Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405337
StrainM_vanbaalenii_PYR-1
Protein IDYP_955166.1
Description C4-dicarboxylate transporter/malic acid transport protein [Mycobacteri
Sequence MTNPPPTILGYLGPNWFASVMGTGIVATAGASLPVHVPGLRGFALVVWVL
SALWLLVLIFATFAHWLRNPVVARSHVRNPQMAHFYGAAPMALLTVGSGA
LLVGRDLIGERAAVDLAWVLWTTGTLGALFTAMTIPYLMFTQYRVEPDAA
FGGWLMPVVPPMVAAATGSLLIPHMAEGPGRATMLYGCYAMFGLSLVASL
IIITMVWSRLAHYGTSGTARVPTLWIVLGPLGQSITVAGLLGTDAALAVD
ARLADGMAVFAVLYGVPVWGFAVLWIALAAALTVRTLRRGMPFALTWWSL
TFPVGTFVTGTAQLALHTGLPAFRYAAAVAYLGLLCTWLLVAVRTVRGGL
RGGLFAPPAAGQIRAYKDPPTATG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo