Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406497
StrainM_vanbaalenii_PYR-1
Protein IDYP_956326.1
Description peptidase M56- BlaR1 [Mycobacterium vanbaalenii PYR-1]
Sequence MNAVTVLLAYAVALSWFAPALLTASASAGAHPRLAVAGWIAAVGSALSAW
AGAVVILVVGAVHAVVTRSALTFCVETLGLTSAVHLPSSTATALVVVLLI
ATSAVALYTVRRVVMALIRGRRRNVEHAEAVSIVGRPTEHPGVVEISARQ
PTAYCVSGGGRSVIVMTTAVRDLLDEDGMAAVLAHERAHLRGRHHHVIAV
LNALAAALPRLPLMRRAAREVAALLEMCADDAASREHGRTHLLNSLALLS
TGDRLPEGALAAAGTAVLDRLLRLAQPPATSWWRPHVAVFAVMAACGVPI
AALSLCVY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo