Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121638328
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_978552.1
Description nucleoside diphosphate kinase [Mycobacterium bovis BCG str. Pasteur 11
Sequence MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY
AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP
GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)19
MHC class 1 prediction (Propred1)84
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)58
Prediction of IL4 inducing peptides (IL4pred)88