Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121639535
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_979759.1
Description hypothetical protein BCG_3680c [Mycobacterium bovis BCG str. Pasteur 1
Sequence MSRVFIIDPTISAIDGLYDLLGIGIPNQGGILYSSLEYFEKALEELAAAF
PGDGWLGSAADKYAGKNRNHVNFFQELADLDRQLISLIHDQANAVQTTRD
ILEGAKKGLEFVRPVAVDLTYIPVVGHALSAAFQAPFCAGAMAVVGGALA
YLVVKTLINATQLLKLLAKLAELVAAAIADIISDVADIIKGILGEVWEFI
TNALNGLKELWDKLTGWVTGLFSRGWSNLESFFAGVPGLTGATSGLSQVT
GLFGAAGLSASSGLAHADSLASSASLPALAGIGGGSGFGGLPSLAQVHAA
STRQALRPRADGPVGAAAEQVGGQSQLVSAQGSQGMGGPVGMGGMHPSSG
ASKGTTTKKYSEGAAAGTEDAERAPVEADAGGGQKVLVRNVV
B cell epitope (IEDB)0
T cell epitope (IEDB)4
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)48
MHC class II prediction (Propred)45
MHC class 1 prediction (Propred1)247
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)202
Prediction of IL4 inducing peptides (IL4pred)210