Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121636401
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_976624.1
Description transcriptional regulatory protein [Mycobacterium bovis BCG str. Paste
Sequence MYSTNRTSQSLSRKPGRKHQLRSHRYVMPPSLHLSDSAAASVFRAVRLRG
PVGRDVIAGSTSLSIATVNRQVIALLEAGLLRERADLAVSGAIGRPRVPV
EVNHEPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSL
ADSADRYLQRWRRRRALWVGVTLGGAVDSATGHVDHPRLGWRQAPVGPVL
ADALGLPVSVASHVDAMAGAELMLGMRRFAPSSSTSLYVYARETVGYALM
IGGRVHCPASGPGTIAPLPVHSEMLGGTGQLESTVSDEAVLAAARRLRII
PGIASRTRTGGSATAITDLLRVARAGNQQAKELLAERARVLGGAVALLRD
LLNPDEVVVGGQAFTEYPEAMEQVEAAFTAGSVLAPRDIRVTVFGNRVQE
AGAGIVSLSGLYADPLGALRRSGALDARLQDTAPEALA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)39
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)303
CTL epitope prediction (CTLpred)90
Prediction of interferon-gamma inducing peptides (IFNepitope)187
Prediction of IL4 inducing peptides (IL4pred)224