Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406436
StrainM_vanbaalenii_PYR-1
Protein IDYP_956265.1
Description 50S ribosomal protein L33 [Mycobacterium vanbaalenii PYR-1]
Sequence MARNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRITLRKYDPVVRRHVDF
REER
gene ID120406436
StrainM_vanbaalenii_PYR-1
Protein IDYP_956265.1
Description 50S ribosomal protein L33 [Mycobacterium vanbaalenii PYR-1]
Sequence MARNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRITLRKYDPVVRRHVDF
REER
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo