Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 148663280 |
Strain | Mtb_H37Ra |
Protein ID | YP_001284803.1 |
Description | transcriptional regulatory protein whib-like WhiB3 [Mycobacterium t |
Sequence | MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAK EMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRR TA |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 13 |
MHC class II prediction (Propred) | 8 |
MHC class 1 prediction (Propred1) | 65 |
CTL epitope prediction (CTLpred) | 16 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
Prediction of IL4 inducing peptides (IL4pred) | 74 |