Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148661788
StrainMtb_H37Ra
Protein IDYP_001283311.1
Description amino acid permease [Mycobacterium tuberculosis H37Ra]
Sequence MVGPRTRGYAIHKLGFCSVVMLGINSIIGAGIFLTPGEVIGLAGPFAPMA
YVLAGIFAGVVAIVFATAARYVRTNGASYAYTTAAFGRRIGIYVGVTHAI
TASIAWGVLASFFVSTLLRVAFPDKAWADAEQLFSVKTLTFLGFIGVLLA
INLFGNRAIKWANGTSTVGKAFALSAFIVGGLWIITTQHVNNYATAWSAY
SATPYSLLGVAEIGKGTFSSMALATIVALYAFTGFESIANAAEEMDAPDR
NLPRAIPIAIFSVGAIYLLTLTVAMLLGSNKIAASDDTVKLAAAIGNATF
RTIIVVGALISMFGINVAASFGAPRLWTALADSGVLPTRLSRKNQYDVPM
VSFAITASLALAFPLALRFDNLHLTGLAVIARFVQFIIVPIALIALARSQ
AVEHAAVRRNAFTDKVLPLVAIVVSVGLAVSYDYRCIFLVRGGPNYFSIA
LIVITFIVVPAMAYLHYYRIIRRVGDRPSTR
B cell epitope (IEDB)3
T cell epitope (IEDB)6
MHC binder (IEDB)14
Vaccine TargetYes
B cell prediction (LBtope)31
MHC class II prediction (Propred)131
MHC class 1 prediction (Propred1)379
CTL epitope prediction (CTLpred)116
Prediction of interferon-gamma inducing peptides (IFNepitope)173
Prediction of IL4 inducing peptides (IL4pred)295