Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637737
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_977960.1
Description hydrolase [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence MTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRA
VIPHLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQAHLVETVVAHTVTGAV
VVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQK
VLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNDG
NRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNG
LRELRPSAAVVELPGLGHYPQVEAPKAYAEAALSLLVD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)36
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)200
CTL epitope prediction (CTLpred)49
Prediction of interferon-gamma inducing peptides (IFNepitope)136
Prediction of IL4 inducing peptides (IL4pred)205