Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID118464998
StrainM_avium_104
Protein IDYP_881605.1
Description proteasome component [Mycobacterium avium 104]
Sequence MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMCETTTMLKVGTAALVLEMIEAGVPFRDFSLDNPIR
AIREVSHDITGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQIE
QIVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKI
AQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIAEAVDTPPQTTRARL
RGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)324
CTL epitope prediction (CTLpred)77
Prediction of interferon-gamma inducing peptides (IFNepitope)182
Prediction of IL4 inducing peptides (IL4pred)302