Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148661456
StrainMtb_H37Ra
Protein IDYP_001282979.1
Description chalcone synthase Pks10 [Mycobacterium tuberculosis H37Ra]
Sequence MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSR
HLVLPLEKYPKLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDV
LITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCVAGAAGVARLHD
YLRGAPDGVAALVSVELCSLTYPGYKPTLPGLVGSALFADGAAAVVAAGV
KRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVE
QYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALEL
TWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLL
RWH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)48
MHC class 1 prediction (Propred1)241
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)106
Prediction of IL4 inducing peptides (IL4pred)200