAVKGIGGYHLACDAENNTAVAELRRRKQRGDKPFAVMVPDAAAAGR
IAVLDEVAQHLLGGPQRPIVLAPRRTPTTVAAAVAPGNPDLGVLLAYSPL
HTLLFGLPGDEPGPQVLVMTSGNLAGEPLCYDDDDAVTRLRALADGWLMH
DREILVPCDDSVVRVVDGVELPIRRSRGYAPLPVALPLAVPPTLAVGADL
KNTMAVADGRYAWLSQHIGDMDDIATLSAFTAAERHLRELTGVAPQILAT
DAHPRYRSTGWAQRHAGDRPVRAVQHHHAHIAAVMAEHGLDGSAPVLGFA
FDGTGYGPDGAVWGGEVLLADYKGFRRIAALEYVPLAGGDVSVLRPYRMA
LAHLWAAGLPWAGDLPPVQACPEDERRVLRHQLETGLNCVPTSSMGRLFD
CVAALAGVRQTVAYEAQAAIELEALARTVDDDPAPYAFTVTESSGTAMIG
AAAVVEAIVADRRRGTAAAVIGWRFHHAVADLVVRLAEGARDPVALSGGV
FQNALLLRMTLRALTERGVEVLTHRRVPPNDGGIALGQLMVANAG
108799101YP_639298.1 hydrogenase expression/formation protein HypD [Mycobacterium sp. MCS]MKYLDEFSDPQLARKLIEQIKSVTTRRWSIMEVCGGQTHSIIRHGIDQLL
PDQIEMIHGPGCPVCVTPLEIIDKALEIASRPEVIFCSFGDMLRVPGSES
DLFQIKSRGGDVRVVYSPLDALTVAKDNPDRQVVFFGIGFETTAPANAMT
VYQAKRQGIPNFSLLVSHVLVPPAISAIMESPTCRVQAFLAAGHVCSVMG
TAEYPPLCEKYGIPIVVTGFEPLDILEGIRRTVVQLEAGRHELENAYPRA
VRAEGNPAAKTMLADVFEVTDRSWRGIGMIPQSGWRLSPAYRDFDAEYRF
AVTGIHTDESTLCRSGEVLQGLIKPHECAAFGTVCTPRNPLGATMVSSEG
ACAAYYLYRRLEVSHA
108799099YP_639296.1 hypothetical protein Mmcs_2132 [Mycobacterium sp. MCS]MLPTRRRGDTLFARYAFPPNELGYCGPPGSATVGGVSELAGQAREFDGAW
PYLRALAAAAGDTDVLDEDVVRSYWIGGGLLHDVDAEGLLVALRRAFTGQ
VTGLLDAVPAGTALAHHSFHVFVVYPWARFLDRDPTTPIRIMQQCRIRSG
TVESVDGDHVVVSTRPLTVDGGTLALGAAVSERVRWRRDGSSLIPAPRPG
DPVAAHWDWVCDALTEDDVAALTAATQATLDLVNEIRTAVNQGAPTQ
108799097YP_639294.1 hypothetical protein Mmcs_2130 [Mycobacterium sp. MCS]MRLTEFRELVDGQFGSMRGRSLLVDHVLSGLGGRTAAQAIEDGVEPRDVW
RALCADFDVPRDQW
108799095YP_639292.1 limonene-1-2-epoxide hydrolase [Mycobacterium sp. MCS]MTESSNGSTSALQSTTNARTVETFLFALQDEDFDAADSLMADHIAWQNVG
FPTIRGRERITKLFRRGQGKLGFEVKIHRIAAEGDAVLTERTDVLVLGPV
RLQFWVCGVFEVHAGRITLWRDYFDTVDFLKATVRGLLAVPFPALRPTL
108799093YP_639290.1 phage shock protein A- PspA [Mycobacterium sp. MCS]MANPFVKAWKYLMALFSSKVDEYADPKVQIQQAIEEAQRQHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQAVANGDAAKATEYNN
AAEAFAAQLVTAEQSVEDLKALHDQALQAAGQAKKAVEQNAMMLQQKIAE
RTKLLSQLEQAKMQEQVSSSLRSMSELAAPGTTPSLDEVRQKIERRYANA
MGEAELAQNSVQGRMLEVQQASVQMAGHSRLEQIRASMRGEALPSGGATP
AASPATPAANPAQQAPENPLSQ
108799091YP_639288.1 CinA-like protein [Mycobacterium sp. MCS]MNDPLVTDDARALVADLTVRHQSVATAESLTAGLLSATLAGVPGSSAVLR
GGLVTYVEDTKIALAGVAPQVLDAVGPVAAPTARALAVGTRQRCGATWGV
GLTGVAGPEPHGGHPVGTVFLGLAGPVDTKVVELHLSGTRWDIRKAAVDE
AIAHLRALVEAQ
108799089YP_639286.1 N-acetylglutamate synthase [Mycobacterium sp. MCS]MRRARTSDVPAIKGLVDIYAGKILLEKNLVNIYEAVQEFWVAELDDELIG
CGALHVLWADLGEVRTVAVHPKVRGRGVGHLIVERLLDVARELRLQRIFV
LTFEVEFFARHGFAEIDGTPVTAEVYEEMCRSYDTGVAEFLDLSYVKPNI
LGNTRMLLTL
108799087YP_639284.1 antibiotic biosynthesis monooxygenase [Mycobacterium sp. MCS]MPVVVVATMTAKPESVDTVREACKKAIESVHSEPGCDLYSLHEANGTFVF
VEQWADADALKTHSTAPGVTTLFAEVGEHLDGAPDIKMLEPVPAGDPAKG
RLRP
108799085YP_639282.1 hypothetical protein Mmcs_2118 [Mycobacterium sp. MCS]MVVSLAVASIRGDHDAESLSPVDPEAVLRRCAESPRIPAIRPFDLGNTMH
ANQLMHPRQFVTTWIVHRPPKHQTVITVQEVELATAAAAAPAAAALARAE
SRHRVLKWPAPHVLPESRSHYYPRRCAYFETSTMSRLMDHL
108799083YP_639280.1 dihydrodipicolinate synthase [Mycobacterium sp. MCS]MSPVSISGFDVTARLGTVLTAMVTPFKPDGTLDTDAAARLANHLVDSGCD
GLVLSGTTGESPTTTDDEKLTLLRTVLEAVGDRARVVAGAGTYDTAHSVH
LAKSCAAEGAHGLLVVTPYYSRPPQAGLLAHFTAVADATDLPVVLYDIPP
RSVVPIAWDTIRTLAEHPNIVAIKDAKGDLHGGGQIIAETGLAYYSGDDA
LNLPWLAMGAVGFISVWGHFAASQLREMLSAFNSGDIATARKISVALGPL
SDAQARLGGVTMSKAGLGLLGFDVGLPRLPQIPPTPDELTALAEDMRAAA
VLR
108799081YP_639278.1 hypothetical protein Mmcs_2114 [Mycobacterium sp. MCS]MRLTGAQARRIAVAAQGFAEPKPRGPVTRGHLRRLVDRIQVLQLDSVSVA
VRAHYAPVFSRLGPYDRGVLDGAAWSHSTRAPRLLVEYWAHEAALMAVDD
WPLLRWRMREYTHGRWGTHIVKANPQLADDIVTAVTELGPATAGQIEEYL
GAEQRGRKGPWWDRSDTKWVTEALFASGVLTTATRVGFARHYDLTERVLP
ADVVARQIDDADAVRELCLRAAGALGVATEADIRDYFRLAAKQVKPALAE
LVAAGELVPVEVDGWAAPAYLRAGQTVPRTDRGTALLCPFDPLIFFRPRV
ERLFGFHYRIEIYVPQHKRQYGYYVWPFLLDGRLVGRVDLKAERTRDALH
VVGAFVEPGEDPARVAVALAGELKTMAQWLGLADVTVGDRGDLVATLRES
AALG
108799079YP_639276.1 thymidylate synthase [Mycobacterium sp. MCS]MPIPTPYEDLLRLVFERGTPKSDRTGTGTRSLFGHQMRYDLAAGFPLITT
KKVHLKSVVYELLWFLRGESNVRWLQEHGVTIWDEWASETGELGPVYGVQ
WRSWPTPSGGHVDQISAAVDLLRTDPDSRRNIVSAWNVGEIPQMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLGVG
EFVWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAQRDSIFDYTYEDVV
VKNYDPHPAIKAPVAV
108799077YP_639274.1 hypothetical protein Mmcs_2110 [Mycobacterium sp. MCS]MPGIADIALGAAPIAGGALLGIAAGGLRGPDVRGMIAKDMELLERLPEEQ
VELRARLRRSIDQRIEDLVTTAERSRELRIAAMSYEGNWRDVLVFICTVL
FTVVWWHVSHSRSNWLVMFIVLIVLTVVAGAYAARGIRRALGRKRRNRRG
AL
108799075YP_639272.1 tetratricopeptide TPR_2 [Mycobacterium sp. MCS]MTDDRRALRTQVLIGLMCVALVVYFLLLGRIAFAFIKTGELAAVGLGVAL
LALPLIGVWVMVSTLQAGFAHQRLVRLAREQDMDLDVSDLPRRPSGRIER
DAADALFELVRAELHEDPDNWIRWYRLARAYDYAGDRGRARAAMRRAVEL
EESA
108799073YP_639270.1 hypothetical protein Mmcs_2106 [Mycobacterium sp. MCS]MDGLPGAVDRLLAAVAELQTASIDELSYEQIVAELDRIKAAVWAVPSVEH
RLTARLMDADPHELGATSIKEVLANHLRISRKAAGERLTDARQLGPRYTL
TGERVQTELAHTAAAVARGDIGTAHVRIIQDFVRKLPAWVSWERRDHYER
DLVGHASALRPEDLRKVADTLLGFIDQDGTEPDHHTQQRRREFTVGRQQA
DGMSRVSGWLTPEARAHWDVIAAKYAAPGTNLPHDDAHTGRDDRTTGQRH
HDALTRAMRDHVQSGALGQVAGVPASIVATMTLSELERAAGWAHTGGGNK
IPIRDLIRMAAHSRHYLAVFDDHTEEILYFGRARRTASTAQRLALFARDR
GCTHPGCTVPFYWTEAHHTHDYSRGGRTDIDDLTLACQPANLLIEKTGWT
THRPGNGRTQWTPPADHDTGQPRINNHFHPHRYLTDNDDGQDDEPE
108799071YP_639268.1 L-alanine dehydrogenase [Mycobacterium sp. MCS]MRVGIPTEIKNNEYRVAITPAGVAELTSRGHDVLIQSGAGEGSAISDADF
KAAGAQLIAGADEVWAEADLLLKVKEPIEPEYSRMREGQTLFTYLHLAAS
QPCTDALLASRTTSIAYETVQTADGALPLLAPMSEVAGRLSAQVGAYHLM
RTQGGRGVLMGGVPGVAPAKVVVIGGGMAGDNAAAVAWGMGAHVTVFDVN
INILRKIDAEYGGAIETRYSSRLELEEAVTQADLVIGAVLIPGAKAPKLV
TNSTVAQMKSGAVLVDIAIDQGGCFEDSRPTTHDDPTFKVHDAVFYCVAN
MPGAVPRTSTFALTNATMPYVLKLADKGWRAACQADPALAKGLSTHAGAL
LSEQVAADLDLPFTDPATVLA
108799069YP_639266.1 twin-arginine translocation pathway signal [Mycobacterium sp. MCS]MTYSLTRRRLLSATAVLGGAAAFATYAGRPAYAQPVAGLDALERANTAVV
GVFAVNLDTGRTVAHRAQESFAMCSTFKAYLAAHVLQLVGRGERSLEQGL
YVDAADILPNSPRTEPRVGGEMTLAELCQAILQVSDNAAANILLRDVGGP
PAVTAFARWIGDPRSRLDRYEIELNSAVPGDPRDTSTPEALGGGFRTLLT
GDVLAPPQRRLLEDWMRANETSSMRAGLPPGWTTADKTGSGDYGTTNDVG
IAYGPQGQRLLLAVMTRSATDDPDAENMRPLIGEVTAAVLPELLRG
108799067YP_639264.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium sp. MCS]MSVVEIEDGVYESTAVIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDET
MLLSATSASKSPKDHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPTFVSGLRNEIQVVVTVMSLDPKDLYDVVAINAASAST
QIAGLPFSGPVGGVRVALIDGTWVAFPTVEQLERAVFDMVVAGRKTADDV
AIMMVEAEATDKVVELVAGGAQAPTEAVVAEGLEAAKPFIKVLCEAQQEL
AGRAAKPTADYPLFPEYGEDVYYAVASVATDALSEALTIAGKEERNNRTD
EIKVEVLGRLADQFAGREKEIGGAFRSLTKKLVRQRILTDHFRIDGRGVT
DIRALSAEVAIVPRAHGSALFERGETQILGVTTLDMVKMAQQIDSLGPET
SKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALMPVLPSVEEFP
YAIRQVSEALSSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSDD
VEVDGKTERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDTKLDGI
PSQVLAGALAQAKDARITILEVMAEAIDAPDEMSPYAPRITTIKVPVDKI
GEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAIDKINAI
ANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGKRIAKV
EDVAKVGDKLRVEIADIDNRGKISLVLVAEEEAAEASDNGSATPSDKAPA
TADATTAGN
108799065YP_639262.1 bifunctional riboflavin kinase/FMN adenylyltransferase [Mycobacterium MARRRLAVVQRWRGQDDIPTDWGRCVVTIGVFDGVHRGHAELIDNAVKSG
RSRGVPTVLMTFDPHPMEVVFPGSHPAQLTTLTRRAELVEELGIDVFLVM
PFTADFMKLTPERYIHELLVERLHVVEVVVGENFTFGKKAAGNVELLRKA
GERFGFAVDSLSLVAEHHRDETVTFSSTYIRSCVDAGDVVAAAEALGRPH
RVEGVVVRGDGRGRGLGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPVM
GTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTAADLYGQHVAVDFVA
RIRGQEKFDSVDDLIATMGTDTERARTILRNSV
108799063YP_639260.1 signal-transduction protein [Mycobacterium sp. MCS]MTDLPSAGSIQVSTLTGDAVVRVPADATVADVATAIIDKEVGAVLIGDDD
RPTALVSERDVVRVVASGRDPATVRADEVATTNLVWCEGDATVDFVATRM
MDRYIRHVLVEQDDRLVGIVSARDLLGVYAADADLPR
108799061YP_639258.1 4'-phosphopantetheinyl transferase [Mycobacterium sp. MCS]MSPQVTLLPEVLGDKAVSAERYDDPPDIAPLPEEEPLIARSVAKRRNEFV
TVRFCAREALGELGLPPVPILKGDKGEPCWPDGVVGSLTHCEGFRGAAVA
RRGDARSIGIDAEPHGVLPKGVLDAISLPAERSALAALPGGLHWDRILFC
AKEATYKAWFPLTHRWLGFEDAHITFDVDGSGQTGRFVSKVLVDPAAESG
PPLSTLEGRWSVRDGLALTAIVL
108799059YP_639256.1 hypothetical protein Mmcs_2092 [Mycobacterium sp. MCS]MAAKLRVLSALCALFAAVMVVIATNPTGESATGRVDLRSTFLPLTGSTTI
KYPVVETVDPSPFDPCRDIPFDVVQRAGLAYTPPAPEDALRCKYDAGNYQ
MTIEAFVWRTYEETLPPDAVQLDIAGHRAAQYWIMKPTDWNNRWWTTCAV
AFDTSYGVIQQVLFYSPIYSQPDVDCMQTNLQKAHELAPHYIY
108799057YP_639254.1 hypothetical protein Mmcs_2090 [Mycobacterium sp. MCS]MSTPALKEWSAAVHAMLDGRQTVLLRKGGIGEKRFRVDADRFVLFPTVAH
SHAERVRAEHRDLLDRAAADSTEEALTLRAGARVVAAVEVNRPEAVGELE
PMHIWTAESVQADRLDFRPKHRLTVLVVQVSPLAEPVRIERTPQFGGCTS
WVDLPVHPAWEPPVHDDATLAAIAESVRRSVG
108799055YP_639252.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MSNADTPDVLAIETTDRVRTLTLNRPQARNALSKALREAFFTALRNAEYD
DDVDVVIVTGADPVFCAGLDLKELGDQTQLPDISPKWPSMTKPVIGAING
AAVTGGLELALYCDILIASEQARFADTHARVGLLPTWGLSVRLPQKVGVG
MARRMSLTGDYLSATDALRAGLVTEVVPHAELLPTARAIAASIVGNNQRA
VRSLLESYHRIDESQTAGALWLEADAARRWMASATGDDIAANRAAVLERG
RAQVR
108799053YP_639250.1 type 11 methyltransferase [Mycobacterium sp. MCS]MTEHPTVVNHHAGQPGFGGPVGVLFAVVFLLTGRGNARLAADVAAVSADD
RVVDVGCGPGTAARLAARRGARVTGVDPSDAMLRVARAVTRRRPSVTWVR
GGAEALPVPDASATVVWALATVHHWPDVGAALTEIRRVLSPGGRLLVVER
QVQPGATGFASHGWTAQQAETFAALCRSAGLTDVGVTGRGRGRRAVWSVR
GVRPAGL
108799051YP_639248.1 phosphoesterase- RecJ-like protein [Mycobacterium sp. MCS]MTAIDKTTDVPAGARVDAYRAADLLAAAATVSVVCHVYPDADTIGAGLAL
ALVLDHSGKSVQVSFAAPAELPESLQSLPGGHLLVAPEEMRRDADLVVTV
DIPSVNRLGALGDLAVPGRRVLVIDHHASNQLFGTANYVDPSADSTTMLV
AELLDAWHKPIDLGVAHCLYAGLTTDTGSFRWASARAHRLAARLVEIGVD
NAAISRTLLDTHPFAWLPMLSRVLASARLLPDAVDGRGLVYAVVSHEELA
GARPEEVESIVDIVRTTQQAEVAAVFKELEPQQWSVSMRAKSIDLSSVAS
AFGGGGHRLAAGYSASGPADDVVAALRAALG
108799049YP_639246.1 translation initiation factor IF-2 [Mycobacterium sp. MCS]MAGKARVHELAKELGVTSKELLATLKEQGEFVKSASSTVEAPVARRLREK
FGSKSAPAPAKSAGNGATAAPATSATPATAAAAAAPAPAPAPQAPAKPAA
PKPAAPQPVAPPQPAAAAPTPPPAASAPAPAPAPSAPAPSRPGPTPGPRP
GPAPKPAPRTPRVGNNPFSTQQPVDRPIPRPQPRPGAPRPGTPRPGMSPN
NMPPRPAGPRPGAPAGRPGGPRPGPGGRGPGGGGGRPGGPGGGGGGNYRG
GGAGGGGGAGGAAAGGFRGRPGGGGRPGQRGGAAGAFGRPGGAPKRGRKS
KRAKRAEYENMQAPVVGGVRLPHGNGETIRLARGASLSDFAEKINANPAS
LVQALFNLGEMVTATQSVNDETLELLGSEMNYVVQVVSPEDEDRELLESF
DLSYGEDAGDEGDLEIRPPVVTVMGHVDHGKTRLLDTIRQANVREGEAGG
ITQHIGAYQVLTELDGNERLITFIDTPGHEAFTAMRARGAKATDIAILVV
AADDGVMPQTVEAINHAQAADVPVVVAVNKIDKEGADPQKIRGQLTEYGL
IPEEYGGDTMFVDISAKQGTNIDALLEAVLLTADASLDLRANPDMEAQGV
AIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVE
AAMPSRPVQVIGFTSVPGAGDNLLVVDEDRIARQIADRRSARKRNALAAR
SRKRISLEDLDSALKETSQLNLILKGDNAGTVEALEEALLGIQVDDEVEL
RVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELANREGVEIRYY
SVIYQAIDEIESALKGMLKPVYEEKELGRAEIRAIFRSSKVGNIAGCLVQ
SGIMRRNAKARLLRDNVVVAENLTVSSLRREKEDVTEVRDGYECGLTLTY
SDIKEGDVIETYELVEKART
108799047YP_639244.1 transcription elongation factor NusA [Mycobacterium sp. MCS]MNIDMAALHAIEADKGISVDVVVDTIKSALLTAYRHTEGHQADARIDIDR
KSGAVKVMARETDADGNLIQEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVAGVIQRDARANARGLVVVRMGSETKGNEGVIPAAE
QVPGERYEHGDRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
NDGSVDIVAVAREAGHRSKIAVASRVPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDEDPARFVANALSPAKVVSVSVIDEQTRAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDAAPPDQHRPDSDAPQSAVRDR
108799045YP_639242.1 hypothetical protein Mmcs_2078 [Mycobacterium sp. MCS]MPSAPVPAVISRRGLLMSAATLAVVGVSVAACGSAPPPPEVDELTAQLDR
ARADSRLATDAAATARQPMKQTLTTIAAERDAHAQALADELVRLVGTEAP
TATAPTSTAAPATPATVREVIGALRQSAESATGLAAQMSGYRAGLLGSIA
ASCTAAWRVALAPPAKDTP
108799043YP_639240.1 prolyl-tRNA synthetase [Mycobacterium sp. MCS]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYVRPVGPGLYTWLPLGLR
VFRKIEQIVRDEMTAIGGQEILFPALLPRAPYETTNRWTEYGDTLFRLKD
RRDNDYLLGPTHEELFTLTVKGEYSSYKDFPLILFQIQTKYRDEARPRAG
ILRGREFVMKDSYSFDVDDDGLKTAYHLHREAYQRIFARLGVHYVIVSAV
SGAMGGSASEEFLAESEVGEDTFVRCLQSGYAANVEAVLTRVPEPLPIEG
QPEAVVYDTPDAPTIATLVDWANGADLPNFAGRAVTAADTLKNVLVKVRE
PGGEWELLAVGVPGDREVDDKRLGAALEPAEYALLDEADFARHPFLVKGY
VGPKALLDNGVRYLVDPRVVDGTAWITGADAPNKHVVGLVAGRDFVADGT
IEAAEVRDGDPSPDGAGPLVSARGIEIGHIFQLGRKYTEAFSADVLGEDG
KPVRLTMGSYGIGVSRLVAVIAEQQHDELGLRWPAAVAPFDVHVVIANKD
DGARTGATELAGELDRLGLEVLLDDRKSSPGVKFKDAELLGVPWIVVVGR
GWGDGVVELRDRFSGEKREIGVDDAATEILATVR
108799041YP_639238.1 uroporphyrinogen-III C-methyltransferase [Mycobacterium sp. MCS]MTDNAYLVGLRLAGRKVVIVGGGTVAQRRLPLLIANGADVHVIARAATPA
VEAMTGITLTLRDFRVGDLDGAWYVIAATDDPDVNAAVVAEAERRHVFCV
RADVAREGTAVTPASFEYEGLSVGVLAGGEHRRSAAIRSAIHEALASGLI
SGDDPDTVTTGVALVGGGPGDPELITVRGRRLLAQADVVVADRLAPQELL
AELPPHVEVIDAAKIPYGRAMAQDAINQVLIDRASAGKFVVRLKGGDPFV
FARGYEEVLACVDAGIPVTVVPGVTSAIGVPALAGVPVTHRHVTHEFVVV
SGHVAPDHPESLVNWDALAALTGTIVLLMAVERIELFTKVLIEGGRPAET
PVLVVQHGTTTAQRTLRATLADAPERMSAEGIRPPAIIVIGPVAAFGG
108799039YP_639236.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium sp. MMPQGRPATVPDDGLTTRARRNAPLLAVHTGPGKGKSTAAFGMALRAWNQG
FDIAVFQFVKSAKWKVGEESVFRELGRLHDEHGTGGAVEWHKMGSGWSWS
RKPGSDDDHAAAAADGWAEIARRLAEERHDFYVLDEFTYPLKWGWVDVDE
VVEVLRSRPGRQHVVITGRDAPQALIDAADLVTEMTKVKHPMDAGRKGQK
GIEW
108799037YP_639234.1 N-acetyltransferase GCN5 [Mycobacterium sp. MCS]MTVALRRSWAKDLDAATLYELLKLRVEVFVVEQACPYPELDGRDLLAETR
HFWLEGSDGEVISTLRLMEEHPGGQKGFRIGRVCTRRDARGHGHTARLMQ
AALADVGDHPCRINAQTYLQEMYARHGFVRAGDEFVEDGIPHVPMLRPGS
GTAHQ
108799035YP_639232.1 hypothetical protein Mmcs_2068 [Mycobacterium sp. MCS]MGARGLSWEADVLPDYQRHTLGLGPDPDGEGDLVATLVRRGGPQPGARHA
VLLVHGFTDYFFHTELADHLAARGFAFYALDLHKCGRSHRDGQTPHFTTD
LARYDRELEQGLRIIGEETDGAAVLVIGHSAGGLIVSLWLDRLRRRGMTA
RLGVSGLVLNSPWFDLQGSAVLRSAATSAALGAVSRFGKRRIVRAPNPGG
GYGATLHRDFAGEFDYNLEWKPVGGFPVTAGWIHAVRRGHARLHRGLDVG
VPNLILRSDHSVREAPDPDAMQRGDAVLDVAHIARWAGCVGNRSTIAPIP
DAKHDVFLSLAEPRRAAYGELDRWLDWYLGEGSNTMRRGL
108799033YP_639230.1 ABC transporter-like protein [Mycobacterium sp. MCS]MTAPAVRIERLRHVYPDGHVALAGVDLTIGVGERVAVLGPNGAGKTTLML
HLNGVLEATAGSVRIGGTTVGRRTLADIRRRVGLVFQDPDDQLFMPTVAQ
DVAFGPANFGVRGDELAARVRRALATVSLTAEADRSPTHLSAGQRRRAAL
ATVLACEPEILVLDEPSANLDPVARRELAETLRAIRATMVIVTHDLPYAA
QLCERAVIVDAGVVVADGPIGELLADAALLAAHRLELPWGFAMPRPS
108799031YP_639228.1 hypothetical protein Mmcs_2064 [Mycobacterium sp. MCS]MTRLFWIACAAVTLVVAGALSYAASASPDGLDATTLRGCEVVETAEGESL
TGDCIARHADEHALADSPLADYTVGGRSGTNGVAGVVGVVVTAAAGSALF
WFIARGRRSRR
108799029YP_639226.1 ArsR family transcriptional regulator [Mycobacterium sp. MCS]MSAVEQPGDHSQVERATSALADVDTSGWTQRFDLLSDPHRLEILLSLHRA
PGICVSDLAAALGRSENAVSQALRVLRQQGWVSSTRVGRAVSYRLDDEVV
HDLLHWIGARHG
108799027YP_639224.1 short chain dehydrogenase [Mycobacterium sp. MCS]MDLTQRLKGKVAVITGGASGIGLATAKRMRAEGATIVIGDIDPATGKTVA
DDLNGTFVQVDVSDQVAVDALFDTAAEEHGSVDIAFNNAGISPPEDDLIE
VTGIDAWDRVQDINLKSVFFCCKAALRHMVPAQKGSIINTASFVAVNGSA
TSQISYTASKGGVLAMSRELGIQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPMGRFAEPAELAAAVAFLASDDASFITGSTFLVDGGIT
GHYVTPL
108799025YP_639222.1 peptidase C26 [Mycobacterium sp. MCS]MSGSDFSPVLGMTTYLQQAQTGVWDVHASFLPAIYFQGVNLAGGVAVLLP
PQPVDSGAAARVLDGLDGLILTGGKDVDPARYGQTPRPTTDEPDRIRDAW
EFALLDEALRRGVPVLGICRGAQILNVALGGTLHQHLPDVIGHTHHQKGN
AVFGTSAVWTEPGTRLADLIGATSDAQCYHHQAIDRVGDGLIVSARDDDG
VIEAVELDRERHPDRWVVAVQWHPEERLDDLRLFAAVVAAANRYAMERVR
T
108799023YP_639220.1 amino acid permease-associated protein [Mycobacterium sp. MCS]MADDRLKSSGATYSQAGEGYFEKRQLKRTAGFWGLWGIGVAAVISGDFSG
WNFGIGEAGWGGLAVASVLIVITYFGMLFSIGEMSAAMPHTGGAYSFARA
SMGPWGGFITGFAETIEYVFTTAVVVFFSASYADAVTSELFGLSMPGWVW
WLILYAIFVGLNSWGAALSFKFALVVAIISIGILVLFGVLAIANGAVDFS
RLFDIAPDPAAAGSSDFLPFGWVAVLYALPFAMWFFLGIEELPLAAEEAH
DPARDIPKAGIWGLISLVGCGAIVFFLNPAVTGSEALGASDEPLLDGFRA
FLPGSLAAVLSAFALIGLLASLQGIMYAYGRNLYSLSRAGYYPKVLSLTG
SRQTPYIALILGAVIGFVALVVVSLNEGAGDVVLNIAVWGAVLAYMLQMI
SFVLLRRNFPNARRPWVSPTGNAGAIVALVIAAITFVGVLVNPTYRPAVI
AIVVFYVIGLLVFGFYGRHRLVLSPEEEYAVTGGLHGYDPEAEGLGGTIE
DEILKGHTD
108799021YP_639218.1 N-acetyltransferase GCN5 [Mycobacterium sp. MCS]MTDLGSHLDPDSDHTEAITLGLHDASPQHLVDRMADDVVLELGWGRLIFG
QTFADPEKLAKVLQHEGPGRRDICIYARESHVLVARSPSELFIDPSHTYR
LRFTEGEETPDPTPTGFTVRSLREPSDADAMNRVYVQCGMVPAPTDVIWE
NHNQVDAVDYLVAVRDDDGSVVGTVTGVDHKLLFDDPEDGSSLWTLAVDP
TSSLPGVGAALTRALARLFRGRGRSYMDLSVAHNNTAAIALYEKLGFQRV
PVLAVKRKNAINEPLFTHSPETVDDLNPYARIIADEAIRRGIWVEVLDAG
AGEMRLSHGGRSVITRESLSEFTSAVAMARCDDKRQTRRIVSEAGITVPK
GRLATFDEKDHEFLAEVGDVVVKPTRGEQGKGITVGVEGPEELDAALARA
REQHPEVLIEQRAPGDDLRLVVIDGKVVAGALRMPAEIVGTGKHTIRELI
ETQSRRRAAATGGESQIPMDKVTEGTVKEAGWSLDDVLPEGERLRVRRTA
NLHQGGTIHDVTAEVNPELCRVAVAAAEAIGIPVTGIDLLVPDVTGVDYV
FIEANERPGLANHEPQPTAAAFVDFLFPMQPGLPQAWTPEETPA
108799019YP_639216.1 hypothetical protein Mmcs_2052 [Mycobacterium sp. MCS]MTGWRAVPWALLLLGALTGCATTVTGNPTWPGARLETVILTEADFPPGVQ
YDRIVDEPGPGGTAGGPPPMLSRPQGCSDGLTRVIERGAQRGPGSAAKYV
AAYDGARVVMTVLTWRLDMDALAATAERCAEFETFFDPTDAGIPMTTTRI
DSVRPDALVYRQTMTLAGVDSSVYFGFENIGTMAVFGIAFPTPNPEIPAK
GTLPQTFLDVATRQADRIAAG
108799017YP_639214.1 methionine aminopeptidase [Mycobacterium sp. MCS]MSVRTALRPGELSPTLPVPKSIARPEYAWRPTVAEGSEPWVQTPEVIEKM
RVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYMVDHGAYPSTLGYKGF
PKSCCTSLNEVICHGIPDSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAG
DVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIEAYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPSVETVIEPGMTFTIEPMINLGGLDYEI
WDDGWTVATKDRKWTAQFEHTLVVTDTGAEILTQL
108799015YP_639212.1 hypothetical protein Mmcs_2048 [Mycobacterium sp. MCS]MTTPAHNPAHDGEARPEPMPMRISDADRNGTLRRLHNAVALGLIDIEEFE
ERSALVSQARLRSDLDALVTDLPGPGAIVTSATDRVELRGVFGSLKRHGE
WIVPTRLALHRRMGSIDLDLTRARFAGPIVVIELDLKFGGLDLRLPDGAS
ASIDDVEVIVGSATDHRRDVPAEGRPHVVLTGKVVWGSVDIRGPQTGWLR
RPRFLGERG
108799013YP_639210.1 hypothetical protein Mmcs_2046 [Mycobacterium sp. MCS]MTYADHDRRIDRREIADALMRALERRHEVLDVIVASEDYDAAIEEVAALL
GTSAAGGEAVLRLSFDRLTKVSRRRIAAELEDLNNQLSFTMGEQSSRPVE
RVVLRPFSAAEDRDVFAARTADVRAAGDGSGAPAGALDDEISAAVGRVNA
EEAVWLVATVGADKIGMVFGELSGGEVNVRIWIHPEHRKRGYGTATLRAS
RSEMAAYFPAVPLVVRAPAAGA
108799011YP_639208.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Mycobacterium spMTSGPAIGLGMPPAPPPVLAPRRKTRQLMVRDVGVGSDHPISVQSMCTTK
THDINSTLQQIAELTASGCDIVRVACPRQEDADALPIIAKKSKIPVIADI
HFQPKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGDAGIPIRIGV
NAGSLDKRFLQKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPV
VMVAAYELLAARSDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTI
RVSLSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANE
VTAGLEGMDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVI
KTVPEAQIVETLIEEAMRIAEEIGAAGDSPEGSPSGSPVVTVS
108799009YP_639206.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. MCSMGTRLRVLILGSTGSIGTQALDVIAANPDRFEVVGLAAGGANPELLARQR
AATGVHAIAVTDPAAAEKIGDVTYSGPDAVTRLVENTQADVVLNALVGAL
GLEPTLAALATGARLALANKESLVAGGPLVLRAAAPGQIVPVDSEHSAMA
QCLRGGSADEVATLVLTASGGPFLGWSAEDLQSVTPEQAGKHPTWSMGPM
NTLNSATLVNKGLELIETHLLFGIDYDRIEVVVHPQSIVHSMATFTDGST
LAQASPPDMKLPIALALGWPDRIPGAALACDFTTASTWEFLPLDDDVFPA
VRLAREAGRRGGSLTAVYNAANEEAAAAFLDGRIRFPQIVESVAEVLRAA
DQWAAEPATVEEVLDAQRWARDRAGRAVEHAATPPSKGLVTR
108799007YP_639204.1 beta-Ig-H3/fasciclin [Mycobacterium sp. MCS]MNININRVLGAGFAAVAAAGLSLGVAATAQAQPATGLVGPGCTAYAQQVP
QGPGSVAGMAMDPVATAASNNPLLTTLTKAVSGQLNPQVNLVETLNGGEF
TVFAPTDEAFAKIDPATIERLKTDAPLLTSILTYHVVPGQAGPDAVVGTH
KTVQGADVNVTHGAELKVNDASVVCGGVKTANATVYLIDTVLMPPAN
108799005YP_639202.1 deoxyribodipyrimidine photo-lyase type I [Mycobacterium sp. MCS]MPTLLWFRRDLRLHDLPALVDAAQGDGQVLACYVLDPRLHRSAGPRRLQY
LHDALRDLRDQLDGRLLVTRGRPEQRIPALAKSIDASAVYVSGDFTPFGR
RRDDAVRKALGEVPLQPSGSPYLVSPGRVTKGDGTPYKVFSPFFDAWRRH
GWRAPAQSGPDSATWIDPADLTGRDLRTEIPDDGATLDIPAGERAAAQHW
RAFVADELDGYADNRNRPDLDVTSRMSAHLKFGTIHPRTMVDDLGRGKGA
QAYLRELAFRDFYAAVLHEWPRSVWWNWNTGFDGIRVDEGAVAEQRFDAW
KRGRTGFPIVDAGMRQLAGIGWMHNRVRMIVASFLVKDLHLPWQWGARWF
LEQLVDGDMANNQHGWQWTAGCGTDAAPFFRVFNPSTQGAKFDPDGTYVR
RWVPELKGVADVHKMGDDRPADYPAPIVDHAAERAEALRRYAEIS
108799003YP_639200.1 hypothetical protein Mmcs_2036 [Mycobacterium sp. MCS]MVTQSLPLDDPNGAARTASAPGPHLEYRLDVLGTDAADLVRYAGGWMFDR
ALAGWRVNAWLLDADDLRPLQVLGVQGHRLEPGARRTDDEHTAGLAVSAN
LAESDADVRAAVRGVLTSGHTEVVLWGGRRPELLGGRAEPVRYRLSAAAR
TFKRHALLAADCREIPVEACESLVCGGYRPVDSDLVRR
108799001YP_639198.1 hypothetical protein Mmcs_2034 [Mycobacterium sp. MCS]MLYSETPEIHMHTLKVGILDVSGVSGGYSRELVRSVAAPRLQALRPLRQQ
LVEIPGRLHHPMWVENQTIDLDYHLRHLEIAAPGGRRELDELIGRIASTP
LDRSKPLWEMYVVEGLVGDRVAIVHKVHHVLADGVASANQMSQAISPRGP
QVDDGDPGPHPGHTSRRLLRAAGEDHLRQIGRLPALVRDTAAGVSQVYRK
GRERDTNPDLARNFAPPRSFLNHVVTPARRFATAPLALADAKHLARTLGV
TLNDIVLATASGALRELLLRYDGHADAPLIAGVPIAFNTSPDRLSGNEFS
YMTPSLPVHVDDPLERVRLTSVSTRIAKENHHLLGPTLIASWLNYLPPRL
VPPVFRHQARRRDSSMIMNLTISNVPGPRELGLVAGASVDEIYSVGPLVV
GSGMNITVWSYVDQLSISVLTDDQTLDDPHEATDAMVRSFAEIRTAAGIT
APLTDVPAALPLAAAARS
108798999YP_639196.1 luciferase-like protein [Mycobacterium sp. MCS]MSMHFTITHPMHTHPYNPELVTGDGVAAVAVAAEAAGFTGFGFTDHPAPT
QRWLDAGGHDALDPFVAMGYAAARTSTLRLIPNIVVLPYRNPFVVAKSGA
TLDLLSGGRFTLAVGVGYLKREFAALGVDFDERADLFTEALSVIRAVWTS
DEFSFEGRHFTAKGITAHPRPVSTPHPPIWIGGNTAAARARAVAFGDGWC
PFPAPAVLAQTARTAALDSVERLGEAIDDLRRRCDAAGRDPATVDVTFTN
LGGGDPGGADFDPDRYLEGVAALERLGVTWIQVTVPGDSLAHACETIEEF
GRRVIAQR
108798997YP_639194.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MDFSVVELSGEDRAFQRELREFLSTVVTDEVLARDRETGENFDEGVHLAL
GEAGYLAADYRSEADGGFSAVRRRIWELEIGRAHTPWFHWGTTAMVAHTV
ERFASSELADEVLPGVLSGRLRLCLGYTEPEGGSDVATCKTRAVREADGS
TWIINGSKMFTSNAHNAHYVFLITNTDPAAPKHKSLTMFLDPLDSPGVEI
QPLRTVDGDRTNITYYSDVRISDRYRVGDVNAGWSVLRGALDVEHGTVER
DAEGLQKIAVMTEHITLMADAVDAIAAALATPDAAGRRPLDDTSVAYRLG
RGIARMEAAMSTPEMFGRVAIAQTMRDVSPDLMDILGAAGALPVDAAGAA
AGGGAEYVFRLAGPTGIYGGTLEVFRNMIAQHALGLGRPHYSAPR
108798995YP_639192.1 alpha/beta hydrolase [Mycobacterium sp. MCS]MTVSDVAARLDPALLRFAAARTDLSADTLPAVRQSLDGRRAEAAATVDTT
GVEIDDRTARFGHASIGVRIYRGGPSPAPAVVYCHSGAFVLGNLDTDHRQ
CVEFARRAECTVVSVDYRLAPEHRYPAAVDDALTGLRWVVANAVELQVDP
SRVAVAGSSAGGALAALLAQASAAGTAPPVVFQLLHQPVLDDRPTPSQRE
FATTAGFDGPAVEQMWRHYLPPGTEPAGIAPARRADLTGLPPAFVSCSEL
DPLRDEALDYARRLVGAGVATELHLYPGTCHGFDSLLPDWEISRQLFDLQ
GTALRRALHQ
108798993YP_639190.1 hypothetical protein Mmcs_2025 [Mycobacterium sp. MCS]MIRIPSPPTSRRIQGVMGALMLIVGAAGTVAPQRLSNTRNSGAGAAERNH
LTQMYAMREAAIGAILLSGGGARSALGAVIGLTAVEVATGVRSPALDRQS
RITTAVTASVFGAAAAYALSGAGPHRGRPQKGH
108798991YP_639188.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MNRVALVTGAARGQGAAIVARLHADGYRVTACDVLIDELRTAVADLGDDV
LAIELDVTSAQQWAAAVADTVERFGALTALVNNAGVLHRAPIADETPAAF
ENSWRVNCLGPFLGIQAVLEHLKAADGAAIVNTCSTGAIRPFPHHAAYGS
AKWALRGLTQVTAAELAVDGIRVNAVFPGPVETPMLDPDTQTRLAARAVL
GRIGKPVEIADAVAFLLSDQASFITGSELVVDGGQTLQIG
108798989YP_639186.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MWAYRLVAPYTFEKLDLPAPSVEGLRDGQVLLRFLSAGICGSDLPGFRGA
KGRLPSDTGVSAAEMNGFPIHEVVGEVAGSRHPAHRRGDLVVGWASGFDG
LMEFVVADGDGLAAYDPALPPHHAVALQPLACVLYAVEQLPDLRGHHVAV
IGQGSIGLLFSYLAKAAGAQHVTGVDPVDRTAVGPAFGVDTVVRATSDRW
VSHLGTDRPDVVIEAVGHQVATLNHAIEAVAFGGTVFYFGVADDDAYPIS
MRLMLRNNLTLKSGVTLERRRMLAAADEFARAHPDLLPAYVTHTFDVDDV
QAAFELACRPTPGRVKIAITR
108798987YP_639184.1 hypothetical protein Mmcs_2019 [Mycobacterium sp. MCS]MSRSLGATVNHLRRWRAMKKYYSHTLLYLHETISLGSGRSETFLPAFSAV
YHPMMADLGARLFAIWESTPYNGHWPAVTVIWEIDAFADYARIGKAQRAG
GTHAEAAAEWSRFLAEMGASGEGRIMYAGRSNRTLAELQDAGFGAGLVIQ
EIMQTKPGRQDDYIRELERLYVPWSERTGKRWLGSFITTFRFNEVIHYWA
LDGEWDCFAEHYPSWKDTPPAEIVTWMSVAPALRDGWEDSILQALPPSPL
Q
108798985YP_639182.1 hypothetical protein Mmcs_2017 [Mycobacterium sp. MCS]MSDSYYELVGEDSRGERFVATDLVRSTWSAAIQHAAPVSALLVRALERCE
HRDDTRLSRVMVDLLGPVPAEGDLWVSAQRERAGKQIELVSAQMAAPGPD
GSPRPVARASGWRLQTLDTTGVAHAGAPALPPLAEARGRDMAKDWDRNYV
HSLDWRWLTRPLNDGPGESWITPTVDLVKGETMTPLERLFAVADDANGIG
TKLDPRQWTFLNTDLVVHVHRIPDGRWIGIRAETSYGPDGIGTTTGTLFD
QTGPVGAIQQSVLVRPRPPR
108798983YP_639180.1 putative ferredoxin [Mycobacterium sp. MCS]MRVEVDLAKCTGHGICESIAEDVFEVQDDGTVTIHGPERPAADRDRMRQA
VTQCPAAALRLTD
108798981YP_639178.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTSVTGDGNRTRERILAATAEVLGRNGMTKLSLSQVAAQARVSRPTLYRW
FPSKQDLLSAFVVWERSLYERAVAEAAANLPADQRLDAALRIIVEYQQSY
PGLRMVDIEPAQVIAGLAHILPRMRDRLERGMSGPDAAVAASTAVRVAIS
HYLVRSDDGEDFLAQLRHAAGLT
108798979YP_639176.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MTKTFSMSPAVGLAAHLGRGVQRVATDAVLRGLRPFPRSVGDLDARTLSG
LMERTVTSVSILGGDAGTSSRARLALTGRDVPDTVFVKLPAETAATRLMG
ELGRLGDTEVRFYRQLRPELDGAPAAYASAFDRLTGRYVLVLEDLPADDC
LFPDTLHPLDRDQAALVVELLARLHARFWGRLSAPGQPGPFDWVYTPSAD
HTSMLTGTLLKTSARRIAQNSDIPVQYGSFIDENYRAAARLIDEPPHTIM
HGDAHPGNLYFRNGAAGLLDWQAVRRGHPSRELAYTLVTSLTPADRQDAQ
RDLLDVYRRALAAAGGPDLDREELWHRYRQAALYAYVAALITAGMGGMQN
EDIAYEGLRRGVAALQDLDTVAVLKKSL
108798977YP_639174.1 formate dehydrogenase [Mycobacterium sp. MCS]MCGLIATVDDGRLVSLRPDPDHPLSQGRACPKGIAFTDIQNDPDRVLEPL
RRRADGTFEAVSWDEALDDIAARLTTILDRDGGDAVGQYFGNPAAFGYAS
SLWAGVFMARIGARHLYSAGSQDINSRFVASKLLYGAASQLPFPDLLRTE
FLLMVGANPLVSHGSAVRAPRIKNDLADIVRRGGRVVVVDPRRTETAREY
EHLAIRPDGDAWLLLSMLQVIFAEGLEDTTAMAEQSTGGETLRRLCREHT
PERTAERTGIPGDIVRMLARDFATAPSATAYGRTGACLGRHGTLVSFLLD
ALTLVTGNLDRPGGSLMSRAVIPVEEMGERLGSFSYDTMRSRIGNHPDVL
GTFPAAVMADEITTPGPGQLRALFVVAGNPVLSVPNGKALESALPQLDLF
VSLDLYVNETNRLADYILPGTTMLERDDLPIMFAACSPTLFVQSTEAVLE
PYGQARQEWQVYAELARRMGISLFATGPLERFNRVLAQLDRFRATRMTPR
RMMALLLRFGPYGDRFGLRRGGLNLDRLRARPHGIVLDEHAPSGILDTVV
RHRDGKVRLDPPEIVAEVGRLGARSHDDPRFPLLAIGIREMRSQNSWMHN
SPTLMKGDRRHRTRIHPDDARAAGLVDGGPVRIVAADGAVESEVLVTDEM
RPGTIAIPQGWGHRGGGWTLANSVPGANVNELTSNRSADLEALAGMSVLN
GVPVRIEAVGTAAAG
108798975YP_639172.1 hypothetical protein Mmcs_2007 [Mycobacterium sp. MCS]MTGAADELEIARLLYRYARAVDSKDWELYRSVFTDDAHIDYSSAGAVVGH
RDEVVDWFAANFGVLPWSMHYITNIESDVDGDSATVRAMFYNPMQLPGMD
EVSACGGYYHHELVRTADGWRSRSLREENVWFTNAPARTG
108798973YP_639170.1 phosphatidate cytidylyltransferase [Mycobacterium sp. MCS]MSETPVDEPQKKPSRAGRNLPAAIAVGVALGGGLIAILLFAPYLWLALVA
AAVAVSTYEVSSRLTEAGYRMPMIPLLVGGQATLWLTWPFGPAGALGGFA
ATVVVCMIWRLVGQGLKHTPQNYSRDIAAAVFLATWVPLFASFGALLIYP
EDGANRVFCLMLGVVFSDIGGYVAGVLFGKHTMAPAISPKKSWEGLVGSL
LFGGTAAVLAVVYLLDKPWYAGVALGVMLVITGTLGDLVESQFKRDLGIK
DMSNLLPGHGGMMDRMDGMLPSAVATWIVLTLLA
108798971YP_639168.1 uridylate kinase [Mycobacterium sp. MCS]MSEPNSDHGAGAAVGETRPLYSRVLLKLGGEMFGGGAVGLDPDVVHLVAR
QIAEVVRSGVQVAVVIGGGNFFRGAQLQQRGMERTRSDYMGMLGTVMNSL
ALQDFLEKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMG
LPYFSTDTTAAQRALEIGAEVVLMAKAVDGVYTADPRKDPDAQLLTAITH
REVIDRGLAVADATAFSLCMDNGMPILVFNLLVDGNIARAVAGEKIGTLV
TT
108798969YP_639166.1 glycerate kinase [Mycobacterium sp. MCS]MKIVLAPDSFKESMSAAQAIAAMRDGVRAALPDAECVGVPMADGGEGTVD
AVVDALDGERVTVEVADALGRPVPATYGYVPGRRLAVIEMAAAAGLELIP
ADERDVLRASTFGVGQLMAYALDRGAAEFLIGLGGSATNDGGAGLLTALG
VELLDGSDAPLPPGGGALADLHRIDTAGLDPRLAGVHIQLACDVTAPLLG
PAGASAVFGPQKGATPADVARLEAALARFAAVADAAHAETPGAGAAGGLG
FALLEFLGATSRPGVEVVAETVGLEQALRGAAWVFTGEGGVDAQTLMGKT
PFGVAQVAARTGTRVVIFAGRVGADASVLLEHGVDEIVGITAPGTPLAEA
LRTGPHSLARAVENFLRRL
108798967YP_639164.1 amino acid permease-associated protein [Mycobacterium sp. MCS]MTAELEASPPPGRDALMTTELVPEQILPKVMSTFGLTAAYVFIICWVTGS
SVMAAGGWTAIPMWVLGILTFLIPAGMAVVELGNLWPGQGGVYIWAYRTM
GETWGFIGGYLSWVPVILNAASSPAVVLQFLLLAFHAELGLTISIILQLV
ILWTVIGLALAKLAANQRIMNIVFVVYGVLTLTIFICGLLYAGKNGSATP
FSWEEATIPNFAVAGFLYGTVLLYLLGVETPYNMGAEFLSVRRSGPRMIL
WGSTALVAIYLLTTLGTMMALPGDEIDPVTGIIGMLDVAGFPGLMEVCAV
VLAFIIIVALMTYQVAYSRLIFVSGLERHLPRIFTHLNPRTRNPVTAILI
QGVISSLILVGLYSQSSMANVTIYLQGGLSTVWLLSGFFFLFPVIIARRK
YADRYVNEQFWRIPGGMVGVWITVVVGTLGTIGGIYYSFVTPWIDVPAAT
WMTWVGGISLGMFALGLVVYIFGRRSAHKMTQDDALAHLAVLDLNKSDTS
PEGV
108798965YP_639162.1 hypothetical protein Mmcs_1997 [Mycobacterium sp. MCS]MREEERTIVLRRGLSYGWLSTRRRIRELVLPIVTTATGAFLVVIVFGMSE
GIRAQSASLGHADEINRAVVLIAVSVLLVGVVEVAVATTRTVAHRTRELG
VLGANGIPRLPVVAALLVEPLVAAVIGALAGAALAAVAGIVLGGTGLAAG
GVAASGLLTGAATAVGVSVVAALATSIPPTWAAASRPPIRSLTAGG
108798963YP_639160.1 amidase [Mycobacterium sp. MCS]MTRISAFTDDALGDLDAVGIVEALQQGRVSRAELVEAAIARTEAVDPALN
GVAYEAFDRARARAGGPGSYGGFFDGVPTYVKDNVAVGDMPTMQGTDAWD
PRPAGAHGDFARAYLATGLLALGKTRLSEFGFSASAEHPRLGAVRNPWDT
DHTAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASCNGLVGLKPSRGR
LPLDRDMRQMPLRIVANGVVTRSVRDTAAFYREMERVYRNPKLPPIGDVT
APGRQRLRIAVCTHSIAREAGREVREETMRTAALLEDLGHRVTPIDNPIP
GHFMDDFLLYWAFLSFALVRGGRRTFGASFDRTRLDNLTLGLESHAARNL
HRLPVAIARLARTRRISARLAREYDVVLTPTLAESPPRIGHLDPTADYRQ
IIDRLVDWVAFTPLQNATGDPAISLPLGVSDRGLPIGMMFASTVGREARL
LELAYELEQARPWRRIQDAS
108798961YP_639158.1 30S ribosomal protein S2 [Mycobacterium sp. MCS]MAVVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DKAYEFVKETVAHGGSIMFVGTKKQAQESIAEEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMQKVPSAIWVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDVVDYPI
PGNDDAIRSAALLTKVVASAVAEGLQARAGGGNGNKPEAEAAEPLAEWEQ
ELLAGATASPTAAGAAPGTPEADIQTEPTAPQNP
108798959YP_639156.1 hypothetical protein Mmcs_1991 [Mycobacterium sp. MCS]MKSVALVVVGVLVALAGGLFALQGFGFVGGSPMSGTTTWSIAGPVIALVG
IGLVYLGWRAGKSRPQ
108798957YP_639154.1 FMN-dependent alpha-hydroxy acid dehydrogenase [Mycobacterium sp. MCS]MAFGDYQLEIYLQGLSGIMPKLPMTFADWEAKAQSAMPPSVYSYVAGGAG
DERTQRVNRTAFDNWGLVPRMFRATRERDLSVDLFGLSLPAPVFMAPIGV
IGICAQDGHGDLATARAAARTGVPMVVSTLTEDPLEDVAAEFGETPGFFQ
LYTPTDRELAASLVQRAEAAGYKGIIVTLDTWVPGWRPRDLSTSNFPQLR
GRCLANYTSDPVFRAGLAQPPEENPQGAVLKWVSLFGNPLTWDDLPWLRS
LTKLPVILKGICHADDARRAKDEGVDGIYCSNHGGRQANGGLPAIDCLPG
VVEAADGLPVLFDSGIRSGSDIVKALALGATAVGIGRPYAYGLALGGVDG
VVHVLRSLLAEADLTMAVDGYPTLADLTPDTLRRVG
108798955YP_639152.1 DNA processing protein DprA [Mycobacterium sp. MCS]MNTIETRAWAYLSRVAEPPCPELAALVTDVGPVEAAEKIRRAEVGERLRR
KTEARREHGCAQADLDVLARMGGRLVTAFDDEWPLLNFLKFTGVDTQKRP
QGHPPLVLWAVGPVGMDEVAERAAAIVGTRAATAYGEHVAADLAAGLAMR
DVAVVSGGAFGIDGAAHRATLAGEGVTVAVVAGGIDVPYPAGHSALLARI
RANGLVLSEYPPGSRPTRSRFLTRNRLVAALSGATVVVEAGARSGAANTA
AWAGALGRNVCAVPGPVTSGASVGCHRLLRDGGAILVTRAEEIIELVGRM
GELPPVEAGPATPLDGLTDAERRIYDALPKRGARSADEVAVAAGIPAYQV
VGPLAMLEVAGLVVHEGGRWRMARGR
108798953YP_639150.1 hypothetical protein Mmcs_1985 [Mycobacterium sp. MCS]MPSVSVWVRSLAPMTTWTRAAIGALGEDLAVKHLDSLGMRVLERNWRCRY
GELDVIAEDPAARAVVFVEVKTRTTDHFGGVAEAVTPQKVRRLRRLAGLW
LAGRDERWAAVRIDVIGVRIGRQATPEITHLTGVA
108798951YP_639148.1 hypothetical protein Mmcs_1983 [Mycobacterium sp. MCS]MSTRPGYGGGTGGGSAGVNGAVNKATNSDAFEYTARAGFAASGVLHLLVG
YIILQIALGSGGNADQSGALATLAGQTGGKIVLWIATIGLIALGLWRLAE
AFIGAKPGEQYGQAQGDNPAWKRAKSVGLAIANFAIAFSALQFATGGGQS
SGQQNSGISAQLMQHGWGKALLILVGLGVIAVGGYHVYKGATKKFLKDLR
VTGGTGINAVGVAGYVAKGLVLAGAGILVIVATLQADPAKASGLDAAVKT
LGQAPFGKFLLIVAAVGIAAFGAYSFVRSRYGRL
108798949YP_639146.1 binding-protein-dependent transport system inner membrane protein [MycMVAAAPPVPPPATPVARSDKNARPGPLVSGTVAILVAATLVPLGYVVWGA
VSIGWDRAYELVVRPRVGELLLNTVALVAVTVPLCVVIGVGVAWLVERTD
LPGRAFWRPLFVAPLAVPAFVNSYAWVGVIPSLHGLWAGVLVTTLSYFPF
MYLPAAATLRRLDPAVEESARALGSHSTGVFFRVVLPQLRLAILGGALLI
AVHLLAEFGAFAMVRFDTFTVAIFQQFQVTFDGAAGSMLAGVLVLLCLTL
LVAEAAARGNARYARIGSGAQRAATPVHLGANIIPAQLTLAALAVLALGV
PVWTILRWLHIGGAEVWAFDDIGEALGQTVALAGIAAVLTTVLAFPVAWV
AVRSSGFLARAVEGANYVTSSLPGIVTALALVTVTIHVVRPLYQSVALIV
FAYVLLFMPRALVNVRAGLAQVPTGLEEASRSLGRSPTVTFLRVTLRLTA
PAAAAGASMVFVAVATELTATLLLAPTGTRTLSMLFWSYASELDYAAAAP
YALVLVLLAVPVTMILLKQSTKGAAQ
108798947YP_639144.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSRLVDCLRAHGDRIAVLTDSERLSYRDLADLVSGSAARLGDTRRLVMLE
TRNDLPTLVHYLGALAGGHVVLPVPAGRDHRELTATYDPDVVVDGCGPQI
RREGSAHRLHDDLALLLSTSGSTGSPKLVRLSRRNLLSNAHAIADYLDIR
ETDRAATTLPMSYCYGLSVVHSHLLRGAALVLTEHSVVDDEFWTLFRRHG
GTTFAGVPYTFDLLDRAGFDTMDLPHLRYVTQAGGRLAPERVKRYAELGA
ARGWQLIVMYGATEATARMAYLPPDLAAEHPGCIGVPIPGGSFTIEPLDG
WPADDAAGELVYRGDNVMMGYAHTAADLSRGDEVEALHTGDIARRRPDGL
YEVIGRSSRFVKMYGLRIDLQRLETALRARGVPALCTDLDDRLVVAATAP
QRPAEVARLAAEAAGVPSSAVHAVVVADLPVLPTGKPDYPAVRALAAPVD
DAPPTTDLTTVFAEVLHLDRDGIDPDASFVDLGGNSLTYVAMSVRLERAL
GRLPADWQRVPLRDLQTRAVPPRRRWTATLETSVALRAVAIVLIVGSHAA
LFELWGGAHVLLGIAGYNFGRFCLTPAPRAQRVRHLRTTIAWIAVPSVVW
VVIALLVTDDYHLSNLLLANKFLGPHDSMTAGRLWFVEVLVWTLVALAVL
MAVPAADRAERRWPFLFAVVFLAAGLALRYDILGLDLGRDAWFTMLTFWF
FAAGWAAAKATAPWQRVAVTTALVVGLYGYFGNTNREILVLAGFLLLIWL
PALRCPPGLTVIAGVVAEASLYTYLTHFQVYALFEGRPALGVAASIAVGV
LLTQALTLLRRRLRDRRPSVSAATAVPARR
108798945YP_639142.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMPATDPVRPLAGVRIVEISSFVAVPLAGMTLTQLGAEVIRVDPVGGAADY
RRWPVTDAGDSIYWAGLNKGKRSVAVDMRTAEGQELVTRLIVDAGILITN
VAGRQWHSYDTLAAQRPDLIHVEVSGRADGGTAVDYTVNAATGFPLVTGP
PELATPVNHVLPAWDVSCGLYAALAVTTALRHRDASGDGARISIPLENVA
LATAGNLAFLTEAMVTGESRPRVGNSLYGTYGQNFVSCDGAAFMVVALTN
RHFRDLTELTGTAKAVAALGDALGADFTDEGERYRHRDALTGLFTVWFSA
HTADEVASALSGTSVLWERYRSFAEVAGDDRVTTNPLFTELDQPRVGRYL
APGLPIAIDGTYPPAVAAPALGDDTAAVLAEWLGMPSDEIAHLAESGSVA
TGSGGA
108798943YP_639140.1 HAD family hydrolase [Mycobacterium sp. MCS]MRSNTRCWLTDMDGVLVREEHALPGAAEFLARLVERERPFLVLTNNSIFT
PRDLAARLARSGLIVPEEAIWTSALATATFLSDQLPGGSAYVIGEAGLTT
ALHEAGYTLTDVGPDFVVLGETRTYSFEAITKAVRLILGGARFIATNPDV
TGPSAEGPLPATGSVAAMITKATGREPYFVGKPNPMMFRSALNRIEAHSE
GTVMVGDRMDTDVVAGIEAGLETILVLTGSTTIEDVERYPFRPSRVLPSI
AEAIDLV
108798941YP_639138.1 hypothetical protein Mmcs_1973 [Mycobacterium sp. MCS]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMVPRN
ANGEVYFELRLADAWVWDMYRPARFVKQVRVITFKDVNIEEVEKPELRLP
E
108798939YP_639136.1 signal peptidase I [Mycobacterium sp. MCS]MTDRPESSSEDAVGSVDPGLEQDAEPHADDQDETPGRKHSALRELAILVT
IAIVLYYVMLTFVARPYLIPSESMEPTLHGCPGCVGDRIMVDKVTYRFSE
PEPGDVIVFKGPPNWNIGYKSIRSDNPAIRLLQNTLSVVGFVPPDENDLV
KRVIAVGGQTVECRAATGLTVDGKRLEEPYLDPKTMMADPAVYPCLGNEF
GPVTVPEDKLWVMGDNRTHSADSRAHCTNLPGDAQRGLLCTGDPEAGTIP
VENVIGKARFIAWPPGRWGGVGSVNPQTAADPNQ
108798937YP_639134.1 hypothetical protein Mmcs_1969 [Mycobacterium sp. MCS]MRRPSVLLTATAASVVAAVVVSGCEARVYGTPPAPDGPHLTVVAPQGALA
PLPEAPPDQPPAAFTGLDDRARMATEEAAEAGADITLVVEDRNTGQIVSN
GNNRGIAIASVVKLFIADDLLLSGKPLSPEDVKNFQSMLRSSDDSAAEVF
WNRGGGSDIVTRVAQRYGLSGTRPPGDGRWWNTISTAADLVRYYDMLLSG
AGGLPRDKAGMIIANLAASTPDGIDGTQPGGVYPQRFGIPEGLYAVPVAV
KQGWMCCVGSDWMHLSTGVIGADRRYIVVIGSDQPAGAAEARATITQAVK
TLFPGGRI
108798935YP_639132.1 16S rRNA-processing protein RimM [Mycobacterium sp. MCS]MDLVIGRVAKAHGVTGELVVEVRTDDPDARFVPGARLRGRAPRGGAERAF
VVESVRPHGGRLLLRLDGVADRTAADALRGTVFLVDSADLPPIEEPDEYY
DHQLEGLLVRTVDGVDVGTVAEVLHTAAGELLSVKTPEGAEILVPFVTAI
VPRVSLADGLVEIDPPEGLLDLE
108798933YP_639130.1 30S ribosomal protein S16 [Mycobacterium sp. MCS]MDRCPPATPAARWSHTRGKTGSGNPPARRIAAWQPLRRIATPMAVKIKLT
RLGKIRNPQYRIVVADARTRRDGRSIEVIGRYHPKEEPSLIELNSERAQY
WLGVGAQPTEPVLQLLKITGDWQKFKGLPGAEGTLKVKEPKPSKLDLFNA
ALAEAEGGPSNEATQPKKKKAPAKKAASDIEATADPAGNADKSEPAAEGE
DATVAGATEG
108798931YP_639128.1 hypothetical protein Mmcs_1963 [Mycobacterium sp. MCS]MFNRAMLSLAEISDRLEIQQLMVDYSSAIDQRRFDDLDRVFTPDAYIDYR
ATGGVDGSYPEVKKWLAEVLPNFPAYSHLVGNFDVRVSGDTATSRAICFN
PMVMGEQVYFVGIWYVDEFVRTAEGWRMTRRVEEKCFDKLV
108798929YP_639126.1 peptidase S11- D-alanyl-D-alanine carboxypeptidase 1 [Mycobacterium spMTMSSVGVVTRTPAALAQPQPAGAVALPEGPAQAWLLADLDSGRVLASRN
PYEPHAPASTIKVLLAMVVLDHLSPDNFARANRSHTEVECSCVGLTPGQP
YTTRQLLSALLMVSGNDAANMLADMLGGQRAAVAAMNRKAALVGAKSTRA
SSPSGLDGPGWESITTPHDLAVMLRAALKYPLIAQIMRSPTAPFPGKTLT
NQNELLSRYPGDIAGKTGFTNLARKTYVGAAQRGNRRLAVVQMYGTGDLY
GQAIGLFDYGFSQP
108798927YP_639124.1 signal recognition particle subunit FFH/SRP54 (srp54) [Mycobacterium sMFESLSDRLTGALQGLRNKGRLTDADIDATAREIRLALLEADVSLPVVRA
FVARIKERAKGAEVSAALNPAQQVVKIVNEELIGILGGETRPLVFAKTPP
TVIMLAGLQGSGKTTLAGKLAKWLRGQGHTPLLVACDLQRPGAVNQLQIV
GERAGVSVFAPHPGTAPGAPEVKGTADPVAVAAAGLAEAKAKHFDVVVVD
TAGRLGIDEELMNQAAAIRDAVDPDEVLFVLDAMIGQDAVTTAEAFREGV
GFTGVVLTKLDGDARGGAALSVREVTGVPILFASSGEKLEDFDVFHPDRM
ASRILGMGDVLSLIEAAEQHFDAEQAEATAAKIGSGELTLEDFLEQMLAI
RKMGPIGNLLGMLPGAGQMKDALAAVDDSQLDRVQAIIRGMTPAERADPK
IINASRRLRIANGSGVSVSEVNQLVDRFFEARKMMSQMAGQMGMPFGRGK
NTRKNAKGKGKKGKKAGRGPTPPKNRNPLGAGMPGMPAGFPDLSNMPKGL
DELPPGLADFDLSKLKFPKN
108798925YP_639122.1 nitrogen regulatory protein P-II [Mycobacterium sp. MCS]MKLITAIVKPFTLEDVKTGLEQTGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVIVDDSAVDKVVDVIVQAARTGKIGDGKVWVSPVDTVV
RVRTGERGADAL
108798923YP_639120.1 signal recognition particle-docking protein FtsY [Mycobacterium sp. MCMTLDLSLAVWIAIAVIAVLLVVALVVGLVRYRRRRIRLSKTDTATPVDRS
GGYTASSGITFTQSSATATPPAAPPVRPKDRIDTSGLPAVGDDATIPRDA
PKRPIADVRLPEPPTETAPPRAPERPVAEPEPAPEPEPTPEPIPEPEPAP
EPEPEPAEVIAPTHGRLDRLRGRLAKSQNALGRSMLGLLGGGDLDEESWE
EIEDTLLIADLGPVVTESVVAALRTRMASDAVRTEADARAVLRDVLISEL
HPEMDRSIRALPHADKPSVLLVVGVNGTGKTTTVGKLARVLVADGRRVVL
GAADTFRAAAADQLQTWASRVGAEVVRGPEGADPASVAFDAVSKGIENGA
DVVAIDTAGRLHTKTGLMDELGKVKRVVEKRAAVDEVLLVLDATIGQNSL
PQARVFAEVVKITGVVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPD
DLAPFEPGAFVDALLG
108798921YP_639118.1 condensin subunit Smc [Mycobacterium sp. MCS]MHLKSLTLKGFKSFAAPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
HSAKTLRGGKMEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYSEVSI
TRRMFRDGGSEYEINGSHCRLMDVQELLSDSGIGREMHVIVGQGKLSEIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMQANLARLTDLTTELRR
QLKPLGRQAEMARRAQTIQADLRDARLRLAADDLVTRRSEFDSTHQTETM
LRREHDEITTRLEAATAELDGHEVAVAELSEHAEAAQRTWFRLSALAERV
NATVRIADERTQLLDTEPEPSTGRDPDELEAEADHTAAHEAELLAELAES
RAVLEATRDELAERERVAAEAERAHMAAARAEADRREGLARLAGQVDTMR
TRVESIDETVARLTVGIEEAAAKAEAAQAEFETVQSRVGELDEGEVGLDE
HHDRTVAALRQADERVAELQTAERAAERQVASLRARIDALAVGLDRRDGA
AWLQQNRGGAGLFGSIAELVKVRPGHEVAVAAVLGAAADALAAEDSGAAR
AAVAALKESDGGRAALVLGDWPETPAGDLPALPAGAVWAVDVVDIPPRLR
GAVTAMLSDVAIVGDLAAALDVVTGRPGLRAATADGDLVGAGWISGGSDR
KPSTLEIASEIDKARTDLEAAEKQVGELAAALSGAQAEQRARQDAAEHAL
AALNESDAAISSIYEQLGRLGQDARAAAEEYQRLIRQRDELEAGRTRTVE
ELTELETRLHNAQQAPMFEAEPVDRQASMAAAEAARAAEVEARLSVRTAE
ERANAVRGRADSLRRAAAAEREARVRAQRAKQAREHAAAVAGAVAESGRQ
VAVRLSAVVAAASRNRDTLAAERRQRAEALSKAREEVNELGTRLTALTDS
LHRDEVAKAQAALRIEQLEATVLEQFGMAPADLIAEYGPHIALPPTDLEM
AEYEQAKERGEQVVAPAPMPYDRGTQERRAKLAEKELKELGRVNPLALEE
FAALEERYNFLSTQLEDVKAARKDLLDVIADVDDRILQVFTEAYADVERE
FTQVFATLFPGGEGRLLLTDPDDMLTTGIEVEARPPGKKIKRLSLLSGGE
KSLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLISLFEQLRERSQ
LIVITHQKATMEVADALYGVTMQGDGITQVISQRLRGQELVGTQS
108798919YP_639116.1 OsmC-like protein [Mycobacterium sp. MCS]MGAMTDLWVERTGVRRYTGRSSRGAEVLVGSEDVEGVFTPGELMKIALAA
CSGMSSDQPLRRRLGDDYPATIRVAGPADREQERYPLLEESLEIDLTGLS
DAEVARLLTVVERAIDQVCTVGRTLKSGTKVTFEVKNVGRA
108798917YP_639114.1 ribonuclease III [Mycobacterium sp. MCS]MTLDRSPLLAALGVTLPDDLLTIALTHRSYSYEHGGLPTNERLEFLGDSV
LGLTITEELFHRHPDRSEGDLAKLRASIVNTGALADVGRKLSDDGLGSYL
LLGKGEESSGGADKSSILADGVESLLGAIYVQHGLTVTREVILRLFAGLL
DTAPTLGAGLDWKSSLQELTAARGLGAPHYVVTSTGPDHDKEFTATVLVT
DIEYGRGVGRTKKEAELKAAAAAWTALSATDVDA
108798915YP_639112.1 hypothetical protein Mmcs_1947 [Mycobacterium sp. MCS]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDSMLRDAKEHSESMVTNARAEAESMVNHARAEADRLLADAK
AQADRMVGEARQHSERMVGEAREEASRVMATAKREYDASTGRAKSEADRL
IESGNLAYEKAVQEGIKEQQRLVSQTEIVSTATAEATRLIDTAHAEADRL
RGECDIYVDSKLAEFEDFLNGTLRSVGRGRHQLRTAAGTHDYAAR
108798913YP_639110.1 phosphopantetheine adenylyltransferase [Mycobacterium sp. MCS]MTPDLDRVRSSPMSGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAVLVN
PNKKGMFTLDERMEMIAESCAHLPNLRVESGQGLVVDFVRARGYSAIVKG
LRSSTDFEYELQMAQMNKHVAGVDTFFIASAPSYSFVSSSLAKEVATLGG
DVSALLPDAVNVRLQAKLRG
108798911YP_639108.1 pyruvate carboxylase [Mycobacterium sp. MCS]MISKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQ
IGEMGHPVRAYLSVDEIIRVAKHAGADAVYPGYGFLSENPELAAACAEAG
ITFIGPRAELLELTGNKSRAIEAARAAGLPVLRSSAPSSSVDELVAAAAD
MEFPVFVKAVSGGGGRGMRRVTDPDALAEAIEAASREAESAFGDPMVYLE
QAVVNPRHIEVQILADRQGDIMHLFERDCSVQRRHQKVIELAPAPNLDPE
LRRRICADAVAFAREIGYSYAGTVEFLLDERGRHVFIEMNPRIQVEHTVT
EEITDVDLVASQMRIADGETLADLGLSQEKLAAPRGFAMQCRITTEDPAN
GFRPDTGRITGYRSPGGAGIRLDGGTVLGAEISAHFDSMLVKLTCRGRDF
STAVSRARRALAEFRVRGVSTNIPFLQAVVNDPDFRAGRVTTSFIDERPY
LLTSRTPADRGTKILNYLADVTVNQPHGPRPSTVYPQDKLPQIDHTTPPP
AGSKQKLVELGPEGFARWMRDSPAVGLTDTTFRDAHQSLLATRIRTTGLL
MVAPHIARMTPELLSLECWGGATYDVALRFLKEDPWERLAALREAVPNIC
LQMLLRGRNTVGYTPYPETVTTAFVEEATATGIDIYRIFDALNNVESMRP
AIDAVRQTGTAVAEVAMSYTGDLSNPAENLYTLDYYLRLAEQIVEAGAHV
LAIKDMAGLLRPQAAAKLVGALRSRFDLPVHVHTHDTPGGQLATYLAAWQ
AGASAVDGAAAPLAGTTSQPALSSIVAAAAHTEYDTGVSLEAVCELEPYW
EALRKVYAPFDVAASGPPTPTGRVYRHEIPGGQLSNLRQQAIALGLGDRF
EEIEEAYAAADRILGRLVKVTPSSKVVGDLALALVGAGITADEFAEDPAR
FDIPDSVIGFLRGELGDPPGGWPEPLRSKALAGRAPAKPVEELSAEDEAV
LAQPGVKRQAALNRLLFPGPTKEFEAHRETYGDTSRLSANQFFYGLRHGD
EHRVVLERGVELLIGLEAVSDPDERGMRTVMCILNGQLRPVLVRDHSVAS
DVPTAEKADRANPDHIAAPFAGVVTVGVEVGDTVSAGETIATIEAMKMEA
AITAPKAGTVERVAVSATAQVEGGDLLVVVS
108798909YP_639106.1 hypothetical protein Mmcs_1941 [Mycobacterium sp. MCS]MATKPKKTPRYDLKAADRKRNLFVQIGLTAVVVVFAVALVLYIVMSAEDK
PGSGEATAVRVAAENVVTQEGTSEPKAVLSLYEDFLCPACGNFERQFGPT
INKLIDTGAVAADYYMVSILDAQGDGYSSRAGSAAYCVADENKDAFRRFH
AALYTEGIQPAEGGGTYPGDEQLTELARQAGAGGTVPECIKKGRYVDMVK
GMASATEIRATPTVRINGEDYDPSTPDALVAKIKEIVGDVPGLDGAAPAP
TS
108798907YP_639104.1 aldo/keto reductase [Mycobacterium sp. MCS]MYLVTKLWNSEQGYDATLAAFEASVDRLGVDYLDLYLIHWPVPEKNLFVD
TFKAFARLREDGRIRSIGVSNFEPEHLRVLIDSTGIVPAVNQIELHPLLP
QRELRELHAQLGIATEAWSPLGQGSLLAHPTVTGVAESHGKTAAQALIRW
HMQLGNIVIPKSVNPQRIESNFDVFDFELSEQDMASISSLEDGSRLGPDP
KTFNFTG
108798905YP_639102.1 hypothetical protein Mmcs_1937 [Mycobacterium sp. MCS]MNRSRSVWVVLAAVLALLVAYQTVSSTAERSAQFIADADVPTVAPGVDVL
AGVATVPARIRGHDYRRAAFGDAWTDDNSAPGGHNGCDTRNDILDRDLVD
KTYVSISRCPTAVATGVLHDPYTNIVISFTRGNQTGAAVQIEHIVPLAYA
WDQGARAWTDEMRVRFANDPANLLAVQGEANQDKGDQEPALWMPPNTAFH
CQYAMQFIAVLRGYGLPVDAPSVPALRRAADSCPRG
108798903YP_639100.1 Dak phosphatase [Mycobacterium sp. MCS]MAAGRLDATVLRDWAHAAVEDLISHTDEINGLNVFPVPDADTGTNMLFTM
RSAWSRAQDCVGDVAEVSAALAAGALHGARGNSGVILSQILRGFAEVTAG
AAARGGGTLPEVDGALFAAALRHAVDLVEAALDTQPGTIVSVLGAAAHAA
DAQASGTAASGLPEVVVAAADAAAIALDETPGQLDVLADAGVVDAGGRGL
LVLLDALTRTLGGHAPRRPSYRPAAPPARRAAGAAPQFEVMYLLGGCDAD
GVEVLRRRLEGLGDSIVIAAAGGSGIPGQYSVHVHSDDAGGAVEAGLAVG
VPTRIQITALAATATTRPQGSWSRERAVLAVVDGPGAAELFAGEGAHVLL
AEPDAPVTAKQLLRGLVDTGAGQVMVLPNGYVAAEELVAGCTAATGWGID
VVPVPAGSMVQGLAALAVHDPARHAVDDGYTMARAAAAARHGAVRVATEE
ALTWAGACRPGDGLGISGDEVLIVGPDVTAAASGLIDLLLLSGGELVTVL
TGHGADGAVGTDIGAALREHVHHRHLGTELVTYHTGHRGDVLLIGVE
108798901YP_639098.1 uracil-DNA glycosylase [Mycobacterium sp. MCS]MTARALSELVDQGWAQALEPVREQVAQMGEFLRAELAAGHRYLPAGANVL
RAFSFPFDQVRVLIVGQDPYPTPGHAVGLSFSVDPEVRPLPRSLANIFTE
YTADLGYPQPSNGDLSPWAQRGVLLLNRVLTVRPGTPASHRGKGWEAVTE
CAIRALVARDTPMVAVLWGRDAATLKPMLTGSACVAIESPHPSPLSASRG
FFGSRPFSRANELLTQMGAEPIDWRLP
108798899YP_639096.1 AsnC family transcriptional regulator [Mycobacterium sp. MCS]MLIQTEVGRAEVVAARLAELPGVRTAEYVTGPYDVVVRVGADNLEELRSG
VVPSVQRVDGITRTLTCPIANGAHP
108798897YP_639094.1 D-alanyl-alanine synthetase A [Mycobacterium sp. MCS]MIARNQRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFDVVAVGITPD
GSWVLTDGRPETLAITDGRLPEVSAESGTALALPADPGRRGELVSLSPAA
AGEVLAAVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDK
EFTKKLLVAEGLPVGDHVVLRPGRANVTLDERERLGLPVFVKPARGGSSI
GVSRVSDWAELPAAIEAARRHDPKVIVEAGIAGRELECGVLEYPDGRVDA
STIGEIRVAGVRGREDGFYDFATKYLDDGAELDVPAKVEDDVADEIRRLA
IRAFRAIDCQGLARVDFFLTDDGPVVNEINTMPGFTTISMYPRMWAASGV
DYPTLLAAMVDTAVARGTGLR
108798895YP_639092.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Mycobacterium spMVKAAVMGSGAWGTALAKVLADAGNSVTLWARRPEVAAEINDTHRNSGYL
DEVDLPKTIHATADAAEALAGACTVVFAVPAQSLRSNLEQWKGLIADDAT
LVSLAKGIELDTLMRMSQVIVQVTGADPARVAVVTGPNLASEIADEQPAA
TVVACSDSGRAVALQRALATGYLRPYTNADVVGAEIGGACKNVIALACGM
AVGVGLGENTVAAIITRGLAEIMRLGIALGAKPATLAGLAGVGDLVATCT
SVQSRNRTFGERLGRGGTMESALRAAGGHVAEGVTSCRSVLALAASYDVE
MPLTDAVNRVCHKGLSVDEAVVLLLGRSTKPE
108798893YP_639090.1 polyphosphate kinase [Mycobacterium sp. MCS]MNISHTRWQDDAAMGEDRAMTEAEAAIRAEGTAESTERTPGDSTPEAPPA
ATSPAIDNALPEDRYLNRELSWLDFNARVLALAADPSLPLLERAKFLAIF
ASNLDEFYMVRVAGLKRRDEMGLSVRSADGLSPREQLRRISERTQQIASR
HARVFLDAVRPALADEGIVIVTWSELDEAERAQLSTYFHEQVFPVLTPLA
VDPAHPFPFVSGLSLNLAITVRHPDDGGQHFARIKVPDNVDRFVRLGVRG
QTGEVVRFLPMEELIAAFLPVLFPGLEIVEHHAFRITRNADFEVEEDRDE
DLLQALERELARRRFGSPVRLEVSDDMTESMLELLLRELDVDPGDVVEVP
GLLDLSALWQIYAVDRPALKDRPFVPATPPAFGERETPKSIFSTLRDGDV
LVHHPYDSFSTTVQRFIEQAAADPNVLAIKQTLYRTSGDSPIVNALIDAA
EAGKQVVALVEIKARFDEQANIKWARALEQAGVHVVYGLIGLKTHCKTAL
VVRREGSMIRRYCHIGTGNYNPKTARLYEDVGLLTAAPDIGADLTDLFNS
LTGYSRKVAYRNLLVAPYGVRRGIIERIEREVAAARDGAEGRIRLKANAL
VDEQVIDALYRASQAGVRVEVVVRGICALRPGAPGFSDNIVVRSILGRFL
EHSRVIHFRAIDEYWIGSADMMHRNLDRRVEVMAQVKDPRLTTQLNDVFE
SAMDPATRCWELGPDGHWSASPREGETVRDHQVSMMHRHRQP
108798891YP_639088.1 nucleoid protein Hbs [Mycobacterium sp. MCS]MNKAELIDALTTKMGTDRRQATEAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAIVSGAQKLASEGP
AVKRGVAAGPAKRAAKKAPAKKTAAKKTTAAAKKTAPAKKSTAAAKKTAP
AKKTAAKKTTAAAKKTAPAKKSTAAAKKTAPAKKAATKAPAKKAAAKAPA
KKATAAKKTASKAPARKAPAKKGRK
108798889YP_639086.1 isopropylmalate isomerase large subunit [Mycobacterium sp. MCS]MAQPATPRTMAEKVWADHVVAHGIGEGAAREPDLIYIDLHLVHEVTSPQA
FDGLRLANRPVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
AEFGIRLHPMGDAEQGIVHIIGPQLGLTQPGMTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFRTMAVNVDGELPPGVSAKDIILAVIAK
IGTGGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMVAPDDTTF
EFLRGRPHAPTGADWDAAVEAWRQLRTDPGAEFDTEVHLDAAELSPFVTW
GTNPGQGVPLSGAVPDPELIVDEGERQAAEKALTYMGLQAGTAMRDVAVD
TVFVGSCTNGRIEDLRVVADVLRGRRVADGIRMLVVPGSMRVRAQAESEG
LDRIFIDAGAEWRQAGCSMCLGMNPDQLSPGQRCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSSPADLSAVPAR
108798887YP_639084.1 glutamyl-tRNA synthetase [Mycobacterium sp. MCS]MNDMAVRVRFCPSPTGTPHVGLIRTALFNWAYARHTGGTFVFRIEDTDSA
RDSEESYQAILDALNWLGLDYDEGPEIGGPYAPYRQSQRRDLYRDVIDRL
IAAGEAYEAYSTAEEVEARHLAAGRNPKLGYDNFDRDLTDEQRAAHRAEG
RNPVIRLRMPERDITWRDLVRGETTFGAGTMPDFALTRGNGEPLYTLVNP
VDDALMKITHVLRGEDLLPSTPRQIALYEALIRIGVADGVPEFAHLPSVL
GDGNKKLSKRDPQSNLFLHRDRGFIPEGLLNYLALLGWGIADDRDVFSLD
EMVAAFDVVDVNSNPARFDQKKADALNAEHIRLLSEDEFTARLKAYFAAH
GHDTGLDDAQFAEAARLVQTRIVVLGDAWGLLKFLDEGAFVLDEKAAAKE
LKADAVPVLDAALAGLEGVGQWTTGAIEEALKKALLEDLELKPRKAFGPI
RVAATGASVSPPLFESLELLGRDRSLARLRAGRDHAAAAA
108798885YP_639082.1 secretory lipase [Mycobacterium sp. MCS]MTLRTVGAVALLVGALTMPAPMAQASSPVPDWSGLDARIYTEDIPAPGTL
IRDVALAPQLSVRGAGAAYRILYATRDQHDAPAVSTAAVFLPHGEPPHGG
WPTVAWAHGTVGLGDDCTPSALPRSDRDNEYLTHWLDQGYAVVATDYAGL
GTPGLMSYLNSVSTARAVVDSVVAAHGFGLPLSPAWAIVGQSQGGAAAVS
SARWATEFSSGTGLDYRGVVATGTPAGIEQVVKRAAPDMALPPELGPAAN
SYAAYILAAFREARPDLDVDSVLSPQGLEAATLAETLCKPALDEALAGQT
PSEFLRAPLVSLPGAAQALEAYMGTPVSGYDRPIFLGVGLLDRDVPPSST
LSLYDQLGANGQDVTLRVYPDQDHSGTVLASLPDSTPFLRTALAGGADG
108798883YP_639080.1 MarR family transcriptional regulator [Mycobacterium sp. MCS]MQQSLRRRCDAALRETGLSMSQYAVLRALADHPQASAAELARLCFVTRQS
LQDVSTALRSAGLIDHAQVAARGRARALTLTTTGRRRLAAAHGAVTAVEA
QMLTGLSSAESRRLSGLLAACAANLEGE
108798881YP_639078.1 amidohydrolase [Mycobacterium sp. MCS]MKPLLLHHATLIDGTGAAPLPDAAVLVENDRIRWAGAASDAPTDDATPVD
LGGNTICPGFFDCHVHFSLPGAGATPIDRALNPPSYHYFQLIDRLRVTLH
NGVTTARDLMGIDAGVRDAVAHGLVDGPRLLVAINMMSQTCGHADFHLPS
GIDLTPMVGGSLVDTVDEARRRTRELIAAGADVIKVASSGGVSSPSDQPE
WLGMRRELIAAVVEEAAAYGHKRVAAHAIGRAGIEAAVEAGVSSVEHGYQ
LDEGLRHKMVEAGIFLVPTLLETMADVTSSPAGQAKSAHWHAVAQESIGA
SAAAGVKIAVGTDAGLSPAHGTNLKELGLLVRFGGLTPMQAIVAATSTSA
ELCGLAEQLGTVEAGKLADLVIVRGDPLADIDSVGEPDNILLVLKEGRAA
IDRAGFLTA
108798879YP_639076.1 3-isopropylmalate dehydrogenase [Mycobacterium sp. MCS]MNLAIIAGDGIGPEVIGEAVKVLDAVLPEVEKTTYDLGARRYHATGEILP
DSVLEELKVHDAILLGAIGDPSVPSGVLERGLLLRIRFALDHHINLRPAK
LYSGVTGPLAGNPEIDFVVVREGTEGPYTGTGGAIRVGTPHEVATEVSLN
TAFGVRRVVEDAFRRAQQRRKHLTLVHKNNVLTFAGALWWRTVQEVGAEY
PDVEIAYQHVDSAMIHIVTDPGRFDVIVTDNLFGDIVTDLAAAVCGGIGL
AASGNIDATRTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLAHVGE
TDAAARVDKAVEAHLSSRGDQELGTAAVGDRIVGLL
108798877YP_639074.1 hypothetical protein Mmcs_1909 [Mycobacterium sp. MCS]MIGAGRSAATGEVIGVDVTVVGSGPNGLAAAVICARAGLSVRVIEGQPTP
GGGARSAADPEFPDVLHDVCSAVHPLSVASPFFAEFDLAARGVDLISPEV
SYANPLPGRPAAVAYRSLDRTCAELDHGESWRRLFGPLVEHVDGVLGFFL
GDKRSLPPDLPTTVRTGLRVLAQGSPLWGSLRGEDARALFTGVGVHAIKA
IPSPVNSGAGLMLGTVAHTAGWPVPVGGTQRISDALIADLQAHGGELVLG
EPVTAPPAGVTLYDTAPTALLAIYGDAVPPRYARALRHYRYGPGVCKVDF
VLSGEIPWRDPRVRDAVTVHMGGSRAQMALAERDVAAGRHAEWPMVLASL
PHLADPSRIDAQGRRPLWTYAHVPSGSDADLTETVTAMFERAAPGFRDLV
VGARCVPAAQMSLHNANYVGGDIIVGGATLFAAMAGPTLRLDPWTTPIPG
AYLCSSATPPGTGVHGMAGYYAARTMLRREFGIEKLPSLAP
108798875YP_639072.1 acetolactate synthase 3 regulatory subunit [Mycobacterium sp. MCS]MATTGNVRTHTLSVLVEDKPGVLARVASLFSRRGFNIQSLAVGATEQKNM
SRMTIVVSVEEAPLEQITKQLNKLINVIKIVEQDEDNSVARELALIKVRA
DATTRGQVIEAVNLFRAKVVDVSTESLTVEATGTQEKLDALLRVLEPYGV
RELVQSGVVSLSRGPRGIGTVK
108798873YP_639070.1 low molecular weight protein antigen 6 (CFP-6) [Mycobacterium sp. MCS]MSSSDPSATTAPVVIRIPRTAHLAVGFFTLGLLSIVLANPRWFAVLLVIP
VVASVFIMRLRTVADRDTVTARNLLGSQTVSWDEIEGLRFSKANWARATR
KDGSEMRLPAVTFSNLPQLTAASGGRVPNPYR
108798871YP_639068.1 protein LppZ [Mycobacterium sp. MCS]MPGDRRGALRRRIRNLASMRTRRPLLGVAALLCATALFGSGCARFDGAQS
QPFTTEPELRPGPTSSEPPPPPLPAKPFPKACPAPGVMQGCLESTSGLIM
LPDSQSALVAERTTGAVKEVSVRAEPKVKTTIPVDPSGDGGLMDIVLSPT
YSQDRLMYAYVSTPTDNRVVRIADGDVPKPILTGIPKGATGNTGSLIFTS
PTTLLVQTGDAGNPGAAADPASQAGKVLRIEQPTTVNQAPTTTAMSGMGS
GGAMCIDPSDGALYVTDRTPTGDRLQKMTKDSKISTVWTWPDRPGVAGCA
ALDGTVLVNLVNTKQTVAVRQAPDTGAVTGQPEVIRQDTRGHAWALALSA
DGNVWGATVNKTAGDAERLDDVVFPLFPQGGGFPRSNADNT
108798869YP_639066.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MSELDLESLRTRLAAAGVCDVRPLTGGASSLTFRATRGDRPVVVKVAPPG
HAPVGHRDVLRQARIIEALAATDVPVPEVLCTDPGAPPEIPPLFVMSLVE
GESFEPLFDTDAAREDTDGARKDTVPERFRSAARVLAALHRTPPAGLGLT
GEPVGDAVAEVDRWSATLRTVDPALVPGWTAVREALVATAPAPVRPGVVH
GDYRLGNLVASGTAITAVIDWEIWSVGDPRIDLGWFLVNADPDTYRRPTP
YVDAVPPVAELASRYTDAVGAPMPELPWFMALACFKSAATWSLIVKHNRR
KSTPRAELEAMAPILPHLLERSTTLLG
108798867YP_639064.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. MCS]MTDTVTATTPSPGVVLLHLNRPDRLNAINSAMVADLAATLAAVRADTATR
AVVLTGTGRGFCSGLDVRDFGDGMLEADAPALDRMRFQEAMAALPQALRA
LPQPVVAAVNGPCVGAGMALCLAADIRICSSAATFGNAAILLGLSGAEMG
MSYHLPRIVGTSVAADWMLTGRTVSAGEADRRGLVSELVDPEVLVDRAVE
LAALVAGLSPFGVQLTKRALQVNTDAPALAAALELENRNQVLAHATDEAA
ARRQPWTAK
108798865YP_639062.1 hypothetical protein Mmcs_1897 [Mycobacterium sp. MCS]MSERLHAQDLLARAEAATGLYDYGDPTLPARFGIAVDHLNGQGMDAEGVQ
RAAQVCHWLLTSRLEFFADRDRYPIGDEVIERPMFVTGEPRSGTTLMHAL
MSVDPDARALRFWEVMYPSPPPGLAGPDDTRRTRADADWREINAKMPKWL
HSHPYNDMLGDGLPEDERTWAFDFRVMTPTAWWRVPMQTVVGGLPTDPAA
QYRIHQAMLQQCQYRRPPKRWVLKGFHGFRLTEFFAGYPDASLIWLHRDP
VQVAASRTMMMADILDGIVGPIDLKAAAKMHLDLTRASIANTMSHPLVDD
PRIQHVRYTDFVADPVGTVRAYYAFCGHALTEAAESAMRGYLAHNRGDRY
GKFRYSTSLLTDIGEDIDALNEEFRPFRERFGVAIEKRD
108798863YP_639060.1 hypothetical protein Mmcs_1895 [Mycobacterium sp. MCS]MAFGDGPDDTALDAAWAAFCDRLKAAGAQAFKDHNATSGAQRVDALRFLT
QNLGQAFDLALETADTRYPIVHAFCTPLRKLGGDSADFTYHQAWIDGTHT
YRLTGNRGGAPFFNITVQGPRGSGPGVLHEPFGDVPEVNLSGSQLATAAG
GDFELYIGGPERGPNWLPTTPGSRKLFIRQGFDRWDDRPAELRIERVDMA
APRPLPTPAEMVAAIDWAGDFVEGVMRDWPDYPFTYGGVDAAHPNRFPAV
DSDTGDDKRGRAAANMFWELGADEALIIEFDAHEGLWMLTNMGVFFNSMD
YLYRPVSYTPSRTVTDGDGRIRIVLAHDDPGCHNWLDTQGFSRGNVTYRH
MLAGKPAVLHTRLVARSDLADALPSDTATVTGEQRVAQMWARFNGIRRRH
RM
108798861YP_639058.1 cutinase [Mycobacterium sp. MCS]MKISRVWNIAIAAAAVGSGVAAGGVLSAPSAAAEPCPDVEVIFARGTTEA
PGVGWAGQEFVDALQSQMGGRSVQVHPVAYPASPDWPRAADGVIDTSNRV
REVVATCPDTKMVLGGYSQGAAVMGYVTADQIPPGYIPPAGITGPMAPEI
ADHVAAVVLFGKPSTRFLDAISAPPITIGSLYADKTLSQCIPDDPVCTAD
GANLFAHSQYGANGMIDQAATFAVDRLGDVEAQPKNSAASS
108798859YP_639056.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium sp. MMSSTELIREDAATLAGRIAAKEISSTELTQACLDQIAATDDRYHAFLHVA
GNRALAAAARVDAAVAEGERLPSPLAGVPVALKDVFTTTDMPTTCGSKIL
EGWRSPYDATVTFRLRAAGLPILGKTNMDEFAMGSSTENSAYGPTRNPWD
VDRVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYG
TVSRYGLIACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVPAEVP
DVVAAARAGASGDLNGVRVGVVKQLRGEGYQPGVLASFTAAVEQLTALGA
DVVEVDCPNFDHSLAAYYLILPSEVSSNLARFDAMRFGMRVGDDGTHSAE
EVMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIAGDLD
AAYEKVDVLVTPATPSTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMS
VPSGLSPDDNLPVGLQIMAPALADDRLYRVGAAYEAARGPLPTAL
108798857YP_639054.1 amino acid-binding protein [Mycobacterium sp. MCS]MVAVPSYLLRVQVEDRPGRLGALAVALGSVGADILSLDVVERVAGYAIDD
LVVDLPAGTMPDRLITAAESLTGVYVDTIRPHTGLLEAHRELELIDHIAA
AKGKAAKLQTLVDEAPRVLRVGWCTVVQDDGSGLQRVVGSHGAPETQAQS
APWLPLAHAEALDASADWVPQLWRDMDTTLAAAPLGDAGTAVVLGRPGGP
AFRPSEVARLGYLAGIVNTILR
108798855YP_639052.1 hemerythrin HHE cation binding protein [Mycobacterium sp. MCS]MRRFPRVAQKPITTGQDVVDYLEAQHEAIRQLFVETLDAADAETKREKFT
RLRTMLAVHETAEEMMVHPRVRRKIEGAGAVVDARLAEEHDSKIALSELE
KLDIDTADFTKGLIHLQAAVLEHAEKEEAEEFPLLTEHLEAEELERLAVA
VQVAERIAPTHPHAGVESATANFALGPFASLIDRARDALRGAA
108798853YP_639050.1 hypothetical protein Mmcs_1885 [Mycobacterium sp. MCS]MPFHQLAVAPADVDGAALGLALNAPAPVPLAGIRLSHRRGGALVLGVLGA
SHVVTIEHPAGGFSEEVSCSAHAYGRTLPGRFEGPGYRFESETTVCAATE
FETLAQRLHERCLTDRNSLGGRFPGDDAALTVLQARPDGPGWWWQTWHLY
PGGPRVPGGTAVHTTSRWHP
108798851YP_639048.1 hypothetical protein Mmcs_1883 [Mycobacterium sp. MCS]MAARAVRTVRSDTPMKEHPMYLAVEFGTISGESLAQNVVAAILYFVIGAL
VLAAGFGLMDLLTPGSLRHLVFVEYRPNAVAVACGMYSALAIVVVSAIIA
SSAELGQGLLDAAVYGIVGVLLQGVALVVLEVAVPGRFRDLIEADRLHPS
AIATSVVLLAVGGVNAAALS
108798849YP_639046.1 NAD-dependent DNA ligase LigA [Mycobacterium sp. MCS]MSAKSTPDAGPQEQATEAEAELRHRWQALADEVRDHQFRYYVRDAPVISD
ADFDKLFQQLEALEAEHPELRAPDSPTQLVGGAGFATDFTPAEHLERMLS
LDDVFNVDELTAWSSRVRAEVGDDAAYLCELKVDGLALALVYRDGRLERA
ATRGDGRVGEDVTLNARTLDDVPERLTPSDEFPHPAVLEVRGEVFFRVAD
FEALNAGLVAEGKPPFANPRNSAAGSLRQKNPAVTARRPLRMVCHGIGYT
EGFSPTSLHEAYGALRAWGLPVSDHTTRVQGMDAVRERIAYWGEHRHDIE
HEIDGVVVKLDQIALQRRLGATSRAPRWAVAYKYPPEEAQTKLLDIRVNV
GRTGRVTPFAYMEPVKVAGSTVGLATLHNASEVKRKGVLIGDTVVIRKAG
DVIPEVLGPVVDLRDGTEREFVMPTHCPECGTELAPAKEGDADIRCPNSR
TCPAQLRERVFHVAGRGAFDIEGLGYEAAIALLQAGVITDEGDLFTLTED
DLLRTELFTTKGGAVSANGRRLLANLGKAKAQPLWRVLVALSIRHVGPTA
ARALATEFGSLDAIIEASEDQLAAVEGVGPTIAAAVKEWFTVDWHCAIVE
KWRAAGVRMADERDASIARTLEGLSIVVTGSLAGFSRDEAKEAIIARGGK
AAGSVSKKTAYVVAGDSPGSKYDKAIDLGVPVLDEDGFRNLLENGPQAPE
G
108798847YP_639044.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSFASPYPAVQIPTTSVYDYLFSDLSDTDAQRVALIDTPSGNRMTYGEML
ARIDAFAGALADRGIGVGDVVGLLAPNSSAFAIAFHGILRAGATATTVNA
LFTAKDIANQLADSRATMLVTVTPLLAHAAEGAAAVGLADDRVIVLDGPG
AAADGHPNAADLLGPGFAPPEVSFDPATHLAVLPYSSGTTGNPKGVMLTH
RNLTANVAQIRPVQGMTADDRILAVLPFFHIYGMTVLLNAALHARAALVI
MPRFDLTEFLANIADHKCTYAFIAPPVAVALAKHPLIDEYDLSSLQGIMS
GAAPLDADLGHAVAERLGCAVVQGYGMSELSPVSHVTPFDGGVGLVGSAA
PLASSGWTVPNSESRITDPETGAEIDIPPSGMSATGELWFRGPNVMAGYL
NNDEATRETIDDEGWLHTGDLAQVDAQGCVYIVDRLKELIKYKGYQVPPA
ELEAVLLSHDAIADVAVVGVVDTESGEEVPKAFVVRRPDASLTEAEVMEF
VAGQVAPYKKVRKVEFIDAIPKSASGKILRKDLRH
108798845YP_639042.1 protein LpqA [Mycobacterium sp. MCS]MTAQATALMVSVAAVLTAGCVSVVGGTAVRSTPGLDDDSRSPVDVDTVLL
ETAQMQAITGAGEDLTIIPTMDGKIPVDIEPLMEQMPTPCQWLFAESQTF
GDEVEEFHKTTFQNPPDGGLISQGAAGYRDPETARRAFDGVVALVDGCGT
TNYGPAYIGEWTATADAVQTRPGDCGRDYRLKSTVLVEVTFCAFTEAVPD
IVMTNILAKVPG
108798843YP_639040.1 class V aminotransferase [Mycobacterium sp. MCS]MTSPKSVYLDHAATTPMHPAAIEAMTAVLTTVGNASSLHGAGRLARRRME
EARETLAGLLGARPSEIIFCAGGTESDNLAVKGIFWARRDAERRRNRIVT
TPIEHHAVLDAVQWLVEHEGAEVTWLPVQADGSVTAAALREVLQSCDDVA
LVSVMWANNEVGTVQPIAELAAVAAEFGVPMHSDAVQAVGQLPVDFAASG
LSAMSVTAHKFGGPTGIGALLLRRDTACVPLLHGGGQERDVRSGTADVAG
AVAMAAAARVAIDGLDAHRARVSALRDRLIEGVLATIDDVSFNGSRVDRL
PGNAHFTFRGCEGDSLLMLLDAKGIECSTGSACTAGVAQPSHVLIAMGAD
PASARGSLRLSLGHTSTDADVDAALEVLPAAVDRARQAALAASGVTD
108798841YP_639038.1 ornithine-acyl[acyl carrier protein] N-acyltransferase [Mycobacterium MSAASVLIAADIAADHPKAADTPRYSLLLSTDSDLIAAAQRLRHDVFTSE
PGFALTGALDGRDADRFDEYCDHLLVREETSGELVGCYRMLPPPGAIAAG
GLYTATEFDVRALDPLRPSLVEMGRAVVRHDHRNGGVVLLMWAGILAYLD
RCGYDYVTGCVSVPIAGADGEPAGTQVRGVRDFVRRRHAAPEHYTVYPYR
PVVVDGRGLDDIPPPVRAGVPPLMRGYLRLGAQVCGEPAHDPDFGVGDFP
ALLDKRHADTRYLRRLRSVSAATGSAS
108798839YP_639036.1 electron transfer flavoprotein subunit alpha [Mycobacterium sp. MCS]MAEVLVLVEHAEGALKKVTSELITAARALGEPSAVVVGKPGTAEPLVDGL
KAAGAAKIYVAESEDAENYLVTPQVDVLAALAEENSPAGVLLAASADGKE
IAGRLAARIGSGVLTDVIAVAEGGKATHSIFGGAYTVEAEVTGDTPVITV
RAGAIDAEPADGAGEVVNVEVPAQAETATKITKREPAVAGDRPELTEATV
VVSGGRGVGSAENFGIVEELADALGGAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIIAVNKDEEAPIFEISDLGIVG
DLFKVTPQLTEKVKARKG
108798837YP_639034.1 type 11 methyltransferase [Mycobacterium sp. MCS]MSAFVTGPRGGGDETLPLTGERTIPGLAEENYWFRRHEVVYARLADQCAG
RDVLEAGCGEGYGADLIAGVARRVIALDYDEATVAHVRARYPRVEIHHGN
LAALPLVDSSVDVVVNFQVIEHLWDQPQFVGECLRVLRPGGLLLMSTPNR
ITFSPGRDTPVNPFHTRELNAAELTELLTTAGFEMEAMLGVYHGPRLREL
DARHGGSIIDAQIARAVADAPWPQDLLDDVAAVRIDDFDLTSGEDIDDSL
DLVAIAVRP
108798835YP_639032.1 group 1 glycosyl transferase [Mycobacterium sp. MCS]MRILLVSWEYPPVVIGGLGRHVHHLATALAAAGHEVVVLSRRPADTDPST
HPTTDEVSEGVRVVAAAHDPHEFAFGPDMMAWTLAMGHAMIRAGLAIKDH
GRPWRPEVVHAHDWLVAHPAITLAEFFDVPLVSTMHATEAGRHSGWVAGP
ISRQVHAVESWLARESDSLITCSSSMREEITELFGPGLPEIRVIRNGIEA
QRWPFAQRRPRSGPAQLLYLGRLEYEKGVHDLIAALPRIRRTHPGTTLTI
AGDGTQLDWLIEQARRHKVRKAVSFAGRLDHDGLVDMLHTADAAVLPSHY
EPFGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGVSFPPRDVTGLAAAV
RTVLDDPAAAQRRAVAARDRLTSEFEWHTIAEETSQVYIAAKRREREPLP
RLPIVERALPDR
108798833YP_639030.1 HNH endonuclease [Mycobacterium sp. MCS]MWFERDGQLIGAGRTTRLINRRLRRALEHRDRTCVVPGCESTRGLHAHHI
QHWENGGTTDLDNLVLVCPYHHRLHHRGVITITGPASKLTVTDGTGRRLH
SGSLARQPNQPPPTVPPYRGPSGERADWWWYTPFQPPPQVAN
108798831YP_639028.1 hypothetical protein Mmcs_1863 [Mycobacterium sp. MCS]MFRRFLVLAVSALLVGASAGCGDASSWVEAKSAPGWPAQYGDAANSSFVA
ADGADSLTLEWSRSVKGDLGAAVALGTGGYLAANAQSPAGCSLMVWEAEN
DARQRWCSRLVQGGGGASPLLDGFDNLYVGQPGAILAFPRTQWIRWRKPV
IGAPTTPRIMAPGQLLVITHLGQVLVFDAHRGTVEGTPIDLVSGVDPRNS
ERGLADCRLSRPECPVAAAPAFSAAGAIVVLSLWEPGADKPVLVGLRYRP
GQTPLLAREWTSDAVEKGPLASPVISADGSTVYVNGRDERLWALDTADGA
AKWSVPLDYLPQTPPSVSPDGSIIAGGGPGAKLTAIRDSGDRGEVVWTRE
DVVPLTTSSRAGRLGYAVVEAPDGAQDLTVFDTADGRTVNSYPLPEATGW
PVGVSLGHDGSVVAATSDGQVYGFAPE
108798829YP_639026.1 immunogenic protein MPB64/MPT64 [Mycobacterium sp. MCS]MTRALSIAALLTATVLTGWTGTPVASAQTACADLGGALNSEQSCQVHAAA
AEYTVEFSFPAGYPDEQAVSAYLTQTRDGFVNVSEMPGARGLPYVLDAKG
TAYHSGLAPRGTQSLVLEVYQNVGGAHPQTWFKAFNYDLGARAPITFDTL
FRPGTRPLDVVYPAVQRDLQAKTGIDQPVLPADGLDPQNYQNFAVTDEAV
IFFFGQGELLPEAAGAIQASVPRAALAPILAV
108798827YP_639024.1 type 11 methyltransferase [Mycobacterium sp. MCS]MTSIDHTSTDLPASNPHATAEQVEAAMTDSKLAQVLYHDWEAETYDEKWS
ISYDQRCVDYARGRFDAAVPEEVQRELPYDRALELGCGTGFFLLNLIQAG
VARRGSVTDLSPGMVKVATRNGQSLGLDIDGRVADAEGIPYDDDTFDLVV
GHAVLHHIPDVELSLREVIRVLKPGGRFVFAGEPTTVGNRYARELSTLTW
RIATNVTKLPMLSDWRRPQTELDESSRAAALEAVVDLHTFDPADLERMAR
SAGAVDIRTASEEFTAAMLGWPVRTFEAAVPPGRLGWNWAKFAFGSWTTL
SWVDANVWRRIVPKGWFYNVMVTGVKPS
108798825YP_639022.1 NUDIX hydrolase [Mycobacterium sp. MCS]MTEPAQKSTPDPLVPRPAATVMLIRSARGVPETNEVFLMRRHAGMDFVAG
VMVFPGGGVDDRDRNADIAWAGPGPQWWAERLGVDEHLAEALVCAAARET
FEECGVLFAGAADDPDVLVDDASVYRESRLALANRSLSFADFLRTEKLVL
RADLLRPWANWVTPEEERTRRYDTYFFVGALPDGQLADGENTETDQAGWV
TPEEALRDFADGRSFLLPPTWTQLDALAGRTVAEVLAVERRIEPVQPTLA
AHNGNWEIEFFDSDRYNAARNHRAP
108798823YP_639020.1 hypothetical protein Mmcs_1855 [Mycobacterium sp. MCS]MAVRLTRASARAAVLLVGLLLYGFSMALMVRAGLGLDPWDVFHQGLARRT
GMTIGTATAVVGVAVLLAWIPLRNRPGVGTVANVVVIAVSVDASLAVLPG
ASTLPVQVAWMLTAVVLNALATVLYIGAGLGPGPRDGLMTGLVARTGRSV
RLVRTAIEATVLTAGWLLGGTVGVGTVVYAFGIGPLVQLFMRVGDFAARR
RGAPQVADDLEYGTMVGCPEKTRPRV
108798821YP_639018.1 phosphoserine phosphatase SerB [Mycobacterium sp. MCS]MTSPVGSSRKRSSLLITVTGVDQPGVTSALFEVLSRHRVELLNVEQVVIR
GRLTLGVLVAAAPEVADGDGLRTDVEEAIHDVGLDVTIERSADTPVMREP
STHTIVVLGRPITAEAFGVVAREVAALGVNIDTIRGVSDYPVTGLELRVS
VPAGAAYGQLQKAMARVAVAEGVDIALEDYSLSRRAKRLIVFDVDSTLIQ
GEVIEMLAARAGAEAAVAEVTEAAMRGELDFAESLHRRVATLAGLPASVL
DDVADQIELTAGARTTLRTLRRLGFHCGIVSGGFRQVIEPLAHELMMDFV
AANELEIVDGKLTGRVVGEVIDRPGKAKALRDFAQQAGVPMEQTVAVGDG
ANDIDMLSAAGLGVAFNAKPALREVADASLSHPYLDTVLFILGVTRGEIE
AADAVDGLLRRVEIPED
108798819YP_639016.1 periplasmic binding protein [Mycobacterium sp. MCS]MGTTVSATLVAALVAALAGCGSTDADPAASALMSSVITSTTSVAGAGVLG
NQRRPDESCAAGPAPVDPGPPEREVRHAAGETRVTADPRRIVVLSGDQLD
ALCALGLQSRIVAAALPDGRDEQPSYLGSVIHDVAPAGTRSAPDVDAIRA
AAPDLILGSQALTPELFDALGQIAPTVFTGPPGADWQANLRTVGAATGRF
DATGGLLDGFADAARRTGLDNDAAHYQVSVVQLTEDTVRVYGARNFAGSV
LAEVGLDRPAAQRFTDEPFVEIGTGDSPDYGIADADIVYVSFASAAAREN
AATILDSDAWRALSAAQDDRVYVVNNEVWQTGQGVVAARGVLSDLRWVNA
PIN
108798817YP_639014.1 hypothetical protein Mmcs_1849 [Mycobacterium sp. MCS]MTDVAVVMRECAGLWRRTLLIEADGSRDTGTDVLWLQGATAYVDSRGFAG
VLTQRPAQGGDVFEWRRDIDLQPPGEFPDAGLMRWDGDTLVEEGVYADYV
EHWVRDAGPAAPCWALSLTSGAGRAMLLRVGDRFGWAGGDLVLIGTVGDD
RWDALGIAMAGTRLRAGGVGWDVQRTEGEVEL
108798815YP_639012.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MIRRLKTVAALAAAAALTLSACGGSDSGGGAPSAAPTDKVLHLSFLQDPG
QPPDPDVFYAGQGLLLTTNVYEGLMQYKGGTEKAEIEPLLATEWTESPDH
RVFTFKLREGVTFHDGTPFTAEAVKASFDRRLAVDQGPAYMVADVESITT
QGDHAVTITLKAPNAAFLDYLACPYGPRMLSPKGLADNAGDDHAQNYLTT
HDLGTGPYTLTAAEVGSRYALAAYPGYWGEKPYFEQVEIPVITDVSAQQL
QFNNGQIAAILHDLPSSAVESYLNNDKYAHFSLPTMMSNYLYLNPRRGML
TDPKNRAAVLAAIDVDALVKQTYFGRGKKAEQLYPPNMIAPELAKQNVTH
DPSLLTEIAAGLPADQKAVTIGYDSSNPDNQLINNLIQTQLAAAGLNAKV
QSYPTSEIYGWIGNDAPNAPDILTGTAWPDAPSPYTWGHISWDADGGLNY
LGCSAPPVTSALARGLETGDPQVFSEAAKAAADTGCWLNIADVDDFVVAQ
PWLAGVEEAHVVTNPNSLRLFELSVA
108798813YP_639010.1 binding-protein-dependent transport systems inner membrane component [MRTFVTTRIAAMFAILVALTGVMFVLAHISPLDPVKAQLGAQASQAAVAA
RREALGLNEPMLVQFWNYLTGAVTGDLGTSYRTRHPVASDLGDFLPATLE
LAVFGMVIALVLAALLAFSTTLKWRGSAVLRAVLFTGSSAPMFLLGILGL
IVFYQQLGWVPANGRIGIANPPTGPTGLLTVDGLLHARFDVVGDALQHLI
LPAVVIAIGPAVAIGRVLRSSLLGDTDSDYARTARAKGLSEGRIMVGHVL
RNSIGAALSMTGLQIGLMFSGVLVVEQVFGWPGIGQYIAQSIPVADFPAI
AGVTLMLGALYVFINTMVDLLQAAADPRITVRGG
108798811YP_639008.1 oligopeptide/dipeptide ABC transporter ATP-binding protein-like proteiMGTAVSEADAPAAAPPTPDPVATVGDLAVKFRRNGRAIHALRGVSLAVAP
GEILGLVGESGSGKSVLGFSLLGLLPDNATVSGTVRVAGSDMVRGDPKAL
RKVRRLDLGAVFQDPMTSLNPTMRIGRQVAEAAGSDEEALRLLTAVGIPE
PARRMRAYPHELSGGLRQRVMIAIAIAGDPDLIVADEPTTALDVTVQAQV
LRLLRRLRDEIGCSIVLITHDLGVAAQISDRIAVLYAGRIAEIGPSAEVL
AAPAHPYTHGLLRSRLTLDTARDRPLAALAGSVPSPVTPLPGCAFVPRCA
LATDECTTAPPEPLAVAPGRVSACIRPQGEVAEHLGAAETNTDDAFPATT
ADRAEMPPSVVLRDVTKSFSVARRWFDRSADGDGKLHALRGVSLRVGHGE
SVALVGESGSGKSTLLRVIAGLEPPTSGFVDLAGGQRPQMVFQDAGASLT
PWLSVGELIAERLRGTGLSRARRRERVAEVLERVGLPAEVAKSRAGQLSG
GQRQRVSLARATVVPPSVLLCDEPTSALDVSLAASVLNLIGDLRRSLDMS
VVFVTHDLSVARVVADRIAVMYLGRIVEIGPADQVIAEPAHPYTQALVDS
IPDLGREPRSLAGEPASPLSPPTGCAFHPRCPLAIDACDDTGLDVRLEGF
PGNPHQVACIERKAG
108798809YP_639006.1 allophanate hydrolase [Mycobacterium sp. MCS]MTAVERVRAAYATIEAVARPEVWIFLRPFADALTDAEAVDSAVAAGADLP
LAGLTVAVKNNVDVAGLPTTAGCPGYATDPAEVDAPVVARLRASGAVVLG
ATNLDQFATGLVGTRSPHGAVRDARRPGHISGGSSSGSAVAVALGIADLA
IGTDTAGSGRVPAALQGIVGIKPTYGVVPTDGVVPACRSYDCVTVFARDL
DTADAAMGVMAGADPSAGVRARPFPPDAPLAAPAVPLVGVPRDLPGLSPA
WRQAFGEARSRLEGQGAAVREIDMRAFLEAARLLYDGGLVAERHEAVGDF
VDTHRDEVDPTVGAIIAAAGTVPATRLLRDRVRLAELTAAAMAELGDCDA
LLIPTTTDHPTIAEVEAEPIAVNSRLGTYTNFCNLLDMCAVAVPSGAADG
AQFGVSIVARAGADAVALDLARRVTSGSSDPVVSQAPWPVRAGLSATPLL
VVGAHLRDQPLAWQLEERGARWLGPAVTAPLYRLARLHTTPAKPGLVRVG
AESGTAIGGELWLVGTAMLGDFLAALPSPMMLGRVTLSDGTEVVGFGCAL
DAWQSGEDISSYGDWRNYLGSGQLSERV
108798807YP_639004.1 hypothetical protein Mmcs_1839 [Mycobacterium sp. MCS]MTTTSDTAEALVPGHTILDETVAARAPWSAVVAAGDVLTIVDLDGNQAVD
CLLYSAADTAIRYSAPETIARQGRIALTTGSVLRADTGAALMTVVADEVG
VHDTLGGACSKESNTLRYGQHTRAQHGCMENFLIEGARHGLDARDLASNI
NWFMNVPVDPDGALGIVDGLSGPGKRVALRADIDTLVLVSNCPQINNPCN
AFDPTPVRMIVTRP
108798805YP_639002.1 hypothetical protein Mmcs_1837 [Mycobacterium sp. MCS]MCLSCDRFSGPWTRSTTLRPVFHVLTLTYLQPLDVIDETRPDHLDWLARE
VESGRILLAGRVEAQTGAVLVTGDLSAEEADALAAADPYSKAGVVSYART
SFNGAFRAPGL
108798803YP_639000.1 putative esterase [Mycobacterium sp. MCS]MSFIQSFRRRLLAGALAALLLPGLIAVAGGTATAGAYSRPGLPVETLMVP
SAAMGRDIPVKFQGGGTKAVYLLDGLRARDDNSGWDIETAAFENYFESGL
SVVMPVGGMSSFYTNWQGPAVGNGQTYTYQWETFLTSELPAYLAANKGIS
PSGNAVVGLSMSGSSALILAAYHPGQFSYAGSLSGYLNLSDGLWPTLVGF
AMRDSGGFDATAMWGPGGGPAWKRNDPTVNVGKLVANGTRIWVYCGTGRP
GDLGGGGDIPGQLLEAITLDSNRQFQSEYRAAGGSNATFNFPANGTHGWG
YWGSQLNAMKGDIQRTLGV
108798801YP_638998.1 hypothetical protein Mmcs_1833 [Mycobacterium sp. MCS]MRRALLALTLAGILATAFELASERHWNGFEQLIPWIALAVLAVALGLACL
RSGTAQLLARAAAVLVMCASIYGVIDHATANHHAGPLDQRYADTWATMPA
TEQWWAAVTKSVGPAPTLAPGILAQTALLLVLAGLLQTRRPEDVAA
108798799YP_638996.1 hypothetical protein Mmcs_1831 [Mycobacterium sp. MCS]MIRQLIAASGALIAVVASPLAPTALADDGQVVMLQSGKVRCAVSADNMDR
GGGPMVVCELSNGQPWGMSPWETSKYNARLNLAIVRATGEHYWDRGRITG
SDASAAGGLSVNDGQTYNLYGWTIHSDGFRTRITNDATRHGLLVTEGYVR
QF
108798797YP_638994.1 hypothetical protein Mmcs_1829 [Mycobacterium sp. MCS]MRCMPLRYVDPHKRHSRRYRAIEAFSRSGPGQFLAHHLWSRVDPWLYRAT
GGRYPSVFGGPSTAPLMTTGAKSGQPREHQITYFHEGSDPIVTASNYGGP
RHPQWYYNLKAHPECELGDEKFVATEITDPQEYARVYGLAEQVYAGWSDY
RLKTEPIGRHIPVFRLKPR
108798795YP_638992.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MRRGSRARTGAEPGGKVDARSERWREHRKKVRSEIVDAAFRAIDGQGPDV
SLREIAEEAGTAKPKIYRHFTDKSDLFQAIGQRLRDMLWSAIFPSIDLSV
DSGREVIRRSVEQYVRLVDEHPNVIRFLIQGRFAEQSESTMRALNESREI
TLAMAELFDNELREIELDAAALELAAYAAFGSIASATDWWLGAEPDSPRR
MPSEEFVAHLTTIMIGSINGTCELLGIKLDPDLPLHEGVRRNEHVA
108798793YP_638990.1 agmatinase [Mycobacterium sp. MCS]MASSAFGPDITFLGVPRCDLSDASTYTDADIVILGAPLDGGTTYRSGARF
GPSALRQACYLPQDGSRPSLALRVDGLKDLRVYDAGDVALYSGNVEQAVQ
LIEEEVFTISAAGAIPIILGGDHTIAWPDHTGVARQHGFGKVSMIHFDAH
ADTGDIHAGSLVGHGTPMRRLIESGALRGDRFLQLGLRGYWPDEPVLQWM
AAQGLRSYEMTEIVARGLETCLTEAFEIATDDCGGVFLSVDIDVCDPGHA
PGTGTPEPGGFSARQLLDAVRRICYELPVLGVDVVEVAPPYDHADITALL
GNRVVLEVISAIARRRKDAAAGTTWDPSQPLLAGREVDEQMRLIAEGEDA
RRRGEGGGRPHHHHH
108798791YP_638988.1 extracellular solute-binding protein [Mycobacterium sp. MCS]MRCTPAVVTLAVTTLVLAATGCSGSSNSPTDTAALMSSVRTPLMSDPPPL
DPDVFYQPEGLLIMTSAYQGLLRYAPESTEVEGLLATEWTVSEDGLTYTF
TLRDGVKFSDGTPFDSAAAKASFQRRIDMAAGPSYMLADVRDMQTPDPQT
FVVTLTKPVAPFLDYLASPYGPLMTSPAAIAEHAVGDDRGAGWLAAHTAG
TGPYELTAAIPANRYTLTANEHYWGEAPQITTVELPVVAATAVQRMQLEN
GQLDMILHGLSKGDYEALGAGPDTEVRQETALVKALVMVDPDSEVFGPPA
ARAALSAALDQTTLTTTVFGDQGSPSTQFYPSGMLPDGAVPDTHDFDPAK
LAETGRSGGDVEIGYPTGDSSLQNLANQMQVILQQAGLTATVRDFPLAQF
FALGENPGQRPDLLLASFNPDAAHPDTWSRIYQYTDAPVNLQGCSVPAAD
ALLDAGSAEPDPAKSRALYVEAAKEYRDSLCWINLADLHNTIAARKGYSG
WSSQPAWMWDTDFSTLAYRD
108798789YP_638986.1 hypothetical protein Mmcs_1821 [Mycobacterium sp. MCS]MFADRRGVAELARGRAPNPRDASAATGGRHPVRRGVEAILWDDSWGRRPA
RMKDALRSAAYQLARVPRLVPVHSNCYLPAGHDSSGHPVLSIYQADIHVV
AADLFDYVDRLTTPAAEPSAVATVDFWSDHVR
108798787YP_638984.1 hypothetical protein Mmcs_1819 [Mycobacterium sp. MCS]MKPATAAKKLDVYLPATPAEFQENSITRAELAALQEDPPQWLKDLRKNGP
HPKNLVAAKLGISIAGLARGGVGDALTTEQINTLLEEKPEWLVAERESYQ
EVLREQRRLKALRADQAREG
108798785YP_638982.1 ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium sp. MLNLYDKDGKIQFDKDVLAAREYFLQHVNQNTVFFHNQDEKLDYLIQKDY
YEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKR
YLERFEDRVVMVALTLAAGDTTLAEKLVDEIIDGRFQPATPTFLNSGKKQ
RGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREHGAPI
KNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLD
TKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGVP
FADISVTEKYYEMVDDSRIRKTKIKAREFFQTLAELQFESGYPYIMYEDT
VNRSNPIEGKITHSNLCSEILQVSTPSEFNDDLSYAKVGKDISCNLGSLN
IAKAMDSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQ
MNLHGYLARERIFYGSDEGVDFTNIYFYTVLYHALRASNRIAIERGTHFK
GFERSKYASGEFFDKYTEQPWEPKTERVRQLFADAGIRIPNQDDWRRLKE
SVQQHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKIEIRKEGKIGRVY
YPAPYLTNDNLEYYQDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTA
TTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCVSCML
108798783YP_638980.1 ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [MyMSQPLITVYTKPACVQCNATYKALDKQGIDYEVVDISLDSEARDYVMALG
YLQAPVVVAGNDHWSGFRPDRIKALSGAVAATA
108798781YP_638978.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MSAPDRFAPLPVTDEPQERGDAARNRLLLLEAARRLIAERGAGAVSTDDI
AAAAGVGKGTLFRRFGSRAGLMVVLLDEDEKAQQQAFLFGPPPLGPGAPP
LERLLAYGRARHTFVHDHYALLSDAGRDPQTRFTGPFRLHHAHIRMLLQS
AGTTGDLDAQTAALTALLDADYIEHRLADGATLDEVADAWEVVAVKLCGR
108798779YP_638976.1 hypothetical protein Mmcs_1811 [Mycobacterium sp. MCS]MLQTVAIRGYRSLRDVVLPLRRLSVVTGANGSGKSSLYRALGLLADCGRG
EVIGSLAREGGLESVLWAGPEQVAGARRTGTTEGTVRTRPVSLELGYAAD
DVGYLVDLGLPQHAGPGSLFARDPQIKREAVFAGPVLRPAATLVRRGGQY
AEASAESGRGFDELTRSLPSYRSVLAEYTGAVPELTSVHDRLRNWRFYDG
FRVDATAPARHPQVGTRTPVLSADGSDLAAAVQTIIEAGFDDLPRAVSDA
FDGATLDVAVHDGLFDLRLRQRGMLRPLRCAELSDGTLRFLLWTAALLSP
EPPSLMVLNEPETSLHPDLVRPLAGLVTAAAARTQVVVVTHSPAMIDLLG
AVPLDEDGDAVRLALYKEFGETRVAGQGLLSTPPWDWGKR
108798777YP_638974.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MTAESATPEIRRSRGDRQRDAIVAAVRELLQEQPFADLSVSTISERAGVA
RSGFYFYFDSKYAVLAVIVADAMAELDKLTHDFAPRDADESPATFARRMV
GYAAAVFASNNPIMRATTLARNTDAQIREIMNDFEDTVIDKIVGLVRQDD
GARPISDDLPALVRTLTATTALTLSHDSGFVGRGADPARAVEVVERLWLY
ALWGGSDLRHT
108798775YP_638972.1 hypothetical protein Mmcs_1807 [Mycobacterium sp. MCS]MSTTSIIESPSPALTPTAGETAPYAWITRLPRGLRKEADDMTWDQFLDEY
APTTGPLRLGQWMCTDTERPAGRLGPQARNYQATLAFGDRISTATAAASG
PVAALTAMLHDQGIAVETVAFHQIPAGSHTATFIRGSDGTHTEWAMGFSQ
DATQSALRAVVACANRLLAA
108798773YP_638970.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MPDAAQQLPTLTDADVTALTQWARREGLGTTVTDVTPLAGGSQNVVVRLH
LDGRPMVLRRPPVHPRPTSDKTMQREIAVLRTLAGNPVPHPGFIAGCEDL
DVLGVVFYLMEEVDGFNPGNEVAEAYRHDPDMRHRVGLSYAASLAQLGNV
TWEGSELAAIKRPGSFLARQVPQFLRLLESYRHEHYSPDSLPAVRDLAEW
LEANRPADGQPGIMHGDAHLNNVLLRRETPELAAFIDWEMCTVGDPLLDL
GWMLICWPHDPNPIDAGSELAALGGLASRRDLLDAYVSAGGRRTDALSWY
LAMACFKLAVVIEGTWSRYLAGRATREAGERLHTSATNLIDLGMRVAKGD
DPFM
108798771YP_638968.1 HxlR family transcriptional regulator [Mycobacterium sp. MCS]MSGYGQFCPVAKAMEVLDERWTLLVVRELLLGSTHFNELRRGVPKMSPAL
LSKRLKSLIRAGVVERSEIDGRTTYSLTPCGKELTAVVDALGAWGVRWIG
ELGEADLDPHLLMWDMRRSIPLTEWPDGRTTLAFRLDGVEARASRWWLVV
ADGRADVCDFDPGYEVTATVSAGLRTLTAIWRGDISWQRALLDGGVSVSG
PAEVRRAVPGWIGQGSLAAVPRP
108798769YP_638966.1 molybdopterin binding oxidoreductase protein [Mycobacterium sp. MCS]MVGIPRTTRAWCGIAAAAVALGVTELTAALFGPEADARTAVGSAVIDATP
GPVKEWAITVFGMADKLVLSILVLAVIAILAAAGASLQTRRVPVGSAVIV
AGGVLGCAAVLSRPGAGAADLIPTIAGTACGVAVLHLLLSGRVTDGGETA
TVDRGRRLSLVTLGLFAAGGLAGAAGAVLSRRAASVSGDRAAFALPRIDV
PAPPIPAGVAPGGVTLPSFVTSNADFYRIDTALSVPQVGREQWRLRVHGM
VDREITYRFADLERFEVVEKVVTLTCVSNPVGGELVSNATWTGYRVRDLL
AEAGIHADADMVLSTSHDGFTAGTPVEALTDSRDALLAVGMNGEPLPTEH
GYPARLVVPGLYGYVSATKWVVDLELTRFDRAQAYWTKLGWSERGPIKTQ
SRIDVPRSGTDVASGPATFGGVAWAQDRGVRAVEVRIDPPGDRGEWRQAT
LGDSYSDDTWRLWSYSWEAKEPGRYTMVVRATDNTGAVQTEDRADPVPDG
ATGWHTVVFHVT
108798767YP_638964.1 ATP-dependent DNA ligase [Mycobacterium sp. MCS]MLLVDVATASVDVGAMSSRLAKTARIADLLSRAGTEQDARLVAVTVAWLS
GELPQRQIGVGWAALRSLPAPAAAPTLTVTAVDAVFSEIGAVAGKGSQAR
