Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405469
StrainM_vanbaalenii_PYR-1
Protein IDYP_955298.1
Description amino acid permease-associated protein [Mycobacterium vanbaalenii PYR-
Sequence MTDAISPPTHSEQRQPALSDEDAKLAELGYRQKLDRSVGTLASFAIGFAT
ISATTAVFTGFGAGYFTAGAPFVWTLLLAGAVFALWAFIAADLTAKLPLA
GYSYQWVSRINGPDLAWFTGFIALMGWVCGMTGVGFILSGYLGGLLGWSM
TQTTQILLAIAVVFVCVLINIYGVRFATMVNNIGVSLELVITVGATALVA
IIAFSAPENHQPISALFTGGQAGDKDSYMLAWLAAALGPFFGLIGVESGA
DVAEETKDARRVVPKTMFYALVTSIVIEFLMYVVYVLAIKDPSAVQANSA
APIEEIITQQAGPAVTKVVVAIALTNILACLLANILVATRLTYSMARDNM
LPFSHVWRHVSPKSKAPTYAVVGLGFLSTVLLLSALVNEKAFNYIIGIAS
LLFFFVYILQTIGLLVGYRRGTIPAAEPGTFDLGRFRLPLYVTALSVFLG
VAVALLLLPQFATNKWVFLGIVVLAAVWWATGLKSRLSRGDAGADYAKTH
GV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo