Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121638820
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_979044.1
Description daunorubicin-DIM-transport integral membrane protein ABC transporter d
Sequence MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIG
AIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAI
DLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVL
GFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQA
IAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIG
MLVWTAGICVVCAVPLAIGYRRASTH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)5
MHC class II prediction (Propred)87
MHC class 1 prediction (Propred1)200
CTL epitope prediction (CTLpred)70
Prediction of interferon-gamma inducing peptides (IFNepitope)81
Prediction of IL4 inducing peptides (IL4pred)173