Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148662794
StrainMtb_H37Ra
Protein IDYP_001284317.1
Description polyketide synthase Pks15 [Mycobacterium tuberculosis H37Ra]
Sequence MIEEQRTMSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVA
VVGIGCRFPGGVDGPDGLWDVVSAGRDVVSEFPTDRGWDVEGLYDPDPDA
EGKTYTRWGAFLDDATGFDAGFFGIAPSEVLAMDPQQRLMLEVSWEALEH
AGIDPLSLRGSATGVYTGIFAASYGNRDTGGLQGYGLTGTSISVASGRVS
YVLGLQGPAVSVDTACSSSLVAIHWAMSSLRSGECDLALAGGVTVMGLPS
IFVGFSRQRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGHS
VLAVVRGSAVNQDGASNGLTAPNGLAQQRVIQVALANAGLSAADVDVVEA
HGTATTLGDPIEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVAG
VIKMVQAMRHGVMPATLHVDEPSPRVDWTSGAVSVLTEAREWSVDGRPRR
AAVSSFGISGTNAHLILEEAPVPAPAEAPVEASESTGGRGRRWCRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)45
MHC class II prediction (Propred)63
MHC class 1 prediction (Propred1)320
CTL epitope prediction (CTLpred)67
Prediction of interferon-gamma inducing peptides (IFNepitope)257
Prediction of IL4 inducing peptides (IL4pred)339