RAGLIAELFAAATDVEQTFLRRLLTGELRQGALIGVMADAVAKAADVPAA
RVRRAAMLAGDLPAVAAAVLAGGDAALARFTLQVGRPVGPMLAQTATGVA
DALDRLGGTAVFEAKLDGARVQIHRRGSDVSVYTRSLDDVTARLPEVVEA
ALALPVTDLIADAEAIALRPDGRPHRFQVTASRFGRAAARATQPLSVFMF
DLLHVDGADLLDQPTSDRVRVLDDLVPAAHRVDRLVTDDGAAAQRFLEAT
LAAGHEGVMAKSPNAPYEAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRT
GKLSNIHLGARDPATGGFVMLGKTFKGMTDAMLDWQTARFLELADPAAQP
ATSGRDPTDGHTVKVRPEQVVEIAFDGVQGSTRYPGGMALRFARVLRYRD
DKSPAEADTVDTVRAFYEHG
108798765YP_638962.1 hypothetical protein Mmcs_1797 [Mycobacterium sp. MCS]MGDNHYRRYLEHRRRTHPGEPVLTEREYWRMRHAAADANPGARCC
108798763YP_638960.1 putative oxidoreductase [Mycobacterium sp. MCS]MPGLKVDRGIPSQLARVPEVATALEDQGYDGCWTGEINHDPFLPLLLAAE
HTTRLEVGTSIAVAFARNPMTVANIGWDLQAYSGGRFILGLGTQIQPHIE
KRFSMPWSHPVGRMREFVAALREIWSCWHEGTPLRFEGEFYTHKIMTPMF
VPEPQPHGVPKIFIAAVGEAMTRMCGEVADGLLAHAFTTKRYLDEVTTPA
LLEGMARTGRRRSDFQVSCPVFVVTGETAEDVRAAAVATRRQLAFYGSTP
AYRRVLELHGWGDLHTELHRLSRLGEWDAMGGLIDDEVLDAFAVVAPLDT
VAAKLRARCDGVIDRVLPAFPAGVPDACVTDVLHELRGLPAAVGRSHP
108798761YP_638958.1 luciferase-like protein [Mycobacterium sp. MCS]MSRDGVLDELGYYLLAGAGGEGPATLMEEARRGEDLGFGTAFISERWNVK
EASSLVGAACAVTSRMRIATAATNHNTRHPLITGSWATTMHRLSGGRFTL
GIGRGIGAIYGAFGIPAVTTAQMEDFAHVMRRLWHGELIFNHDGPLGKYP
VLFLDPDFKEDIRLAIVAFGPQTLALGGRAFDDVILHTYFTPETLQRCVK
TVKEAAEQAGRDPDSVRVWSCFATVGDHLPEELRLKKTVARLATYLQGYG
DLLVKTNNWDPAVLQSFREDEVVKSIPGGIDHKATAEQIEHIATLIPDEW
LAPAATGSARQCVDRIRKEFDYGADALIMHGATPDELAPIVEEYRAR
108798759YP_638956.1 hypothetical protein Mmcs_1791 [Mycobacterium sp. MCS]MKAVDRAWRVAADVAGVVPRAHAALTDSGDWSAFSLGGIGQLGEVVLDEA
ALAGMTLTGPGPALARSVKSCAAAAEELSALGMDRAHAEPAPLRIRGTTR
RRFGPVRYERVTFDHDPALPESLAAQGFGGTATAVAHLCRAGERRPWLVW
VHGAGQGQPLDLMFSRARRLQDELGVNVALPVQPGHGSRRTAWPPYPNMD
PLANVAGMMRAVSEVRALVRWLLPQSTTVVVSGVSMGSPVAALVSHLEAS
VDAVAVYTPIFGLNEMIAHHLGRWGPAAQGTVDLLRSDTVSALTSVVDLL
AVEPSPPQARRLIVGAWHDRMAMRDPAIALHERWGGELFWHRGSHVGHIF
SRGVQEVSERFLRRVGVRE
108798757YP_638954.1 NAD-dependent epimerase/dehydratase [Mycobacterium sp. MCS]MGSAMDGAQARKRALVLGASGNVGAAVVRHLVADGDDVRVLLRRSSSTRG
IDGLDVDRRYGDIFDTEAVAAAMADRDVVFYCVVDTRAHLADPAPLFATN
VEGLRGVLDIAARADLKRFVFLSTIGTIAVGADGAAVDEDTPFNWSGKGG
PYIESRRQAEDLVLRCARERGLPAVAMCVSNPYGPPDWNPRQGALVALAA
FGKMPCYIRGVGAEVVDIDDAARALVSAAERGRVGERYIVSERYMSQREM
LTLAAEAAGATPPRFGIPMALVHAFAAVAGMSNRLFGTDLPINPAAARLI
ALTSPADHGKATRDLGWRPGPTADAIRRAARSYVERRDRNEQVVAL
108798755YP_638952.1 isochorismatase hydrolase [Mycobacterium sp. MCS]MTPRLAELVAPAHTALVTQELQGAVVGPGAGLAALAEEARRSALPNITRL
LPVARAAGVRVVHCLVQRRPDGLGSNHNAKLFAVGRSGVAIEPGSPGATL
LPEFGPEPEDLVLARWHGLGPMGGTDLDAILRNLGVTTIVAVGVSLNVAI
PNLVMDAVNAAYRVVLPRDAVAGIPTEYGDAVIDNTLSLLATITTTEGLL
QTWKQEA
108798753YP_638950.1 cytochrome P450 [Mycobacterium sp. MCS]MTQTKLVFDPFSEDFFNGPYDTYRRLRQEAPVYYSDQYDFYALSRHADVA
AAFKNFATYSSARGVDLAMVRNEDPPPHKSIIMMDPPEHRHMRSLLNKVF
TPRAIQSLRPMVEEVIDDCVRAVDPAGFDAEFDMVQDFSALFPIEIISRM
IGVPAEDRQQMRLWVDEFLHREPGEVEMGERGIRAGTEMAVYLYRLTKDR
RKNLGDDLLSRLITAEIERESGEHGPLDNIEITQFAMLLAGAGAETVTKL
IGNAAVVFARNPDQWRRLLDDPGKVPAAVEELLRYEAPAQYNVRCSLTDV
EMHGTTIPAGKPVFLIGGSANRDPDAWTDPDIFDIDRDRTEAQNLGFGYG
IHSCLGAALARMESTIALEKMLDFMPAYEVDWAGCRRVNMQNVAGWQNVP
VRVLR
108798751YP_638948.1 hypothetical protein Mmcs_1783 [Mycobacterium sp. MCS]MTTVAERVDNAGDHERLLTALQRQRSAFRAEGPPTAAVRRDRIDRLTALM
LDNADAIVDAMAADYGTRPRPGA
108798749YP_638946.1 aldehyde dehydrogenase [Mycobacterium sp. MCS]MSDAVEDRTETSVEIGERAARRAEPRMLIDGELTESASGARFDNHSPATG
RLLGDTAAATAADMDRAIAAARRAFDASDWSTNRALRVRCLHQLQEAIES
EREDLREELVAEVGCPVMSTRDAQLDWPLTESLRYPAALVDDFDWARTLS
GGGLFGERNVRTVVKEAVGVVAAITPSNYPIEVILNKLGPALATGNTVVL
KPDPHTPWNATRLGRLIAERTDIPPGVVNVVPTPSNDVAEILGADPRVDM
VSFTGSTAVGRHLMRRGADTMKRTFLELGGKSALIVLDDAKPARILPGAL
GVLAHAGQACAMTTRLIIHESLLEQAVGEIAAAFEAVPVGDPASPSTFVG
PLISARQQRKVLDACAQARRDGAEIVTGGGLVEGLAEHLAGGHFVAPTLI
TGVDNSAAIAQEEIFGPVLVVIPFRDDDEAVRIANDSAYGLAGAVLSSSL
DRGMGIAHRVRTGSIGVNGGMFYGADAPFGGYKSSGIGRQCGIEGFEQYL
ETKTIAHRTPRTG
108798747YP_638944.1 thiolase [Mycobacterium sp. MCS]MNDVAIIGVGLHPFGRFEGKSAMQMGVDAIFAAVDDAGVAWSDVQFATGG
SWTVANPDAIVGMVGLSGIPFTNVFNACATAASALKACADGIRLGDYDIG
IAIGLDKHPRGAFTEDPALVGMPSWYAENGQYLTTQFFGMKANRYLHDHQ
ISHATLAKVAAKNFRNGALNPNAFRRKPMTEEQILDSTMLNYPLTQYMFC
APDEGAAAVVMCRADLAHRYTSKPVYLRAVEVRTRQYGAYEVNTTFAPVD
EDVAPTVYAARSAFEKAGIAPTDVDVVQLQDTDAGAEIIHMAECGFCADG
DQEKLLADGATEIGGPLPINTDGGLIANGEPIGASGLRQIHELVRQLRGE
AGDRQVPGEPRVGFGQLYGAPGTAAAMIVST
108798745YP_638942.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MMDRYELRRIDYSLSEDHVDLQTAYRQFFKTHCPIETVRAAEASGFDKSL
WERLCAMGATTMALPESAGGDGATLVDLTLVAEEIGRSLAPVPWIEHVVA
ARLLAALDGLGSGVVAGEELATLDLRLDAGPGQRLVSGGSIADHIIVRDG
DEVVLLGFGTRPGRVDNIGKLPMAWVDPAAADTRTVLAAGPDAVAAHDLA
LTEWRLLTAAALVGLVEETMTIAAEFAKSRYTLGVPISTLQGISHPLANI
AIVVQGGRNLVRRAAWYLDNEPDERAELAPSAFVFMAEEAAKAATMAVHV
QGGLGVSAEAAATAYLVRARGWPLAGGDPGLSAQRVAAIVAERETGAERS
S
108798743YP_638940.1 acyl-CoA synthetase [Mycobacterium sp. MCS]MSEWTIGGVVDAIAEAVPDRLMTICGDRRSTYAQTADRTRRLANFLLANG
IGAHQERDSLDGWECGQDRVALIMHNDLYPDVVIGALKARAVPVNVNFNY
TPREVDELLSYLRPRAVVFHRSLGAKFADVLPRAGVEVMISIDDGSGSPE
PAGAVALEDALAQGDTDRPVAPSSPDDVMMICTGGTTGRPKGVMWRQSDT
YVVSMNGADHESVTEIHDKVQHAGPPWFAVSPLMHAAGMWTAFAALLNGQ
TVILYDKPTLDAAAVLTTAEREKVGLMTMVGDAYAAPLIAELRRRPYDLS
SLFAIGTGGAATNQRHQDALLELLPQITLINGYGSSETGNMAFGRSLRDD
RKDTFERRDGVVVLSEDRSRFLQPGDDEIGWVAREGRIPLGYFDDAEATR
RTFPEVDGRRVVISGDRAALEADGTLRLYGRDALVVNTGGEKVFVEEVEE
VLRAQAGVADALVVGRDSDRWGQEIVALIERQAGADVDPGALLDACTSAL
ARFKAPKEFIFVDELRRLGNGKADYRWAKSQVAQRDTLAGQL
108798741YP_638938.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MRSRCVTAGDAEPDAVLYDVRPSGVAVVTLNRPDRLNTWGADISAGFYAA
MDRAESDPAVRVVVLTGSGRAFCAGAHLGSMATIGDSLGNGQSHDVSKIV
GERHPHFLTALRKPVIAAINGSCVGIGLTHALMCDVRFAADGAKFATSFA
RRGLIAEYGISWILPRLVGFGAAMDLLLSGRTFYADEAAHLGLVKEVVAP
DELMARAVEYAEDVAANCSPASLAVIKAQTYGDAERDVVDASARAEKLMG
ESLLRPDVIEGIVSFLEKRAPSFPMLQEGPS
108798739YP_638936.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MERQGRTLIITINRPEARNAVNFAVSQGLADAVDELDSDTSLSVAILTGA
GGNFCSGMDLKAFAAGERVDIPGRGIGFTERPPRKPLISAVEGYALAGGT
EVVLATDLVVASATAKFGIPEVKRGLVAAGGGLLRLPRRIPYQKALELAL
TGESFTAEQGAAWGFVNKVTEPGQALAGAVELAERITANGPLAVAVTKEI
LVRSSEWSEAEMWSKQMELIIPVFSSNDAKEGAIAFAEKRAPNWSGT
108798737YP_638934.1 acetyl-CoA C-acetyltransferase [Mycobacterium sp. MCS]MSTPVIVGAVRTAIGRSFKGTLVNTPPETLITTVLPEAIRRSGVDPNAID
DLIFAESHYGGGDLARYAADATGLQHVPGQSVNRHCAGSLTAIGNAAAQI
GSGMERVLVAGGVQSLSMTPLVNWRIPGPELKFEERWMPPTHVETPDAPT
RDMSITVGWNTAQAVGITREEMDAWAARSHQRAIAAMDAGKFLDEIVSLK
VEQPDGSVIDFSVDEHPRRDTTAEKLAGLKVLHPEIEGFSITAGNSSGTN
DAAAATVLVERGYAESEGLTVMAKVRAWASVGVAPRDTGLGGVKVIGKVL
DRAGLTPADVALWEINEAFASVPIAACREYGLDEEKVNFSGSGCSLGHPI
AASGARMVTTLVYELQRRGGGIGVAAMCAGGGQGGAVVIEV
108798735YP_638932.1 hypothetical protein Mmcs_1767 [Mycobacterium sp. MCS]MSANADRRYGEDPLPQTVSAAAAMRRLTDLLLVQEAPHPAVDEMLARFPE
WEKQLSAAAPPDSAPRLGDGGEDRRVYLQHAFDVGAYNPCFPQYRFDNIG
DETASGSVTFALAFEGPPGLVHGGFLGVFFDCVTQHQSCAAGVAGKTRSL
TVRYRRPTPVLTELAFDVARAETERGLTSTARLLLDGEVLCTGEVDTVAS
PPDRLAGSRYGRRRV
108798733YP_638930.1 enoyl-CoA hydratase/isomerase [Mycobacterium sp. MCS]MTDSSYDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYDEAENDD
DVWLLIVTATGRAFCTGADVKEIPEDGKVLNERAFLSTYEQWEAPQEGTP
PFRRMAKPVLAAINGICCGAGLDWVTTGDIVIASEQATFFDPHVSIGLVS
GREVVRLARVLPRSVALRMAIVGKHERMSAQRAYELGMISEVVEHDRLLE
RAHEIADLVTRNAPLAVRGTRLAILKGLDLPLHEAEMLGEAFRERNLHTE
DSLEGPKAFVEKRTPDWKCR
108798731YP_638928.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MAPHRLSRRIAHVLDLCPEGNAVEYDGQWVTWAQIGEAARRIAELVTRYG
GDTPQVGILLRNRPPQVAAVLGVLLAGGTVVVVNPSRGDDRTRADITALA
LPVLIGEPDDLAALVTPAPATTVLSLTALSQEPVVDAAARRRAETRPGVA
VRMLTSGTTGPPKRIDLTYDMLAHSVLGPEPDGPRRGIAIVNAPLVHIGG
VFRVLQCVGEARSFALLERFELQRWADAVRRHRPAAVSLVPAALRMVLHS
DLTRDDLAGIRAVTSGTAPLSADDADAFTEMFGIPVLTSYAATEFGGGVA
GWTLADHQRHWHTKRGSVGRASGGAHLRVVDEDGTPLGPDQPGLLEVKPG
QLGPGADWIRTTDLARIDADGFLWILGRADQAIIRGGFKVMPDDVRTALE
GHPAVRGATVVGCPDDRLGETPVAMVELRDGATTSVDELTAYLRGRLAHY
EVPSEIAVVDTIPRTPSGKADLGAVRRYFSPAVTVDHG
108798729YP_638926.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MSNADTTIDRLLRRNTAAHPEKAAVIDPASRVSHGDLDRITRTLAAALVG
AGVGKGSRVGLVMPNSVQWVQIAVALTRIGAVLVPLSTLLAPRELVAQLR
TAAVQVLVTVEEFRGHRYLADLRAELGLPDLDDPLHSPELPALRQVWSPD
QLMAARAVDHELVDALTDAVTPGDTLAIMFTSGSSGPPKGVVHSHGNALG
AVAAGLHARCIDADTRLYLPMPFFWVGGFGSGVLSALVAGATLVTEQIPQ
PESTLRLLEAERVTLFRGWPDQAEALARQRHSVGADLSSLRPGSLEALLP
PDQRGRPGARARLFGMTEAFGPYCGYRADADMPETAWGSCGRPFDGMEVR
IVDPETAAPVPAGRIGEIQIRGPHVMRGVCRRSREEVFTADGFYPTGDLG
HLDDRGFMFYHGRSDDMFKVSGATVYPSEVEAALRTLDGVAAAFVTDVPD
AGVDRVGAAVVCDRPTTVGALRSAAKNVLSAFKVPTIWLLLDDDDAVPRK
ATGKVDVRALRELLAASSGEQT
108798727YP_638924.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MTRLAQTLGLTEFQTEIVSTVRQFVDKEIIPNAQELEHADTYPQEIVDAM
REMGLFGLMIPEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAY
MIRQHGTEAQKQRFLPRMATGETRGAFSMSEPELGSDVAAIRTRARRDDS
GGYVIDGQKMWLTNGGSSTLVAALVRTDEGADKPHRNLTAFLVEKPTGFG
EVMPGLTIPGKLDKLGYKGIDTTELIFDGYRASAEDILGERPGQGFFQMM
DGVEVGRVNVSARACGVGLRAFELAVRYAQQRHTFGKPIADHQAIAFQLA
EMATKVEAAHLMMVNAARLKDSGERNDVAAGMAKYLASEFCAEVTQQSFR
IHGGYGYSKEYEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRI
108798725YP_638922.1 3-ketoacyl-ACP reductase [Mycobacterium sp. MCS]MYADRAPRRPPTSQVGDRVSLLSGQTAVVTGGAQGLGYAIAERFVSEGAR
VVLGDLDLDATEAAAKRLGGPDVATAVRCDVTRADEVDALVAAAVERFGG
LDVMVNNAGITRDATLRKMTEEQFDQVIAVHLKGTWNGLKSAAAIMRENK
RGAMVNMSSISGKVGLVGQTNYSAAKAGIVGMTKAAAKELAHLGVRVNAI
QPGLIRSAMTEAMPQHIWDQKLAEIPMGRAGEPAEVAKVALFLASDLSSY
MTGTVLEVTGGRHI
108798723YP_638920.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MTGRLAGKVAFITGAARGQGRAHAERLATEGADIIAVDIAGKLPDCVPYD
HSTPEDLAETVSLVEATGRRILASVVDTRDHDALRETVDAGVAELGRLDV
IVANAGITAPQAWNTITPADFRDVTDVNITGTWNTVMAGAQHIVDGDRGG
SIILISSAAGLKMQPFMVHYTASKHAVTGMARAFAAELGKHRIRVNSVHP
GAVATPMGTGDMVEGLMRADAANPGLMNMVTPFIQDIAQPEDIADAVAWL
ASDESRFVTAAAIAVDCGSTQF
108798721YP_638918.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MRSATDRRPAQRSDLRREAILDALDRWLQQSSVETVNIAEVAQQAGVTRS
AFYFYFENKAAAVAALTERILDETIAVNQALTSASGSPRARVHKMLAGLF
GLCERHRHLFQAMLEVRGSSPAVRSIWDDARESFVDSIAELIRTERSAGV
APPGVDALVLATVLLEFNDRMLERLTLGGPLAADELRHGAAAVWLSSVYG
ITDPEERPAT
108798719YP_638916.1 MaoC-like dehydratase [Mycobacterium sp. MCS]MKTFNGLDELAAAEGTSLGPTEWLEITQDRVNLFADATDDHQWIHVDPEK
AAQGPFGGTIAHGLLTLSLLPHFSHQLYTVGNIAMAINYGYNKVRFINPV
KVGARLRARGEISKVDRLDGAVQAMTTITVEIEGADKPAAVAESIVRFIG
108798717YP_638914.1 hypothetical protein Mmcs_1749 [Mycobacterium sp. MCS]MTRSTTDQTVYTASVLTDDADRDALATLRSDPGIEFVDRAAELRSALAEL
RPPADGELADEPIRWAYFPWRRTVVSVLGPRAHSRLRLDRNRNLITASEQ
QRLGRLRVGVIGLSVGHAVAHTLAAQGVCGELRLADFDGLEVSNLNRVPA
SLVDLGVNKAVVAARRIAELDPHLPVQVLTDGVTPATVEEFLDGLDVVVE
ECDSLDVKVLVREHARARRIPVLMATSDRGLLDVERFDVDPSRPLLHGLL
GDIDSAALSGLTSKDKVPYVLRILDASALSSRMAASLVEVGTSLTTWPQL
AGEVALGATAVTEAVRRIGLGEPLPSGRVRMDAAALLDRVEDPLASPAVE
DTADDRVADSETDSVPEKVAAAAVRAPSGGNSQPWHIELQSDAVHLWVAP
EATSAMDVAYRGSAVALGAAVFNARIAAAAHHRAADVHIERGDERSPLRA
VVRLGRAEDEELARLYPAMLRRETNRHHGSGTPIGAPEIEAMAAAARAEG
GRLAMLTDTRDMAEAAEILAATDRIRYLTPRLHSEMFSELRWPGDPAPDS
GIDVRTLELGPTDLVKLDILRRGEVMADLARWEAGSALGEDTYDRLTSSA
ALGVVTVTGHTLPDYLRGGAATEAVWIAAEQHGVATHPVSPVFLYAHGDR
ELAELSPAFAGELGELQRRFRALTGIGAEESEALVLRFSIAPRPSMRSRR
RRLSTPAPA
108798715YP_638912.1 hypothetical protein Mmcs_1747 [Mycobacterium sp. MCS]MWDHEVDVLCVGGVIGALASAVVAADAEVEVLVAISSADDSGWPTDRVED
EDTVAYFAALTDGLATSPQAMADVPVRPVRPLTAAERRRAAPFYGARLKN
WTEQCLLSPYGLLHTRVTDWRTTTMRTLDNRPVQVKTVGRIALPAAGGPA
PLATWLEEQARVRDIDIESDARLQRLVFEEGVVVGAVLETAAGPYAVRSR
HGITLAPRVAHDVAEYARGDDEAEVALISEIGSRFARVELLAAAPPAAPP
AATCSSSNRRLPKAMRESRRNRAEPRRSREMNGNPPFGQ
108798713YP_638910.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MIRQARSEATRRRIIEAAVDLFSERGYPGTGLGDIIERAQMTKGALYYHF
DSKEALAAEIVSEGSARLLATFDAISESSSPALESIIHGTFLVVDQLGSD
KVARVGIVLMRVFAGFSESAGGTYSGWLSAMVTDVARARDEGDVRDDVDI
VAVAETFVGAFVGGSLLSDAASGGTDLRERVTRLFGLVLPAIVTDESREY
FTEFLARETRRGPTGD
108798711YP_638908.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MDLTWSDRDLAFRDEVRAFLAEKLTPEIQRAGRLMTSVYADHDASMAWQK
ILHERGWAAPAWPVEYGGCDWSLTQHYIFSRESTLAGAPSLSPMGIRMVA
HAIIKFGTPEQKDYFLPRILTGEVFFCQGYSEPEAGSDLAALTMAAVDDG
DDLVCTGSKIWTTHAAEANWMFALVRTTRAPKKQQGITFVLIDMTTPGIE
IRPLVMTSGEEVQNQVFFDEVRVPKSNVIGEIDDGWTVAKYLLEFERGGG
SSAPALQVLAEEIATVAADQPGPEGGRLIDDARFAQRLADARIRTDVLEI
LEYRVLATVAAGGNPGSASSMLKVLGTELSQDLTELAMAAAGPRSRVYQP
HATCPGGPVAEYEPPADGYVSGEPWQAVAPLRYFNDRAGSIYAGSNEIQR
NILAKAALGL
108798709YP_638906.1 phosphoribulokinase/uridine kinase [Mycobacterium sp. MCS]MRPPIVAGVDSSSESVTAAEALRVVVDESRALLDSGPGRVIVGITGPPGT
GKSTFARRIVERAAAVASYVPMDGFHLSNAQLDRLGRRSRKGAPDTFDVD
GYVAALTRIAADHGIRDVYVPDFDRTLEEPVAAGRVVPADARLVVTEGNY
LGLWEGVPALLDRLYYLDTEPAVRRARLLARHVAGGRGNAEAQDWVETVD
FSNAALIAAARDRCDRILEVVEPQSL
108798707YP_638904.1 hypothetical protein Mmcs_1739 [Mycobacterium sp. MCS]MGAPSAPPGWDPDAHTSSPPRTRSRSRTGAVVGAVVLAAAMLTGVTALRD
AVGPQNPQRPPLARSSVTATPTVLQDGWGVRTPTRAAIEAMWEWVTASSD
TLKTVTEVAHQVRPQVQNALTARDVGDIRFYCSQMIAPITVEMSAIVDTP
DPDLTRAMQTVVVSAHDVEARCASLRDPPDQPSLDALHAAFGRVASDLDA
MVQIVDRDATIMQRAGR
108798705YP_638902.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MDITIHNTFLPHDDPEESLAFYRDVLGFEVRLDVGGGTMRWITVGPPNQP
GTSIVLHPPAVDPGVTDDERRLIAEMMAKGTYAMIVLATKDLDAAFERLQ
ARDADIVQEPTVQPYGVRDCAVRDPAGTMIRIQELP
108798703YP_638900.1 PE-PPE-like protein [Mycobacterium sp. MCS]MKGALKVATVATSIAITTAVPAAADTTLYVGGTGWPGTPTHSQMTWLQND
VYAGRDDALVGVGYPASPILMNESVAVGAGRLGEAVATTKGPKSLVGVSQ
GSLVLHEQERRIMALPEDQRPADDELRFVYIGDPARPSGGVANWVPEGVR
VPGIGLSRPAPLAETPYETVYVTREYDGIADFPDRPLNLLATANAVMGVA
YLHPNYGVDLSDVPEDNITETTNTKGGRTTSYLVPTNDLPLTKPLRQLGV
DRRIVDEVDKRLRPVIDSGYKRNDPKSESGGDDARTTADDDDSDSDSDRD
PTAGRPS
108798701YP_638898.1 hypothetical protein Mmcs_1733 [Mycobacterium sp. MCS]MTARWDVVIVEPFEQGIEHPSDEDLQSTTIDGADEADARQTYVEKLQAVG
NQRHTAVQLRCDGRIVEQWPT
108798699YP_638896.1 integrase catalytic subunit [Mycobacterium sp. MCS]MVAVNEPIDPLVRLAISQWPDNAPRGAVSTFCAEYGISRKSFYELRKRVK
TEGPAAVLEPMTRRPKSSPSKLSDEVKEQALAVRAALEATGLDHGPISVH
DKMHAMGLERVPSTASLARVFREAGVARLEPKKKPRSAWRRFVYPAPNAC
WQLDATEYVLSGGRRCVIFQLIDDHSRYALASHVALSETAKEAIAVVDKA
IAAHGVPQRLLSDNGIALNPSRRGHVGQLVAHLAALGVEAITGKPYKPTT
QGKNERFHQTLFRYLDKQPIAESLAELQCHVDAFDGIYNTERPHQGLPGR
VTPRTAWEATAKAPAPRPKPDPPSFDHAVVRPHRPAPTPADLPHGTSVKT
LNTAGAFVLAGVTYKVDGRRSLEQVLVVIDGDKITAADLDGEVLIEHTRP
APGITYVGNGRPRGPHPKTTQTSPKS
108798697YP_638894.1 major facilitator transporter [Mycobacterium sp. MCS]MSSRTEGDCPAKTTKQRLPREVWVLVVANVVVALGYGVVAPVLPQYARHF
GVSISAATFVITAFAVMRLVGAPAAGLFVQRLGERRVYVSGLIIVALSTA
ACAFAETYWQLLLFRSLGGVGSAMFTVSSLGLMIRISPPDARGRVAGLFS
SGFMIGSVGGPILGSLTAGLGLSAPFVIYGAALLVAAAVVFISLRNSAVV
GRADEAIETPVPFRAVIRHRAYQAALFSNFATGWASFGLRIALVPLFVVE
VLGRGPGAAGLALTAFAVGNISVVIPSGYLSDRLGRRKLLIFGLALAAVS
TALVGFTTSMPVFLAAAYVAGAATGVFVSPQQAAVADVVGNKSRGGTAVA
TFQMMADFGSIGGSLLVGLIAQYTSFGWAFLISGVILGVAAVGWIFAPET
RPRSSTEHTQARPLGPEAGGEVP
108798695YP_638892.1 camphor resistance protein CrcB [Mycobacterium sp. MCS]MPRFDGRELAAVFVGGALGTLARAGFEELAAPDPGRWPWPTFTVNIVGAF
LLGYFTTRLLERLPVSSYRRPLLGTGLCGGLTTFSTMQVETVRMLEHGHV
GLAAGYTAASLAAGLAAVLVATALVRRARIRR
108798693YP_638890.1 hypothetical protein Mmcs_1725 [Mycobacterium sp. MCS]MNDDLTKVTAYFGERQRHGDRFTADALLDLYGAASVATSIVVRGIAGFGP
RHELRSDVTLTGSEDPPIAVVAVDRSAKMRELALQTVDSVSRGLVTRESV
RSADGPIPSGPLTRLTVYVRRGQRISGVLAYVAVCDVLRRHGFHSATAYL
GVDGTADGQRRRATFFSRNLDVPAMVVGMGPTARAAEAIDVLRAIPGLQM
LTVEAVNTCVLAGRPVAPPDTTGHHAHRKLTVQTSASAMHDGIPVHRELI
SRLRDLHSSAGATVFRGVWGFQAGEAALSDSLLRVGRRVPVTTVVVDTPE
RIAAGAQVVEEVTAQRSVVTVESVPGAVWIDGGVRRGAL
108798691YP_638888.1 long-chain-fatty-acid--[acyl-carrier-protein] ligase [Mycobacterium spMASALADAMTSSGRDLVVLDHGGWRRHPWAEVHQRAENIAARITEDAATV
VVLVGEPTVEFIAAIPGTLYAGAALSILPGPVRGADLGQWARNTMQRCAS
IGVRLVFSHGEHLDALRATPASIPTCDVTETGHARRDSSFTPPDHGEFAV
LQGTAGSTGIPRTAQLSPEAVLANLRGLVACIDITPADTGCSWLPLYHDM
GLAFLLTNALGGAELWQAPTTAFSASPFSWLQWMTESTATLTAAPNMAYG
LIGKYGSRLTDFDLGALRFALNGGEPVDCQGYRRFATEMARFGLDPSALV
PAYGLAESSCAVTVPILGSGLQVDEVQVSSDDGRFIRTHAVVGEPIPGMQ
VRIAPTDGSGEQVDGRDFGEIEVRGTSLMSGYLGEPPLEAGSWFPTGDLG
YFVDSGLVVCGRAKELITVAGRNIFPAEVERVAAQVQGVREGAVVAVGTD
ESAVRPGLVIAAEFRGTDEPAARTELVQRVASECGVVPSNVVFLEPGALP
RTSSGKLRRLEVKRSMEDVNR
108798689YP_638886.1 hypothetical protein Mmcs_1721 [Mycobacterium sp. MCS]MQHRDVGKPTLSYSGRLIAQMTEIDEALKPVLPRELTTVSDEVRAVPAPP
LPVLAEPFALRPADPDADAEMISEWMNRPHLVEAWEYPWPPQRWRRHLKA
QIDGEYSRPLIGSFKGADVVYVELYRAAKDSIAPRYAADPHDIGIHAAIA
DLRFVNRGFAPLLLPRVVASVFEIDPRCRRIMFDPDHRNTGARRVCEFAG
CTFLGEHDMANRRMALYALPRTPADAPPTGDLQSSPVGESISSS
108798687YP_638884.1 YbaK/prolyl-tRNA synthetase associated domain-containing protein [MycoMRLGELDFTPIADALDLVAEPVRRDVRRGGAQGLWVSAIDPGLADTAEFC
AQYGIAPEHSANCVVVEAKRAERVWYAACLVLATTRADVNGVVRKWLDAR
KISFAPTETAVSLTGMEYGGITPLGLPDDWPILIDEQVLAQPHVVIGSGV
RASKILAEPDRLTSLPRAEVLSIVKTG
108798685YP_638882.1 cytochrome P450 [Mycobacterium sp. MCS]MRRSHSPGSRADGSARDDGWVVTDLDLDLQALPLAPKNPLPYRQLLPLVR
HFHTGQEVLRQAAGPVIRLKLGPKWMIPEIVVVTSPAGIRDVLGRNHASA
ERCRVHDEVRDLGGESLFVLPNDPWIPRRRALQPVFTKPSVRGFGGHMSR
AAEMVGERWGQTAQVNLDEECRRLTMRSLGRSILGLDLDAKADLIAGPLP
VAAGYAADRALKPVRAPRWLPTPQRRRANAAVATMKAVTNDILQACRADP
ARDAPLVHALINASDPETGRSLSDDDICNELLVFMLAGHDTTATLLTYAL
WALGHHPDIQDRVAAEACALGDRLPTPDDVGRLGYTVQVLNESLRLCPPA
AGVGRMALRDVEVDGYRVEAGSLVGIGIYAVHRDPELWDRPLEFDPERFS
PENVKDRDRWQFIPFAGGPRACIGQHFAMLEATLALATLIRSHEIRSIDD
DFPLETPYTTVAAGPIWARVHRRT
108798683YP_638880.1 beta-lactamase [Mycobacterium sp. MCS]MTNGTPVVRTAIVRAAVALALVAASSCGYASSSAVNEGTQTAATTKVPAP
PPRASATRPAPPPPPVAPLAADFATVAKLVNDAIAARRLPGAVVSIGHGG
RVVFQQAFGSRKVAGAPGLDGLPAPAEPMTEDTIFDLASLTKCLATATAV
MQLYEQGKVQFDDPVQKYLPEFNRADDPQRARVTVRMLLTHTSGEEPDVN
LDDPWGLRRAEKGEGLHRALTSPLHSEPGAVYRYSDINYILLGALIEKVT
GEAEDTYVERSIFSPLGMGDTRYLPPAEACGPRRMRGTAIGWAAARQSGV
PAVCPAGTWNTSLFSRIAPTAHDDEGRRDPRTNPDWDQLLRGAVHDTTAR
RMGGVAGHAGVFSTARDVGIYAQALLDRLAGRPSNFPLKRATLELMTAPE
QPGSSPRQLEAANGTARHAIAHTPNTAHPLLAPSYPAIEGQNLRGFGWDI
DTAHSQPRGRVFPIGSFGHTGFTGTSMWIDPSSDTYVVLLANAIHPRGNY
PISELRGEVATAAAQALGLDDGATSAPR
108798681YP_638878.1 alcohol dehydrogenase GroES-like protein [Mycobacterium sp. MCS]MDVRSVADPSPPPGGVVVEVHATGLCRSDWHGWAGHDRGITLPHVPGHEL
VGVVAEVGAGVEKWRVGDRVTTPFVCGCGRCQWCLEGQAQVCPDQTQPGF
THWGSYAEYVALHAADANLVAVPDAVGDAAAAGLGCRFATAYRALSARAR
IRPGEWVTVVGAGGVGLSSVQIAVAFGARVIAVDREPAALALASRLGAEH
TVHADGADVAGRVHDLTGGGSHVAVDAVGSAATCADAIHSLRRRGRHLQV
GLLPDVTGHPAVPMDRVIAWELDVLGSHGMASGDYPGMMRLIEAGTLRPQ
AIVERVVGLTEGATLLSSLSVATPAGVTLIDPRLG
108798679YP_638876.1 apolipoprotein N-acyltransferase [Mycobacterium sp. MCS]MWGVNASRLGLAAAFVVGALPALAFPAPSWWWLAWIGVVPLLLVVRAAPT
ARTAALRAWCGMAGYILATQYWLLPSAGPLLLVLAVGLGALWLPWGAATY
LLLREPNTVGRTGAAMAVLPSAWVVAEAVRSFPGLGGPWALLGASQWNQP
ATLASASLGGVWLTSFLIVAANTAVAGVILNRQLPVRLVAAAVALACAAL
GPAWFWLGPAPPAGSTVRVALVQPGNIEDSAARQAAGEALTDDLRGRRVD
LVVWGESSVGVDLAGDPDAVARLADLSRRVGADLLVNVDARDRTGEISKS
SVLIGPGGVRGTYSKMRLVPFGEYVPLRPLFGWATRHTKAAAEDRKRGSG
IAVLHTEDLALGPLISFETTFSDLPRELVERGAQLLVYQSSTSTYQGSWA
QPQLAGMVAVHAAEVGHPAVHTGLSGVSSAFDARGRQLGWYAATESGVLV
VDVPLGLHTTTFQRFGNWVLAMALSILACGIAWLVIQHAGRGERLGTGSG
A
108798677YP_638874.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MSTETTSNAVTREHGRLHGKSAVITGAAFGIGRATAVLFAREGARLVVTD
IQSEPLLALADELRHAGADVEPVVGDVSVEYDAGRMIGAAVDRFGRLDVL
VANAGIIPLGDALEMTAAGWDEVMAIDGRGMFLCCKFAIEAMLPTGGGAI
VCLSSISGLAGQKRQAAYGPAKFIATGLTKHLAVEWADRGIRVNAVAPGT
IRTERVKRFPEEPGGSEYLAAVERMHPMGRIGEPAEVASAIVFLASDDAS
FITGAVLPVDGGYLAQ
108798675YP_638872.1 hypothetical protein Mmcs_1707 [Mycobacterium sp. MCS]MKRVIVALATAAAALVAVAPPAGADTVAYLVNVHVRPGYNFPNAEAAIGY
GRTICDRVAAEMNYAQLVDQVKADFRTADYYQGAYLINQAVNELCPAQIW
QLRQSAAGYPYSASSTG
108798673YP_638870.1 hypothetical protein Mmcs_1705 [Mycobacterium sp. MCS]MCNSTHEKRPRGDQLYARRPNPGAMKMVREPSGGRRLRHPLTLTVGIVAV
LGVQALLITPAAHGDNKRLNDGVVANVYTIQRQAGCVSDIKISPSLQLAA
QWHARDALTNRNVNGDVGSDVSTLQQRAEAAGFSGAVSETVAINPALAFS
GIELINQWYHDPVDLAVMSDCSNTRIGVWSENSVDRTVVVAVYGKPQ
108798671YP_638868.1 butyryl-CoA:acetate CoA transferase [Mycobacterium sp. MCS]MTRTVDASTRACVEHLDRGPLDRREIAAMIARDIPAGSYVNLGIGQPTMV
ADFLDPAAGVVLHTENGMLGMGGEAIGDAIDPDLTNAGKIPVTETPGASY
FHHADSFAMMRGGHLDVCVLGAFQVSERGDLANWHTGAPDAIPAVGGAMD
LAIGAKSVLVMMTLFAKDGTAKLVPSCSYPLTGLRCVNRVYTDYAVFDID
HTGGGQLRVLHTFGLSIAALEERMRMALSCDGRVADLRQC
108798669YP_638866.1 4-carboxymuconolactone decarboxylase [Mycobacterium sp. MCS]MSNPPLTAIHLGGPDDGPLLLLGPSLGTTTATLWTGVAQRLVDHVRVVGW
DLPGHGRGRRAHPFTIADLAAAVLVIADDLNVETFHYAGDSVGGCVGLQL
LLDAPQRVSSATLLCTGAAIGTPDGWLARAATVRAGGVDTMLTGAAERWF
APGFVDREPGTASALLDALSHTDAESYAQVCEALAVFDVTDRLSEIVTPV
LAVAGSADSPTPPESLRRIASDVKDGDLVVLEGVGHLAPAEAPERVAGLI
AEIVGVPQPPSKSLEDVHRAGMAVRREVLGHAHVDRAVAGTTDLTADFQH
MITQYAWGSIWTRPGLDFRSRSMITLTALVARGHHEELAMHLRAARRNGL
SNDEIKELLLQTAIYCGVPDANSAFRIAAEVLPEFDEHPGAPS
108798667YP_638864.1 protocatechuate 3-4-dioxygenase subunit alpha [Mycobacterium sp. MCS]MSTLLPATPGQTVGPFFGYALPFDRCNELVPPGSPNAVQLHGVVADADGR
GLPDALLEIWQADADGSIPNASGSLHRDGWTFTGWGRATTDEAGRYTFTT
VIPGVSEPVAAPFISITVFARGLLNRLFTRAYIPGKQLENDSLLNTLTPE
RRDTLIATRDRTGLRFDIQLQGTPDKPETVFLRYPGHQR
108798665YP_638862.1 regulatory proteins IclR [Mycobacterium sp. MCS]MFATLTRITPYTIVSPTVLSSQMQRIHREGVATTSEEMSLGACSLAVPVI
RQTDDAVVAAIAVVVPTLKRDRQRLLGALQVAARGIGRLL
108798663YP_638860.1 ketopantoate reductase ApbA/PanE-like protein [Mycobacterium sp. MCS]MRVLILGAGGLGSVLGGYLANIGVDVTLVGRPAHAEAITRYGLRITGRRG
DLVITDNLTAVDQTAKATGHFDYLVLAVKGKDTAQALAEADGLRDCVSSA
LSVQNTVEKDATLAGWLGPDRVIGASTIEGGTLLEPGLVRNHLTAEVTAY
FGELDGTSSARVDDLTAAFTNAGLPAKAVGNIEQVEWEKLAQIALAAAWS
VTALGAIPDASVFEGMEVREGAMYFVALAKDLLGVYRAKGYEPMNFFAPL
SRLKELDALPTADAIEFVIGQGRVMREKGNLGHPSMYEDVLRRRKTEVDF
MLAPYLAAAQELGMDVPTLRVAYQIIKTVDRFLA
108798661YP_638858.1 integrase catalytic subunit [Mycobacterium sp. MCS]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
108798659YP_638856.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMVATVEQQLLLRCEMENFLFEEAELLNDGRFHDWLELCAEDIHYVIPVRV
SRERANGDGNSTTMTHWDDDYAGLELRVLRLDTEYAWAEDPPSRIRHHVS
NVRVRPGAGTDEYDVRSNLLVFRNRGDSPQHDLISAERHDVIRRSEMGLR
LASRRVVLDHAVVGTHNLANFF
108798657YP_638854.1 hypothetical protein Mmcs_1688 [Mycobacterium sp. MCS]MGRHVNDRMVSFYVRTPSGFDIEYGWDAVTVDEETWTVAQYDRPSVWGHQ
MVAQTPPGALEAATT
108798655YP_638852.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium sp.MLVKALGYVGVESPDAKEWLAFGPEVLGMEAVEASSGSVLLRIDDADHRL
AVHHGERNRMLYAGWDVGSEEALEAAGESLHRQGIGFEVGTEEDCAARGV
LGFVTLSDPSGLRHELFYGQKVVPGSFRPGRAISGFVTGAQGLGHVVLAT
PDLAQADRFLRGVLGFKKSDEIYTFMDLWFYHCNPRHHSIALTRMPGVRG
LHHVMVEVQSFDDVGMAYDLCMSRNIPLSMTLGS
108798653YP_638850.1 class II aldolase/adducin-like protein [Mycobacterium sp. MCS]MSSTPSGAGLDTERHAIALACRVLAARDLAPGILGHISLRVDRDRLLIRC
RGPRERGLAFTSAEDIRMVTLDGTAGGKGELDDGYQPPNELPLHTEVLRT
RRDVNAVVHAHPEAVVAADLAGLAVRPIVGAFDIPGFRLAAAGVPVYRRG
VLVRNRQLAQEMVAAMADRPVVVLRAHGLTSAADTVERAVLQAISVDTIS
RLSLQIASAGGTLADLPDADAAELPDLGNAFNETIAWRHELARLETHGLS
CHPSEKRSS
108798651YP_638848.1 oxidoreductase-like protein [Mycobacterium sp. MCS]MTDVASRELGLGFLGIGQAVARIFQQYPDMSTLPYRVVAAADTRSHSLAR
FATEFSGQTYTNAEQLCADPSVDVVYIATPPELHREHALMAARHGKHMVV
EKPLAMSVDDCTAMVEAAQAAGVQLMAGHTHSFDAPVRAMAELVASGELG
ELLMVNTWNFNDFNRRPWPTSELRSTSGPVLNQGPHQVDIVRQIVGGVAR
TVRASTIWDDVRECVGGYTCHLGFESGASATLVYDARAFFDVAELHSWVA
EDGGRRSPQANQRVANNFAALSQNPDQLEVALEAQKEQGRYGAATTTEES
QELWGYSAPGEIIHHPYFGLTVVSCERGAIRQSPDGLVVYGQNGLQEIPV
ARTMRGRAAELAELHRAITEDRPVQHDGRWGRATLEVCFAILQSAYEDRE
VVLSHQVSL
108798649YP_638846.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]METIGSKTGSALPIDSSAFYDEAVYQRELDSIFKRSWLFVGHESMIPKPG
DFRTTYMADDAVIVCRDKESRVRVLLNKCRHRGNKVCQFDKGNANIFHCS
YHGWSYDTAGRLRSVPLAESAYGPQFDKASMGLVSPRVATYKGLIFACWD
QSAPPLEEYLGEGLLWYLDNFLLDCDPNGLQVVPGLHRYLMPVNWKLLAE
NFGGDQYHFAATHGSVSALSKAGQTARINFSIDEGQHYSVVLDGCAPHGL
LQLAVGKNFYQDDLAQAETLGTEAVDWLTERQRLQDERLATSPVQPYSFH
VANIFPNFSMIGMGTAFYGRGFIMWQPRGPRLTEVWEWCLVESSAPRAVK
ERMVFVLSQRQSAAGLVTPDDHENFERLSDALDTGVARDVPFNYSLGEDV
EPMESLVAELPGNVRPQISEAYQREFYRHWHRTMTEPA
108798647YP_638844.1 transposase- mutator type [Mycobacterium sp. MCS]MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWG
QPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAE
SALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQ
FRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVL
GMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGA
AWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAERLNKEIRRR
TDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITN
DNPEIGADDMPALTA
108798645YP_638842.1 6-phosphogluconate dehydrogenase protein [Mycobacterium sp. MCS]MRRVGVIGLGGMGSALAASLLATDHYVVCFDIRPDVLRPIVELGAEAAAD
ARELAGACDVVLTFLPGPSQVLEVALGSERGVLAGLADGAALLDMSTCNP
EVAAIIGQAYDAAGRRFVDCPVSRKAPNMTVLVGGPSGVLGPDADVLAAV
SRTLVYCGHRGAGYATKLLNQHIKYSWYLASAEALLIAEAMGLNAGEVAD
AIAECSGGDSGLTTAAAYFRHDTESVRNRAPASTITKDSALAERMATNAG
IRSRTLEPVVDFFQSVAASEFRDRAYPESTELLQRIRSMPPK
108798643YP_638840.1 3-phenylpropionate dioxygenase subunit beta [Mycobacterium sp. MCS]MSATGGEISTRQDAVEKLLLQAEIADFLYREADLLDERRYSEWLGLLTDD
YEYSVPLRANVAYDDLAQLEQTQEGHDICWFDEKKETVALRVEQLMTGLH
WAEEPVSRVSHLVTNVRIEGVDGAEVDVSCRFLVYRNRVADETDLLVGRR
KDRLRRVAGDWQLCRRRLLLDQTVLLAKNLSIIL
108798641YP_638838.1 hypothetical protein Mmcs_1672 [Mycobacterium sp. MCS]MAAADELRDRVGEKIHFRGADSVTQNDIRRKLEVFTFSCPLHDDEAAAKA
HGYLGVVAPVTMTPLWGLPPYWAPGQPSPYLVDGQEMTGNITDTLALPFS
RSVNVSSEWQYHTPLYLGDRLQGTTTIISVEQKRTRVGTGVFLQYESEYV
KVSGELVALNRNTVFNYDPDDASRPEPGTSARAQQGDRGPRTRSVDDADT
SVDWNTPLQFDDVTVGAQVRGPALALTYQRMVMNIAADRMFSGIHHSAAA
AHAAGLADIIFNTRGLETLFETGLRRWMGLRGRLVQLGPFKMSASVHPGD
VVQARWTVTGKHAQAGADVVDLDFGVFAGDRQAAQGVAAIHLNGKKQC
108798639YP_638836.1 putative nonspecific lipid-transfer protein [Mycobacterium sp. MCS]MSSLRDKACIVGVGHTVYRRDATESATDLGLQLEAAHAAIVDAGLSAGEI
DGLICPINGGTAEDFIANLGLTNVRYAVTSHTGGAASVAGLATAAMAVWS
GVARHVLIPAGWCGYSGPRARGMASSADMAIGKVVRDYYAPQGAVSAVHQ
YALVADRYVRKYDVPPEAMGAVAVAFRANAQLNSNAVMCGRELTMQDYLD
APPISTPFRLFDCSLETDGAAAVVVSAADRAADSPHRPVFVMSVAEGRPF
PVDEFANRADPLEIGLAEAAPRAFADAGVAPSDIDLLEVYDSFTVNVLRQ
IEAAGFCKPGEAADFVLDGCIAADGLLPTNLNGGLLSEAHVQGMNNLVEA
VRQLRGGLAERQVHNAELAVVTGMGGGWGSGALAILRR
108798637YP_638834.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MRAAIYHGREDVRIEELPDPSPRAGEVVIEVARAGICGTDLHEYIAGPMH
AAPGVVIGHEYSGTVVGVGSGVREFTEGDRVCGVGVFGCGECGFCKQGAE
ALCGAVGFIGFAVNGALARYASLPTKALFRIPDEISLAEAAVVEPIASAY
HAVRRSGLAAGGTVFIAGAGPIGLALVQFSLAQGATQVIVSEVSATRRVA
AHRVGATRVIDPLAEDAVEVVRTLTNGNGVDISFDAAGVQPALDAALGVL
RPRGRLMVVAIWEAPAGIDINRSVMREANIGFSFCYEAQRQVPAILDLLA
TGAINLGELITDEIPLDAVVSQGLEELRVNRDAHVKILIDPSA
108798635YP_638832.1 ring hydroxylating dioxygenase subunit alpha [Mycobacterium sp. MCS]MSAHVLGAQIDRKVRPVDSMAPDATTMRTLENARGSILKGRLPASLIANA
ALYELELKRVFGRTWQFLCHEDEIPNAGDYVVRYIADNSIIVARQQDMTI
RAMSNSCRHRGTLLCRTESGNESAFQCPYHGWTYRNNGDLIAIPAQQAVY
GAAFDKSRLGLRALPMLDSYAGLVFGCVSDEAPGLDEYLGDMRWYLDLMM
KKSPTGLEAWGAPQRWVIDANWKTGADNFVGDGYHTVMTHRSMCELGLLP
PDNVAVSPAHVSLSGGHGAGVLGAPPGIPAPPYMGYPEEVVSGLSEGYGD
DVHGELLKRTMFIHGNVFPNLSFLNAFIAKDGESMPVPILTLRQWRPLDA
ARMEVWSWFFVERNAPEEFKQQSFETYVRTFGVGGVFEQDDAEIFQAITK
GTRGELAGGVELNLEMGLDNLAPDPTWLGPGRPLASGYAEQNQREYWKQY
FDYLATPRRDENV
108798633YP_638830.1 EmrB/QacA family drug resistance transporter [Mycobacterium sp. MCS]MNETVVERLSRRHKAFVLASCCLSVLIVSIDVTIANVAIPSIRADLSASP
SQMQWVIDIYTLMVASLLLLSGAMADRFGRRRTLQIGLTIFASASLLCSV
APNVETLIGARFLQAIGGSMLTPAGLSIVTQVFTGRVERARVIGIWGGVV
GISMALGPIMGGILLEYVDWRAVFWINVPICALAVLLTAIFVPESKSVTM
RHVDLIGLVLGMAFLFGLVFVLIEGPGMGWTDTRVVVSCCLAALAFATFL
RYESRRVDPFVELRFFRSIPFASATAIAVCAFAAWGAFLFMMSIYLQGER
GLSAVNTGLMFLPVAVGAFIFSPLSGRLVGRFGARPSLMIAGALIVAATL
MFAQMSDATPQWQMLVAFAVFGVGTSMVNAPVTTAAVSGMPTDRAGAAAA
ITSTSRQVGVAIGVAICGPVAGAALGDTNVDFAVSAQPLWLVFAGVGVLI
FTLGVYSTSKRALRSAEHLAPLIAGTDPRREAADVA
108798631YP_638828.1 epoxide hydrolase-like protein [Mycobacterium sp. MCS]MRAVRPFSIHVADDVLDDLRTRLSRTRWPEAECVPDWTQGIPLGYTRELA
AYWADGYDWRSREAALNRFDQFVVEIHGVDIHFIHQRSPHQEAFPLVITH
GWPGSIVEFHNVIEPLTNPTAHGGRAEDAFHVVCPALPGYGFSGKPTNAG
WGVGKIAQAWETLMLRLGYQRYGAQGGDWGAAITTQMGRNRGHCAAIHLN
MPIAYPPAGGITDPTEEEQLALAALTTYQRWETGYSEQQSTRPQTVGYGL
ADSPVGQMAWIVEKFAAWMDCDGHPENVLSRDELLDNVMMYWATNSGSSS
ARLYWESFKTLDATTRVELPTGIAAFPKEVLRAPRSWCEPIYNITHWTTM
PRGGHFAALEQPRLFVDDIRAFFESVR
108798629YP_638826.1 hypothetical protein Mmcs_1660 [Mycobacterium sp. MCS]MTIHTADDPAGDDPTPCSPAPDDTLDVGTDKGAGGAGADSEDTEVVDGKH
QRDTSRAWRNRMPPQRLALVMGSVAAVTMGALTSWLGFQTHQAHQASEQR
QQFVQVGRQGALNLTTIDWQHADVDVKRILDSATGTFYDEFSQRSQPFID
VVNKVKSKSVGTITEAGLESHSRDTAQVLVAVSVKTTVGDGPEQEPRAWR
MRVTVQKVGNDAKVADVEFVV
108798627YP_638824.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MTGKRFARAAAVIMIALTVAGLSGCGFRGLNSFRLPGTQGQGQGSYTIQA
EMPDVETLQPNSRVRVGDVNVGTVTKIERRGWHALLTLALNGDVDLPANS
TVSLGQTSLLGSLHIELAPPTDVRPAGKLRAGSLIPLTSAGAYPSTEQTL
ASVSLLLNGGGVGQVQDITTALTSALGGREADFRSLLTQLDTFTANVNGQ
IGDIIAATDSLNNLVAQFAAQKPIIDKALETIPDALAVINAERDQLVEAV
DQLGKFSALAADTVNQSQESLIQILNDMGPVLESLANAGPALTRSLNLFT
TIPFVKDNLTKWWRGDYANITTIVDLTLSRIDAGLFTGTRFEGHLTELEL
QWGRTIGQLPSPYTARNPLIVPYRLDQGP
108798625YP_638822.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MKTFSERNVIVIGAIGVLLTAAIVAGALNYNKLPFVSSGKSYSAYFDEAG
GLTTGAPVRVSGAPAGQVQSITLDGQWVLVTFTVADGIRLGDRTEASIKT
TSVLGNKVLDLTTRGAGTLAGTIPVERTTSPYQLPDAIGDLTTTISGLDT
GQLSASLAVLSQTLQDTPDDLRFAVAGIARFSETLNQRDAQLRDLLAHAA
KATTVLGERSNDIVRLISDTNAVLAQLRTQSAALDEISTSISAVSRQLAG
FIAENKTTLKPALEKLNGVLAILDNRKAQIQESIKGLAAYAMQFGETIAA
GPFFNAYLANLVPGQFIQPFVDAAFSDLGLDPNVLLPSERTDPQVGQPGT
PALPIPYPRTGQGGDPKLTLPDAITGNPGDPRYPYRESVPAPPPGGPPPG
PPAPPPPDQQAPQPPTPSPVVVPAPDEVAPGPTDSSIPQGRR
108798623YP_638820.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MADGTGARRISPGWWAMLLVTGIVAAVVLSLAMFNRTFTPTVPVTLTADR
SGLMLEPNSRVKMRGVQIGRVSAVTGGDAPRIQLAIDPDQIRHIPANVEA
RIQSISLFGAKYVDLVYPPDPSPQRLSAGAVLTSQNTATEVNTVFQNVVQ
LIKTIDPLKLNAVLSALAEGVRGQGDRIGEAITASNQVLLELNPRTDTVR
EDFRALKGVSDTYSAAAKDIIDTVAAATTTSATVTTHAQQLDTLLLNVVG
LSRSGIDLLGASKDNLVKAVNLLEPTTNLLMKYNPMLTCLFVGAKTTLDT
GYADMLGGNGKSLIMDASLLLGDDPYRYPDHRPINAAKGGEGGKPSCGSL
PDVAQNFPVRQLIANTGFGTGLDWRPNPGIGFPGYANYFPVTRAVPEPPS
IRYPGGPAPGPMPYPGAPPYGAPQYGPDGTPLYPGVPVPPPPSAGPTP
108798621YP_638818.1 integrase catalytic subunit [Mycobacterium sp. MCS]MTGKASGCEVELSRNRFTNQEAFVSHANAALTPRARLRLARLVVETGWTY
AAAAKMFMVSPRTAKKWADRFRAEGTAGMVDRSSRPHHSPTKTSQQVMRR
IVDVRWRQRLGPVQIAGQLTMPASTVHAVLTRCRINRLSYIDRVTGEPLR
RYEHAHPGSLIHVDVTKFANIPDGGGHKFLSREHGGRNRRRTAHRTGDRG
DRTKNWRPIIGTAFVHTVIDDHSRMAYAEICTDEKAATAVAVLQRAVAWF
SERGVTVERVLSDNGSAYRSYAWRDACTQLHITPKRTRPYRPQTNGKIER
FHRTLADGWAYAHFYESTEQRNTALPDWLHFYNHHRAHSAIGGQPPVTRL
TNLPGHHR
108798619YP_638816.1 hypothetical protein Mmcs_1650 [Mycobacterium sp. MCS]MKGFSLRKNLPTAADVKALKPLSIIGGLYAMTLDMFVAMFKPPFQWREFL
LQTWFVARVSMVPALTLSIPLVVLTSFTFNTLLGEFGAADFSGTGAALGA
VNQIGPFVTVLVVAGAGASAMCADLGSRTIREEVDAMRVLGLDPIHSLVV
PRVLATTLVAVLLSSVVTVTGLLGAFLFSVYFQHVTPGSFVASMTLITGL
GDVLVSLVKATLFGFVAGLIACYQGLRVQKGAAGVGNAVSETVVIAFLLL
FVVNAIVTAVGFEVTK
108798617YP_638814.1 sterol-binding protein [Mycobacterium sp. MCS]MTAVALMSPEWARAYRDLWNDSAEIRQGAKELSMLIEWRVQDANDQVSQL
EITDGEAVYGGVQIEGRKADFVLTATASVWHRVADGELGVANAIATRKIK
FVGPVKVAMANMAVLGAGLRLLGQVDGLVWGD
108798615YP_638812.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium sp. MCS]MKLGPTMEFDHIQPAIRKRFTSAADIPKEVFSDPDVYREELTRIFYGPYW
HPIAHRAELAERNAFRTRWLADVPLLMVRDGDDRIRVFVNSCAHRGTLLE
QRRCGVAERFECPYHRWIFNNDGRFAGAPRRMQFRPDFREEDYGLRELHV
VEAWGLIFVSMAAQPPPFDDYLGDSADPLRDCMVDDGNLTLLGYQTVVFQ
SNWKTYIDNDPYHAPLLHSAFKLLNWQGGSGNVLVSKPYGHMSILYDAQP
YVDNGFLADPSVVTRMGDDSRARVIALRPVTGIVRHVDTINIRYARPLGV
DRTEVRYTFFGHASDSEDFARHRVRQSSNLLGPSGFISIEDAAVYNRVQA
TARDGGYQRFVAGVGRPLSESSQNDEVANTGWWAHYQEVMEFC
108798613YP_638810.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MEAIVLNGTNDVGLTSVPDPAPQDGEVIIEVAATGLCGTDLHEYVAGPTF
SQPPVVLGHEVSGRIVEVGAGVDQSRIGEGAAVIPMDFCGSCHYCHRSLY
HLCQRPGWIGFTRNGGLANYVAVPSRLAVRVPDVVDLEEAALTEPTAVAF
HAVRRAELLLGETVMVLGAGALGLTVIQCARAAGAARIFVTEPSGVRASL
ARDLGATLVLDPHDPGTTACILEETRGVGVDVVFHVAGSAEAFTQGLDCL
RKQGRFMEMSSWAGAASLDVNRHLLKEIQLRMVFGYDMFDDFPAVLALIA
DGKLALAPQITARVPLDRAVKEGLGGLLEGREGLVKVLVKP
108798611YP_638808.1 ring hydroxylating dioxygenase subunit alpha [Mycobacterium sp. MCS]MTTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTIEMERI
FGRAWVFLGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHR
GALVCRAEMGNTAHFQCLYHGWVYSNTGELVGVPAMTEAYPGGFDKSQWG
LRHIPHVDSYAGFIFGSVDPKAPSLTDYLGDTTFYLDLIAKKTAGGLEVI
GAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAPGDPNFASAPA
EISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSW
FLVERDAPEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAG
EGLLNYEMGMDLTPLTDWPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPA
FGGRA
108798609YP_638806.1 hypothetical protein Mmcs_1640 [Mycobacterium sp. MCS]MLGEHGTHGLDTPAQPGPAVGAGHLMVLVFGDEPDRRLPGRSSSAPKKIA
AAFKISLARRNSAISLRSALFSSAICVVTPGRWPVSTSERRIQVRKVSGV
PIPNMPATAVIAAHCDGYCGRTSATMRTARSRNSSGYLLGRPITQILPRS
GASGLAGRGQSHFGRCPFGDVVLTGRVT
108798607YP_638804.1 hypothetical protein Mmcs_1638 [Mycobacterium sp. MCS]MTETVVAVEPSQNPDDEAAVAAIDVPDSGEVDELEVARELVRQAREAGVS
LTGPGGLLKAMTKTVIETALD
108798605YP_638802.1 4Fe-4S ferredoxin [Mycobacterium sp. MCS]MIESIDETTCDGCNVCIDSCPTGVIRLVEGDEPWATTKWRAKIIYPNDCH
SCRLCAIDCHVDAIVVSHALVIPDPFLPGVEPLDGSRDAPPDEKKT
108798603YP_638800.1 aromatic-ring-hydroxylating dioxygenase subunit beta [Mycobacterium spMEAPHELASRFGCAASSLVARRFGRGSFGDVVLTGRCDVSSILYSGGRIC
SAEYRVSVDGLVEEFGVMNAVAVDRDTREAVEAFMFREAELLDGGQFREW
LGLLDPDIRYVVPVRTTREDSAGWVGAIAHWNDDYTGLEMRVLRGETDFS
WAESPRSRTRHFVSNIRTVAGPEADELTVRSNLLFFRSRGDSGRWELLSA
ERVDVLRRTDDSLRLARREVLLDHSTLPIDNLSVVL
108798601YP_638798.1 hypothetical protein Mmcs_1631 [Mycobacterium sp. MCS]MAIQFLTDDWATAVTDAANADERFRIAAKGHDVVLRVSVSQSPASDDYYM
HFSDGSLIVGIGSPPRTPDVEAELSYETNVELSRGALNGQTATMTGQMKA
VGNMMKMMSIGKAQDRLAELESGLDIDY
108798599YP_638796.1 dihydrodipicolinate synthetase [Mycobacterium sp. MCS]MRDTKLTVDDITGVVGIIPTPSIPTADQPGTAFSVDLDEAAKLADAMVRG
GVDVLMTTGTFGECASLTWDELQSFVATVVDAVAGRIPVFAGATTLNTRD
TITRGRRLGELGADGLFVGRPMWLPLDDAGIVRFYRDVAEAVPNMALVVY
DNPGAFKGKIGTPAYEALSQIPQVVAAKHLGLLSGSAFLSDLRAVSGRVR
LLPLETDWYYFARLFPEEVTACWSGNVACGPAPVTHLRDLIRAGRWDDCQ
ALTDELEGALETLYPGGNFAEFLKYSIQIDNAQFQAAGFMRTGPTRPPYT
EVPESYLAGGREAGKNWAALQQRYASLAVSNH
108798597YP_638794.1 transposase IS3/IS911 [Mycobacterium sp. MCS]MARKNYPDEFKRDAVALYRDTEGATIAQIAAELGVSEATLSAWCKSAGVP
IRHRRGVVVAEPVPGAESPEQELARLRSEVKALRATEARLSTERDILRSA
AKYFAGETNW
108798595YP_638792.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMSGIRELCRSRRGLLRHRRPGTRGGPQDGGPFRGQDPGRGGCAQLSGGSV
GSRRRMTSRVVIVGSSVGGVRTAQALRSQGYDGDIVLVGEETALPYDKPP
LSKALLAGTSDIAAATLLTRDAAAADAIELLLGRRAIGVDVAACQVEFAD
DEPLRYDHLVVATGASARPSPWGHGSGVHVLRTLEDCLRLRADLVAGARL
VVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSRVLTEEIGGWFVDLHR
DHGVHTRFGVGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVPNDGWL
MPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTN
AVDQASCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPLV
VGDRLSDNRFTALYPDREQRLSGAAIVNWPRALIECRRALKAGSDLETVR
ERLELLTNPPDTAATRSP
108798593YP_638790.1 3-phenylpropionate dioxygenase subunit beta [Mycobacterium sp. MCS]MTVDDQRTGRPMAPSVLGAHAARAQRVGDPLPFDDSRHLEAHRFLVNEAY
LLDAQDYDRWLGVLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSL
SRRVARFATEHAWTEDPPSRLRHFITNVRTFLTDDADHLAVDSAELLFRS
RGDVNESTLLSCGREDLLRRDGNALKLARRTIAVDESVLRMQNLAVFL
108798591YP_638788.1 IclR family transcriptional regulator [Mycobacterium sp. MCS]MQEGDFSSAGTRVVAIRRAAFGPLRGTLSVMQKPPLAGMEHDSTGKPPQY
PIESVDNALRLLLLLGERSEIRLTDASEYLRVASSTAHRLLSMLQYRGFV
RQDPASKAYQPGPSLTNVAFAVHSRMDIPRTAAPILRQLVDTLQETVHVG
TLDGRLVRFIAALESPSAVRVISRLGSTRPAHCTSTGKVLLAGLSDDELD
QLYPDPHLEPLTEHSVRTLTELRAQLAEVRKSGFAISRQESEEGVASVAV
AVPQSGSGIRLALNASAPSYRFRPSDVRKACSALTDAAAELARNLGS
108798589YP_638786.1 two component LuxR family transcriptional regulator [Mycobacterium sp.MMDLRMKRVDGIEATRRLARHEAPTVLALTTFNEDKLLSGALRAGVAGFV
LKDSSAEELIRAVRAVARGDSYLDPAVTARVLNTYRRAPDMPRALTSVDL
TTRELDVLRLIGRGYSNAEIATELHISEVTVKSHIGHIFLKLELRDRAAA
IVYSYDHGIVAPQ
108798587YP_638784.1 hypothetical protein Mmcs_1617 [Mycobacterium sp. MCS]MNRDKRRAAIRRRIAELQRNRLSLALGGGSSQESAELAQQRAHESLRSAQ
DAHHVAAEQHERAARAHEDAANLHQQAVMDGVRDSRRHQQAADDHWEAAN
EDHLAALEDEKQAVDPPESSSGGLTL
108798585YP_638782.1 diguanylate cyclase/phosphodiesterase [Mycobacterium sp. MCS]MCWRGIMGWLPANCGGSVSVKSAQWRLMVFAVVAVLAWVNALAIFGDDVA
RRVAVVLQATAGVSALVAAVLVARKSAGVARWWRLLVIAAMGSWLVAEMV
WFFGGAGRGGDEAHPVAVVAYFLPPVLSLAAMVVLARGGGGLRGRHSGLR
HSRVVAVLDGLVAASAFSILAFIAGLGAMTGAALPRSQSVPVVVAYSLLE
VVVVVVAALMAMAYRRDRPDRVNYLLLSGGVLTIAASDRLIAYLRTVGAE
SGDLWAGVGFTLGPLIIAFAVLEVRPKPVTGRGEDAMDWLQAFLPYIGFL
CIIGLLSYHLLIGRDMPKLVIAVAVVMIALVTARQVVAMRAQRLVTNQLY
EAQRRLAHQVHHDPLTGLPNRVLFAKRLDEAMHDGKFVLIFVDIDDFKEV
NDQFGHAAGDDLLCAVGERLRRCVGPSDTLARIGGDEFAILVEGEHDAPE
VVADKLRVALRDPFAVHGSSVRVRASMGLVRPSVDEPNPTSDDLLRQADI
SMYAGKRLGKDTAVVYRPSSGVSVDFPSALRQADGGVPKGFTLAYQPVVT
LPHAAPVAVEALARWTAPNGMQISPETFVAVAEGAGLGGALDAMVLDLAC
REMEAAGLDVALHVNIGAARLGNRGFEQQVVRTLERHGIEPERLVLEITE
TVPIVDLAKGAAAIRRLRSFGVQVALDDFGAGFNSLNYLHALPIDVVKLD
RSLVVGGEPDRDVALYRSVIGLCDALGLDVIAEGIEYPEQADTVFAAGCR
MAQGHLFGRAVPLSELGRVLSAAWEEAVPRP
108798583YP_638780.1 SsrA-binding protein [Mycobacterium sp. MCS]MAAKKAGKAGATKDRNNQVVASNRRARHNYAILDTYEAGIALMGTEVKSL
RDGQASLADAFATVDDGEIWLRNLHIPEYQHGSWTNHAPRRNRKLLLHRR
EIDNLIGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDLARR
DAEREVVRELGRRAKGMS
108798581YP_638778.1 cell division ATP-binding protein FtsE [Mycobacterium sp. MCS]MITLDHVTKQYKSSARPALDNVSLQIDKGEFVFLIGPSGSGKSTFMRLLL
AEDTPTSGDIRVSKFHVNKLPGRQIPSLRQVMGCVFQDFRLLQQKTVFEN
VAFALEVIGKRAEVINRVVPEVLEMVGLSGKANRLPAELSGGEQQRVAIA
RAFVNRPLVLLADEPTGNLDPETSKDIMDLLERINRTGTTVLMATHDHHI
VDSMRQRVLELELGRLVRDEQRGVYGMDR
108798579YP_638776.1 mechanosensitive ion channel MscS [Mycobacterium sp. MCS]MTTSTTLAIGFAEGWHDFWHGDIGVWVMTRGLQIALLVIGALLGARFINW
VARRVTRRIDAEYQESDQLVRSESAKHRQAVASVISWVSIAVLFVVVGMQ
ITAVLNIPVGSLVAPAAVLGAALGFGAQKLVQDLLAGFFIITERQYGFGD
LVQLNMIGATDAAEGTVEEVTLRVTKLRTSEGEVFTVPNGNIVRSLNMSK
DWARAVVDIPVPTTADLNDVNELLHRVGEDAMDDVKLSALLLDTPQLMGV
ESIEVDTVNLRMVARTLPGKQFEVGRRLRIRIIAALTRAGIATKDHTPKV
DTIAGHGEAPPQSRTESRQ
108798577YP_638774.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacterMPQKRPYHVAIVGSGPSGYFAASSLLKFADSDDADRDVRVDMLEMLPTPW
GLVRSGVAPDHPKIKSISAQFDKTSGDPRFRFFGNIAVGEHVHPEELAER
YDAVVYAVGAQSDRALNIPGEHLPGSVAAVDFVGWYNAHPHFEQMGPDLS
TGRAIVVGNGNVALDVARILVTDPEALSRTDIADHALESLHRRGVEEVVV
IGRRGPLQATFTTLELRELGDLEGLGDVDVIVDPADLADITDDELEAAGK
TVKQNVKVLRGYAERPPRGATRRIVFRFRTSPIEIKGREHVESIVLGRNE
LVDDNGRVVAKDTGEREELPAQLVVRAVGYRGVPTPGLPFDERSGTIPHT
DGRIDGRRNEYVVGWIKRGPSGVIGSNKKDSQATVDTVVGDLRGASLADF
GDDHSDRLVEWLVSRQPKLVTDDHWKLIDEHERSAGQTAGRPRVKLTSVA
ELLRIGHG
108798575YP_638772.1 histidinol-phosphate phosphatase [Mycobacterium sp. MCS]MLVDRRAVDHPGDRDELLPRHVIRTGADAGHQQSPLSEFASRTPAPHDPR
RGQHGDRPDQQQEHSEFPHTAMVGLADMSTGSSSVADDLALALRLADHAD
AVTVDRFRALDLHVETKPDLTPVTDADRSVENDLRRALAGERGDDSVLGE
EFGGTAVFSGRQWVIDPIDGTKNFVRGVPIWATLISLLNDGVPVVGVVSA
PALHRRWWAADGLGAFVTVSGESPRRLSVSKVAELDSASLSFSSLSGWAK
RGLRDRFIDLTDAVWRVRGFGDFFSYCLLAEGAVDIAAEPEVSLWDLAAI
DILVREAGGTFTNLDGAAGPHGGSVVASNGLLHDAALGHLSR
108798573YP_638770.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MAINLELPKKLHAVIEKAHQGAAEMLRPISRKYDLREHDYPVELDTLATL
FEGISEANTISFAGAEAFRDAEDGPKGNVNGGNMSAVLNVTEISWGDVGL
MLSVPRQGLGNAAISGVATDEQLERLGKGVWAAMAITEPGFGSDSAAVST
TARLEGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGRAAIKSFIVPRD
HPGVTVERLEDKLGIKASDTAVIRFDNARIPKDNLLGDPEIHVEKGFAGV
METFDNTRPVVAGMAVGIGRAALEELRKILTDAGVEISYDKPAHAQSAAA
AEFLRLEADWEAGYLLTVRSAWQADNAIPNSKEASMAKAKAARVGSDITL
KVVEMAGTVGYSEESLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLTS
AQLK
108798571YP_638768.1 hypothetical protein Mmcs_1601 [Mycobacterium sp. MCS]MRASLTACVLAAGLLVGCSGGGQPPTDAAAVHVHDAWVKAADGGMTAAFA
HLTNGADREVRITSATTPAAARVELHEVVRDGGMPTMQPKQGGIALPAGA
DVELLPGGDHLMLMDLTAPLTPGSDVEITATFDDGSTLPITAQVREFPGA
DEHYGGGHHG
108798569YP_638766.1 hypothetical protein Mmcs_1599 [Mycobacterium sp. MCS]MTSRAGALCGVLVGACSGLFAVSAHALAGGDVPTGPTLVLVALVCAAVGA
FAGANGRAQAAGLIAAVGAGQLLTHIVLAVTAGHHGGGHEVLPSAPMMLA
HALAAVALGLLICLVGHLYRVCVSVLCWLTLTLVHRGRPSAPRRHRTTSI
VVQLLLLRSGLGMRAPPSAVSFGG
108798567YP_638764.1 zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]MNSFQALVARQSDDKIDTAVETLEESALPPGEVTIRVHYSSVNFKDALAV
TPKGGVVRDYPIVPGIDLTGEVVASQSDEFGVGDLVLAHGYDIGTGKHGG
YAEFARLPADQVVALGALSPREGAAIGTAGFTAAMSVEALTERGIRPDDG
PIVVTGASGGVGSVSVDLLSALGYHVVASTGKPEQADLLRALGATEVIGR
LPEDPDVKPRPLGKARWAGAVDCVGGATLADVLSTLAYGGAVAASGLTGG
PALNTTVMPFILRGAALLGIDSVLLPIGPRRELWARLGGALKPPHLADLS
HDVDVKDVVEVIDEVRAGRYSGRAVVRVAGGF
108798565YP_638762.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MNWGSAESRSTARHLRIRLMSTAMPRPRSSGGGRLSVDDWIHQGYVIVAE
EGLAALKVDRLCDRLGVTKGSFYWHFDDMPAYRAALVAAWGRLRDEDCRR
LDDMAGLPPRERLSQMMSELVSAPHWTMERAMREWARSDEAVAASMRAAD
RALVGRLRRALLDDGFDEEDADLRANAIFAAGVGFIHLSGPTPEAGQASR
RDRFLELMLRR
108798563YP_638760.1 hypothetical protein Mmcs_1593 [Mycobacterium sp. MCS]MPGLRDTVTHTFQKRIANPVMRRLPFQTLLETTGRKSGQPRRTPLGGKRI
GDQFWFVSEFGERSQYIRNIKADPHVRVRLRGRWHTGVAHLVPEDDPHAR
LRELPQFNSFGVRTFGTDLLTVRVDLTG
108798561YP_638758.1 homogentisate 1-2-dioxygenase [Mycobacterium sp. MCS]MESFVHLRKGKTPRRPHADLDGQKDDELGRGGFTGRTANMYRRNDPTAFR
TVGPLRPIDVLGDQLKPGDATDADGAPLLMFSNADCQVLLSRRSQEMPYF
ARYVDGDLLSFVHTGSGLLETEFGPLRYRAGDWVYIPKACTFRQIPDTES
TLLMIQATDEFRVPPAGPLGRHFPFDPSQAEIPEPAPIDDGVGPQVDGEY
EVRLFHEGGPTSLFYQHHPLDVEGWRGDNFAFTFNIEDYNVVTSDSVHLP
ATAHLFMQATGVYVMNFLPKPAEGVPGTERTPWYHRNVDYDEIAFFHGGT
LYGIPMPPGLISHAPQGVHHGAPEKARERARRKFDEYQRVDWQVIAVDTR
RRLIPSPEVLANDLGQHS
108798559YP_638756.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium sMAGALDGIRVIEVGTLISGPFAGRLLGDMGAEVLKIEPPAAPDPLRTWGQ
AELDGHHFFWTVHARNKKAITLDLRTPRGREIFLELVEQTDVIVENFRPG
TLERWDLGYDVLRERNKGIILVRVSGYGQTGPDAHRAGYASVAEAASGLR
HLNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRTVTGEGQVVDTAL
TESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYRTADGSWVVIAA
NQDTVFRRLCAAMGQPELATDDRFADHRARGRNQDELDKIIGDWAAERQP
GDIIETLSAAGVIAGPINTVAEVVDDPQLRARGMLAEHWDERVDRAVLGP
GIVPVLSESPGSIRNAGPAHPGQHNIEVYTGLLGKTAEEVAQLQAEGVL
108798557YP_638754.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MAPESSTLSSKGRQTRLAIEQAARKLFAERGFHGTTLADITSAAGKSPAV
FYRYFDDKEDLLAALAQSFLHDVVAPSGLSVPLPSSPDDREFFTTVVTGY
WNIFKQNIGIMIAVAQLAAAQQRFADLQHEFRRFGMDVIAASVRHAQSQG
YGAELNAEYTAAAIALLFENFTVVMVGTSGLGVQMSDADAIATLSTIWKK
TLYGY
108798555YP_638752.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MRTELEAVLRPILGEVAVENLTTLTGGASRTTWAFDAVTPDTRRALILRT
GPPDEVHAGMELEARAQQRAAAVGAPVPHILTADNDAAALGNPYLICEAI
GGETIVRRIYRSLDDAGRRRLLTQCAEALAAVHRADPNGIGLTESDEITE
WRERLDEMGDTTATFEWAFRWLAAHRPPPSPHRLVHGDFRMGNLIVDDTG
LVAVLDWELVHVGEIYEDLAWFCIRAWRFGASERLGAGGLGSVEDFLTAY
ETASGEALDRSAFRWWLTVATLRWGVICRFQAERHLSGQTPSVELAAIGR
RVCETEWDLLDLLEGGGPR
108798553YP_638750.1 type 11 methyltransferase [Mycobacterium sp. MCS]MYAGGAAPWVIGEPQPAVVDLERRGAISGAVLDAGCGAGEHTILLTGLGY
DVLGVDFSARAVELARANAAARGVNARFEVADATRLDGGPRFDTVVDSAL
FHVFDDIDRRRYVDSLASVCRPGAVVHILALSDAGRGFGPQVSEADIRTA
FTDGWRVESVETTTYRGVVGPAHADALGLPVGARVDEPAWLARVRRS
108798551YP_638748.1 response regulator receiver protein [Mycobacterium sp. MCS]MAAPPRTLRILVYSDNPQTREAVRLALGKRIHPDLPELGYLDVATAPMVI
KQLDAGGFDLAILDGEATPAGGMGVAKQIKDEIADAPPILVLTGRPDDAW
LATWSRAEAAVPHPIDPIRLGDAVVSLLRLSAQQ
108798549YP_638746.1 NADH dehydrogenase subunit B [Mycobacterium sp. MCS]MGLEERLPGGILLSTVEKVAGYVRAGSLWPATFGLACCAIEMMSTAGPRF
DISRFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLHAIIKLHEKI
QQMPLGVNRDEAIREAEQAALAVPSTIELKGLLR
108798547YP_638744.1 NADH dehydrogenase subunit D [Mycobacterium sp. MCS]MTTPPGPPNAGGDARTGTDTVIVVGGEDWEQVVAAAEQAQAGERIVVNMG
PQHPSTHGVLRLILEIEGETITEARCGIGYLHTGIEKNLEYRNWTQGVTF
VTRMDYLSPFFNETAYCLGVEKLLGVTDAIPERVNVIRVMLMELNRISSH
LVALATGGMELGAMSAMFYGFREREEILSVFEMITGLRMNHAYIRPGGLA
ADLPDGAVPRIRELLALLPGRLRDLENLLNENYIWKARTQGIGYLDLAGC
MALGITGPVLRSTGLPHDLRRAQPYCGYEDYEFDVITDDGCDAYGRYLIR
VKEMRESLKIVEQCVDRLKPGPVMIADKKLAWPADLELGPDGLGNSPAHI
ARIMGQSMEGLIHHFKLVTEGIRVPAGQVYTAVESPRGELGVHMVSDGGT
RPYRVHYRDPSFTNLQAVAAMCEGGMVADAISAVASIDPVMGGVDR
108798545YP_638742.1 NADH-quinone oxidoreductase subunit F [Mycobacterium sp. MCS]MTALTPVLSRFWDEPESWTLETYRRHGGYRALEQALGTAPDDVITTIKDS
GLRGRGGAGFPTGTKWSFIPQGDEGPAAKPHYLVINADESEPGTCKDIPL
LLTTPHFLVEGAIIAAYAIRAHHAFIYVRGEVVPVLRRLQAAVAEAYEAG
YLGTDIRGSGFDLDLIVHAGAGAYICGEETALLDSLEGRRGQPRLRPPFP
AVAGLYACPTVVNNVESIASVPPILLGGIDWFRSMGSEKSPGFTLYSLSG
HVTRPGQYEAPLGITLRELLEYAGGVRAGHELKFWTPGGSSTPLLTGEHL
DVPLDYEGMASVGSMLGTKALQIFDETTCVVRAVRRWTQFYAHESCGKCT
PCREGTYWLAQIYARLESGEATEADVDKLLDISDTILGKSFCALGDGAAS
PIISSIKYFRDEYLAHLGNGCPFDPHASTLMAGQEVGV
108798543YP_638740.1 NADH dehydrogenase subunit H [Mycobacterium sp. MCS]MIHPDPTLFGHDPWWLILAKAVGVFVFLVLTVLAAILIERKVLGRMQMRF
GPNRVGPKGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLA
FAVIPMGGEVSVFGHRTALQLTDLAVAVLYILAVTSVGVYGIVLAGWASG
STYPLLGGLRSSAQVVSYEIAMALSFATVFLYAGTMSTSGIVAAQTSTWY
VFLLLPSFLVYVTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFM
LAEYVNMTTVSALATTMFLGGWHAPWPISLWEGANSGWWPLLWFTAKVWV
FLFVYIWLRGTLPRLRYDQFMAIGWKMLIPVSLAWIMIVATAHSLRTTGH
GGWASGLLIAGTVLTFGLAVILWRTMRFRADRTVPARTAADVFPIPPIPG
RAGTARTPESRETTDA
108798541YP_638738.1 NADH dehydrogenase subunit J [Mycobacterium sp. MCS]MVLAADGAARTSTSEAVVFWILGGIALIGALGVVSAPKAVYSAIFLATTM
IALAVLYIAQEALFLGVVQIVVYTGAVMMLFLFVLMLVGVDNSESLVETI
RGQRVAAIAVGVGFGVLLIAGIGTVSTSGFTGLPDANSSGNVEGLAALIF
TRYLWAFELTGALLITAALGAMVLAHRERFEHRKTQRELSIERFQDGGHA
TPMPNPGVYARHNAVDMPGRLPDGSGAKTSVSTILQPREVPENGRNGDR
108798539YP_638736.1 nitric-oxide reductase subunit B [Mycobacterium sp. MCS]MAIDTSGTVGRSAGEEKQPAIGKGWVQAVALVMIFGFFIMGILAYRTYTA
SMPMPDRVVDESGQELFTGADITRGQELFQARGLMQYGSVHGHGAYLGPD
YTADYLRRAADDVTAQFERAGEAQVQERVVEEFRTNRFDDRTKTLVFTDR
QAAAFDRIQQHYVAHFGADARKNGLSPDLITDPEEIRDLTAFFAWSAWAS
AAERPGHNYTYTNNWPAEPRVDNGPTADLIVWSALSLIALLGGTGILFAV
YGRWSQRIGWHAEDAPAISYHQPGEVTLTRSQRATVWFFAIVSVLFLAQA
LLGALTEHYRADLSSFFGLDLARWLPYNLARTWHVQLSLFWTAAAFLAGG
IFLTPFITRREPRRQHWLAYGLLGAVALVVFGSLISEALSIFGVIPEGTL
LSQQWEYLDLPRLWQILLIVGLFLWIAIVWRGLRSSLKTSSKTSMPWMFF
FAGLAIPAFYAVGLLAGSDTHFSVADFWRFWVVHLWVEDFLELFTTVMVA
YIFVLLGVVRQRIALGIIFLDIILYSAGGVIGTMHHLYFSGTPVEHMALG
AFFSAAEVIPLTFLTVEAWTFLQLGSRQQTGDTKPFPHRWSVMFLVAVGF
WNFLGAGVFGFLINLPIVSYYQIGTALTANHAHGAMMGVYGMLAVGMAMF
AFRYIIPADKWPERLARLSFWSLNIGLAWMVFATLLPLGVLQLYHSVNDG
YFEARSLGYITQPGNVLLEWMRMPGDIVFIGGGILPLLWIAWVAIKSFWQ
GRNTAYVDELPDEPLYTELPAAAGARNVGDTTP
108798537YP_638734.1 hypothetical protein Mmcs_1567 [Mycobacterium sp. MCS]MTWLIPVAAAALVVVVVLYLSLKVIPEYERGVVFRAGRLRPLYGPGVKFL
IPVVDRLIRVDQRVVTLTIPPQEVITKDNVPARVNAVVMFRVTDPLNAIV
AVENYSVATSQIAQTTLRSLLGRADLDTLLAHRDDLNQDLRTIIEKQTCD
WGVEVSVVEIKDVEIPESMQRAMAREAEAERERRAKVINAHGELQASDEL
RQAAETLSKSPASLQLRYLQTLLELGADQNSTVVFPLPVDIITPFLRGLK
S
108798535YP_638732.1 NADH dehydrogenase subunit M [Mycobacterium sp. MCS]MIPWLSVLWAAPIVGAGVVMLVPRRTLAKWVALAVSLVALAVTAVVAVGF
DPGGEQYQFVESRQWIPSFGTGYILGVDGIALALIVLTAVLVPLLIVAGW
NDADRAPQRRSVHTYLALTLAVEGMVFMSLVALDVLLFYVFFEAMLIPMY
FLIGGFGADRAASSKAAVKFLLYNLFGGLIMLAAVIGLYVTTAASDAFEG
GTFDFRAIVAAVAAGDFAVNPAVLNLMFLGFMFAFAVKAPLWPLHRWLPD
AAVEATPASAVLMMAVMDKVGTFGMLRYCLQLFPDAATLFRPLIITLAVV
GIVYGAVVAIGQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGSALYMV
NHGISTAALFLIAGFLVSQRGSRLIASYGGVQKVAPVLAGTFLVAGLATL
SLPGLAPFISEFLVLIGTFTRYPVLAVVAATALVLSAIYVLWMYQRMMTG
PVRDGNERLRDLVPRELAVVTPLIALLLVLGVYPKPALDVIDPAVGHTLT
TINQPDPTPKVAEGAAR
108798533YP_638730.1 enoyl-CoA hydratase [Mycobacterium sp. MCS]MTSLVQVADVDHVRLLTMNRPEARNALSRDLIRALYASLSEADDDASVHV
VVLTGADPAFCAGVDLKEAAREGTEYFAEFQSQSCITRVAEMRTPVIGAV
NGAVFTGGLEMALGCDFLIASHRAVFADTHARVGILPGGGMTARLPQVVG
AAMARRLSMTGEVVDAERAERIGLVTEVVPHERLLDRAIELAAQIAEVPA
ATMAGLKEIYTRGADAVISPALAAEQDIAGSQARDFAGLSTRFDDVTARN
RAQIATD
108798531YP_638728.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MKADPSVVDKVQTAGRPRDPRIDAAILRATADLLVEIGYSNLTMAAVAER
AGTTKTALYRRWSSKAELVHEAAFPAAPTALDTPAGDIAADVRAMIGAAR
DVFTSPVVRAALPGLIADVADDADLNTRVMARFTDLFAAVRVRLEDAITR
GEVHGDIEPDRLIEVIGGATMLRLLLLPGSDLDEAWVDQTAAIVTRGVMA
108798529YP_638726.1 hypothetical protein Mmcs_1559 [Mycobacterium sp. MCS]MLGPMDEFPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRSGDIFLITGIGY
YPNLGVKDAFVLVSRRGGGEKGLLGDTHTAVHLSDGIDQDRLNQHVGNYR
VEVSEPLRKLRIVMDETEGVAVDLTWEGLFDVVQEQPHVMRTGNRVTLDA
QRFAQVGAWSGRILLDGQEIAVDPQTWIGTRDRSWGIRPIGEAEPAGRPA
DPPFEGMWWLYVPMAFDDFAIVLIIQEDPTGFRSLNDCTRVWRDGRVEQL
GWPRVRIHYTSGTRIPYGATIEATAGDGSPVVFEVESKLPVPIHIGGGYG
GDSDWLHGVWKGEKFTERRDYDLSDPSVSGRAMFGVIDHVGRATCSVDGR
TVEGWGLFEHGALGRHDPSGFADWLTLAP
108798527YP_638724.1 hypothetical protein Mmcs_1557 [Mycobacterium sp. MCS]MTALFGPTDAIRRAHALREAGADGVFTFEGPHDVFTPLTLAATVGGLDLM
TNVAIAFPRNPIHLAHQAIDHQVLSGGRFTLGLGTQIRTQIEKRFGADFD
RPVARMTEMIGALRAIFATWSTGEPLDFRGEFYRHTLMTPNFTPRGNDFG
PPPIYVGALGPRLTRATAEHADGLLVMPFGTKRFLHESTMTAVAEGLAAA
GRDAAEFTVVPEVIVSVASEQNPDHAATRQLLAFYGSTPAYRPVLDLHGW
GDLQPELHAMSKQGRWQEMATLIPDDMLHTIAACGTPAEIAAHIRDRVGG
VADRICLYQPQPIDVDSLAQIVDALRG
108798525YP_638722.1 alpha/beta hydrolase fold protein [Mycobacterium sp. MCS]MSRARSTSRFAAAKSLPPSRVVPVRSVDGVRLHTEVFGPENAPPVVLAHG
ITCAIRVWAYQIADLARDHRVIAFDHRGHGRSGVPPRRGNYSLDYLAADL
DAVLDATVAPGERAVVAGHSMGGIAISSWAERFPERVAQRAAGVALINTT
TGDLLRDIQFLPVPHRLSATRVRAAGTVIKTFGAAPLLAAAHRPGRRFVS
ELAVGRAADPEVAAFVFELFAGTPAAGRGGWARVLVESLGPRHIGLENLH
VPTLVIGSDKDRLLPITSAKRIAESVPNLAAFLELSGGHCAILERPHEVN
GALRNLVESVATPRRATS
108798523YP_638720.1 hypothetical protein Mmcs_1553 [Mycobacterium sp. MCS]MSGKHRSPEPMTQHRTTQWPVVVGGSLSFAVASAGVLAGAIVHFSSPGPA
PAAPEAPQATSSAPVTQNGTVIAVTADSVTTRSDDGLIQTYRITPDTHAV
TTDRQQPASPVTSFSVDDRVAVFATVQSGQPVATAVADQAAVGPDGPPMD
YVAAG
108798521YP_638718.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MKRRSDAEQNRARILAAARARIVASDDVKMNEIAKAAGVGQGTLYRHFPT
REALLAELYRDDVDALVASASELLERHPPFDALALWFDRVADYARVKRGV
FAAATDSARTELAGHSAGPIGGAVTTLLEAGKAAGQIRDDVDARDVILLL
GYLTRLDDAEWNVRAQRILTIILAGLRR
108798519YP_638716.1 putative ABC transporter [Mycobacterium sp. MCS]MLDHTPWGYVRQGCGSIKAARRDGSVRHAGEMTAATDLLDAVADLGAVLW
HTTFPLPAPSAWPAERDRRELTGQLADYLIPRLRSIDAPLLAVVGGSTGA
GKSTLINSLVGDDVSQSGVLRPTTRGPVIVCHPADLQWFTDDRILPQLPR
SAGPDGLRLAPHPGIGPGLALLDAPDIDSVVSSNRELAATLLAAADLWIF
LTTAARYADAVPWNMLHTARDRGTAIAVVLDRCPPEAVHDVAGHLQDMLA
AGGLNGAPLFVIAEQSLRNGRLKEKAIAPIRAWLGGLTADAEQRASVVRY
TLDGALRSLPPRTYALAGAADEQADVRAQLESCVRSSYDTALARVDEAIR
DGAMLRGEVLARWQDVVGTGEFLRRLESRVGRIRDRMVSAVSGRSTPVEE
LGSALESGIATVVRAAVEDAAEAAYGCWARHQAGALLLTDELARPAPGLP
EAVERLVRDWEGFVLELVRTEGASKRSGARLASYGVNGAGLVVMLAVFSQ
TAGLTGAEIAVAGGTTVAGQKVLEAIFGEQAVRGLARQARDELLARVGRL
LTEDSGRYHRILESAASPVSGDDLRRAANRIAAVLQ
108798517YP_638714.1 type 11 methyltransferase [Mycobacterium sp. MCS]MTEAMDAEFDTVAEWTAQVAADLGPDFYIPAGCRGSGSPAALDWLIEQLA
LTAEDSLLDCGAGVGGPAAYAAKAVALQPLLVEPEAGACRAARTLFGFPV
VQAVGSALPLADASVDAAWSLGVLCTTPHQLELLSEMRRTVRPPGRIALL
AFVSREPLLTKQPEGNHFPARGELIELIADAGLRIEKWRSTADLPAIPQE
WTDRVDAVTNALAERHGASRAWQLAERQSGRIADLLAEGAVTGEMLVLRH
A
108798515YP_638712.1 hypothetical protein Mmcs_1545 [Mycobacterium sp. MCS]MTVTAIQIGLAPEVIDYSSPDFAQFANLSRETLRAANDRNVDELRAAGYH
VDNCLIDFGEAGAAKAREWLSAKRYDAVLIGAGVRMVARNTWLFEAIVNA
AHVSQPACRFVFNREAKATPDDIRRWYPDPEAHR
108798513YP_638710.1 adenylate/guanylate cyclase [Mycobacterium sp. MCS]MLDDPHMDIALWVVVLLEFAGLVTLGVLLLVARRRLASARKQVVRRSDGD
GPRRRRRPMGVAPLAIKTVANTVQTADSIIRRQLGASVRSSIEDLAGWAR
VERPDLARITADGRVVLVFSDIEGSTQRNATLGDRDWVELLERHEQLIRR
QVTAHRGFVVKNQGDGFMIAFPEPAGAVRCCIAVQQALLQDGYATDGIRV
RMGVHVGTSVRRGDDLFGLDVATAARVADLADGGQILVSEALRGAVGEDA
GIDFGTRRDVELKGLPAPQTVYAVEIPRS
108798511YP_638708.1 lipid-transfer protein [Mycobacterium sp. MCS]MQSTVCIAGVGMTPFAKPGKSADYQQMGAQAARAALADAGLDYAKVEQAY
AGYVYGDSTSGQATLYHLGLSGIPVVNVNNNCSTGSSALWLARQAVASGV
ADCVLALGFEQMRPGALAAVWDDRPSSTGKFEKIALGRPGADPKAPMAAQ
LFGGAGVAHMERFGTKPETFGRISVKARQHAARNPFAVFRDPVTLDEVMA
SPTIWGPLTRLQCCPPTCGAAAAVVCSTEFAAAHGIDGAVGIRAQSLVTD
LPGAFDGEDMRRVVGYDMTAKAAADVYEAAGVGPEDIPVVELHDCFTTNE
LITYEGLGLTPEGTAEKFILDGDNTYGGRVVTNPSGGLLSKGHPLGATGL
AQCAELVWQLRGEAGDRQVEGARLGLQHNLGLGGACVVTLYEKSA
108798509YP_638706.1 MaoC-like dehydratase [Mycobacterium sp. MCS]MTTDIADIQVGTEVPALAVQPITRTTLALFAGASGDHNPIHIDLDAAKEA
GFDDVFAHGMLSMAYLGRLITSWVPQSQLRSLSTRFSAITPVHARPTCTG
TVTSVDEVDGERRATLDVQITLEDGTVTLRGEAVVAVR
108798507YP_638704.1 3-4-dihydroxy-2-butanone 4-phosphate synthase [Mycobacterium sp. MCS]MRDDMVVAEISCGRAAVILDGERGALLFFAAEAASAQLLNFAIRYSSGLI
HAAMRSDRLDRLRIHDQPVLPSEDRALGFTVSVDAVGTGTGISGQARAQT
LRALGSAQTTPEDLVRPGHVLPVRCPHVPRNAQDLVWDRMVRIVERAGCT
PVAAACRLVHDSGDVLDDAAAEDFAATFGLALVSAPQRVRVLAAGA
108798505YP_638702.1 alpha/beta hydrolase [Mycobacterium sp. MCS]MWEVVSEMGSSLIEEYLSDADREALARAEGDLGRVFGDGRVSVPELRARL
DEMMLAPGLPDGTAVTELDAGGVPTLRVETGSVDDSAAIVWLHGGGYLIG
SAHGYRAMAAAVSAASGHPVVVPDYRRAPENPYPAALQDAQAVMNWAAQA
YGDRWVLAGDSAGGGLTMASLIRARDAATPMPAGAVLVSPLADLTASGAS
FDTYAAEDMAISRRSVKHLAYAYLNGHDPGDPHVSPIFGTFDRMPPTLIM
ASDREVLLDDARTLHAAMQRDGSPSTLSVYAGVCHAWTMFASYMPRARRA
VDEISVFARAAIDAARTEGR
108798503YP_638700.1 hypothetical protein Mmcs_1533 [Mycobacterium sp. MCS]MRTTMTRALTRTAILLAASAGLAAAAVQPVAQADNRRFNSSVVQNVYTVQ
RQAGCTNDLNVSPQLLLAAEWHAKDLMGNRSLGGDTGSDGSTPQQRAEAA
GFRGGVAETIAIHPALAISGIELINLWYHNPAYHAIMSDCGFTKMGVWSE
NSLDRTVVVAVYGRPD
108798501YP_638698.1 hypothetical protein Mmcs_1531 [Mycobacterium sp. MCS]MTLNIENDIANDIEDHAEVDTEDVDVAQGEAPAETSGEATPVQAGRNIGR
IVAYVVLPVAVLAMACGVGFLKWQANSIGTSQATAAQSVSAATEIATAML
SYRADQVEQDLTAASDRMTGEFRNEYTTLINDVVIPGAKEKRVSAEATVP
AAALVSSSADRAEVLVYIDQTTTVGDDPPSATTSSARVSLEKVGDRWLLA
GFEPV
108798499YP_638696.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MLTRRVKLQLAVFALVALIAGGIMAFGYVRVPAMLGIGQYTVTVELPQAG
GLYQTGNVTYRGTKVGRVSDVRLTDNGGVEAVLSMDSSVAIPSDLDAEVH
STSAIGEQYVALVPRSDDAPPLKNGDVIPVDRASVPPPINTLLDAANSGI
QAIPRDNVKTVIDESYTAVGRLGPELSRIVQGSTRLAGDARANLDPILAL
IDKAKPVMDSQAETADSINAWASHLANLTDQVRDADPGVAGLLERGAGAA
EEARQLFDTVKPTLPVLLANLVSVGEVAVVYQPAIEQVLVLEPQLVASLQ
GALLANKDSQRFSPGLYVSFNLNLNLPPPCTTGFLPVDQQLAPNVETPAD
PVAGDLYCRIPKDSFNVVRGNRNYPCLNRPGKRAPTAKMCESDEEYVPLN
DGMNWKGDPNATLSGQDIPQLAPSPDPAPAAPPPIAVAEYDPATGEYLGP
DGKIYTQADLGSQTEGRTWQSMLIPPTAG
108798497YP_638694.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MRNRTLRIGLAFALVLVALAGGVVALRSMDHAGRTTITAYFDNSNGLFTG
DEVRILGVPVGAVETIEPQPERVKITFWVDDKYQVPADAKAVIVSPQLVT
ARAVQLTPAYSSGPAMADGAVIPEDRTAVPLEWDDLRTQLEKLTNALQPT
QPGGVSTLGQFVNTAADNLRGQGANIRETVTAMAKALSALGDHSGDTFST
LKNLSVVVSALEDSSELLGQLNRNLATVTGLLADDPDAVGNAINDLNAVV
AQATQFLRDNREAAGIATDRLAAITTAVNGGLDDIKQALHAFPNAAQNFA
NVYQPSQAALTGMLAVNNLADPIQFICGSIEAASRVNAVYSSKLCAQYLA
PIVKNRQMNFPPLGENLFVGQQARPNEITYSEDRLRPDFVPPAAPTEPAV
AEEPVATDPSAGLPGLMVPAGGGS
108798495YP_638692.1 virulence factor MCE-like protein [Mycobacterium sp. MCS]MPPWQSSSSPPNPGVLLTEATKAQIRWANPIGDRYMALLDGPGSAKRLTT
DVAIPVARTEPALDLDTLLGGFRPLFRALDPEQVNTLSSALIQAFQGEGV
TIGSFLRQASLVTNTLADRDELIGQVIGNLNAVLDTFGGRTDQFGKAVDS
LSQLVAALEARKTDVTNAVAYTNAASATVADLLTQARQPFKEAVAQSDRV
TSLVLADHEYFDDLLNTLPDAYKKLARLGSRGDFIPEYLCSLSLKVNGKG
GQPVYVKIAEQTTGRCAPK
108798493YP_638690.1 hypothetical protein Mmcs_1523 [Mycobacterium sp. MCS]MHRRVAGWVDGLSRIGTQAQFYFQTLGSTKDVVIHYKVELFRLVAQMSLG
VGALAVVGGTVVIVGFLTLSTGALVAVQGYNQFADVGVEALTGFASAYFN
VRLIGPVIAGIGLAATIGAGATAQLGAMRINEEIDALEVMGVRSVAYLAS
SRVLAGVIVVIPLYCVAVLSAFWAARFGTIAIYGQSSGVYDHYFTTFLNS
TDIIWSFFQAIAMAIVIMLVHTYYGFTATGGPAGVGEAVGRAVRTSLIAA
VLVVLFLSLAIYGQSGNFHLAG
108798491YP_638688.1 cytochrome P450 [Mycobacterium sp. MCS]MTTSEQTANVDSGAQDANSQELPVFPFKRQCPFAPADDYADGGSIRKVSF
KSLVPAWLVTDYSDVKAVLADRRSSVRNIPDPSRGDEGGEPLPGFFVAMD
PPDQTRLRKMLSREFTPRRMEAMRPAVERITNKLIDQILEQDGPVDLVQA
LALPLPSLVICELLGIPYDRHDWFQEETVKFLRLDTSPEEAAQTVASVMG
YLGELTVSKMDDPGDDLISLLLNHVRSGDLTIPEVAGMAAFLLMAGHETT
GNMISLGVYALLEHPDQLELLRQDPSRVPAAVEELLRFLDIIGNLPRYLT
EDIELAGQTIPAGDIVMVAMDKANRDPKQFEDPDTLNILRTDAKGHVAFG
HGIHVCLGAPLARVELQSVISTLFSRIPTLKVAVPSDEIQVKTEAKIFGL
KSLPVTW
108798489YP_638686.1 luciferase-like protein [Mycobacterium sp. MCS]MRIGTVLDFGRPMSDVGDEIAAWEAAGLSSVTLGEAYSFDAPTQLAYLAA
RTKSLELATGVLPLDTRTPTLIATTAAGLDYVSAGRARLGLGPSGPQVVE
GFHGIPFADTLGKTRETIEICRSVWRRETLVHEGRHYRVPLDPSRGTGLG
KPLKLINHPVRERIPISIASLGPRMVELTAELADAWEPIFFYPEKLQDVW
GEALARGTAKRQPDLGPLEIIARAPLAVTDGDSSAWVDAAKPQLALYVGG
MGSREKNFYNQLVASYGFAEEAAVIQDHFLAGRAKEAAAAVPDELVHATA
LIGDADHIRQRLTVLHEAGVTLVNVTPMATDPNQRLDAVKTVVALSKEI
108798487YP_638684.1 acetyl-CoA acetyltransferase [Mycobacterium sp. MCS]MPEEAFIYEAIRTPRGKQRGGALHEVKPISLVVGLVDEIRSRFPDLDESL
ISDLILGVVSPLGDQGAVLARTAVLAAKLPDTTGGVQLNRFCGSGLEAVN
TAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAWANDPETNYAVSFVPQG
IGADLIATMEGFSREDVDAYAVRSQQRAAAAWSGGYFAKSVVPVKDQNGL
VILDHDEHMRPNTTLESLSKLKPAFTDIGAMGGFNEVALQKYHTVEKINH
VHHGGNSSGIVDGAALVLIGSENAGVSQGLTPRARIVATATSGADGTIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLGIPDEKLNV
NGGAIAMGHPLGATGAMITGTMVDELERRGAKRALITLCIGGGMGVATII
ERV
108798485YP_638682.1 AMP-dependent synthetase and ligase [Mycobacterium sp. MCS]MYLTQALHRAVQQTPDLPATVFGERVRTWAQTADRAARLASAFQGLGVRS
GDRVALLAQNCDAYHDFLFAVPWADGVAVPVNTRWSVHEIAFSLEDAGAL
VLVVDDVFLDMVEELRELAPTVQAYIHAGDRARPEGVLDFEDIITAHDPI
EDARRGGDALAAIYYTGGTTGTPKGVMLSHANLMAAALGALSTGQFLEPR
GRLLHSAPMFHLADGSGWLARNLVGGTHVILPSFTPDAVAVAVERYQITD
MFLAPTMIQMFVDSPAAAQHDLSSLKHLIYGASPISQAVLERAMRLLPQV
KLLQAYGMTELSPTTTVLTGEEHLDPALLRSAGRAVPIAEVKIVDEDDNE
VPRGTVGEVAARGPHVMLGYWNRPEETAQALRGGWMHTGDGGYLDDNGYL
FIVDRIKDMIVTGGENVYSAEVENALAQHASVATCAVIGVPDADWGERVH
AVVVLQEGMTATAQELRDHCGSLIARYKAPRTVDFVDSLPLTAAAKVSKV
DLRQRYWKGASRSVN
108798483YP_638680.1 alpha/beta hydrolase [Mycobacterium sp. MCS]MIVGIVEGRKSQAKCSKVSANYAMIATMARTEALARVEKMYVEGFPDPAT
ASVEDLRTAYDELLLQFELPAGVEPVSGEIGGVPVLTVTAEGATRDKVLV
WCHGGGYVLGSARGFQDLGHTLSRASGVTVVLPDYRRAPENKFPAAVDDG
AAVISDLVSTLGATNVAVGGDSAGGGLTLAALTALRDGGTPLPAAAVFIS
PLLDFTASGASVDLYDGRDVAVSRGSIANLREAYLQGHDPQDPLASPVFA
DLGALPPSLFLVGSGEVLLDDSCRAAMAITEQGGTATVSVYDDMVHVWPL
FSSILPEGVDAANEAGAFIRKNLGL
108798481YP_638678.1 integrase catalytic subunit [Mycobacterium sp. MCS]MACLGPYRPEVLVSHRNARTTFHGRLLMVRRHQAGWPKAHIASAMGVSRK
CVHTWISRFEADGEAGLIDRSSRPHTSPMRTAQRLENQIVAWRRRHRCGP
EEIGAKLGVSARTVSRVLHRRGAPYLRDCDPMTGQVIRASKSTAVRYERG
RPGELVHMDVKKLGRIPDGGGWRAHGRGCAPDRKRLRGNGFDYIHSLVDD
HSRLAYSEILPDEKGSTCAGFLERAAHYFRAHGITTIEQVMTDNAWAYRY
SLRDVCTQLGARQIFIRPHCPWQNGKVERLNRTLQTEWAYKRVFTSNAHR
AAALAPWLKHYNTQRRHSALVTCSRLSGRFLLGVHAAVLVV
108798479YP_638676.1 transposase IS3/IS911 [Mycobacterium sp. MCS]MPAAHPEEFRRRAVELARLREKPIAQIAKDLGISESCLRRWMDQADVDEG
HKEGLSRDERAELVRLRREKRVLEMEVEILKRASAYFARENILPK
108798477YP_638674.1 TetR family transcriptional regulator [Mycobacterium sp. MCS]MPRATAARAETVKATLRSSARGRHRTEQVARAAAHLFQDYGYQNVSIDRI
GAAVGLTGPAVYRHFKGKHDILVHALMTQVHLVEELHTVTAEQGTTALEQ
LQLLLAGLGDITANGNEATLWRREQRHLEDAEREVFRRHFDENQERITAK
LLAVRPEVGEHKAELLGFAVLAMYSNTPNFRGNLSAERLQEIQSAAAWAI
IDCDLPAPAEGAGPIPDLGQRQPAGRRERIIDAAARLFTERGFYDVHIDD
IAKASEMSTATLYQHVSSKSEVLRAVLERGAEGLLYVTSDALAYAFTAEQ
ALDALITTYVRQALGVYGRIMHILATDLLYLPEEEQSALRNAQREYVAEW
VEAIEALSDDLSSADARALAQAAIGVVTDISQHPRLRQRPGIADELAALM
RAIVVPSGPTTA
108798475YP_638672.1 aminoglycoside phosphotransferase [Mycobacterium sp. MCS]MMTVVAEEETSMSDSASEFLTELAEVLGGRVAGGRPVELVDVDQRSEGNS
WETYLVAAAWDSGKHSASYAVKRQPLSGIVGSYDVGREVALLRAAQSIGL
PVPGVVAHRVGEPGNRGFFVMERLEGVVPMPHNVSRMIADADDRAALGRR
VAREMATLHAAAPEALALPELDAPPAPGDTGRVENDQWRRTYDEVATVRI
PVLDLALAWLDHRSDHVSGRVSLVHNDFRVGNLVVNPGDGGLVGILDWET
AHFSDPVADLAWFFQRTSRGRSPLACKLLGVEDFLDEYAQAAGWRPDPRT
LTWWAVQSLTKTAIGCLQAVAIFQRGDRRDLRYANMAHSVYYSLGWLNQM
LRDGEWGS
108798473YP_638670.1 acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]MRRTLYTEEHEAFRKAFRAFIDHDAVPHVEAWENSGTVDRAFIRAAGENG
FLGFEFGSEYGGLGIEDFRYNAVMTEEVVASGMAGDLFSMQNDIIVPYLR
DLTTAEQRDRWLPAFTRGECVTALGLTEPGAGSDLAAIKTSARRDGDHLV
LNGQKTFITSGATCDLAIVLVRTGERDGRGTTFVAVENGTPGFERGRPMH
KIGRRAQDTAELFFDDCRVPVSNIIGEPGRGFGCAIANLPRERLSIAVAA
VASARHALELGLEHARQRSAFGAPLAQLQSVRMQIAGMHTDIVVLQEYVD
RCVVALNDGELTAAEAAGAKYKATELQWEVLDRVLQLFGGYGYMEEYPIA
RMWRDARIQRIYGGANEVMKDLVGRAVVG
108798471YP_638668.1 hypothetical protein Mmcs_1501 [Mycobacterium sp. MCS]MDTSAPFTACQYGPDAEFTHEFAGIEKFNESVYVNFVDPVSEVSALMRIG
NRPTLGYSEATVQLTLPGGKIALRAGRQPNETNDKWSTQGLEIAPKDATR
TWEVNYRNTVALISTPSLLADRGRQALKNSPSLECEISLTFEASVPMFTI
EEGGDCTPGSSQIATDHYEQFGHVSGSVRVGSTTWTVDRATSFRDHSWGP
REWASYNGEWLAAWLADGTAITAYGEFEPNGVRVSGGVVITPDGVFHPIR
DYTVYTDYAGEATYDGRNTAVIAADGLPTMVLDGTINHFVPVTQRTADRA
ARMGQMSVRYANGHGGWGIGEFLRPISAR
108798469YP_638666.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MAAGHLDGKVALVSGSGRGIGRAVAEKLAAEGARVVINDLDAEPAKEVVA
AIEAAGGQATACVGSVTDPEFADRFVSTAVDNYGGLDIIVNNAGYTWDSV
IQKMTDQQWNDIIDVHLTAPFRILRAAQPVISGLAKKEKAENGVASRRAI
VNTSSTSGLQGNPGQVNYSTAKAGLIGMTKTLAKEWGRYNVTVNAIAYGV
INTRLTTITTEAKTIDVAGREIKVGVNPEVYEAVTTQIALGRGGSVEEAA
GAVYLLCAPESSYITAQTLVCSGGA
108798467YP_638664.1 hypothetical protein Mmcs_1497 [Mycobacterium sp. MCS]MIVTVGLVILVLAVIVGAVGLLGNAGPTHQMAEPFSVFGYHVTGSTGTLF
LVGIAVGAAAALGLAVLLAGARRTAERGRDARRQLALSRRESAFINRDPV
DVLEYRNPHTTSTSGVTAQPQGGVLGRWRHRKATRDRVDHGW
108798465YP_638662.1 hypothetical protein Mmcs_1495 [Mycobacterium sp. MCS]MNPSRPSTHAPRVEQHDRHLKIVELELPQQDSIRYDVMMQLCRPLTVFEI
DALIVHRSIGLDVSPDDPARLIATHTTIEEVRNRLPEFHELLCAAAADGH
AAQDSATEARDALTVEESRRQALVTDANASLGPCSHVHDAAVGMR
108798463YP_638660.1 DoxX protein [Mycobacterium sp. MCS]MDTTYSEAATDIPSRIRAADVGLLLLRVVFGGLLAAAGLQKLFGWFGGPG
LTDTGTVFEQIGYSPGVFFAAVAGSLETVGGILLMLGLFTPLACSIVVGV
MINAASATWSGGLFGQGGYQMALLYATAGAVIACTGAGVMAIDHGRPWQR
AGARWAAASIATGIAAAAAVLLLKAVV
108798461YP_638658.1 hypothetical protein Mmcs_1491 [Mycobacterium sp. MCS]MAGTIERASSTATSPSRDEFSERLLRGSAKKSYAPVVDVDWETPVVPDKF
FLPPRVVSLYGTRMWTEMTREQQIELSRQEFINLLSAGVWFENILNQALL
RGLMHADCTSAATHYSLTELGDETRHMVMFGRTIEAVGGKPFQPKRFQRM
IINALPLFFQKSVLWIAALVGEEIFDALQRQILDDPDLQPIVRRIMRIHV
TEEARHIQFARDGARRAVPAMRPVNRYLLATIHGAGGPFYRYLFTNPAVY
RRAGLDPREARRQARGNPHFHEAMRTGFAPLAAFLEEVGLMSAIGRRMWR
RCGFL
108798459YP_638656.1 cation diffusion facilitator family transporter [Mycobacterium sp. MCSMSAAIREVFAPHSHDASDSIDDALESSAAGVRAVKISLLALGATAVAQLV
IVLVSGSVALLADTIHNFSDALTAIPLWVAFVVGTKAATRRYTYGFGRAE
DIAGLFVVAMIALSAIVAGVESIRRLINPVPIENVGWVAVAGLVGFVGNE
LVALYRIRVGRRIGSVALVADGLHARTDGFTSLAVLFGAGGVALGFPLAD
PIIGLVITVAILAVLRTAVRDVFRRLMDGVEPELVDKAEAALAAEPGVTD
VRAVRMRWIGHRLHADAELDIDPATSLADAHRIAHEAEHTLTHAVPKLSS
ALVHAYPAEPSRRR
108798457YP_638654.1 hypothetical protein Mmcs_1487 [Mycobacterium sp. MCS]MPAGVAGIRVSGRVTADDFHQFKPTLDQMLDADEIRFVEVIGPDYEGFGP
GGLLADVKQGFSSVKHIRAFKRAAVVTDKEWIAHTLHALAWMIPGEVELF
GLDQLDAAKQWAAS
108798455YP_638652.1 cytochrome P450 [Mycobacterium sp. MCS]MTVTSAAPNVFDADLPTFSYGLTATPGDIIDDVRAAQSCSPIAIGPLGPE
ILSYDLARKMLRDNRFRLPPGITLAAQGITSGPLFDKITSSLLGLNGEPH
SRLRKLVSKAFTPRATARLQDTIHEVVNGLIDRVMDDGRCDVVTDIARPY
PTPIICALLGAPREDWHLFADWTEEVFKAFNFQTELTFDESEIMRAWGEL
DAYVDDMVAARRDNLTDDLLSELIRAESDGDRLNLDELRMLVAGFLMAGT
DTTRNQLAASVQVLCEHPDQWAKLGDQPELAMQAVEESMRHSPAACIVPR
VATEDAEFGGYTFPEGTFVLVNTFAANRDPAIYGDADRFDIARADVPAIL
TFGGGAHYCLGANLARRELAEALTVLTRRLPAPRRVGPAPWKSVLGMTGP
TTLPIEFTSGRVVTADA
108798453YP_638650.1 glycosyl transferase family protein [Mycobacterium sp. MCS]MRDKRRAKWQALARLAGCCLVAGLLAAALMFPFVGGAGSAIMRVSDSATE
ESTQLIEGEVPIVSTMVDTEGNPIAWLYEQRRWEVPSNRIANTMKLAIIS
IEDKRFSEHNGVDWQGTLTGLAGYLQGAERTRGGSTLEQQYVKNFNLLVK
AQTDADRRAAVENTPARKLREIRAALAMDAALPKAEILARYLNLVSFGNG
AFGVQDAAKTYFGINASELNWQQAAMLAGMVRSPSSLDPYTHPDATLERR
NVVLNTIIENLPDKADELRAAKDRPLGVLPRPDPLPQGCIAARDRAFFCA
YAMEYLARAGLSKEDVARNGYLIRTTLDPKVQDSVKNAIDEVADPTAVGV
ASVMSVIRPGKDAHRIVAMADSRTYGLDVNAGQTVQPQPFSLVGDGAGSI
FKIFTTAAALEMGMGINATLDVPQTFRGTGLGDSTEPGCPPKTWCVRNVS
GFAGQLNVTDALAKSPNTAFAKLISQIGVPRAMDMAVRLGLRSYAEPGTA
RAYDPESNESIADWVKRQNLGSFTLGPLELNALELSNVAATLASGGMWCP
PSPIDKVLDRNGDEVALAAAPCEQVVPEGLANTMANALGKDHTGGTATGA
AGSVGWDLPMSGKTGTTESHRSSGFLGFTNQYAAANYIFNDSPTPSGLCS
YPLRQCSDGDLYGGTEPARTWYMAMKPIANYFGPVAMPPTDPRYVDGGPG
SEVPSVTGLKLDAARKKLSEAGFQVAAEPTAVNSSSAKGTVVGTTPRGKT
IPGSIVTINTSTGYVPAPVYQPPRPSAPSAPSAPPPVEAPPPQPPPPNVF
EIPGLPPIMLPWPPPPPPPPPAPPPPPPPPA
108798451YP_638648.1 phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS]MPTKADGPSGADIDRLVNEPNRVRAMRKAIFAIADGLGPVIDLCRIYVDG
FENLPRDGRFLLVGNHTISGSAEIVLIPYFVHRELGVRVRGLASSQIADA
NGVVRDVMEAAGAVLGHPDTCAELMRKGETLLVFPGGGRDMVKFKGENYQ
LQWERRSGFARLAIANDYPIVPVGLVGGDDVYLSLIERDSAWERGSRAIG
ERVHGLPGVGIPLVRGVGPTLIPRPQRMYLRFAPPIDTARPARVDFDPWV
TTVKDRAQGALETALAELQELREIDPFRNLNPLAWRRAVRGG
108798449YP_638646.1 DSBA oxidoreductase [Mycobacterium sp. MCS]MTNHPVSVDFHFDVMCPFAYQTSRWIRSVRDQTGLEVNWRFFSLEEINRQ
EGKKHPWEREWSYGWSMMRIGALLRRQSMADVDAWYERAARALRVEGHKP
HEKTVARHLLEELGFDPGLVDQAIADQTTSDEVMADHKRVVDAGGYGVPT
LFFPDGQCLFGPVLIDPPVGEGALRLWDAVVAWTEFPHLYELQRPKTSAD
QQAIADTLRPYLEARDWVSINRGKVISFDDFR
108798447YP_638644.1 hypothetical protein Mmcs_1477 [Mycobacterium sp. MCS]MKLRGMLAVKRAAITTGAAVALCCATGGVVAPVASASPTDDAYLAAIEAN
GVPILGRDYVIALGHAICETARQYPSMPLVDLVLNDVGNENKPSPYSFDQ
GKVIATSALANYCPSGAAGSEPVAPVSAPPPASTPYTPAPNAPSVNAPNI
GCTWVNGYTKKNGTRVRGHYRC
108798445YP_638642.1 short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]MRLANKVTLVTGGSAGLGLAIAQRFGSEGAHVYITGRRREALEAARASIE
GRVTALTADATVPGDLDLLIETIRRESGHLDVVVANAGSIERMNFGDVTE
EHFDRTFDLNARGTLFTVQKALLTVQKALPLLRTGGSIVLLGSVTALQGH
PGAGTYSAAKAAVRSYARTWSAEFGDKGLRVEQ
108798443YP_638640.1 Toll-interleukin receptor [Mycobacterium sp. MCS]MSDHHCTMGCSQHPGRPDMPQAQFTRYDLGQQKRGAAAVVTLRGNAANVL
LLDASNFNSYRSGRSYRYAAGGLVTRSPFRLVIPSDGHWYVTVDLRSQGP
SARVNSTISMEPAPLPIARSAAPPSLQQIEVNRPPEGALRGGETWDVFIS
HASEDKASVARPLFESLRDLGVSVWFDEAELRIGDSLRRKIDQGLARSAF
GVVIFSEAFFAKGWPQYGLDGIVTRTVAGEQNLLPIWHKISKDEVRAQSP
SLADKVARSTSDLGIAEIADEIARRVRPDLFES
108798441YP_638638.1 hypothetical protein Mmcs_1470 [Mycobacterium sp. MCS]MTRISDQAALVYRNEMTAAKNAADASTRWRHLERAHIVSQPDPRLHTCNH
AAMLALALRQRDRREALGQVVRIIVAAPGSLSGRYPVGNTGRVAAGLMTP
MPIPDDLADLTS
108798439YP_638636.1 DSBA oxidoreductase [Mycobacterium sp. MCS]MMRHQTLREADHPGHVAHAQFIAGRQRRGDRQPGGITQAAGGRGRGSHRV
AIWHRGPDLLRVGQVQTQQIAGIQRLTHIHILKYVDMKTKGLSSILANTR
VLLTIFVIAVATVATAVFLSVRDSGSAAEVALDGSLAGQTVRDNSHRLNS
VPDSDVYFVEFLDFECEGCRALYPVVEQLRAEYGDRVNFVLRYFPLRSHF
NAERAARAVEAAAQQGQLEAMYKKMYETQAQWGEQQVPADDVFRGFAQQL
GLDMSTFDATYNDPATLERIQLDISDGTALGVQGTPTFFINDERIQPRSY
EDLTTALDQALAR
108798437YP_638634.1 hypothetical protein Mmcs_1466 [Mycobacterium sp. MCS]MTSPRPPLSFGAPLAGPIPTGAPRFPGTRIAGPGPGRQQQRLGPQFAALQ
EALQTGRVEVDGETTEADPELVVVFDLAAPVAEFARAAARVPGLEFLLEV
DGEEFAADDDFHPVRDGEATDDAVTDSLYVVMSNSQAVVDLLALFERWQE
NRQTAMPFGLAPLRDVFELLREVRRWGPQDRVRETGLLERWREDVAIVGQ
SRTMTRVEIELWFRRDAARRAVAERSVQTIIAEAGGHVITQAAIIGIGYH
AILADLPYSQVEAVLDRGPDAIALLTTDTIMYVSPARPMTIPAAAPSDEP
LDSQAFSAKPSGPRPRIALLDGLPMAGHIALSERLIIDDPDQIAATYTAS
QMQHGTAMASLICHGDLNAPGASTQRRLYVRPVMQPHPFNGDEETVLRDR
LLVDLIHEAFRRMFERHGQHDPVAPSVRIINLSIGDPIQMFVRRVSPLAK
LLDWLAHTYNVLILVSAGNHAIDADIPAAALLDTDELRRAVGTAMYEKAR
QRRLLSPAEAVNVISVGALHADAASTPTSDTVLDTTDTGMPALYSPVGFG
HRNSVKPEILLPGGRSLHQRPPVAEGTTTLYPAETTITGPGMRVAAPGRG
GSLNGTTYLHGTSNATAMATRTADHIFDVLEALQAVDGEPPFASAEYHPV
LTKALLVHAATWGPMRDELTRAIVGGEDLTRRDISQFLGYGAVDLERVIS
ATTTRVLLLGAGSITADQRHTFELPLPGSLAATTDWRRLTVTLAWLSPVN
TATRRHRMARLSFEPPRQPLGVDRLEAEARVSRNGTVQHEILEGRRAVAF
AVGDALEINVDCRVDVGRLAAPVRYGLAATLEVAPAIRVDIHQEVRQQLQ
TRLRTRTR
108798435YP_638632.1 hypothetical protein Mmcs_1464 [Mycobacterium sp. MCS]MASRSKGRWLRCHPVYVAPRTAKKTDSRLAARLAALASLGASVIHFAVVP
THWQEWMPAGLFFASFALFQLLWARLVLIRTTTPVLAAGIMLNLGAIALW
AVSRTSGAPFGPHAGEAELIQAADLCALLLQIYVVMGASWVWYRGLQGEP
VPVFGSALVLMGAFGVVALASTVGVASGLQHGHHSPTSADGGHHRTAPEN
GHSDHHGTGAGDAPADHHGTSAEPAEGDQHGTSAEHAHNPDSTHESAVPP
LVNEPADEPAPPEETPAPPAVTLHDDHGDHDHGD
108798433YP_638630.1 pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium sp. MCS]MNVTFARVEKALRQQTFGTLSTLTDHGAPHATGVVYAVSAPGEPLDLYVT
TRTTTRKVRNLRAHPEVAFVVPVPHRFLPAFPPRAIQFLGTATIVAADDK
GGNRAFDGSWFLRRILATERRIVTEGGDLCFIRVRPNGTVFTYAMGMSVW
DNLRQPRGAIGRVTIPEARR
108798431YP_638628.1 hypothetical protein Mmcs_1460 [Mycobacterium sp. MCS]MTVAAWLFVSGGVIMVGIGTFFLFTRPALLPEDLRYLGQTASDIDAAIPP
LRRWLRLVFTVLGGYAVATGILTIYLAANEIPDANSSAVAVLAVTGASSL
GVMTVVNFLLHSAFRWPLSAAAALWIAACAVSAAS
108798429YP_638626.1 ABC transporter-like protein [Mycobacterium sp. MCS]MSHRQQVLRGADLSLMPGEIVGLVGENGSGKSTMMKILVGELAADGGTVT
RSGVLGYCPQQPVVYERLTCDEHIELFARAYRMTHEAEGRARRDLYDALG
FERYASTRADRLSGGTLAKLNLALAMLADPPVLLLDEPYAGFDWDTYLKF
WDLVGRRRDGGRSVLIISHFVTDEHRFDRIVKLCEGRLCHGQCDADETCR
108798427YP_638624.1 integrase catalytic subunit [Mycobacterium sp. MCS]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
108798425YP_638622.1 hypothetical protein Mmcs_1454 [Mycobacterium sp. MCS]MTPADDTDHCPASGSTPHGYITDKEKYLKRLKRIEGQARGISRMIEEERY
CIDILTQADALTKALQGVALALLDDHLRHCVLDAAAVGGPAADNKLTEAS
EAIARLVRS
108798423YP_638620.1 heavy metal translocating P-type ATPase [Mycobacterium sp. MCS]MTTSTPVTEASVELQIGGMTCASCANRIERKLNKLDGVVATVNYATEKAT
VTVPEGYDPAQLIAVVEKTGYRASLPAPPTPPATASGQPEPARQTDDPEL
VSLRQRLIASTVLSVPVIAMAMIPVLQFTYWQWASLTLAAPVIVWAAWPF
HRAAWTNLRHGTATMDTLISLGTVSAFLWSLYALFFGTAGTAGMTHPFAL
TLAPSHGAANIYLEVAAGVTTFILAGRYFEKRSKRQAGAALRALLDLGAK
DVSVLRDGVESKIAIDDLVVGDEFVVRPGEKIATDGEVVSGTSAVDASML
TGESVPVEVSAGDTVVGATVNAGGRLVVRASRVGSDTQLAQMAALVERAQ
TGKAEVQRLADRISGVFVPIVIAIAVITLGAWLGAGFSVAAAFTAAVAVL
VIACPCALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRKVDTVVLDKT
GTVTTGTMTLVDVITTPGTERRELLRLAGALENASEHPIARAVATAAAEE
VGTLPTPQDFANAEGKGVHGVVDGHAVLVGRESMLTDWAQHLSAELAHAK
TRAEADGKTVVAVGWDGQPRGLLIIADTVKPTSAQAISQMRALGLTPILL
TGDNAAAARHIAAEVGIDTVIAEVMPQDKVDVIARLQAQGKTVAMVGDGV
NDAPALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRRTLA
TIKTNLFWAFAYNVAAIPVAALGMLNPMLAGAAMAFSSVFVVGNSLRLRG
FTSTSFNTTH
108798421YP_638618.1 heavy metal transport/detoxification protein [Mycobacterium sp. MCS]MWQPRQFADRPLGSSRLLARYPLGVYLDRVGIPGTGIDERSLRMSTSTYT
VTGMTCGHCEMSVREEVSDVDGVQNVEVSAQTGTLIVTASDAIDDAKILH
AVEEAGYSAVPVS
108798419YP_638616.1 ErfK/YbiS/YcfS/YnhG [Mycobacterium sp. MCS]MPKAACPPPYRVTQWLRTAAIALAVVFVAAACAPSPSAAPQADVITEKGT
PFADLLVPKLQASVTDGAIGVSVDAPVTVSAGDGVLGQISLINEAGELVD
GQLSPDGVSWASAEPLGYNKQYTLRAEALGLGGATSTTATFETHSPDNLT
MPYVLPNDGETVGIGQPIAIRFDENITDRLAAQRAITVTTTPAVEGAFYW
LSNREVRWRPAEYWKPGTTVEVDVNAYGVDFGDGLFGQDDVTTRFTVGDQ
IIATADDATKTMTVRRNGEVVKTMPISMGKAKTPTDNGVYIIGDRYSFLV
MDSSTYGVPVNSPDGYRTEVEWATQMSYSGIYVHSAPWSVGSQGVANVSH
GCLNVNPANARWFYDNTRRGDIVEVINTTGPTLSGTDGLGDWNIPWQQWK
AGNANL