Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406409
StrainM_vanbaalenii_PYR-1
Protein IDYP_956238.1
Description PadR-like family transcriptional regulator [Mycobacterium vanbaalenii
Sequence MNTPFTPPENPFDRRGFGFGFGPEGRRTVHERRRQARREFHDHIREHRGD
AGFGPGPGGFGPGGFGPGFGGFGPGGGKFGPGFGFGPGGRGGRRGGPRGG
GRSRRGDVRAAILKLLTDRPMHGYEMIQEINDRSQQLWKPSPGSIYPTLQ
LLVDEGLLTAAETEGSKKLFELTEDGRAAAEKIETAPWDEITEAFKDEAP
EAMGLRTAVGQLMGAVAQSAHAATPEQQQRIVDIVNNARREIYQILGED
B cell epitope (IEDB)2
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo