Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405208
StrainM_vanbaalenii_PYR-1
Protein IDYP_955037.1
Description acyl-CoA dehydrogenase domain-containing protein [Mycobacterium vanbaa
Sequence MDFRDSPEEAAFRDRLRGWLSEQKGKFPTSGDAYWAKAGEWHQALFGAGF
FGTSWPKEYGGQDLPPVYDVIVDEEIAKAGAPARPSLGYLVVGLSHHGSE
ELRQRFLPGMINGSERWCQGFSEPGAGSDLASLTTTAVRDGDEYVIHGHK
IWTSYSDVADWCLLLARTDKDVPKHKGISAFIVNMHQAGIEQRPLKMISG
VTKEFGQVSFDGARVPAENMVGAPGEGWKLAMTVVSHEREPSTLGFSARY
GKTVRQMASRLDGAPNQELLWAWVQTEMLRLHVRRRLSEQLDGLTHGPQG
SLDKLLMTWVEQSVGHAALATVGTSDEELFGAYMYSRAQSVMGGTSQIQK
NIIAQRILGLGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo