Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148662936
StrainMtb_H37Ra
Protein IDYP_001284459.1
Description AraC family transcription regulator [Mycobacterium tuberculosis H37
Sequence MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLA
GFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA
IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANA
ARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD
HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQ
CSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY
LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)5
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)249
CTL epitope prediction (CTLpred)60
Prediction of interferon-gamma inducing peptides (IFNepitope)130
Prediction of IL4 inducing peptides (IL4pred)236