Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637569
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_977792.1
Description polyketide synthase pks7 [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence MNSTPEDLVKALRRSLKQNERLKRENRDLLARTTEPVAVVGMGCRYPGGV
DSPETLWELVAHGRDAVSEFPADRGWDVAGLFDPDPDAVGKSYTRCGGFL
TDVAGFDAEFFGIAPSEALAMDPQQRLLLEVSWEALERAGIDPITLRGSQ
TGVFAGVFHGSYGGQGRVPGDLERYGLRGSTLSVASGRVAYVLGLQGPAV
SVDTACSSSLVALHLAVQSLRLGECDLALVGGVTVMATPAMFIEFSRQRA
LSADGRCKAYAGAADGTAFAEGAGVLVLARLADARRLGHPVLALVRGSAV
NQDGASNGLATPNGPAQQRVITAALASARLGVADVDVVEGHGTGTTLGDP
IEAQAILATYGQRPADRPLWLGSIKSNIGHTSAAAGVAGVIKMVQAMRHG
VLPKTLHVDVPTPHVDWSAGAVSLLTEPRPWHVPGRPRRAGVSSFGISGT
NAHVILEEAPAVEPVGAAHGNDPVAVPWVLSARSAQALTNQARRLLAWVG
ADENVRPLDVGWSLVNTRSLFDHRAVVVGADRTQLMEGLTGLAAGVPGAD
VVAGRAQTVGKTAFVFPGQGAQWLGMGAQLCATAPVFAEHIHRCERALRE
HVEWSLLDVLRGAPGAPGLDRVDVVQPALWAVMVSLAELWRSVGVVPDAV
IGHSQGEIAAAYVAGALSLWDAAAVVALRSRLLVRLGGAGGMVSLACGQP
QAEKLASQWGDRLNIAAVNGVSSVVLAGETDAVTELMQRCEAEGIRARRI
DVDYASHSAQVDAIREELIAALRGIEPRTSTVAFFSTVTGELMDTAGVNA
EYWYRSIRQPVQFERAVRNAFDGGYRVFVESSPHPVLIAGIEETLVDCDR
GATGEPIVIPTLGRDDGGVGRFWLSAGQAHVAGVGVDWRAAFADLGGRRV
ELPTYAFARQRFWLDGLGAVGGDLGGVGLVGAEHGLLAAVVQRPDSGGVV
LTGRISVVAAPWLADHAVGPVVLFPGTGFVELALRAGDEVGCSVLQELTL
QAPLVLPADGVRVQVVVGGVEQSGTRNVWVYSAAGQADSSPGWTLHAQGV
LGVGSVQPAAELSVWPPVGARAMDVADGYQVLAARGYGYGPAFRGLQALW
RRGAEVFADVTLPEGVPIRGFGIHPAVLDAALHAWGIVEGEQQTMLPFSW
QGVCLHASGAARVRVRLAPVGRGAVPVELADPQGLPVLSVRQLMVRPVSA
AALSRSTAGDRGLLEMIWTPVPLEGGDIGDDAVVWELPPHAGAQAGGDVL
AAVYRGVHEVLEVLQSWLASDATGLGVVVTRGAVGPVDDDVTDLAGAAVW
GLVRSAQAEHPGRVVLVDTDGSVAVEDAVGFGARSGEPQLVVRRGRVYAA
RLAPVAAGLTLPSASAGGWRLVAGGGGTLADVVVAPVAPVELATGQVRVA
VGAVGVNFRDVLVALGMYPGGGELGVDGAGVVVEVGPGVTGLAVGDRVMG
LLGLVGSEAVVDARLVTMVPAGWSLVEAAAVPVAFLTAFYGLSVLAEVAA
GQKVLVHAGTGGVGMAAVSLARYWGAEVFVTASRAKWDTLRAMGFDDIHI
SDSRSLEFEEAFLRATEGSGVDVVLNSLAGEFTDASLRLLPSGGRFIELG
KTDIRDGQTVAERHRGVRYRAFDLVEAGPDRIAAMLSEVVGLLAAGVLAR
LPVKTFDARCAPAAYRFVSQARHIGKVVLTIPDGPGGQSGLAGGTVVVTG
GTGMAGSAVATHLVRRHGVANLVLVSRSGEQADRAAEVAALLREGGAQVA
VVSCDVADRDALAALLAGLDPRYPLKGVFHAAGVLDDAVITGLTPDRVDT
VLRAKVDGAWNLHELTEDMDLSAFVVFSSMAGIVGTPAQGNYAAANAFLD
GLVAYRRSRGLAGLSVAWGLWEQASAMTRHLGERDRARMTQAGLAPLTTE
QALGFLDTALQADRAVVVAARLDRAALAGAGAALPALFSQLAAGPTRRRI
DAADTAVSMSGLVSRLHALTPERRQRELTDLVISNAAAVLGRSSSVDINA
HKAFQDLGFDSLTAVELRNRLKTATGLTLSPTLIFDYPTPATLAEHLDSR
LVTASGSDQQSLSDRVDDITRELVVLLDQPDLSANVKAHLRTRLQTMLTS
LTTEDDDIAAATESQLFAILDEELGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)154
MHC class II prediction (Propred)312
MHC class 1 prediction (Propred1)1467
CTL epitope prediction (CTLpred)369
Prediction of interferon-gamma inducing peptides (IFNepitope)1054
Prediction of IL4 inducing peptides (IL4pred)1339