Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID118619653
StrainM_ulcerans_Agy99
Protein IDYP_907985.1
Description two component sensory transduction protein RegX3 [Mycobacterium ulcera
Sequence MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRSGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEVSDGVLESGPVRMDVERHVVSVNGD
AITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)23
MHC class II prediction (Propred)37
MHC class 1 prediction (Propred1)156
CTL epitope prediction (CTLpred)43
Prediction of interferon-gamma inducing peptides (IFNepitope)60
Prediction of IL4 inducing peptides (IL4pred)167