Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121636548
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_976771.1
Description exonuclease V (alpha chain) recD [Mycobacterium bovis BCG str. Pasteur
Sequence MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALA
VAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADP
PVLHLYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGF
DEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPR
IALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPG
ARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDG
DAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVAL
ATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLV
TANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHA
MTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVARAKRKVRVVGSEAS
VRAAIARRAVRASGLRMRLQSTGCG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)45
MHC class II prediction (Propred)90
MHC class 1 prediction (Propred1)420
CTL epitope prediction (CTLpred)116
Prediction of interferon-gamma inducing peptides (IFNepitope)276
Prediction of IL4 inducing peptides (IL4pred)302