Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405866
StrainM_vanbaalenii_PYR-1
Protein IDYP_955695.1
Description ribokinase-like domain-containing protein [Mycobacterium vanbaalenii P
Sequence MRALVIGEALIDIVERDGGVTEHVGGSPLNVAVGLARLGRDVDFLTHIGT
DARGQRITDFVESSGAQLVPGSRSAARTATARAVLDATGSATYSFDIDWQ
LSGTPEVAPPLVVHTGSIAAVLEPGCLATTALVDTYHLSATFTFDPNVRP
ALITDPDAARSRIDRLLERADVVKASSEDLHWIDPTRNPEQVATAWLALG
PSIVVVTFGAEGSVAMCADGTVRVPAGNVDVVDTVGAGDAFMTGLIDALW
SMDLLGAGRRARLAGIGTDALTTAVRAATLTAALTVTRPGADLPDRVTRD
AATASDILG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo