Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 121639381 |
| Strain | M_bovis_BCG_str_Pasteur_1173P2 |
| Protein ID | YP_979605.1 |
| Description | 50S ribosomal protein L36 [Mycobacterium bovis BCG str. Pasteur 1173P2 |
| Sequence | MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | No |